4OOGC

Crystal structure of yeast rnase iii (rnt1p) complexed with the product of dsrna processing
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
261
structure length
261
Chain Sequence
KWPPKLPEIQDLAIRARVFIHKSTIKDKVYLSGSEMINAHNERLEFLGDSILNSVMTLIIYNKFPDYSEGQLSTLRMNLVSNEQIKQWSIMYNFHEKLKTNFDLKDENSNFQNGKLKLYADVFEAYIGGLMEDDPRNNLPKIRKWLRKLAKPVIEEATRNQVALEKTDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSESVLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease 3
publication title Structure of a Eukaryotic RNase III Postcleavage Complex Reveals a Double-Ruler Mechanism for Substrate Selection.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 79
structure length 261
sequence length 261
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2014-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00035 dsrm Double-stranded RNA binding motif
C PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 4oogC01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4oogC02
4JI5E 4M2ZA 1HNXE 1GQEA 3LLHA 4B3SE 1ZBTA 2VQEE 3HTXA 1T4NA 4WFTA 2FFLA 1STUA 4DV5E 2RTXA 2A11A 2N3GA 1YYWA 2F4VE 4AQYE 4NXNE 1PKPA 4DV3E 2NUGA 4DKKA 2DB2A 4DV6E 1JFZA 4OX9E 4DR6E 1I4SA 2L3CA 4LFBE 3T1HE 4JYAE 4DR7E 4JI8E 4M30A 2L2MA 3RV1A 2IHR1 4LF8E 4GKJE 4JI4E 4NXME 2EZ6A 4JI2E 2UXCE 1IBLE 1IBKE 3N3WA 4YHHE 2LTSA 4DV0E 5LMNE 1FKAE 2UU9E 4B3TE 4DR4E 2NA2A 1HR0E 5LMUE 4YY3E 4DV2E 3VYXA 1IBME 4X64E 2L2KB 3O2RA 3T1YE 1J5EE 1EKZA 1N33E 2LTRA 2YT4A 5BR8E 2LRSA 1X47A 2UUAE 3C4BA 3ADGA 4DV1E 3VYYA 4JV5E 4GKKE 4OUNA 1FJGE 2DMYA 2B7TA 1N36E 1J26A 2B7VA 1HNZE 4DR2E 2KHXA 4JI0E 4B3ME 4DV4E 1RC7A 4OOGC 4JI7E 3RV0A 1T4OA 3C4TA 1YYOA 2DIXA 2LUQA 1YZ9A 4LFCE 2UXBE 4DR1E 1UHZA 2LBSB 1T4LB 1DI2A 2GSLA 4X66E 4DR5E 5IWAE 2B3TB 2UXDE 2UUBE 4JI6E 1XNRE 4LF9E 4LF4E 4LF6E 4WYQB 4X65E 2LJHA 1RC5A 1X49A 2MDRA 4JI1E 4JI3E 1N32E 2UUCE 5CFFE 2VQFE 1RQ0A 2ZM6E 4X8WA 1HNWE 2NUEA 1X48A 1XNQE 2JVAA 3ADJA 2L2NA 1WHQA 4B3RE 3OTOE 2RS7A 1U61A 1XMQE 4LF5E 3ADLA 2N3HA 4X62E 3P1XA 1WHNA 2E5LE 3O2RB 2L33A 2RSMA 4DUYE 4K0KE 2HHHE 1UILA 4KHPE 4LFAE 4DR3E 2CPNA 1QU6A 3J7Yp 4DV7E 2LUPB 1XMOE 2RS6A 2NUFA 3ADIA 2JY9A 2L3JA 1YYKA 1I94E 4LF7E 1N34E 1O0WA 4DUZE 2EB1A 2QVWA
chains in the Genus database with same CATH superfamily
