4OOGC

Crystal structure of yeast rnase iii (rnt1p) complexed with the product of dsrna processing
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
261
structure length
261
Chain Sequence
KWPPKLPEIQDLAIRARVFIHKSTIKDKVYLSGSEMINAHNERLEFLGDSILNSVMTLIIYNKFPDYSEGQLSTLRMNLVSNEQIKQWSIMYNFHEKLKTNFDLKDENSNFQNGKLKLYADVFEAYIGGLMEDDPRNNLPKIRKWLRKLAKPVIEEATRNQVALEKTDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSESVLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Ribonuclease 3
publication title Structure of a Eukaryotic RNase III Postcleavage Complex Reveals a Double-Ruler Mechanism for Substrate Selection.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 79
structure length 261
sequence length 261
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2014-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00035 dsrm Double-stranded RNA binding motif
C PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 4oogC01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4oogC02
4JI3E 2B7VA 1YYKA 4JYAE 3C4BA 4YY3E 2QVWA 2CPNA 1WHQA 4X66E 4GKKE 2DB2A 2L33A 4JV5E 2B3TB 4JI2E 2RS7A 1HNZE 2DMYA 4DV4E 4JI0E 4LF8E 4K0KE 2YT4A 1X48A 2UUCE 1N33E 3HTXA 4X8WA 2LTRA 2EZ6A 2F4VE 1N36E 4NXME 2A11A 2E5LE 4DUZE 2N3GA 3P1XA 4DR6E 4LF5E 2NUFA 3T1YE 2GSLA 2NA2A 1STUA 3J7Yp 1RC5A 3OTOE 1JFZA 2MDRA 1J26A 2RSMA 4JI7E 2IHR1 1IBLE 2UUAE 1YYWA 4JI4E 1UILA 3VYYA 2L3CA 4X64E 1X49A 2FFLA 3ADGA 4DV6E 1IBME 4GKJE 4LFBE 2UXBE 4OUNA 4DR2E 4JI6E 4KHPE 4DV0E 4LF4E 3O2RB 4JI8E 1XMQE 1FKAE 2LJHA 5LMNE 1WHNA 1XMOE 4DV2E 4DV1E 1N32E 2HHHE 4WFTA 4OOGC 4DUYE 4DV7E 2RS6A 1U61A 1QU6A 2UXCE 2L2NA 3RV0A 2RTXA 1DI2A 1XNRE 3ADIA 1O0WA 4DV3E 2LTSA 4B3ME 4WYQB 4LF7E 4LFAE 4OX9E 2ZM6E 1ZBTA 4JI5E 3RV1A 4LFCE 2N3HA 2L2KB 5BR8E 2UUBE 4B3TE 4DR4E 4LF9E 2DIXA 4LF6E 4AQYE 1J5EE 1HNWE 2LUPB 2UU9E 4X65E 4DV5E 1T4NA 4DKKA 2B7TA 1GQEA 4M30A 4DR5E 1PKPA 1HR0E 3O2RA 1X47A 2L2MA 3VYXA 4B3SE 5IWAE 1I4SA 2NUGA 4JI1E 2VQEE 3LLHA 2NUEA 2LUQA 4YHHE 5LMUE 2UXDE 5CFFE 4DR3E 1YYOA 2JVAA 1EKZA 1IBKE 3C4TA 2LRSA 2KHXA 1N34E 4NXNE 2EB1A 4M2ZA 1UHZA 1YZ9A 4X62E 1HNXE 2VQFE 1T4OA 4B3RE 4DR7E 2JY9A 1XNQE 3ADLA 2L3JA 4DR1E 3N3WA 1RC7A 3T1HE 2LBSB 1T4LB 1I94E 1FJGE 1RQ0A 3ADJA
