The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
46
|
sequence length |
127
|
structure length |
127
|
Chain Sequence |
IDAKQLNSLALAYMGDAVYEQYIRYHLLQKGKVRPNQLHRLGTSFVSAKAQAKVVYHLLETAFLTEEEEAVLRRGRNANSGTVPKNTDVQTYRHSTAFEALIGYHHLLNNRERLDEIVYKAIAVLEE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
X-ray crystal structure of conserved hypothetical protein from Bacillus cereus
rcsb |
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Bacillus cereus
|
| molecule keywords |
hypothetical protein
|
| total genus |
46
|
| structure length |
127
|
| sequence length |
127
|
| ec nomenclature | |
| pdb deposition date | 2004-07-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00636 | Ribonuclease_3 | Ribonuclease III domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Ribonuclease iii, N-terminal Endonuclease Domain; Chain A | Ribonuclease III domain |
#chains in the Genus database with same CATH superfamily 3C4B A; 1O0W A; 1YZ9 A; 4OUN A; 3O2R B; 2EZ6 A; 1RC7 A; 4OOG C; 3C4T A; 1RC5 A; 2A11 A; 1U61 A; 2EB1 A; 1YYK A; 3RV0 A; 4M30 A; 3RV1 A; 1YYO A; 3O2R A; 2QVW A; 2FFL A; 2NUE A; 4M2Z A; 1I4S A; 2GSL A; 1YYW A; 3N3W A; 1JFZ A; 2NUG A; 2NUF A; #chains in the Genus database with same CATH topology 3C4B A; 1O0W A; 1YZ9 A; 4OUN A; 3O2R B; 2EZ6 A; 1RC7 A; 4OOG C; 3C4T A; 1RC5 A; 1ZTD A; 2A11 A; 1U61 A; 2EB1 A; 1YYK A; 3RV0 A; 4M30 A; 3RV1 A; 1YYO A; 3O2R A; 2QVW A; 2FFL A; 2NUE A; 4M2Z A; 1I4S A; 2GSL A; 1YYW A; 3N3W A; 1JFZ A; 2NUG A; 2NUF A; #chains in the Genus database with same CATH homology 3C4B A; 1O0W A; 1YZ9 A; 4OUN A; 3O2R B; 2EZ6 A; 1RC7 A; 4OOG C; 3C4T A; 1RC5 A; 2A11 A; 1U61 A; 2EB1 A; 1YYK A; 3RV0 A; 4M30 A; 3RV1 A; 1YYO A; 3O2R A; 2QVW A; 2FFL A; 2NUE A; 4M2Z A; 1I4S A; 2GSL A; 1YYW A; 3N3W A; 1JFZ A; 2NUG A; 2NUF A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