2E1MA 4JI5E 4M2ZA 3BBGA 3VHTB 4R2EA 4B3SE 2BBGA 4R2QA 2EM5A 4R2CA 2RTXA 5A69A 5FLXC 1UN6B 1JFZA 2JWOA 2YTFA 1ZU1A 4BBYA 4F54A 4F6MA 4DR6E 4LFBE 1KJKA 3IWBA 3M99B 5F3WA 4BHBA 2M9AA 3JAMC 1A1HA 3EPLA 4JI4E 2EM9A 4NXME 2EZ6A 4F2JC 1IBLE 5KL6A 1LLMC 2JP9A 2EOEA 4HTGA 5LMNE 2UU9E 2DLQA 2NA2A 4F9BB 2VRDA 4X64E 3O2RA 1ZAAC 2E72A 2Q8UA 4BHCA 3T1YE 1EKZA 3DJWA 1N33E 2EPRA 2CT1A 2RSIA 1A1LA 5BR8E 2EOSA 2YTQA 1AAYA 3C4BA 3VYYA 3KZYA 2DMYA 3BIDA 1WXRA 2B7VA 2EM2A 4DR2E 1T39A 2DSYA 3ECRA 4R8OA 4M9VC 4JI7E 3RV0A 2EOOA 2EN8A 2EMLA 3C4TA 2GHFA 3ZOQB 3JTZA 1YZ9A 2CTDA 4R03A 2ENHA 2HC5A 5IXMB 4F9AB 4Q28A 4LU9A 4BS9A 3VK6A 4X66E 2EMHA 2R76A 4JI6E 4NZVA 2YWQA 4LF4E 2FGGA 4LF6E 1IQOA 4JI1E 2EMXA 4WXDA 5AC5A 3THOB 2EORA 2EOXA 3MSWA 2LMZA 3J81C 4X8WA 2KOUA 1PDAA 2NUEA 2V86A 2EMKA 3TQMA 1XNQE 2EMWA 1BB8A 3OMLA 1DQ3A 2R1FA 4F6NA 2EJ4A 4TUGA 2EOHA 5A6BD 4X62E 4IS1C 1F2IG 1WHNA 2EPNA 4R2RA 2JOBA 2GLIA 1BBGA 2EPMX 1X6HA 4LFAE 2CPNA 2EMZA 4WSPA 2EOQA 1QU6A 2K7IA 2V85A 2L3JA 3THNA 2JR1A 3AUZA 2EPOA 2EOIA 1A1KA 4ZYGA 1T4NA 4WFTA 4KZSA 2EMYA 4R2SA 4O24A 4MLVA 2EM7A 2YTEA 2F4VE 4NXNE 2EMBA 3C6KA 1IMUA 4DV6E 4OX9E 2L3CA 2EN4A 5A6AA 4DR7E 4JI8E 4GKJE 1PJSA 2D9HA 1WRJA 5AE2A 1SR9A 1IBKE 1X6EA 4L5NC 2LTSA 2EN1A 2JYAA 2YZTA 1FKAE 2EOZA 4YY3E 5AE1A 3EQ1A 1IBME 4ZYDA 3HQ1A 2EP3A 2ADRA 2EPLX 2YTGA 3QG5C 3RMPA 1J5EE 2EL6A 3JU0A 2LTRA 2YT4A 2LRSA 1X47A 1A1FA 3ADGA 2EM6A 5A6JA 2VF1A 1IQSA 4F9CB 1HNZE 3IWDA 2EMFA 4B3ME 1KYQA 1RC7A 4RH8A 2WZOA 2YTJA 1TF3A 4GZNC 1ZR9A 2DIXA 2LUQA 4KWYA 1DGCA 4LFCE 4DR1E 2EN6A 4DMIA 2LBSB 1DI2A 5ADZA 2EWLA 1X6FA 5IWAE 2B3TB 4DR5E 1AH5A 2UUBE 1YPNA 3FIGA 1SFEA 2JPAA 2L6MA 2B9DA 2YRMA 1RC5A 4IJDA 4JI3E 4FK5C 1HNWE 2WBSA 1X48A 5A6KA 2JOXA 1GZ6A 2FV4B 3OTOE 1P47A 2RS7A 1PJQA 2ENAA 3L00A 2M1SA 2N3HA 3O2RB 2RSMA 4Q35B 1UILA 4DR3E 2ODRD 2M7QA 4DV7E 2EQ3A 2RS6A 2NUFA 2MKNA 2EM3A 1JK2A 2EOJA 1N34E 4LF7E 5KL2A 1ZBQA 4DUZE 2A25A 2QVWA 1EH8A 5IT9C 2YTOA 4R2PA 3J7AG 2DRPA 2BB8A 1GQEA 4P7DA 1G2FC 1STUA 4DV5E 2EMIA 4ZYHA 2KONA 2LO3A 3MHHC 2A11A 2EM8A 5T6JA 2WBTA 2EQ0A 1PKPA 4DV3E 2NUGA 2EPUA 2DB2A 2RQLA 4DKKA 5KL7A 1A1JA 1I4SA 3DF6A 1GTKA 3T1HE 4JYAE 3AV0A 3RV1A 2EQ1A 4N4RB 5LLQA 2L92A 2UXCE 2EPXA 4YHHE 4DR4E 1X5WA 2EPZA 2N8XA 1A1IA 1HR0E 3BF2A 2MC5A 1B69A 1QNTA 2L2KB 2F8BA 2I13A 2JXPA 5LL6R 2MDGA 1PJTA 2EN7A 3KZZA 4JV5E 