5B7OA

Crystal structure of proliferating cell nuclear antigen from leishmania donovani at 2.95 angstrom resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
289
structure length
248
Chain Sequence
MLEAQVQFASLWKRLVECINGLVNEANFDCNPGGLSVQAMDSSHVALVHMLLRDDCFVKYQCGRNSILGLNLASLSKVLKIVDSNDSLSLRHDDDSDVVTLTSENPEKTRKCEYQLKLLEIEAESMGIPEMDYRSTVTLNSAEFAKIVRDMQVFGDTVTIAISKEGVKFSSSGDVGQGYTFLQAAGVEVTMEEPITLSFALRFMGIFAKGSTLSERVTLKFAKDSPCMVEYGIDNVGYLRYYLAPKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of proliferating cell nuclear antigen from Leishmania donovani at 2.95 Angstrom resolution.
rcsb
molecule keywords Proliferating cell nuclear antigen
molecule tags Dna binding protein
source organism Leishmania donovani
total genus 52
structure length 248
sequence length 289
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 5b7oA00
5DA7A 2ZVKA 3P83A 2Z0LA 3FDSD 1UL1A 2AWAA 1SXJF 1U7BA 2HIIB 1U76A 2IJXA 4HK1A 2IO4A 3V61B 5B7OA 2HIIC 3HI8A 2IX2A 1VYJA 1VYMA 4RJFA 3GGRC 3VKXA 2AVTA 3A2FB 5A6DA 1RWZA 3G65B 5AUJA 3AIXB 5E0VA 3V62B 3I2MX 3A1JB 1B77A 3G65C 5E0TA 3V60B 1PLQA 5CFKA 2ZVWA 2HIIA 3A1JC 5DAIA 3GGRA 1YYPA 1RXZA 5E0UA 3P87A 4D2GA 4ZTDA 3HSLX 5HACA 1DMLA 4YHRA 3U5ZF 3FDSC 3P91A 2NTIB 3LX2A 2ZVLA 4CS5A 3G65A 3K4XA 3AIXA 1PLRA 2ZVMA 3GPMA 1UD9A 1B8HA 2NTIC 3A1JA 3AIZC 1ISQA 2OD8A 2HIKB 3F1WA 2IZOB 3U61F 1RXMA 2HIKC 3TBLA 1CZDA 2IZOC 5IWDA 5JNED 4L6PA 3WGWA 3LX1A 1T6LA 1IZ5A 2ZVVA 4L60A 2IO4B 3U60F 1AXCA 2NTIA 3AIZA 3GGRB 5IXAA 1IZ4A 2IX2B 4TR6A 3IFVA 2HIKA 2IX2C 5IY4A 5H0TA 3GPNA 1GE8A 1W60A
chains in the Genus database with same CATH superfamily
5DA7A 2ZVKA 3P83A 2Z0LA 3FDSD 1UL1A 2AWAA 1SXJF 1U7BA 2HIIB 1U76A 2IJXA 4HK1A 2IO4A 3V61B 5B7OA 2HIIC 3HI8A 2IX2A 1VYJA 1VYMA 4RJFA 3GGRC 3VKXA 2AVTA 3A2FB 5A6DA 1RWZA 3G65B 5AUJA 3AIXB 5E0VA 3V62B 3I2MX 3A1JB 1B77A 3G65C 5E0TA 3V60B 1PLQA 5CFKA 2ZVWA 2HIIA 3A1JC 5DAIA 3GGRA 1YYPA 1RXZA 5E0UA 3P87A 4D2GA 4ZTDA 3HSLX 5HACA 1DMLA 4YHRA 3U5ZF 3FDSC 3P91A 2NTIB 3LX2A 2ZVLA 4CS5A 3G65A 3K4XA 3AIXA 1PLRA 2ZVMA 3GPMA 1UD9A 1B8HA 2NTIC 3A1JA 3AIZC 1ISQA 2OD8A 2HIKB 3F1WA 2IZOB 3U61F 1RXMA 2HIKC 3TBLA 1CZDA 2IZOC 5IWDA 5JNED 4L6PA 3WGWA 3LX1A 1T6LA 1IZ5A 2ZVVA 4L60A 2IO4B 3U60F 1AXCA 2NTIA 3AIZA 3GGRB 5IXAA 1IZ4A 2IX2B 4TR6A 3IFVA 2HIKA 2IX2C 5IY4A 5H0TA 3GPNA 1GE8A 1W60A
chains in the Genus database with same CATH topology
5DA7A 2ZVKA 3P83A 2Z0LA 3FDSD 1UL1A 2AWAA 1SXJF 1U7BA 2HIIB 1U76A 2IJXA 4HK1A 2IO4A 3V61B 5B7OA 2HIIC 3HI8A 2IX2A 1VYJA 1VYMA 4RJFA 3GGRC 3VKXA 2AVTA 3A2FB 5A6DA 1RWZA 3G65B 5AUJA 3AIXB 5E0VA 3V62B 3I2MX 3A1JB 1B77A 3G65C 5E0TA 3V60B 1PLQA 5CFKA 2ZVWA 2HIIA 3A1JC 5DAIA 3GGRA 1YYPA 1RXZA 5E0UA 3P87A 4D2GA 4ZTDA 3HSLX 5HACA 1DMLA 4YHRA 3U5ZF 3FDSC 3P91A 2NTIB 3LX2A 2ZVLA 4CS5A 3G65A 3K4XA 3AIXA 1PLRA 2ZVMA 3GPMA 1UD9A 1B8HA 2NTIC 3A1JA 3AIZC 1ISQA 2OD8A 2HIKB 3F1WA 2IZOB 3U61F 1RXMA 2HIKC 3TBLA 1CZDA 2IZOC 5IWDA 5JNED 4L6PA 3WGWA 3LX1A 1T6LA 1IZ5A 2ZVVA 4L60A 2IO4B 3U60F 1AXCA 2NTIA 3AIZA 3GGRB 5IXAA 1IZ4A 2IX2B 4TR6A 3IFVA 2HIKA 2IX2C 5IY4A 5H0TA 3GPNA 1GE8A 1W60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DA7 A;  2ZVK A;  3P83 A;  2Z0L A;  3FDS D;  1UL1 A;  2AWA A;  1SXJ F;  1U7B A;  2HII B;  1U76 A;  2IJX A;  4HK1 A;  2IO4 A;  3V61 B;  5B7O A;  2HII C;  3HI8 A;  2IX2 A;  1VYJ A;  1VYM A;  4RJF A;  3GGR C;  3VKX A;  2AVT A;  3A2F B;  5A6D A;  1RWZ A;  3G65 B;  5AUJ A;  3AIX B;  5E0V A;  3V62 B;  3I2M X;  3A1J B;  1B77 A;  3G65 C;  5E0T A;  3V60 B;  1PLQ A;  5CFK A;  2ZVW A;  2HII A;  3A1J C;  5DAI A;  3GGR A;  1YYP A;  1RXZ A;  5E0U A;  3P87 A;  4D2G A;  4ZTD A;  3HSL X;  5HAC A;  1DML A;  4YHR A;  3U5Z F;  3FDS C;  3P91 A;  2NTI B;  3LX2 A;  2ZVL A;  4CS5 A;  3G65 A;  3K4X A;  3AIX A;  1PLR A;  2ZVM A;  3GPM A;  1UD9 A;  1B8H A;  2NTI C;  3A1J A;  3AIZ C;  1ISQ A;  2OD8 A;  2HIK B;  3F1W A;  2IZO B;  3U61 F;  1RXM A;  2HIK C;  3TBL A;  1CZD A;  2IZO C;  5IWD A;  5JNE D;  4L6P A;  3WGW A;  3LX1 A;  1T6L A;  1IZ5 A;  2ZVV A;  4L60 A;  2IO4 B;  3U60 F;  1AXC A;  2NTI A;  3AIZ A;  3GGR B;  5IXA A;  1IZ4 A;  2IX2 B;  4TR6 A;  3IFV A;  2HIK A;  2IX2 C;  5IY4 A;  5H0T A;  3GPN A;  1GE8 A;  1W60 A; 
#chains in the Genus database with same CATH topology
