3QIRA

Crystal structure of piwil2 paz domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
115
structure length
112
Chain Sequence
NDCVLDVMHAIYQQNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVKEEDQPLLIHRPSERQDNLLKGEILLLPELSFMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Piwi-like protein 2
publication title Crystal structure of PIWIL2 PAZ domain
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 27
structure length 112
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02170 PAZ PAZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 3qirA00
2L5CA 3QIRA 3O6EX 3O7XA 4NH3A 4KREA 4Z4CA 4W5OA 2L5DA 4W5TA 4NGGA 4NHAA 4W5QA 1VYNA 3MJ0A 4NGCA 1R4KA 5JS2A 4Z4FA 4Z4IA 5T7BA 4W5NA 3O7VX 2FFLA 3O3IX 4NGDA 1SI2A 2XFMA 4F3TA 4W5RA 4NH5A 4Z4EA 4NH6A 4OLAA 4KRFA 1T2SA 4NGBA 4Z4HA 1R6ZA 5KI6A 5JS1A 2QVWA 4OLBA 1SI3A 1T2RA 4Z4GA 4NGFA
chains in the Genus database with same CATH superfamily
2L5CA 3QIRA 3O6EX 3O7XA 4NH3A 3HO1A 2BZEA 4KREA 1Z25A 4Z4CA 4W5OA 2L5DA 4W5TA 4NGGA 4NHAA 1VYNA 4W5QA 3DLBA 3DA5A 3MJ0A 1R4KA 1U04A 5JS2A 4Z4FA 4NGCA 4Z4IA 5T7BA 4W5NA 3O7VX 2FFLA 3O3IX 2DB9A 4NGDA 1SI2A 2XFMA 3HK2A 4F3TA 4W5RA 4NH5A 4Z4EA 3HVRA 4NH6A 4OLAA 4KRFA 3F73A 1T2SA 4NGBA 3DLHA 4Z4HA 1R6ZA 5KI6A 3HJFA 4L1PA 4L1UA 5JS1A 2QVWA 3HM9A 4OLBA 3U1UA 1SI3A 1T2RA 4Z4GA 4NGFA 1Z26A
chains in the Genus database with same CATH topology
2L5CA 3QIRA 3O6EX 3O7XA 4NH3A 3HO1A 2BZEA 4KREA 1Z25A 4Z4CA 4W5OA 2L5DA 4W5TA 4NGGA 4NHAA 1VYNA 4W5QA 3DLBA 3DA5A 3MJ0A 1R4KA 1U04A 5JS2A 4Z4FA 4NGCA 4Z4IA 5T7BA 4W5NA 3O7VX 2FFLA 3O3IX 2DB9A 4NGDA 1SI2A 2XFMA 3HK2A 4F3TA 4W5RA 4NH5A 4Z4EA 3HVRA 4NH6A 4OLAA 4KRFA 3F73A 1T2SA 4NGBA 3DLHA 4Z4HA 1R6ZA 5KI6A 3HJFA 4L1PA 4L1UA 5JS1A 2QVWA 3HM9A 4OLBA 3U1UA 1SI3A 1T2RA 4Z4GA 4NGFA 1Z26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L5C A;  3QIR A;  3O6E X;  3O7X A;  4NH3 A;  4KRE A;  4Z4C A;  4W5O A;  2L5D A;  4W5T A;  4NGG A;  4NHA A;  4W5Q A;  1VYN A;  3MJ0 A;  4NGC A;  1R4K A;  5JS2 A;  4Z4F A;  4Z4I A;  5T7B A;  4W5N A;  3O7V X;  2FFL A;  3O3I X;  4NGD A;  1SI2 A;  2XFM A;  4F3T A;  4W5R A;  4NH5 A;  4Z4E A;  4NH6 A;  4OLA A;  4KRF A;  1T2S A;  4NGB A;  4Z4H A;  1R6Z A;  5KI6 A;  5JS1 A;  2QVW A;  4OLB A;  1SI3 A;  1T2R A;  4Z4G A;  4NGF A; 
#chains in the Genus database with same CATH topology
 2L5C A;  3QIR A;  3O6E X;  3O7X A;  4NH3 A;  3HO1 A;  2BZE A;  4KRE A;  1Z25 A;  4Z4C A;  4W5O A;  2L5D A;  4W5T A;  4NGG A;  4NHA A;  1VYN A;  4W5Q A;  3DLB A;  3DA5 A;  3MJ0 A;  1R4K A;  1U04 A;  5JS2 A;  4Z4F A;  4NGC A;  4Z4I A;  5T7B A;  4W5N A;  3O7V X;  2FFL A;  3O3I X;  2DB9 A;  4NGD A;  1SI2 A;  2XFM A;  3HK2 A;  4F3T A;  4W5R A;  4NH5 A;  4Z4E A;  3HVR A;  4NH6 A;  4OLA A;  4KRF A;  3F73 A;  1T2S A;  4NGB A;  3DLH A;  4Z4H A;  1R6Z A;  5KI6 A;  3HJF A;  4L1P A;  4L1U A;  5JS1 A;  2QVW A;  3HM9 A;  4OLB A;  3U1U A;  1SI3 A;  1T2R A;  4Z4G A;  4NGF A;  1Z26 A; 
#chains in the Genus database with same CATH homology
 2L5C A;  3QIR A;  3O6E X;  3O7X A;  4NH3 A;  3HO1 A;  2BZE A;  4KRE A;  1Z25 A;  4Z4C A;  4W5O A;  2L5D A;  4W5T A;  4NGG A;  4NHA A;  1VYN A;  4W5Q A;  3DLB A;  3DA5 A;  3MJ0 A;  1R4K A;  1U04 A;  5JS2 A;  4Z4F A;  4NGC A;  4Z4I A;  5T7B A;  4W5N A;  3O7V X;  2FFL A;  3O3I X;  2DB9 A;  4NGD A;  1SI2 A;  2XFM A;  3HK2 A;  4F3T A;  4W5R A;  4NH5 A;  4Z4E A;  3HVR A;  4NH6 A;  4OLA A;  4KRF A;  3F73 A;  1T2S A;  4NGB A;  3DLH A;  4Z4H A;  1R6Z A;  5KI6 A;  3HJF A;  4L1P A;  4L1U A;  5JS1 A;  2QVW A;  3HM9 A;  4OLB A;  3U1U A;  1SI3 A;  1T2R A;  4Z4G A;  4NGF A;  1Z26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...