4GKKE 4OUNA 1FJGE 1BBOA 2B7TA 2LT7A 1J26A 2GPIA 4JI0E 2YSPA 2V89A 5KL4A 5AE3A 1EH7A 2EN2A 1T4OA 4BMJA 5KL3A 4WX9A 1YFHA 2YRKA 1A1GA 4J8ZA 4WSGA 2EM0A 1L4SA 2M4IA 4BC7A 2UXBE 3F6HA 2G7HA 2GSLA 4GEQB 4TUIA 1MEYC 2UXDE 4P78A 2ENCA 2WBUA 1XNRE 3K6QA 1T38A 4X65E 2EMCA 1X49A 2MDRA 2YRHA 1N32E 2UUCE 5CFFE 3EPHA 1RQ0A 2WCC3 2EM4A 1NEIA 2NABA 3ADJA 2MKDA 5TSEA 4B3RE 4R2AA 2CSHA 1XMQE 2K4VA 1NCSA 3UK3C 2E5LE 4WXCA 2L33A 1MGTA 3BGHA 4I8OA 4DUYE 2ODRC 4KHPE 2DGCA 2EPCA 4M0VA 1XMOE 2EN3A 5IV8B 1YYKA 1I94E 1ZTDA 3HXLA 1O0WA 1YSAC 1UBDC 2JVAA 2V83A 2LE2A 2EMGA 2EE8A 4BCAA 2YPNA 1HNXE 4O4KA 3LLHA 2LCEA 5A6BA 1ZBTA 2DMIA 2VQEE 3HTXA 2YU5A 2EMAA 1WJPA 1TN9A 2FFLA 4RHBB 4X9JA 2RPCA 3MHSC 3C6MA 2N3GA 1YYWA 4AQYE 1N3GA 2EL4A 4BC9A 1YUJA 4M30A 2L2MA 2IHR1 4LF8E 2EPAA 4JI2E 2LVHA 2I9IA 2YSOA 2YTPA 2YTNA 3H09A 3N3WA 5AC4A 4DV0E 2MC6A 2V87A 4B3TE 2HJJA 5LMUE 2V8QB 4DV2E 1G2DC 3VYXA 2EPPA 4L8NA 1JK1A 2EL5A 2UUAE 4DV1E 4HEIA 3EPJA 2PRTA 1N36E 1RMDA 3LMLA 2KHXA 4O43A 4DV4E 5A2QC 3EPKA 3IWCA 5AASA 4OOGC 1TF6A 2YTDA 1YYOA 4O5GA 2FTXB 2EOFA 1UHZA 3HPSA 2H36X 1T4LB 1YUIA 4WPYA 5KL5A 4NHRA 4LF9E 2L8TA 4WYQB 2LJHA 2LJUA 2DLKA 2EOYA 2VQFE 2ZM6E 3KWRA 4MLQA 2L2NA 2ELZA 2YU8A 1WHQA 1EH6A 1Z1BA 2YTIA 2EOMA 2EPKX 2VE7C 5DNYA 1U61A 4LF5E 3ADLA 3F6GA 3P1XA 4R2DA 4LTYA 3J80C 2ELYA 3HPZA 2V88A 4K0KE 2HHHE 2HGHA 4ZYEA 3J7Yp 2LUPB 3ADIA 2LV2A 2JY9A 1X3CA 2EB1A 2J7JA
chains in the Genus database with same CATH topology
2E1MA 2LE2A 4JI5E 5IT9C 4M2ZA 3J7AG 3AUZA 4BCAA 1HNXE 1GQEA 3LLHA 4B3SE 1ZBTA 4P7DA 2VQEE 3HTXA 1T4NA 4WFTA 4KZSA 2FFLA 1STUA 4DV5E 2RTXA 2KONA 2A11A 2N3GA 1YYWA 2F4VE 5T6JA 4AQYE 4NXNE 1PKPA 4DV3E 2NUGA 4DKKA 2DB2A 5FLXC 4DV6E 1JFZA 2JWOA 4F54A 1I4SA 3DF6A 4BC9A 4BBYA 2L3CA 4OX9E 4DR6E 3T1HE 4JYAE 3IWBA 4DR7E 5F3WA 3AV0A 4JI8E 4LFBE 4M30A 3RV1A 2L2MA 2IHR1 3JAMC 4LF8E 4JI4E 4GKJE 4NXME 2EZ6A 4JI2E 2L92A 1IBLE 5AE2A 2UXCE 1SR9A 3H09A 3N3WA 4YHHE 1IBKE 4L5NC 2LTSA 2YZTA 2MC6A 2V87A 5LMNE 4DV0E 1FKAE 2UU9E 4B3TE 4DR4E 2NA2A 1HR0E 5LMUE 2V8QB 4YY3E 4DV2E 4F9BB 2MC5A 5AE1A 3VYXA 1IBME 3HQ1A 4X64E 2L2KB 3O2RA 2F8BA 3RMPA 3T1YE 1J5EE 1EKZA 5LL6R 4L8NA 3DJWA 1N33E 3JU0A 2LTRA 2YT4A 5BR8E 2LRSA 1X47A 2UUAE 3C4BA 3ADGA 4DV1E 3VYYA 4JV5E 4GKKE 4OUNA 1FJGE 2VF1A 2DMYA 4F9CB 2B7TA 1WXRA 1N36E 1J26A 2B7VA 1HNZE 3LMLA 