1R4KA

Solution structure of the drosophila argonaute 1 paz domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
168
structure length
168
Chain Sequence
TAFYKAQPVIDFMCEVLDIRDINEQRKPLTDSQRVKFTKEIKGLKIEITHCGQMRRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKATARSAPDREREINNLVKRADFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Argonaute 1
publication title Structure and conserved RNA binding of the PAZ domain
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rna binding protein
total genus 15
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2003-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02170 PAZ PAZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 1r4kA01
4NHAA 4Z4EA 4W5QA 2XFMA 5KI6A 4W5TA 4OLAA 4NGGA 4NH5A 5JS2A 1T2RA 4NH6A 4NGBA 1R6ZA 2L5DA 3MJ0A 4Z4FA 4NGFA 4NGCA 4NH3A 5T7BA 4Z4HA 4Z4GA 4W5RA 3O3IX 2FFLA 3O7XA 4Z4CA 4W5OA 4KREA 3O6EX 1VYNA 1R4KA 3QIRA 1SI3A 4OLBA 4KRFA 2QVWA 4NGDA 4F3TA 4Z4IA 2L5CA 4W5NA 3O7VX 1T2SA 5JS1A 1SI2A
chains in the Genus database with same CATH superfamily
4NHAA 4Z4EA 4W5QA 2XFMA 5KI6A 4W5TA 3HJFA 4NGGA 4OLAA 4NH5A 5JS2A 3HVRA 1T2RA 4L1UA 4NH6A 4NGBA 2BZEA 3F73A 3DLBA 1R6ZA 2L5DA 3HK2A 3MJ0A 3HM9A 4Z4FA 1Z26A 3HO1A 4NGFA 1U04A 3DA5A 4NGCA 4NH3A 5T7BA 4Z4HA 4Z4GA 4W5RA 1Z25A 3O3IX 2FFLA 3O7XA 4Z4CA 4W5OA 4L1PA 4KREA 3O6EX 1VYNA 1R4KA 3QIRA 1SI3A 4OLBA 2DB9A 4KRFA 2QVWA 4NGDA 4F3TA 4Z4IA 2L5CA 3DLHA 4W5NA 3O7VX 3U1UA 1T2SA 5JS1A 1SI2A
chains in the Genus database with same CATH topology
4NHAA 4Z4EA 4W5QA 2XFMA 5KI6A 4W5TA 3HJFA 4NGGA 4OLAA 4NH5A 5JS2A 3HVRA 1T2RA 4L1UA 4NH6A 4NGBA 2BZEA 3F73A 3DLBA 1R6ZA 2L5DA 3HK2A 3MJ0A 3HM9A 4Z4FA 1Z26A 3HO1A 4NGFA 1U04A 3DA5A 4NGCA 4NH3A 5T7BA 4Z4HA 4Z4GA 4W5RA 1Z25A 3O3IX 2FFLA 3O7XA 4Z4CA 4W5OA 4L1PA 4KREA 3O6EX 1VYNA 1R4KA 3QIRA 1SI3A 4OLBA 2DB9A 4KRFA 2QVWA 4NGDA 4F3TA 4Z4IA 2L5CA 3DLHA 4W5NA 3O7VX 3U1UA 1T2SA 5JS1A 1SI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NHA A;  4Z4E A;  4W5Q A;  2XFM A;  5KI6 A;  4W5T A;  4OLA A;  4NGG A;  4NH5 A;  5JS2 A;  1T2R A;  4NH6 A;  4NGB A;  1R6Z A;  2L5D A;  3MJ0 A;  4Z4F A;  4NGF A;  4NGC A;  4NH3 A;  5T7B A;  4Z4H A;  4Z4G A;  4W5R A;  3O3I X;  2FFL A;  3O7X A;  4Z4C A;  4W5O A;  4KRE A;  3O6E X;  1VYN A;  1R4K A;  3QIR A;  1SI3 A;  4OLB A;  4KRF A;  2QVW A;  4NGD A;  4F3T A;  4Z4I A;  2L5C A;  4W5N A;  3O7V X;  1T2S A;  5JS1 A;  1SI2 A; 
#chains in the Genus database with same CATH topology
 4NHA A;  4Z4E A;  4W5Q A;  2XFM A;  5KI6 A;  4W5T A;  3HJF A;  4NGG A;  4OLA A;  4NH5 A;  5JS2 A;  3HVR A;  1T2R A;  4L1U A;  4NH6 A;  4NGB A;  2BZE A;  3F73 A;  3DLB A;  1R6Z A;  2L5D A;  3HK2 A;  3MJ0 A;  3HM9 A;  4Z4F A;  1Z26 A;  3HO1 A;  4NGF A;  1U04 A;  3DA5 A;  4NGC A;  4NH3 A;  5T7B A;  4Z4H A;  4Z4G A;  4W5R A;  1Z25 A;  3O3I X;  2FFL A;  3O7X A;  4Z4C A;  4W5O A;  4L1P A;  4KRE A;  3O6E X;  1VYN A;  1R4K A;  3QIR A;  1SI3 A;  4OLB A;  2DB9 A;  4KRF A;  2QVW A;  4NGD A;  4F3T A;  4Z4I A;  2L5C A;  3DLH A;  4W5N A;  3O7V X;  3U1U A;  1T2S A;  5JS1 A;  1SI2 A; 
#chains in the Genus database with same CATH homology
 4NHA A;  4Z4E A;  4W5Q A;  2XFM A;  5KI6 A;  4W5T A;  3HJF A;  4NGG A;  4OLA A;  4NH5 A;  5JS2 A;  3HVR A;  1T2R A;  4L1U A;  4NH6 A;  4NGB A;  2BZE A;  3F73 A;  3DLB A;  1R6Z A;  2L5D A;  3HK2 A;  3MJ0 A;  3HM9 A;  4Z4F A;  1Z26 A;  3HO1 A;  4NGF A;  1U04 A;  3DA5 A;  4NGC A;  4NH3 A;  5T7B A;  4Z4H A;  4Z4G A;  4W5R A;  1Z25 A;  3O3I X;  2FFL A;  3O7X A;  4Z4C A;  4W5O A;  4L1P A;  4KRE A;  3O6E X;  1VYN A;  1R4K A;  3QIR A;  1SI3 A;  4OLB A;  2DB9 A;  4KRF A;  2QVW A;  4NGD A;  4F3T A;  4Z4I A;  2L5C A;  3DLH A;  4W5N A;  3O7V X;  3U1U A;  1T2S A;  5JS1 A;  1SI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...