chains in the Genus database with same CATH superfamily
2B7VA 3KZZA 2QVWA 2N8XA 4GKKE 5AE3A 3MSWA 4JI0E 4BHBA 2YWQA 2YT4A 2UUCE 1N33E 2K4VA 2WCC3 1L4SA 3ZOQB 2LTRA 4RHBB 3J81C 3EPLA 3AUZA 4HEIA 4LF5E 3T1YE 2LJUA 2GSLA 1STUA 3J7Yp 1A1HA 1JFZA 2EL6A 1IBLE 2IHR1 1YYWA 2WZOA 1UILA 1NEIA 2L3CA 5AE2A 2EM5A 2EOMA 2YTGA 2DSYA 2ELYA 4GKJE 1EH6A 2EM0A 4JI6E 1A1JA 2EWLA 5LMNE 2EPNA 1WHNA 1XMOE 2DMIA 1BBGA 2YPNA 4WFTA 4GEQB 5A6AA 2EQ0A 5KL7A 4Q35B 1U61A 3JTZA 3IWBA 1QU6A 2ENAA 2L2NA 1X6FA 3J7AG 3BGHA 2V87A 2YSPA 4ZYDA 3IWDA 1O0WA 2V8QB 4R03A 4O24A 4WYQB 2LV2A 3HQ1A 2L8TA 2UUBE 1HNWE 4LF6E 4X9JA 2E1MA 1T4NA 3HPZA 4R2RA 2B7TA 4M30A 4BBYA 1PKPA 5AE1A 2I9IA 1PJTA 3VYXA 2D9HA 4P78A 1I4SA 2HC5A 4M9VC 2YSOA 1G2FC 2Q8UA 1GTKA 2NUEA 2LUQA 2WBSA 2UXDE 2ELZA 5CFFE 2B9DA 1EKZA 2LRSA 1IQSA 2JPAA 2JOBA 2EOSA 2FTXB 2I13A 4NHRA 2EB1A 4F9AB 1A1FA 1YZ9A 2EMWA 2E72A 4B3RE 2JY9A 2V86A 3IWCA 2V88A 1BBOA 4LU9A 2EMFA 1T4LB 4WSGA 3ADJA 3RMPA 2YTQA 4BMJA 5IXMB 4TUGA 2R1FA 2EMXA 3C4BA 1WHQA 4X66E 4JV5E 2DB2A 1AH5A 2EOXA 2L33A 1MEYC 4JI2E 3H09A 4HTGA 1HNZE 1KJKA 3OMLA 4TUIA 5KL5A 5AC5A 3HTXA 2ADRA 4GZNC 3ECRA 2MKNA 5A6BA 2EZ6A 2EMZA 2YTEA 2F4VE 5TSEA 1ZAAC 2EP3A 5DNYA 4DR6E 2YTJA 3L00A 5T6JA 4FK5C 2EM8A 1RC5A 5IV8B 2JOXA 1J26A 2A25A 3J80C 2UUAE 1X3CA 4R2DA 4X64E 1X49A 1ZU1A 2F8BA 1G2DC 4LFBE 2UXBE 4WX9A 4DMIA 4KHPE 3AV0A 2EOFA 2LJHA 3EQ1A 3C6MA 2EPPA 4OOGC 2CSHA 4DUYE 1A1GA 2EE8A 2UXCE 2GLIA 2EMYA 1Z1BA 4P7DA 2WBUA 2RTXA 3VHTB 4IS1C 5KL4A 2ZM6E 4JI5E 3RV1A 4LFCE 2M9AA 4WSPA 2YRMA 5BR8E 4B3TE 4DR4E 2EPKX 4L8NA 2DIXA 4AQYE 3EPHA 2UU9E 2YTDA 2M7QA 4DR5E 1ZTDA 3BF2A 2YRHA 1SR9A 4N4RB 1X47A 2PRTA 4M0VA 2EMBA 5FLXC 2EMGA 1EH8A 2NUGA 2BBGA 2VRDA 4MLVA 3LLHA 3THNA 2JVAA 2ODRD 1IBKE 2DGCA 2EPXA 2EMKA 2YU8A 2RQLA 1YPNA 4X62E 5A6JA 1F2IG 4L5NC 2EM2A 3F6GA 2HGHA 2LMZA 2L3JA 2EOZA 2EOYA 4O43A 3T1HE 1RC7A 2LBSB 1PDAA 2YTPA 2EPAA 3JAMC 2EN3A 