2KHXA 4DR2E 3IWDA 2DSYA 4JI0E 4B3ME 4DV4E 4R8OA 5A2QC 2V89A 1RC7A 3IWCA 5AASA 5AE3A 4OOGC 4JI7E 2WZOA 3RV0A 1T4OA 4BMJA 3C4TA 3ZOQB 3JTZA 1YYOA 2DIXA 2LUQA 4J8ZA 1YZ9A 4R03A 4LFCE 2M4IA 4BC7A 4K0KE 2FTXB 2UXBE 4DR1E 4DMIA 4F9AB 1UHZA 3HPSA 2H36X 4Q28A 2LBSB 4LU9A 1T4LB 3F6HA 4WPYA 4BS9A 1DI2A 2G7HA 3VK6A 5ADZA 2GSLA 2EWLA 4GEQB 5IWAE 2B3TB 4X66E 4TUIA 4DR5E 4P78A 2UUBE 2UXDE 3FIGA 4JI6E 1XNRE 4LF9E 2L8TA 3K6QA 4LF4E 2FGGA 4LF6E 2L6MA 2B9DA 4WYQB 4X65E 2LJHA 1RC5A 1X49A 2MDRA 4JI1E 4JI3E 3MSWA 1N32E 2UUCE 2LMZA 5CFFE 3J81C 1RQ0A 2ZM6E 4X8WA 2KOUA 2VQFE 1HNWE 2NUEA 1X48A 3KWRA 2V86A 2JOXA 1XNQE 2JVAA 1GZ6A 3ADJA 2L2NA 3OMLA 1DQ3A 1WHQA 2FV4B 4B3RE 3OTOE 2VE7C 2RS7A 5DNYA 4TUGA 1U61A 1XMQE 4LF5E 2M1SA 2K4VA 2N3HA 3ADLA 4X62E 3F6GA 3P1XA 1WHNA 4LTYA 3J80C 2E5LE 3O2RB 2L33A 2JOBA 2RSMA 2V88A 3HPZA 4I8OA 2ODRC 1UILA 4DUYE 2HHHE 4LFAE 4DR3E 2CPNA 4KHPE 2ODRD 4WSPA 2M7QA 1QU6A 4M0VA 3J7Yp 2V85A 4DV7E 2RS6A 2LUPB 2NUFA 1XMOE 3ADIA 2JY9A 2L3JA 1YYKA 1I94E 4LF7E 1N34E 3HXLA 1ZBQA 1O0WA 4DUZE 2EB1A 2QVWA 2V83A 2JR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 E;  4M2Z A;  1HNX E;  1GQE A;  3LLH A;  4B3S E;  1ZBT A;  2VQE E;  3HTX A;  1T4N A;  4WFT A;  2FFL A;  1STU A;  4DV5 E;  2RTX A;  2A11 A;  2N3G A;  1YYW A;  2F4V E;  4AQY E;  4NXN E;  1PKP A;  4DV3 E;  2NUG A;  4DKK A;  2DB2 A;  4DV6 E;  1JFZ A;  4OX9 E;  4DR6 E;  1I4S A;  2L3C A;  4LFB E;  3T1H E;  4JYA E;  4DR7 E;  4JI8 E;  4M30 A;  2L2M A;  3RV1 A;  2IHR 1;  4LF8 E;  4GKJ E;  4JI4 E;  4NXM E;  2EZ6 A;  4JI2 E;  2UXC E;  1IBL E;  1IBK E;  3N3W A;  4YHH E;  2LTS A;  4DV0 E;  5LMN E;  1FKA E;  2UU9 E;  4B3T E;  4DR4 E;  2NA2 A;  1HR0 E;  5LMU E;  4YY3 E;  4DV2 E;  3VYX A;  1IBM E;  4X64 E;  2L2K B;  3O2R A;  3T1Y E;  1J5E E;  1EKZ A;  1N33 E;  2LTR A;  2YT4 A;  5BR8 E;  2LRS A;  1X47 A;  2UUA E;  3C4B A;  3ADG A;  4DV1 E;  3VYY A;  4JV5 E;  4GKK E;  4OUN A;  1FJG E;  2DMY A;  2B7T A;  1N36 E;  1J26 A;  2B7V A;  1HNZ E;  4DR2 E;  2KHX A;  4JI0 E;  4B3M E;  4DV4 E;  1RC7 A;  4OOG C;  4JI7 E;  3RV0 A;  1T4O A;  3C4T A;  1YYO A;  2DIX A;  2LUQ A;  1YZ9 A;  4LFC E;  2UXB E;  4DR1 E;  1UHZ A;  2LBS B;  1T4L B;  1DI2 A;  2GSL A;  4X66 E;  4DR5 E;  5IWA E;  2B3T B;  2UXD E;  2UUB E;  4JI6 E;  1XNR E;  4LF9 E;  4LF4 E;  4LF6 E;  4WYQ B;  4X65 E;  2LJH A;  1RC5 A;  1X49 A;  2MDR A;  4JI1 E;  4JI3 E;  1N32 E;  2UUC E;  5CFF E;  2VQF E;  1RQ0 A;  2ZM6 E;  4X8W A;  1HNW E;  2NUE A;  1X48 A;  1XNQ E;  2JVA A;  3ADJ A;  2L2N A;  1WHQ A;  4B3R E;  3OTO E;  2RS7 A;  1U61 A;  1XMQ E;  4LF5 E;  3ADL A;  2N3H A;  4X62 E;  3P1X A;  1WHN A;  2E5L E;  3O2R B;  2L33 A;  2RSM A;  4DUY E;  4K0K E;  2HHH E;  1UIL A;  4KHP E;  4LFA E;  4DR3 E;  2CPN A;  1QU6 A;  3J7Y p;  4DV7 E;  2LUP B;  1XMO E;  2RS6 A;  2NUF A;  3ADI A;  2JY9 A;  2L3J A;  1YYK A;  1I94 E;  4LF7 E;  1N34 E;  1O0W A;  4DUZ E;  2EB1 A;  2QVW A; 
#chains in the Genus database with same CATH topology
 2E1M A;  4JI5 E;  4M2Z A;  3BBG A;  3VHT B;  4R2E A;  4B3S E;  2BBG A;  4R2Q A;  2EM5 A;  4R2C A;  2RTX A;  5A69 A;  5FLX C;  1UN6 B;  1JFZ A;  2JWO A;  2YTF A;  1ZU1 A;  4BBY A;  4F54 A;  4F6M A;  4DR6 E;  4LFB E;  1KJK A;  3IWB A;  3M99 B;  5F3W A;  4BHB A;  2M9A A;  3JAM C;  1A1H A;  3EPL A;  4JI4 E;  2EM9 A;  4NXM E;  2EZ6 A;  4F2J C;  1IBL E;  5KL6 A;  1LLM C;  2JP9 A;  2EOE A;  4HTG A;  5LMN E;  2UU9 E;  2DLQ A;  2NA2 A;  4F9B B;  2VRD A;  4X64 E;  3O2R A;  1ZAA C;  2E72 A;  2Q8U A;  4BHC A;  3T1Y E;  1EKZ A;  3DJW A;  1N33 E;  2EPR A;  2CT1 A;  2RSI A;  1A1L A;  5BR8 E;  2EOS A;  2YTQ A;  1AAY A;  3C4B A;  3VYY A;  3KZY A;  2DMY A;  3BID A;  1WXR A;  2B7V A;  2EM2 A;  4DR2 E;  1T39 A;  2DSY A;  3ECR A;  4R8O A;  4M9V C;  4JI7 E;  3RV0 A;  2EOO A;  2EN8 A;  2EML A;  3C4T A;  2GHF A;  3ZOQ B;  3JTZ A;  1YZ9 A;  2CTD A;  4R03 A;  2ENH A;  2HC5 A;  5IXM B;  4F9A B;  4Q28 A;  4LU9 A;  4BS9 A;  3VK6 A;  4X66 E;  2EMH A;  2R76 A;  4JI6 E;  4NZV A;  2YWQ A;  4LF4 E;  2FGG A;  4LF6 E;  1IQO A;  4JI1 E;  2EMX A;  4WXD A;  5AC5 A;  3THO B;  2EOR A;  2EOX A;  3MSW A;  2LMZ A;  3J81 C;  4X8W A;  2KOU A;  1PDA A;  2NUE A;  2V86 A;  2EMK A;  3TQM A;  1XNQ E;  2EMW A;  1BB8 A;  3OML A;  1DQ3 A;  2R1F A;  4F6N A;  2EJ4 A;  4TUG A;  2EOH A;  5A6B D;  4X62 E;  4IS1 C;  1F2I G;  1WHN A;  2EPN A;  4R2R A;  2JOB A;  2GLI A;  1BBG A;  2EPM X;  1X6H A;  4LFA E;  2CPN A;  2EMZ A;  4WSP A;  2EOQ A;  1QU6 A;  2K7I A;  2V85 A;  2L3J A;  3THN A;  2JR1 A;  3AUZ A;  2EPO A;  2EOI A;  1A1K A;  4ZYG A;  1T4N A;  4WFT A;  4KZS A;  2EMY A;  4R2S A;  4O24 A;  4MLV A;  2EM7 A;  2YTE A;  