1AXCA

Human pcna
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
255
structure length
249
Chain Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the C-terminal region of p21(WAF1/CIP1) complexed with human PCNA.
pubmed doi rcsb
molecule keywords PCNA
molecule tags Complex (dna-binding protein/dna)
total genus 57
structure length 249
sequence length 255
chains with identical sequence C, E
ec nomenclature
pdb deposition date 1997-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 1axcA00
1RXZA 3P83A 2HIIA 2HIKA 2NTIA 3P91A 2IZOB 2NTIB 2AWAA 2HIIC 3P87A 1UD9A 1IZ4A 5IY4A 4CS5A 1GE8A 3GPMA 3TBLA 5A6DA 1VYJA 2ZVWA 5AUJA 1VYMA 5DAIA 3IFVA 3A2FB 1T6LA 1UL1A 1B77A 1IZ5A 1W60A 1RWZA 3V62B 3FDSC 3LX1A 2OD8A 4HK1A 5IWDA 4D2GA 3AIXA 2HIIB 2HIKB 2AVTA 2IX2C 5B7OA 4L60A 3FDSD 5E0VA 5IXAA 2ZVKA 5E0TA 1ISQA 1B8HA 3LX2A 3WGWA 1PLQA 3GGRC 3GPNA 1SXJF 4YHRA 2ZVVA 3AIXB 3VKXA 2IX2A 5E0UA 3A1JA 2IO4A 4L6PA 4TR6A 4ZTDA 1YYPA 3G65C 3A1JC 2Z0LA 1U76A 3AIZC 1AXCA 2ZVLA 1RXMA 3GGRA 1DMLA 3GGRB 1PLRA 5CFKA 3U60F 1CZDA 5HACA 5DA7A 1U7BA 3V60B 5JNED 3HI8A 3F1WA 2IZOC 2HIKC 2NTIC 2IX2B 3G65A 3U5ZF 2IJXA 3G65B 5H0TA 3U61F 3AIZA 3A1JB 2ZVMA 2IO4B 3K4XA 3V61B 4RJFA 3HSLX 3I2MX
chains in the Genus database with same CATH superfamily
1RXZA 3P83A 2HIIA 2HIKA 2NTIA 3P91A 2IZOB 2NTIB 2AWAA 2HIIC 3P87A 1UD9A 1IZ4A 5IY4A 4CS5A 1GE8A 3GPMA 3TBLA 5A6DA 1VYJA 2ZVWA 5AUJA 1VYMA 5DAIA 3IFVA 3A2FB 1T6LA 1UL1A 1B77A 1IZ5A 1W60A 1RWZA 3V62B 3FDSC 3LX1A 2OD8A 4HK1A 5IWDA 4D2GA 3AIXA 2HIIB 2HIKB 2AVTA 2IX2C 5B7OA 4L60A 3FDSD 5E0VA 5IXAA 2ZVKA 5E0TA 1ISQA 1B8HA 3LX2A 3WGWA 1PLQA 3GGRC 3GPNA 1SXJF 4YHRA 2ZVVA 3AIXB 3VKXA 2IX2A 5E0UA 3A1JA 2IO4A 4L6PA 4TR6A 4ZTDA 1YYPA 3G65C 3A1JC 2Z0LA 1U76A 3AIZC 1AXCA 2ZVLA 1RXMA 3GGRA 1DMLA 3GGRB 1PLRA 5CFKA 3U60F 1CZDA 5HACA 5DA7A 1U7BA 3V60B 5JNED 3HI8A 3F1WA 2IZOC 2HIKC 2NTIC 2IX2B 3G65A 3U5ZF 2IJXA 3G65B 5H0TA 3U61F 3AIZA 3A1JB 2ZVMA 2IO4B 3K4XA 3V61B 4RJFA 3HSLX 3I2MX
chains in the Genus database with same CATH topology
