1VYMA

Native human pcna
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
255
structure length
255
Chain Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Studies of Human Proliferating Cell Nuclear Antigen Complexes Provide a Rationale for Cyclin Association and Inhibitor Design
pubmed doi rcsb
molecule keywords PROLIFERATING CELL NUCLEAR ANTIGEN
molecule tags Dna binding protein
source organism Homo sapiens
total genus 53
structure length 255
sequence length 255
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 1vymA00
3LX2A 4TR6A 5JNED 2HIKA 2IO4A 3A1JB 3G65A 2AWAA 5H0TA 1CZDA 5DA7A 3U5ZF 1GE8A 1AXCA 3HSLX 5E0VA 1UD9A 1YYPA 3GPNA 1PLQA 2NTIB 4RJFA 1IZ5A 2ZVMA 1PLRA 1U7BA 3V61B 5A6DA 1B8HA 2HIIA 3AIZA 1RWZA 2HIKC 3LX1A 1IZ4A 3V62B 3HI8A 3G65C 3AIXB 1UL1A 2ZVKA 1ISQA 4HK1A 1RXMA 3I2MX 2IJXA 2IX2A 2IZOC 2IX2C 3WGWA 3GGRA 4D2GA 3GGRC 3F1WA 2Z0LA 4YHRA 4ZTDA 5IWDA 5IXAA 5IY4A 3FDSD 3K4XA 2HIIC 2HIKB 3AIZC 3P87A 2IO4B 3GPMA 4CS5A 3P91A 3G65B 1B77A 3V60B 4L6PA 3FDSC 3TBLA 1T6LA 2NTIA 2NTIC 5B7OA 2ZVVA 3GGRB 5HACA 1RXZA 3A1JA 5E0UA 1U76A 3A1JC 5CFKA 3AIXA 3U61F 3VKXA 2HIIB 1W60A 3U60F 1DMLA 1VYMA 4L60A 1VYJA 3A2FB 2AVTA 5AUJA 2ZVLA 1SXJF 2ZVWA 3P83A 2IZOB 3IFVA 2IX2B 5E0TA 2OD8A 5DAIA
chains in the Genus database with same CATH superfamily
3LX2A 4TR6A 5JNED 2HIKA 2IO4A 3A1JB 3G65A 2AWAA 5H0TA 1CZDA 5DA7A 3U5ZF 1GE8A 1AXCA 3HSLX 5E0VA 1UD9A 1YYPA 3GPNA 1PLQA 2NTIB 4RJFA 1IZ5A 2ZVMA 1PLRA 1U7BA 3V61B 5A6DA 1B8HA 2HIIA 3AIZA 1RWZA 2HIKC 3LX1A 1IZ4A 3V62B 3HI8A 3G65C 3AIXB 1UL1A 2ZVKA 1ISQA 4HK1A 1RXMA 3I2MX 2IJXA 2IX2A 2IZOC 2IX2C 3WGWA 3GGRA 4D2GA 3GGRC 3F1WA 2Z0LA 4YHRA 4ZTDA 5IWDA 5IXAA 5IY4A 3FDSD 3K4XA 2HIIC 2HIKB 3AIZC 3P87A 2IO4B 3GPMA 4CS5A 3P91A 3G65B 1B77A 3V60B 4L6PA 3FDSC 3TBLA 1T6LA 2NTIA 2NTIC 5B7OA 2ZVVA 3GGRB 5HACA 1RXZA 3A1JA 5E0UA 1U76A 3A1JC 5CFKA 3AIXA 3U61F 3VKXA 2HIIB 1W60A 3U60F 1DMLA 1VYMA 4L60A 1VYJA 3A2FB 2AVTA 5AUJA 2ZVLA 1SXJF 2ZVWA 3P83A 2IZOB 3IFVA 2IX2B 5E0TA 2OD8A 5DAIA
chains in the Genus database with same CATH topology