2F4V E;  4NXN E;  2EMB A;  3C6K A;  1IMU A;  4DV6 E;  4OX9 E;  2L3C A;  2EN4 A;  5A6A A;  4DR7 E;  4JI8 E;  4GKJ E;  1PJS A;  2D9H A;  1WRJ A;  5AE2 A;  1SR9 A;  1IBK E;  1X6E A;  4L5N C;  2LTS A;  2EN1 A;  2JYA A;  2YZT A;  1FKA E;  2EOZ A;  4YY3 E;  5AE1 A;  3EQ1 A;  1IBM E;  4ZYD A;  3HQ1 A;  2EP3 A;  2ADR A;  2EPL X;  2YTG A;  3QG5 C;  3RMP A;  1J5E E;  2EL6 A;  3JU0 A;  2LTR A;  2YT4 A;  2LRS A;  1X47 A;  1A1F A;  3ADG A;  2EM6 A;  5A6J A;  2VF1 A;  1IQS A;  4F9C B;  1HNZ E;  3IWD A;  2EMF A;  4B3M E;  1KYQ A;  1RC7 A;  4RH8 A;  2WZO A;  2YTJ A;  1TF3 A;  4GZN C;  1ZR9 A;  2DIX A;  2LUQ A;  4KWY A;  1DGC A;  4LFC E;  4DR1 E;  2EN6 A;  4DMI A;  2LBS B;  1DI2 A;  5ADZ A;  2EWL A;  1X6F A;  5IWA E;  2B3T B;  4DR5 E;  1AH5 A;  2UUB E;  1YPN A;  3FIG A;  1SFE A;  2JPA A;  2L6M A;  2B9D A;  2YRM A;  1RC5 A;  4IJD A;  4JI3 E;  4FK5 C;  1HNW E;  2WBS A;  1X48 A;  5A6K A;  2JOX A;  1GZ6 A;  2FV4 B;  3OTO E;  1P47 A;  2RS7 A;  1PJQ A;  2ENA A;  3L00 A;  2M1S A;  2N3H A;  3O2R B;  2RSM A;  4Q35 B;  1UIL A;  4DR3 E;  2ODR D;  2M7Q A;  4DV7 E;  2EQ3 A;  2RS6 A;  2NUF A;  2MKN A;  2EM3 A;  1JK2 A;  2EOJ A;  1N34 E;  4LF7 E;  5KL2 A;  1ZBQ A;  4DUZ E;  2A25 A;  2QVW A;  1EH8 A;  5IT9 C;  2YTO A;  4R2P A;  3J7A G;  2DRP A;  2BB8 A;  1GQE A;  4P7D A;  1G2F C;  1STU A;  4DV5 E;  2EMI A;  4ZYH A;  2KON A;  2LO3 A;  3MHH C;  2A11 A;  2EM8 A;  5T6J A;  2WBT A;  2EQ0 A;  1PKP A;  4DV3 E;  2NUG A;  2EPU A;  2DB2 A;  2RQL A;  4DKK A;  5KL7 A;  1A1J A;  1I4S A;  3DF6 A;  1GTK A;  3T1H E;  4JYA E;  3AV0 A;  3RV1 A;  2EQ1 A;  4N4R B;  5LLQ A;  2L92 A;  2UXC E;  2EPX A;  4YHH E;  4DR4 E;  1X5W A;  2EPZ A;  2N8X A;  1A1I A;  1HR0 E;  3BF2 A;  2MC5 A;  1B69 A;  1QNT A;  2L2K B;  2F8B A;  2I13 A;  2JXP A;  5LL6 R;  2MDG A;  1PJT A;  2EN7 A;  3KZZ A;  4JV5 E;  4GKK E;  4OUN A;  1FJG E;  1BBO A;  2B7T A;  2LT7 A;  1J26 A;  2GPI A;  4JI0 E;  2YSP A;  2V89 A;  5KL4 A;  5AE3 A;  1EH7 A;  2EN2 A;  1T4O A;  4BMJ A;  5KL3 A;  4WX9 A;  1YFH A;  2YRK A;  1A1G A;  4J8Z A;  4WSG A;  2EM0 A;  1L4S A;  2M4I A;  4BC7 A;  2UXB E;  3F6H A;  2G7H A;  2GSL A;  4GEQ B;  4TUI A;  1MEY C;  2UXD E;  4P78 A;  2ENC A;  2WBU A;  1XNR E;  3K6Q A;  1T38 A;  4X65 E;  2EMC A;  1X49 A;  2MDR A;  2YRH A;  1N32 E;  2UUC E;  5CFF E;  