1RXZA 3P83A 2HIIA 2HIKA 2NTIA 3P91A 2IZOB 2NTIB 2AWAA 2HIIC 3P87A 1UD9A 1IZ4A 5IY4A 4CS5A 1GE8A 3GPMA 3TBLA 5A6DA 1VYJA 2ZVWA 5AUJA 1VYMA 5DAIA 3IFVA 3A2FB 1T6LA 1UL1A 1B77A 1IZ5A 1W60A 1RWZA 3V62B 3FDSC 3LX1A 2OD8A 4HK1A 5IWDA 4D2GA 3AIXA 2HIIB 2HIKB 2AVTA 2IX2C 5B7OA 4L60A 3FDSD 5E0VA 5IXAA 2ZVKA 5E0TA 1ISQA 1B8HA 3LX2A 3WGWA 1PLQA 3GGRC 3GPNA 1SXJF 4YHRA 2ZVVA 3AIXB 3VKXA 2IX2A 5E0UA 3A1JA 2IO4A 4L6PA 4TR6A 4ZTDA 1YYPA 3G65C 3A1JC 2Z0LA 1U76A 3AIZC 1AXCA 2ZVLA 1RXMA 3GGRA 1DMLA 3GGRB 1PLRA 5CFKA 3U60F 1CZDA 5HACA 5DA7A 1U7BA 3V60B 5JNED 3HI8A 3F1WA 2IZOC 2HIKC 2NTIC 2IX2B 3G65A 3U5ZF 2IJXA 3G65B 5H0TA 3U61F 3AIZA 3A1JB 2ZVMA 2IO4B 3K4XA 3V61B 4RJFA 3HSLX 3I2MX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RXZ A;  3P83 A;  2HII A;  2HIK A;  2NTI A;  3P91 A;  2IZO B;  2NTI B;  2AWA A;  2HII C;  3P87 A;  1UD9 A;  1IZ4 A;  5IY4 A;  4CS5 A;  1GE8 A;  3GPM A;  3TBL A;  5A6D A;  1VYJ A;  2ZVW A;  5AUJ A;  1VYM A;  5DAI A;  3IFV A;  3A2F B;  1T6L A;  1UL1 A;  1B77 A;  1IZ5 A;  1W60 A;  1RWZ A;  3V62 B;  3FDS C;  3LX1 A;  2OD8 A;  4HK1 A;  5IWD A;  4D2G A;  3AIX A;  2HII B;  2HIK B;  2AVT A;  2IX2 C;  5B7O A;  4L60 A;  3FDS D;  5E0V A;  5IXA A;  2ZVK A;  5E0T A;  1ISQ A;  1B8H A;  3LX2 A;  3WGW A;  1PLQ A;  3GGR C;  3GPN A;  1SXJ F;  4YHR A;  2ZVV A;  3AIX B;  3VKX A;  2IX2 A;  5E0U A;  3A1J A;  2IO4 A;  4L6P A;  4TR6 A;  4ZTD A;  1YYP A;  3G65 C;  3A1J C;  2Z0L A;  1U76 A;  3AIZ C;  1AXC A;  2ZVL A;  1RXM A;  3GGR A;  1DML A;  3GGR B;  1PLR A;  5CFK A;  3U60 F;  1CZD A;  5HAC A;  5DA7 A;  1U7B A;  3V60 B;  5JNE D;  3HI8 A;  3F1W A;  2IZO C;  2HIK C;  2NTI C;  2IX2 B;  3G65 A;  3U5Z F;  2IJX A;  3G65 B;  5H0T A;  3U61 F;  3AIZ A;  3A1J B;  2ZVM A;  2IO4 B;  3K4X A;  3V61 B;  4RJF A;  3HSL X;  3I2M X; 
#chains in the Genus database with same CATH topology