3LX2A 4TR6A 5JNED 2HIKA 2IO4A 3A1JB 3G65A 2AWAA 5H0TA 1CZDA 5DA7A 3U5ZF 1GE8A 1AXCA 3HSLX 5E0VA 1UD9A 1YYPA 3GPNA 1PLQA 2NTIB 4RJFA 1IZ5A 2ZVMA 1PLRA 1U7BA 3V61B 5A6DA 1B8HA 2HIIA 3AIZA 1RWZA 2HIKC 3LX1A 1IZ4A 3V62B 3HI8A 3G65C 3AIXB 1UL1A 2ZVKA 1ISQA 4HK1A 1RXMA 3I2MX 2IJXA 2IX2A 2IZOC 2IX2C 3WGWA 3GGRA 4D2GA 3GGRC 3F1WA 2Z0LA 4YHRA 4ZTDA 5IWDA 5IXAA 5IY4A 3FDSD 3K4XA 2HIIC 2HIKB 3AIZC 3P87A 2IO4B 3GPMA 4CS5A 3P91A 3G65B 1B77A 3V60B 4L6PA 3FDSC 3TBLA 1T6LA 2NTIA 2NTIC 5B7OA 2ZVVA 3GGRB 5HACA 1RXZA 3A1JA 5E0UA 1U76A 3A1JC 5CFKA 3AIXA 3U61F 3VKXA 2HIIB 1W60A 3U60F 1DMLA 1VYMA 4L60A 1VYJA 3A2FB 2AVTA 5AUJA 2ZVLA 1SXJF 2ZVWA 3P83A 2IZOB 3IFVA 2IX2B 5E0TA 2OD8A 5DAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LX2 A;  4TR6 A;  5JNE D;  2HIK A;  2IO4 A;  3A1J B;  3G65 A;  2AWA A;  5H0T A;  1CZD A;  5DA7 A;  3U5Z F;  1GE8 A;  1AXC A;  3HSL X;  5E0V A;  1UD9 A;  1YYP A;  3GPN A;  1PLQ A;  2NTI B;  4RJF A;  1IZ5 A;  2ZVM A;  1PLR A;  1U7B A;  3V61 B;  5A6D A;  1B8H A;  2HII A;  3AIZ A;  1RWZ A;  2HIK C;  3LX1 A;  1IZ4 A;  3V62 B;  3HI8 A;  3G65 C;  3AIX B;  1UL1 A;  2ZVK A;  1ISQ A;  4HK1 A;  1RXM A;  3I2M X;  2IJX A;  2IX2 A;  2IZO C;  2IX2 C;  3WGW A;  3GGR A;  4D2G A;  3GGR C;  3F1W A;  2Z0L A;  4YHR A;  4ZTD A;  5IWD A;  5IXA A;  5IY4 A;  3FDS D;  3K4X A;  2HII C;  2HIK B;  3AIZ C;  3P87 A;  2IO4 B;  3GPM A;  4CS5 A;  3P91 A;  3G65 B;  1B77 A;  3V60 B;  4L6P A;  3FDS C;  3TBL A;  1T6L A;  2NTI A;  2NTI C;  5B7O A;  2ZVV A;  3GGR B;  5HAC A;  1RXZ A;  3A1J A;  5E0U A;  1U76 A;  3A1J C;  5CFK A;  3AIX A;  3U61 F;  3VKX A;  2HII B;  1W60 A;  3U60 F;  1DML A;  1VYM A;  4L60 A;  1VYJ A;  3A2F B;  2AVT A;  5AUJ A;  2ZVL A;  1SXJ F;  2ZVW A;  3P83 A;  2IZO B;  3IFV A;  2IX2 B;  5E0T A;  2OD8 A;  5DAI A; 
#chains in the Genus database with same CATH topology