3EPH A;  1RQ0 A;  2WCC 3;  2EM4 A;  1NEI A;  2NAB A;  3ADJ A;  2MKD A;  5TSE A;  4B3R E;  4R2A A;  2CSH A;  1XMQ E;  2K4V A;  1NCS A;  3UK3 C;  2E5L E;  4WXC A;  2L33 A;  1MGT A;  3BGH A;  4I8O A;  4DUY E;  2ODR C;  4KHP E;  2DGC A;  2EPC A;  4M0V A;  1XMO E;  2EN3 A;  5IV8 B;  1YYK A;  1I94 E;  1ZTD A;  3HXL A;  1O0W A;  1YSA C;  1UBD C;  2JVA A;  2V83 A;  2LE2 A;  2EMG A;  2EE8 A;  4BCA A;  2YPN A;  1HNX E;  4O4K A;  3LLH A;  2LCE A;  5A6B A;  1ZBT A;  2DMI A;  2VQE E;  3HTX A;  2YU5 A;  2EMA A;  1WJP A;  1TN9 A;  2FFL A;  4RHB B;  4X9J A;  2RPC A;  3MHS C;  3C6M A;  2N3G A;  1YYW A;  4AQY E;  1N3G A;  2EL4 A;  4BC9 A;  1YUJ A;  4M30 A;  2L2M A;  2IHR 1;  4LF8 E;  2EPA A;  4JI2 E;  2LVH A;  2I9I A;  2YSO A;  2YTP A;  2YTN A;  3H09 A;  3N3W A;  5AC4 A;  4DV0 E;  2MC6 A;  2V87 A;  4B3T E;  2HJJ A;  5LMU E;  2V8Q B;  4DV2 E;  1G2D C;  3VYX A;  2EPP A;  4L8N A;  1JK1 A;  2EL5 A;  2UUA E;  4DV1 E;  4HEI A;  3EPJ A;  2PRT A;  1N36 E;  1RMD A;  3LML A;  2KHX A;  4O43 A;  4DV4 E;  5A2Q C;  3EPK A;  3IWC A;  5AAS A;  4OOG C;  1TF6 A;  2YTD A;  1YYO A;  4O5G A;  2FTX B;  2EOF A;  1UHZ A;  3HPS A;  2H36 X;  1T4L B;  1YUI A;  4WPY A;  5KL5 A;  4NHR A;  4LF9 E;  2L8T A;  4WYQ B;  2LJH A;  2LJU A;  2DLK A;  2EOY A;  2VQF E;  2ZM6 E;  3KWR A;  4MLQ A;  2L2N A;  2ELZ A;  2YU8 A;  1WHQ A;  1EH6 A;  1Z1B A;  2YTI A;  2EOM A;  2EPK X;  2VE7 C;  5DNY A;  1U61 A;  4LF5 E;  3ADL A;  3F6G A;  3P1X A;  4R2D A;  4LTY A;  3J80 C;  2ELY A;  3HPZ A;  2V88 A;  4K0K E;  2HHH E;  2HGH A;  4ZYE A;  3J7Y p;  2LUP B;  3ADI A;  2LV2 A;  2JY9 A;  1X3C A;  2EB1 A;  2J7J A; 
#chains in the Genus database with same CATH homology
 2E1M A;  2LE2 A;  4JI5 E;  5IT9 C;  4M2Z A;  3J7A G;  3AUZ A;  4BCA A;  1HNX E;  1GQE A;  3LLH A;  4B3S E;  1ZBT A;  4P7D A;  2VQE E;  3HTX A;  1T4N A;  4WFT A;  4KZS A;  2FFL A;  1STU A;  4DV5 E;  2RTX A;  2KON A;  2A11 A;  2N3G A;  1YYW A;  2F4V E;  5T6J A;  4AQY E;  4NXN E;  1PKP A;  4DV3 E;  2NUG A;  4DKK A;  2DB2 A;  5FLX C;  4DV6 E;  1JFZ A;  2JWO A;  4F54 A;  1I4S A;  3DF6 A;  4BC9 A;  4BBY A;  2L3C A;  4OX9 E;  4DR6 E;  3T1H E;  4JYA E;  3IWB A;  4DR7 E;  5F3W A;  3AV0 A;  4JI8 E;  4LFB E;  4M30 A;  3RV1 A;  2L2M A;  2IHR 1;  3JAM C;  4LF8 E;  4JI4 E;  4GKJ E;  4NXM E;  2EZ6 