1SI3A

Crystal structure of the paz domain of human eif2c1 in complex with a 9-mer sirna-like duplex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
126
structure length
120
Chain Sequence
MAQPVIEFMCEVLDIRNIDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-R(*CP*GP*UP*GP*AP*CP*UP*CP*U)-3'
publication title Structural basis for overhang-specific small interfering RNA recognition by the PAZ domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation/rna
total genus 26
structure length 120
sequence length 126
ec nomenclature
pdb deposition date 2004-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02170 PAZ PAZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 1si3A00
1R4KA 4Z4GA 4NGCA 4W5OA 4KRFA 4KREA 4W5TA 3O3IX 4F3TA 5T7BA 3O7XA 3O7VX 4NH6A 4W5RA 4NH5A 5KI6A 5JS1A 5JS2A 1SI2A 2FFLA 4W5QA 4W5NA 3O6EX 1SI3A 4OLAA 4Z4HA 4Z4EA 2QVWA 1T2RA 4Z4IA 4NGFA 2L5CA 4Z4CA 2L5DA 4Z4FA 1VYNA 2XFMA 4NGGA 4NH3A 1R6ZA 3MJ0A 4NHAA 4NGBA 4NGDA 4OLBA 3QIRA 1T2SA
chains in the Genus database with same CATH superfamily
3DA5A 1R4KA 1Z25A 4Z4GA 4NGCA 4W5OA 4KRFA 4KREA 4W5TA 4L1PA 3O3IX 4F3TA 5T7BA 3O7XA 3O7VX 4NH6A 1U04A 4W5RA 4NH5A 5KI6A 5JS1A 5JS2A 1SI2A 2FFLA 4W5QA 4W5NA 3O6EX 1SI3A 4L1UA 3HK2A 4OLAA 1Z26A 4Z4HA 3HM9A 4Z4EA 3DLHA 2QVWA 1T2RA 4Z4IA 4NGFA 2L5CA 4Z4CA 3F73A 2L5DA 3HVRA 4Z4FA 1VYNA 3HJFA 2XFMA 3HO1A 4NGGA 3U1UA 4NH3A 3DLBA 1R6ZA 3MJ0A 2BZEA 4NGBA 4NHAA 4NGDA 2DB9A 4OLBA 3QIRA 1T2SA
chains in the Genus database with same CATH topology
3DA5A 1R4KA 1Z25A 4Z4GA 4NGCA 4W5OA 4KRFA 4KREA 4W5TA 4L1PA 3O3IX 4F3TA 5T7BA 3O7XA 3O7VX 4NH6A 1U04A 4W5RA 4NH5A 5KI6A 5JS1A 5JS2A 1SI2A 2FFLA 4W5QA 4W5NA 3O6EX 1SI3A 4L1UA 3HK2A 4OLAA 1Z26A 4Z4HA 3HM9A 4Z4EA 3DLHA 2QVWA 1T2RA 4Z4IA 4NGFA 2L5CA 4Z4CA 3F73A 2L5DA 3HVRA 4Z4FA 1VYNA 3HJFA 2XFMA 3HO1A 4NGGA 3U1UA 4NH3A 3DLBA 1R6ZA 3MJ0A 2BZEA 4NGBA 4NHAA 4NGDA 2DB9A 4OLBA 3QIRA 1T2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R4K A;  4Z4G A;  4NGC A;  4W5O A;  4KRF A;  4KRE A;  4W5T A;  3O3I X;  4F3T A;  5T7B A;  3O7X A;  3O7V X;  4NH6 A;  4W5R A;  4NH5 A;  5KI6 A;  5JS1 A;  5JS2 A;  1SI2 A;  2FFL A;  4W5Q A;  4W5N A;  3O6E X;  1SI3 A;  4OLA A;  4Z4H A;  4Z4E A;  2QVW A;  1T2R A;  4Z4I A;  4NGF A;  2L5C A;  4Z4C A;  2L5D A;  4Z4F A;  1VYN A;  2XFM A;  4NGG A;  4NH3 A;  1R6Z A;  3MJ0 A;  4NHA A;  4NGB A;  4NGD A;  4OLB A;  3QIR A;  1T2S A; 
#chains in the Genus database with same CATH topology
 3DA5 A;  1R4K A;  1Z25 A;  4Z4G A;  4NGC A;  4W5O A;  4KRF A;  4KRE A;  4W5T A;  4L1P A;  3O3I X;  4F3T A;  5T7B A;  3O7X A;  3O7V X;  4NH6 A;  1U04 A;  4W5R A;  4NH5 A;  5KI6 A;  5JS1 A;  5JS2 A;  1SI2 A;  2FFL A;  4W5Q A;  4W5N A;  3O6E X;  1SI3 A;  4L1U A;  3HK2 A;  4OLA A;  1Z26 A;  4Z4H A;  3HM9 A;  4Z4E A;  3DLH A;  2QVW A;  1T2R A;  4Z4I A;  4NGF A;  2L5C A;  4Z4C A;  3F73 A;  2L5D A;  3HVR A;  4Z4F A;  1VYN A;  3HJF A;  2XFM A;  3HO1 A;  4NGG A;  3U1U A;  4NH3 A;  3DLB A;  1R6Z A;  3MJ0 A;  2BZE A;  4NGB A;  4NHA A;  4NGD A;  2DB9 A;  4OLB A;  3QIR A;  1T2S A; 
#chains in the Genus database with same CATH homology
 3DA5 A;  1R4K A;  1Z25 A;  4Z4G A;  4NGC A;  4W5O A;  4KRF A;  4KRE A;  4W5T A;  4L1P A;  3O3I X;  4F3T A;  5T7B A;  3O7X A;  3O7V X;  4NH6 A;  1U04 A;  4W5R A;  4NH5 A;  5KI6 A;  5JS1 A;  5JS2 A;  1SI2 A;  2FFL A;  4W5Q A;  4W5N A;  3O6E X;  1SI3 A;  4L1U A;  3HK2 A;  4OLA A;  1Z26 A;  4Z4H A;  3HM9 A;  4Z4E A;  3DLH A;  2QVW A;  1T2R A;  4Z4I A;  4NGF A;  2L5C A;  4Z4C A;  3F73 A;  2L5D A;  3HVR A;  4Z4F A;  1VYN A;  3HJF A;  2XFM A;  3HO1 A;  4NGG A;  3U1U A;  4NH3 A;  3DLB A;  1R6Z A;  3MJ0 A;  2BZE A;  4NGB A;  4NHA A;  4NGD A;  2DB9 A;  4OLB A;  3QIR A;  1T2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...