3QIRA

Crystal structure of piwil2 paz domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
115
structure length
112
Chain Sequence
NDCVLDVMHAIYQQNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVKEEDQPLLIHRPSERQDNLLKGEILLLPELSFMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PIWIL2 PAZ domain
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Piwi-like protein 2
total genus 27
structure length 112
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02170 PAZ PAZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 3qirA00
2QVWA 3O7VX 1T2RA 1R4KA 4NH6A 4NGDA 4F3TA 4W5TA 2L5CA 4NH5A 3QIRA 3O6EX 5JS2A 4NHAA 4W5QA 4Z4IA 4NGCA 4Z4HA 4KREA 1T2SA 2FFLA 2XFMA 4OLBA 4Z4EA 5T7BA 3O7XA 4W5NA 4Z4CA 2L5DA 4NH3A 5KI6A 4KRFA 1SI2A 1R6ZA 1SI3A 4NGGA 4Z4GA 4NGBA 4W5RA 3O3IX 1VYNA 4OLAA 3MJ0A 4NGFA 5JS1A 4W5OA 4Z4FA
chains in the Genus database with same CATH superfamily
2QVWA 3O7VX 1T2RA 1R4KA 3DLHA 4NH6A 4L1PA 4NGDA 3F73A 3HO1A 1Z26A 4F3TA 3HJFA 4W5TA 3HK2A 2L5CA 4NH5A 3QIRA 3O6EX 5JS2A 4NHAA 4W5QA 4Z4IA 2DB9A 4NGCA 4Z4HA 3U1UA 4L1UA 2FFLA 1T2SA 3HM9A 3DA5A 2XFMA 4OLBA 4KREA 4Z4EA 5T7BA 3O7XA 4W5NA 4Z4CA 2L5DA 4NH3A 5KI6A 4KRFA 1SI2A 1R6ZA 1SI3A 1U04A 4NGGA 4Z4GA 4NGBA 4W5RA 4Z4FA 3O3IX 1VYNA 1Z25A 4OLAA 3DLBA 3MJ0A 4NGFA 5JS1A 3HVRA 4W5OA 2BZEA
chains in the Genus database with same CATH topology
2QVWA 3O7VX 1T2RA 1R4KA 3DLHA 4NH6A 4L1PA 4NGDA 3F73A 3HO1A 1Z26A 4F3TA 3HJFA 4W5TA 3HK2A 2L5CA 4NH5A 3QIRA 3O6EX 5JS2A 4NHAA 4W5QA 4Z4IA 2DB9A 4NGCA 4Z4HA 3U1UA 4L1UA 2FFLA 1T2SA 3HM9A 3DA5A 2XFMA 4OLBA 4KREA 4Z4EA 5T7BA 3O7XA 4W5NA 4Z4CA 2L5DA 4NH3A 5KI6A 4KRFA 1SI2A 1R6ZA 1SI3A 1U04A 4NGGA 4Z4GA 4NGBA 4W5RA 4Z4FA 3O3IX 1VYNA 1Z25A 4OLAA 3DLBA 3MJ0A 4NGFA 5JS1A 3HVRA 4W5OA 2BZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QVW A;  3O7V X;  1T2R A;  1R4K A;  4NH6 A;  4NGD A;  4F3T A;  4W5T A;  2L5C A;  4NH5 A;  3QIR A;  3O6E X;  5JS2 A;  4NHA A;  4W5Q A;  4Z4I A;  4NGC A;  4Z4H A;  4KRE A;  1T2S A;  2FFL A;  2XFM A;  4OLB A;  4Z4E A;  5T7B A;  3O7X A;  4W5N A;  4Z4C A;  2L5D A;  4NH3 A;  5KI6 A;  4KRF A;  1SI2 A;  1R6Z A;  1SI3 A;  4NGG A;  4Z4G A;  4NGB A;  4W5R A;  3O3I X;  1VYN A;  4OLA A;  3MJ0 A;  4NGF A;  5JS1 A;  4W5O A;  4Z4F A; 
#chains in the Genus database with same CATH topology
 2QVW A;  3O7V X;  1T2R A;  1R4K A;  3DLH A;  4NH6 A;  4L1P A;  4NGD A;  3F73 A;  3HO1 A;  1Z26 A;  4F3T A;  3HJF A;  4W5T A;  3HK2 A;  2L5C A;  4NH5 A;  3QIR A;  3O6E X;  5JS2 A;  4NHA A;  4W5Q A;  4Z4I A;  2DB9 A;  4NGC A;  4Z4H A;  3U1U A;  4L1U A;  2FFL A;  1T2S A;  3HM9 A;  3DA5 A;  2XFM A;  4OLB A;  4KRE A;  4Z4E A;  5T7B A;  3O7X A;  4W5N A;  4Z4C A;  2L5D A;  4NH3 A;  5KI6 A;  4KRF A;  1SI2 A;  1R6Z A;  1SI3 A;  1U04 A;  4NGG A;  4Z4G A;  4NGB A;  4W5R A;  4Z4F A;  3O3I X;  1VYN A;  1Z25 A;  4OLA A;  3DLB A;  3MJ0 A;  4NGF A;  5JS1 A;  3HVR A;  4W5O A;  2BZE A; 
#chains in the Genus database with same CATH homology
 2QVW A;  3O7V X;  1T2R A;  1R4K A;  3DLH A;  4NH6 A;  4L1P A;  4NGD A;  3F73 A;  3HO1 A;  1Z26 A;  4F3T A;  3HJF A;  4W5T A;  3HK2 A;  2L5C A;  4NH5 A;  3QIR A;  3O6E X;  5JS2 A;  4NHA A;  4W5Q A;  4Z4I A;  2DB9 A;  4NGC A;  4Z4H A;  3U1U A;  4L1U A;  2FFL A;  1T2S A;  3HM9 A;  3DA5 A;  2XFM A;  4OLB A;  4KRE A;  4Z4E A;  5T7B A;  3O7X A;  4W5N A;  4Z4C A;  2L5D A;  4NH3 A;  5KI6 A;  4KRF A;  1SI2 A;  1R6Z A;  1SI3 A;  1U04 A;  4NGG A;  4Z4G A;  4NGB A;  4W5R A;  4Z4F A;  3O3I X;  1VYN A;  1Z25 A;  4OLA A;  3DLB A;  3MJ0 A;  4NGF A;  5JS1 A;  3HVR A;  4W5O A;  2BZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...