A;  4JI2 E;  2L92 A;  1IBL E;  5AE2 A;  2UXC E;  1SR9 A;  3H09 A;  3N3W A;  4YHH E;  1IBK E;  4L5N C;  2LTS A;  2YZT A;  2MC6 A;  2V87 A;  5LMN E;  4DV0 E;  1FKA E;  2UU9 E;  4B3T E;  4DR4 E;  2NA2 A;  1HR0 E;  5LMU E;  2V8Q B;  4YY3 E;  4DV2 E;  4F9B B;  2MC5 A;  5AE1 A;  3VYX A;  1IBM E;  3HQ1 A;  4X64 E;  2L2K B;  3O2R A;  2F8B A;  3RMP A;  3T1Y E;  1J5E E;  1EKZ A;  5LL6 R;  4L8N A;  3DJW A;  1N33 E;  3JU0 A;  2LTR A;  2YT4 A;  5BR8 E;  2LRS A;  1X47 A;  2UUA E;  3C4B A;  3ADG A;  4DV1 E;  3VYY A;  4JV5 E;  4GKK E;  4OUN A;  1FJG E;  2VF1 A;  2DMY A;  4F9C B;  2B7T A;  1WXR A;  1N36 E;  1J26 A;  2B7V A;  1HNZ E;  3LML A;  2KHX A;  4DR2 E;  3IWD A;  2DSY A;  4JI0 E;  4B3M E;  4DV4 E;  4R8O A;  5A2Q C;  2V89 A;  1RC7 A;  3IWC A;  5AAS A;  5AE3 A;  4OOG C;  4JI7 E;  2WZO A;  3RV0 A;  1T4O A;  4BMJ A;  3C4T A;  3ZOQ B;  3JTZ A;  1YYO A;  2DIX A;  2LUQ A;  4J8Z A;  1YZ9 A;  4R03 A;  4LFC E;  2M4I A;  4BC7 A;  4K0K E;  2FTX B;  2UXB E;  4DR1 E;  4DMI A;  4F9A B;  1UHZ A;  3HPS A;  2H36 X;  4Q28 A;  2LBS B;  4LU9 A;  1T4L B;  3F6H A;  4WPY A;  4BS9 A;  1DI2 A;  2G7H A;  3VK6 A;  5ADZ A;  2GSL A;  2EWL A;  4GEQ B;  5IWA E;  2B3T B;  4X66 E;  4TUI A;  4DR5 E;  4P78 A;  2UUB E;  2UXD E;  3FIG A;  4JI6 E;  1XNR E;  4LF9 E;  2L8T A;  3K6Q A;  4LF4 E;  2FGG A;  4LF6 E;  2L6M A;  2B9D A;  4WYQ B;  4X65 E;  2LJH A;  1RC5 A;  1X49 A;  2MDR A;  4JI1 E;  4JI3 E;  3MSW A;  1N32 E;  2UUC E;  2LMZ A;  5CFF E;  3J81 C;  1RQ0 A;  2ZM6 E;  4X8W A;  2KOU A;  2VQF E;  1HNW E;  2NUE A;  1X48 A;  3KWR A;  2V86 A;  2JOX A;  1XNQ E;  2JVA A;  1GZ6 A;  3ADJ A;  2L2N A;  3OML A;  1DQ3 A;  1WHQ A;  2FV4 B;  4B3R E;  3OTO E;  2VE7 C;  2RS7 A;  5DNY A;  4TUG A;  1U61 A;  1XMQ E;  4LF5 E;  2M1S A;  2K4V A;  2N3H A;  3ADL A;  4X62 E;  3F6G A;  3P1X A;  1WHN A;  4LTY A;  3J80 C;  2E5L E;  3O2R B;  2L33 A;  2JOB A;  2RSM A;  2V88 A;  3HPZ A;  4I8O A;  2ODR C;  1UIL A;  4DUY E;  2HHH E;  4LFA E;  4DR3 E;  2CPN A;  4KHP E;  2ODR D;  4WSP A;  2M7Q A;  1QU6 A;  4M0V A;  3J7Y p;  2V85 A;  4DV7 E;  2RS6 A;  2LUP B;  2NUF A;  1XMO E;  3ADI A;  2JY9 A;  2L3J A;  1YYK A;  1I94 E;  4LF7 E;  1N34 E;  3HXL A;  1ZBQ A;  1O0W A;  4DUZ E;  2EB1 A;  2QVW A;  2V83 A;  2JR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...