1ZR9A 4JI3E 1YYKA 4JYAE 1X6EA 4IJDA 4YY3E 2CPNA 2EPMX 4BHCA 2EN6A 2RS7A 4R2EA 4DV4E 1QNTA 2EQ3A 4K0KE 2EPRA 2MDGA 3C6KA 1X48A 2EPLX 2EPCA 1X6HA 1T39A 1N36E 1DQ3A 2A11A 4R2SA 3TQMA 3EPJA 4DUZE 2N3GA 3P1XA 3HPSA 5LLQA 2YZTA 2ENHA 1GZ6A 2L6MA 2JP9A 3UK3C 4Q28A 4F9BB 2EM6A 2EPOA 2KONA 4JI7E 4I8OA 1YSAC 1ZBQA 2FV4B 1IBME 2G7HA 4DR2E 4DV0E 4JI8E 1XMQE 2EOJA 4DV2E 4DV1E 1N32E 2HHHE 4BCAA 2H36X 2EMAA 5A6KA 2RS6A 2VF1A 2EORA 5A69A 2EMCA 3RV0A 1TF6A 1WRJA 4KZSA 4R8OA 3HXLA 1DI2A 4NZVA 3ADIA 4DV3E 2L92A 2LE2A 2EN2A 4LTYA 2L2KB 2V83A 2EM7A 2ENCA 2CT1A 5LL6R 2LUPB 2YTOA 1EH7A 4X65E 1A1IA 4DKKA 2EN8A 1GQEA 1IMUA 5ADZA 1YUIA 2EMIA 1HR0E 3O2RA 3MHHC 5IT9C 2V85A 2L2MA 2DLKA 4B3SE 1TN9A 5IWAE 1PJSA 1YUJA 2EN7A 2EL4A 1KYQA 2ODRC 3QG5C 4YHHE 5LMUE 4O5GA 4BS9A 1YYOA 5KL2A 4DR3E 2M4IA 2JYAA 3THOB 2KHXA 2EM9A 3F6HA 2YTFA 2WBTA 2EJ4A 2FGGA 2EMLA 1N3GA 3MHSC 3LMLA 1P47A 4DR7E 2JR1A 1XNQE 2VE7C 1NCSA 4MLQA 3N3WA 2EQ1A 3JU0A 2V89A 1TF3A 2EOEA 2GHFA 2DLQA 2YU5A 2R76A 4R2AA 1WXRA 2YRKA 2B3TB 2JXPA 4F6NA 4R2CA 2MKDA 2DMYA 4LF8E 2EOOA 5A6BD 1DGCA 1X5WA 4KWYA 1BB8A 2K7IA 5KL6A 4X8WA 3BBGA 5KL3A 4WPYA 3DF6A 2EPZA 2RSIA 4WXCA 2E5LE 4NXME 3DJWA 2M1SA 2RPCA 2NUFA 2NA2A 2MC6A 2EN1A 3OTOE 1B69A 2MDRA 1AAYA 2LVHA 2RSMA 1YFHA 4JI4E 3VYYA 2FFLA 3ADGA 4F9CB 4DV6E 2EN4A 1A1KA 4OUNA 2EL5A 2CTDA 4F2JC 4LF4E 3O2RB 4ZYHA 3VK6A 1FKAE 1A1LA 2LT7A 2GPIA 4DV7E 1RMDA 1LLMC 1IQOA 4F54A 1PJQA 5AASA 1XNRE 2LO3A 4RH8A 2LTSA 4B3ME 4LF7E 4LFAE 4OX9E 2EM4A 1UBDC 1ZBTA 3KZYA 4ZYGA 2MC5A 2HJJA 2N3HA 3BIDA 4J8ZA 4R2PA 1WJPA 2BB8A 4WXDA 4F6MA 2DRPA 4LF9E 2EM3A 2JWOA 1J5EE 4DV5E 3FIGA 2YTNA 5F3WA 3K6QA 4R2QA 1T38A 2EPUA 2EOHA 2EMHA 4JI1E 2VQEE 1JK1A 1SFEA 2NABA 3KWRA 1JK2A 3C4TA 2EOQA 1N34E 4NXNE 5A2QC 2LCEA 1UN6B 4BC7A 1UHZA 4M2ZA 4BC9A 1HNXE 5AC4A 2VQFE 1T4OA 4ZYEA 2KOUA 1MGTA 2YTIA 3ADLA 4O4KA 2J7JA 2EOIA 4DR1E 1I94E 3M99B 1FJGE 3EPKA 1RQ0A
chains in the Genus database with same CATH topology