 3LX2 A;  4TR6 A;  5JNE D;  2HIK A;  2IO4 A;  3A1J B;  3G65 A;  2AWA A;  5H0T A;  1CZD A;  5DA7 A;  3U5Z F;  1GE8 A;  1AXC A;  3HSL X;  5E0V A;  1UD9 A;  1YYP A;  3GPN A;  1PLQ A;  2NTI B;  4RJF A;  1IZ5 A;  2ZVM A;  1PLR A;  1U7B A;  3V61 B;  5A6D A;  1B8H A;  2HII A;  3AIZ A;  1RWZ A;  2HIK C;  3LX1 A;  1IZ4 A;  3V62 B;  3HI8 A;  3G65 C;  3AIX B;  1UL1 A;  2ZVK A;  1ISQ A;  4HK1 A;  1RXM A;  3I2M X;  2IJX A;  2IX2 A;  2IZO C;  2IX2 C;  3WGW A;  3GGR A;  4D2G A;  3GGR C;  3F1W A;  2Z0L A;  4YHR A;  4ZTD A;  5IWD A;  5IXA A;  5IY4 A;  3FDS D;  3K4X A;  2HII C;  2HIK B;  3AIZ C;  3P87 A;  2IO4 B;  3GPM A;  4CS5 A;  3P91 A;  3G65 B;  1B77 A;  3V60 B;  4L6P A;  3FDS C;  3TBL A;  1T6L A;  2NTI A;  2NTI C;  5B7O A;  2ZVV A;  3GGR B;  5HAC A;  1RXZ A;  3A1J A;  5E0U A;  1U76 A;  3A1J C;  5CFK A;  3AIX A;  3U61 F;  3VKX A;  2HII B;  1W60 A;  3U60 F;  1DML A;  1VYM A;  4L60 A;  1VYJ A;  3A2F B;  2AVT A;  5AUJ A;  2ZVL A;  1SXJ F;  2ZVW A;  3P83 A;  2IZO B;  3IFV A;  2IX2 B;  5E0T A;  2OD8 A;  5DAI A; 
#chains in the Genus database with same CATH homology
 3LX2 A;  4TR6 A;  5JNE D;  2HIK A;  2IO4 A;  3A1J B;  3G65 A;  2AWA A;  5H0T A;  1CZD A;  5DA7 A;  3U5Z F;  1GE8 A;  1AXC A;  3HSL X;  5E0V A;  1UD9 A;  1YYP A;  3GPN A;  1PLQ A;  2NTI B;  4RJF A;  1IZ5 A;  2ZVM A;  1PLR A;  1U7B A;  3V61 B;  5A6D A;  1B8H A;  2HII A;  3AIZ A;  1RWZ A;  2HIK C;  3LX1 A;  1IZ4 A;  3V62 B;  3HI8 A;  3G65 C;  3AIX B;  1UL1 A;  2ZVK A;  1ISQ A;  4HK1 A;  1RXM A;  3I2M X;  2IJX A;  2IX2 A;  2IZO C;  2IX2 C;  3WGW A;  3GGR A;  4D2G A;  3GGR C;  3F1W A;  2Z0L A;  4YHR A;  4ZTD A;  5IWD A;  5IXA A;  5IY4 A;  3FDS D;  3K4X A;  2HII C;  2HIK B;  3AIZ C;  3P87 A;  2IO4 B;  3GPM A;  4CS5 A;  3P91 A;  3G65 B;  1B77 A;  3V60 B;  4L6P A;  3FDS C;  3TBL A;  1T6L A;  2NTI A;  2NTI C;  5B7O A;  2ZVV A;  3GGR B;  5HAC A;  1RXZ A;  3A1J A;  5E0U A;  1U76 A;  3A1J C;  5CFK A;  3AIX A;  3U61 F;  3VKX A;  2HII B;  1W60 A;  3U60 F;  1DML A;  1VYM A;  4L60 A;  1VYJ A;  3A2F B;  2AVT A;  5AUJ A;  2ZVL A;  1SXJ F;  2ZVW A;  3P83 A;  2IZO B;  3IFV A;  2IX2 B;  5E0T A;  2OD8 A;  5DAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...