 5DA7 A;  2ZVK A;  3P83 A;  2Z0L A;  3FDS D;  1UL1 A;  2AWA A;  1SXJ F;  1U7B A;  2HII B;  1U76 A;  2IJX A;  4HK1 A;  2IO4 A;  3V61 B;  5B7O A;  2HII C;  3HI8 A;  2IX2 A;  1VYJ A;  1VYM A;  4RJF A;  3GGR C;  3VKX A;  2AVT A;  3A2F B;  5A6D A;  1RWZ A;  3G65 B;  5AUJ A;  3AIX B;  5E0V A;  3V62 B;  3I2M X;  3A1J B;  1B77 A;  3G65 C;  5E0T A;  3V60 B;  1PLQ A;  5CFK A;  2ZVW A;  2HII A;  3A1J C;  5DAI A;  3GGR A;  1YYP A;  1RXZ A;  5E0U A;  3P87 A;  4D2G A;  4ZTD A;  3HSL X;  5HAC A;  1DML A;  4YHR A;  3U5Z F;  3FDS C;  3P91 A;  2NTI B;  3LX2 A;  2ZVL A;  4CS5 A;  3G65 A;  3K4X A;  3AIX A;  1PLR A;  2ZVM A;  3GPM A;  1UD9 A;  1B8H A;  2NTI C;  3A1J A;  3AIZ C;  1ISQ A;  2OD8 A;  2HIK B;  3F1W A;  2IZO B;  3U61 F;  1RXM A;  2HIK C;  3TBL A;  1CZD A;  2IZO C;  5IWD A;  5JNE D;  4L6P A;  3WGW A;  3LX1 A;  1T6L A;  1IZ5 A;  2ZVV A;  4L60 A;  2IO4 B;  3U60 F;  1AXC A;  2NTI A;  3AIZ A;  3GGR B;  5IXA A;  1IZ4 A;  2IX2 B;  4TR6 A;  3IFV A;  2HIK A;  2IX2 C;  5IY4 A;  5H0T A;  3GPN A;  1GE8 A;  1W60 A; 
#chains in the Genus database with same CATH homology
 5DA7 A;  2ZVK A;  3P83 A;  2Z0L A;  3FDS D;  1UL1 A;  2AWA A;  1SXJ F;  1U7B A;  2HII B;  1U76 A;  2IJX A;  4HK1 A;  2IO4 A;  3V61 B;  5B7O A;  2HII C;  3HI8 A;  2IX2 A;  1VYJ A;  1VYM A;  4RJF A;  3GGR C;  3VKX A;  2AVT A;  3A2F B;  5A6D A;  1RWZ A;  3G65 B;  5AUJ A;  3AIX B;  5E0V A;  3V62 B;  3I2M X;  3A1J B;  1B77 A;  3G65 C;  5E0T A;  3V60 B;  1PLQ A;  5CFK A;  2ZVW A;  2HII A;  3A1J C;  5DAI A;  3GGR A;  1YYP A;  1RXZ A;  5E0U A;  3P87 A;  4D2G A;  4ZTD A;  3HSL X;  5HAC A;  1DML A;  4YHR A;  3U5Z F;  3FDS C;  3P91 A;  2NTI B;  3LX2 A;  2ZVL A;  4CS5 A;  3G65 A;  3K4X A;  3AIX A;  1PLR A;  2ZVM A;  3GPM A;  1UD9 A;  1B8H A;  2NTI C;  3A1J A;  3AIZ C;  1ISQ A;  2OD8 A;  2HIK B;  3F1W A;  2IZO B;  3U61 F;  1RXM A;  2HIK C;  3TBL A;  1CZD A;  2IZO C;  5IWD A;  5JNE D;  4L6P A;  3WGW A;  3LX1 A;  1T6L A;  1IZ5 A;  2ZVV A;  4L60 A;  2IO4 B;  3U60 F;  1AXC A;  2NTI A;  3AIZ A;  3GGR B;  5IXA A;  1IZ4 A;  2IX2 B;  4TR6 A;  3IFV A;  2HIK A;  2IX2 C;  5IY4 A;  5H0T A;  3GPN A;  1GE8 A;  1W60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...