 1RXZ A;  3P83 A;  2HII A;  2HIK A;  2NTI A;  3P91 A;  2IZO B;  2NTI B;  2AWA A;  2HII C;  3P87 A;  1UD9 A;  1IZ4 A;  5IY4 A;  4CS5 A;  1GE8 A;  3GPM A;  3TBL A;  5A6D A;  1VYJ A;  2ZVW A;  5AUJ A;  1VYM A;  5DAI A;  3IFV A;  3A2F B;  1T6L A;  1UL1 A;  1B77 A;  1IZ5 A;  1W60 A;  1RWZ A;  3V62 B;  3FDS C;  3LX1 A;  2OD8 A;  4HK1 A;  5IWD A;  4D2G A;  3AIX A;  2HII B;  2HIK B;  2AVT A;  2IX2 C;  5B7O A;  4L60 A;  3FDS D;  5E0V A;  5IXA A;  2ZVK A;  5E0T A;  1ISQ A;  1B8H A;  3LX2 A;  3WGW A;  1PLQ A;  3GGR C;  3GPN A;  1SXJ F;  4YHR A;  2ZVV A;  3AIX B;  3VKX A;  2IX2 A;  5E0U A;  3A1J A;  2IO4 A;  4L6P A;  4TR6 A;  4ZTD A;  1YYP A;  3G65 C;  3A1J C;  2Z0L A;  1U76 A;  3AIZ C;  1AXC A;  2ZVL A;  1RXM A;  3GGR A;  1DML A;  3GGR B;  1PLR A;  5CFK A;  3U60 F;  1CZD A;  5HAC A;  5DA7 A;  1U7B A;  3V60 B;  5JNE D;  3HI8 A;  3F1W A;  2IZO C;  2HIK C;  2NTI C;  2IX2 B;  3G65 A;  3U5Z F;  2IJX A;  3G65 B;  5H0T A;  3U61 F;  3AIZ A;  3A1J B;  2ZVM A;  2IO4 B;  3K4X A;  3V61 B;  4RJF A;  3HSL X;  3I2M X; 
#chains in the Genus database with same CATH homology
 1RXZ A;  3P83 A;  2HII A;  2HIK A;  2NTI A;  3P91 A;  2IZO B;  2NTI B;  2AWA A;  2HII C;  3P87 A;  1UD9 A;  1IZ4 A;  5IY4 A;  4CS5 A;  1GE8 A;  3GPM A;  3TBL A;  5A6D A;  1VYJ A;  2ZVW A;  5AUJ A;  1VYM A;  5DAI A;  3IFV A;  3A2F B;  1T6L A;  1UL1 A;  1B77 A;  1IZ5 A;  1W60 A;  1RWZ A;  3V62 B;  3FDS C;  3LX1 A;  2OD8 A;  4HK1 A;  5IWD A;  4D2G A;  3AIX A;  2HII B;  2HIK B;  2AVT A;  2IX2 C;  5B7O A;  4L60 A;  3FDS D;  5E0V A;  5IXA A;  2ZVK A;  5E0T A;  1ISQ A;  1B8H A;  3LX2 A;  3WGW A;  1PLQ A;  3GGR C;  3GPN A;  1SXJ F;  4YHR A;  2ZVV A;  3AIX B;  3VKX A;  2IX2 A;  5E0U A;  3A1J A;  2IO4 A;  4L6P A;  4TR6 A;  4ZTD A;  1YYP A;  3G65 C;  3A1J C;  2Z0L A;  1U76 A;  3AIZ C;  1AXC A;  2ZVL A;  1RXM A;  3GGR A;  1DML A;  3GGR B;  1PLR A;  5CFK A;  3U60 F;  1CZD A;  5HAC A;  5DA7 A;  1U7B A;  3V60 B;  5JNE D;  3HI8 A;  3F1W A;  2IZO C;  2HIK C;  2NTI C;  2IX2 B;  3G65 A;  3U5Z F;  2IJX A;  3G65 B;  5H0T A;  3U61 F;  3AIZ A;  3A1J B;  2ZVM A;  2IO4 B;  3K4X A;  3V61 B;  4RJF A;  3HSL X;  3I2M X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...