3O3IX

Crystal structure of human hiwi1 paz domain (residues 277-399) in complex with 14-mer rna (12-bp + 2-nt overhang) containing 2'-oh at its 3'-end
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
118
structure length
108
Chain Sequence
SETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKGPAMLIPELCYLTGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Piwi-like protein 1
publication title Inaugural Article: Structural basis for piRNA 2'-O-methylated 3'-end recognition by Piwi PAZ (Piwi/Argonaute/Zwille) domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 21
structure length 108
sequence length 118
ec nomenclature
pdb deposition date 2010-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 3o3iX00
3O7VX 4Z4HA 2FFLA 4NGBA 4NHAA 4NGCA 1SI2A 1T2SA 4W5OA 3MJ0A 4OLAA 2L5DA 4Z4IA 4KREA 5KI6A 1R4KA 2QVWA 4Z4EA 4F3TA 3O6EX 1SI3A 5JS1A 4NGDA 5T7BA 1R6ZA 4W5TA 3O3IX 4NH5A 4NGFA 4NH6A 5JS2A 4Z4GA 4W5QA 4OLBA 4Z4FA 2XFMA 3O7XA 4W5RA 4KRFA 4NH3A 1VYNA 2L5CA 3QIRA 4Z4CA 4NGGA 1T2RA 4W5NA
chains in the Genus database with same CATH superfamily
1Z25A 3O7VX 4Z4CA 2FFLA 4Z4HA 1U04A 4NGBA 3HJFA 3HVRA 4NHAA 4NGCA 1SI2A 2BZEA 1T2SA 4W5OA 3DLHA 3MJ0A 2L5DA 4OLAA 3DA5A 4Z4IA 4KREA 5KI6A 3U1UA 1R4KA 2QVWA 3F73A 4Z4EA 4F3TA 3O6EX 1SI3A 5JS1A 4NGDA 5T7BA 3HK2A 1R6ZA 4W5TA 3O3IX 4NH5A 4NGFA 4NH6A 5JS2A 4Z4GA 4W5QA 3HM9A 4OLBA 4Z4FA 4L1UA 2XFMA 3O7XA 4W5RA 4KRFA 3DLBA 4NH3A 2DB9A 1VYNA 2L5CA 3QIRA 1Z26A 3HO1A 4L1PA 4NGGA 1T2RA 4W5NA
chains in the Genus database with same CATH topology
1Z25A 3O7VX 4Z4CA 2FFLA 4Z4HA 1U04A 4NGBA 3HJFA 3HVRA 4NHAA 4NGCA 1SI2A 2BZEA 1T2SA 4W5OA 3DLHA 3MJ0A 2L5DA 4OLAA 3DA5A 4Z4IA 4KREA 5KI6A 3U1UA 1R4KA 2QVWA 3F73A 4Z4EA 4F3TA 3O6EX 1SI3A 5JS1A 4NGDA 5T7BA 3HK2A 1R6ZA 4W5TA 3O3IX 4NH5A 4NGFA 4NH6A 5JS2A 4Z4GA 4W5QA 3HM9A 4OLBA 4Z4FA 4L1UA 2XFMA 3O7XA 4W5RA 4KRFA 3DLBA 4NH3A 2DB9A 1VYNA 2L5CA 3QIRA 1Z26A 3HO1A 4L1PA 4NGGA 1T2RA 4W5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O7V X;  4Z4H A;  2FFL A;  4NGB A;  4NHA A;  4NGC A;  1SI2 A;  1T2S A;  4W5O A;  3MJ0 A;  4OLA A;  2L5D A;  4Z4I A;  4KRE A;  5KI6 A;  1R4K A;  2QVW A;  4Z4E A;  4F3T A;  3O6E X;  1SI3 A;  5JS1 A;  4NGD A;  5T7B A;  1R6Z A;  4W5T A;  3O3I X;  4NH5 A;  4NGF A;  4NH6 A;  5JS2 A;  4Z4G A;  4W5Q A;  4OLB A;  4Z4F A;  2XFM A;  3O7X A;  4W5R A;  4KRF A;  4NH3 A;  1VYN A;  2L5C A;  3QIR A;  4Z4C A;  4NGG A;  1T2R A;  4W5N A; 
#chains in the Genus database with same CATH topology
 1Z25 A;  3O7V X;  4Z4C A;  2FFL A;  4Z4H A;  1U04 A;  4NGB A;  3HJF A;  3HVR A;  4NHA A;  4NGC A;  1SI2 A;  2BZE A;  1T2S A;  4W5O A;  3DLH A;  3MJ0 A;  2L5D A;  4OLA A;  3DA5 A;  4Z4I A;  4KRE A;  5KI6 A;  3U1U A;  1R4K A;  2QVW A;  3F73 A;  4Z4E A;  4F3T A;  3O6E X;  1SI3 A;  5JS1 A;  4NGD A;  5T7B A;  3HK2 A;  1R6Z A;  4W5T A;  3O3I X;  4NH5 A;  4NGF A;  4NH6 A;  5JS2 A;  4Z4G A;  4W5Q A;  3HM9 A;  4OLB A;  4Z4F A;  4L1U A;  2XFM A;  3O7X A;  4W5R A;  4KRF A;  3DLB A;  4NH3 A;  2DB9 A;  1VYN A;  2L5C A;  3QIR A;  1Z26 A;  3HO1 A;  4L1P A;  4NGG A;  1T2R A;  4W5N A; 
#chains in the Genus database with same CATH homology
 1Z25 A;  3O7V X;  4Z4C A;  2FFL A;  4Z4H A;  1U04 A;  4NGB A;  3HJF A;  3HVR A;  4NHA A;  4NGC A;  1SI2 A;  2BZE A;  1T2S A;  4W5O A;  3DLH A;  3MJ0 A;  2L5D A;  4OLA A;  3DA5 A;  4Z4I A;  4KRE A;  5KI6 A;  3U1U A;  1R4K A;  2QVW A;  3F73 A;  4Z4E A;  4F3T A;  3O6E X;  1SI3 A;  5JS1 A;  4NGD A;  5T7B A;  3HK2 A;  1R6Z A;  4W5T A;  3O3I X;  4NH5 A;  4NGF A;  4NH6 A;  5JS2 A;  4Z4G A;  4W5Q A;  3HM9 A;  4OLB A;  4Z4F A;  4L1U A;  2XFM A;  3O7X A;  4W5R A;  4KRF A;  3DLB A;  4NH3 A;  2DB9 A;  1VYN A;  2L5C A;  3QIR A;  1Z26 A;  3HO1 A;  4L1P A;  4NGG A;  1T2R A;  4W5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...