1SI3A

Crystal structure of the paz domain of human eif2c1 in complex with a 9-mer sirna-like duplex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
126
structure length
120
Chain Sequence
b'MAQPVIEFMCEVLDIRNIDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-R(*CP*GP*UP*GP*AP*CP*UP*CP*U)-3'
publication title Structural basis for overhang-specific small interfering RNA recognition by the PAZ domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation/rna
total genus 26
structure length 120
sequence length 126
ec nomenclature
pdb deposition date 2004-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02170 PAZ PAZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 1si3A00
4F3TA 4NGDA 4OLBA 3MJ0A 4NGCA 4W5NA 1T2SA 2L5CA 2FFLA 4Z4EA 5JS1A 1T2RA 1SI2A 4NH3A 4NGGA 2L5DA 2QVWA 4NH5A 4NH6A 3QIRA 4W5RA 4NGBA 4Z4IA 2XFMA 4NHAA 3O7XA 4W5OA 1R6ZA 4NGFA 4Z4CA 3O3IX 1R4KA 4W5QA 1SI3A 4Z4FA 4OLAA 4W5TA 4Z4HA 1VYNA 3O7VX 5JS2A 3O6EX 4KRFA 5KI6A 5T7BA 4Z4GA 4KREA
chains in the Genus database with same CATH superfamily
4F3TA 4NGDA 3HM9A 4OLBA 3MJ0A 3HO1A 3DLBA 4L1PA 4NGCA 4W5NA 1T2SA 2FFLA 2L5CA 3DA5A 3DLHA 4Z4EA 5JS1A 2DB9A 1T2RA 1SI2A 3HVRA 4NGGA 2L5DA 4NH3A 2QVWA 3HK2A 4NH5A 4NH6A 3QIRA 4W5RA 4NGBA 4L1UA 4Z4IA 2XFMA 4NHAA 3O7XA 4W5OA 1R6ZA 2BZEA 1Z25A 4Z4CA 3O3IX 1R4KA 1Z26A 4NGFA 3HJFA 4W5QA 1U04A 1SI3A 4Z4FA 4OLAA 4W5TA 4Z4HA 1VYNA 3O7VX 5JS2A 3U1UA 3O6EX 4KRFA 5KI6A 5T7BA 3F73A 4Z4GA 4KREA
chains in the Genus database with same CATH topology
4F3TA 4NGDA 3HM9A 4OLBA 3MJ0A 3HO1A 3DLBA 4L1PA 4NGCA 4W5NA 1T2SA 2FFLA 2L5CA 3DA5A 3DLHA 4Z4EA 5JS1A 2DB9A 1T2RA 1SI2A 3HVRA 4NGGA 2L5DA 4NH3A 2QVWA 3HK2A 4NH5A 4NH6A 3QIRA 4W5RA 4NGBA 4L1UA 4Z4IA 2XFMA 4NHAA 3O7XA 4W5OA 1R6ZA 2BZEA 1Z25A 4Z4CA 3O3IX 1R4KA 1Z26A 4NGFA 3HJFA 4W5QA 1U04A 1SI3A 4Z4FA 4OLAA 4W5TA 4Z4HA 1VYNA 3O7VX 5JS2A 3U1UA 3O6EX 4KRFA 5KI6A 5T7BA 3F73A 4Z4GA 4KREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F3T A;  4NGD A;  4OLB A;  3MJ0 A;  4NGC A;  4W5N A;  1T2S A;  2L5C A;  2FFL A;  4Z4E A;  5JS1 A;  1T2R A;  1SI2 A;  4NH3 A;  4NGG A;  2L5D A;  2QVW A;  4NH5 A;  4NH6 A;  3QIR A;  4W5R A;  4NGB A;  4Z4I A;  2XFM A;  4NHA A;  3O7X A;  4W5O A;  1R6Z A;  4NGF A;  4Z4C A;  3O3I X;  1R4K A;  4W5Q A;  1SI3 A;  4Z4F A;  4OLA A;  4W5T A;  4Z4H A;  1VYN A;  3O7V X;  5JS2 A;  3O6E X;  4KRF A;  5KI6 A;  5T7B A;  4Z4G A;  4KRE A; 
#chains in the Genus database with same CATH topology
 4F3T A;  4NGD A;  3HM9 A;  4OLB A;  3MJ0 A;  3HO1 A;  3DLB A;  4L1P A;  4NGC A;  4W5N A;  1T2S A;  2FFL A;  2L5C A;  3DA5 A;  3DLH A;  4Z4E A;  5JS1 A;  2DB9 A;  1T2R A;  1SI2 A;  3HVR A;  4NGG A;  2L5D A;  4NH3 A;  2QVW A;  3HK2 A;  4NH5 A;  4NH6 A;  3QIR A;  4W5R A;  4NGB A;  4L1U A;  4Z4I A;  2XFM A;  4NHA A;  3O7X A;  4W5O A;  1R6Z A;  2BZE A;  1Z25 A;  4Z4C A;  3O3I X;  1R4K A;  1Z26 A;  4NGF A;  3HJF A;  4W5Q A;  1U04 A;  1SI3 A;  4Z4F A;  4OLA A;  4W5T A;  4Z4H A;  1VYN A;  3O7V X;  5JS2 A;  3U1U A;  3O6E X;  4KRF A;  5KI6 A;  5T7B A;  3F73 A;  4Z4G A;  4KRE A; 
#chains in the Genus database with same CATH homology
 4F3T A;  4NGD A;  3HM9 A;  4OLB A;  3MJ0 A;  3HO1 A;  3DLB A;  4L1P A;  4NGC A;  4W5N A;  1T2S A;  2FFL A;  2L5C A;  3DA5 A;  3DLH A;  4Z4E A;  5JS1 A;  2DB9 A;  1T2R A;  1SI2 A;  3HVR A;  4NGG A;  2L5D A;  4NH3 A;  2QVW A;  3HK2 A;  4NH5 A;  4NH6 A;  3QIR A;  4W5R A;  4NGB A;  4L1U A;  4Z4I A;  2XFM A;  4NHA A;  3O7X A;  4W5O A;  1R6Z A;  2BZE A;  1Z25 A;  4Z4C A;  3O3I X;  1R4K A;  1Z26 A;  4NGF A;  3HJF A;  4W5Q A;  1U04 A;  1SI3 A;  4Z4F A;  4OLA A;  4W5T A;  4Z4H A;  1VYN A;  3O7V X;  5JS2 A;  3U1U A;  3O6E X;  4KRF A;  5KI6 A;  5T7B A;  3F73 A;  4Z4G A;  4KRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...