4JI3E 2B7VA 1YYKA 4JYAE 3C4BA 1WXRA 4YY3E 2QVWA 2CPNA 1WHQA 4X66E 4GKKE 2DB2A 2L33A 4JV5E 2B3TB 5AE3A 4JI2E 3MSWA 2RS7A 3H09A 2DMYA 1HNZE 4DV4E 4JI0E 4LF8E 3OMLA 4K0KE 4TUIA 4TUGA 2YT4A 1X48A 2UUCE 1N33E 2K4VA 4X8WA 3HTXA 3ZOQB 2LTRA 2EZ6A 4WPYA 3DF6A 2F4VE 3J81C 1N36E 1DQ3A 4NXME 2A11A 2E5LE 3DJWA 4DUZE 3AUZA 2N3GA 3P1XA 5DNYA 2M1SA 3HPSA 4LF5E 5T6JA 4DR6E 2YZTA 1GZ6A 2NUFA 2L6MA 2GSLA 1STUA 2MC6A 2NA2A 1RC5A 4Q28A 4F9BB 1JFZA 2JOXA 2MDRA 3J7Yp 1J26A 2RSMA 3J80C 2KONA 4JI7E 2IHR1 1IBLE 2UUAE 1YYWA 4JI4E 2WZOA 4I8OA 1UILA 3VYYA 1ZBQA 2L3CA 5AE2A 2FV4B 4X64E 1X49A 2FFLA 3ADGA 4F9CB 3OTOE 2DSYA 4DV6E 1IBME 2F8BA 4GKJE 4LFBE 2UXBE 4OUNA 2G7HA 4DMIA 4DR2E 4JI6E 4KHPE 3AV0A 4DV0E 2EWLA 4LF4E 3O2RB 4JI8E 1XMQE 3VK6A 2LJHA 5LMNE 1FKAE 1WHNA 1XMOE 4DV2E 4DV1E 1N32E 2HHHE 4WFTA 4OOGC 2H36X 4GEQB 4BCAA 4DUYE 3T1YE 4DV7E 2RS6A 1U61A 3JTZA 3IWBA 2VF1A 1QU6A 2UXCE 2L2NA 3RV0A 4F54A 4R8OA 4KZSA 4P7DA 5AASA 2RTXA 3HXLA 3J7AG 1XNRE 1DI2A 2V87A 3ADIA 3IWDA 1O0WA 4DV3E 2LTSA 2V8QB 4R03A 4WYQB 2L92A 4B3ME 4LF7E 4LFAE 2ZM6E 1ZBTA 2LE2A 4JI5E 4OX9E 3RV1A 4LFCE 2MC5A 4J8ZA 2N3HA 3HQ1A 2L8TA 4LTYA 4WSPA 2L2KB 5BR8E 2V83A 2UUBE 4B3TE 4DR4E 4LF9E 4L8NA 2DIXA 4LF6E 4AQYE 2JWOA 5LL6R 1J5EE 1HNWE 2LUPB 2UU9E 2E1MA 4X65E 4DV5E 1T4NA 3FIGA 3HPZA 2M7QA 2B7TA 1GQEA 3K6QA 4DKKA 5F3WA 5ADZA 4M30A 4BBYA 4DR5E 1PKPA 1HR0E 3O2RA 1SR9A 5AE1A 5IT9C 2V85A 1X47A 2L2MA 3VYXA 4M0VA 4B3SE 5IWAE 4P78A 1I4SA 5FLXC 2NUGA 4JI1E 2VQEE 3LLHA 2NUEA 2LUQA 4YHHE 2ODRC 5LMUE 2UXDE 5CFFE 4DR3E 4BS9A 1YYOA 2B9DA 2JVAA 3KWRA 1EKZA 2ODRD 2M4IA 1IBKE 3C4TA 2LRSA 2JOBA 2KHXA 1N34E 4NXNE 2FTXB 5A2QC 3F6HA 4BC7A 2EB1A 4M2ZA 1UHZA 4BC9A 4F9AB 1YZ9A 4X62E 1HNXE 2FGGA 2VQFE 1T4OA 4B3RE 4DR7E 3LMLA 4L5NC 2JR1A 2KOUA 2JY9A 2V86A 3IWCA 3F6GA 1XNQE 2LMZA 3ADLA 2L3JA 2V88A 2VE7C 4LU9A 3N3WA 1RC7A 4DR1E 3T1HE 2LBSB 3JU0A 1T4LB 1I94E 1FJGE 1RQ0A 2V89A 3ADJA 3JAMC 3RMPA 4BMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 E;  2B7V A;  1YYK A;  4JYA E;  3C4B A;  4YY3 E;  2QVW A;  2CPN A;  1WHQ A;  4X66 E;  4GKK E;  2DB2 A;  2L33 A;  4JV5 E;  2B3T B;  4JI2 E;  2RS7 A;  1HNZ E;  2DMY A;  4DV4 E;  4JI0 E;  4LF8 E;  4K0K E;  2YT4 A;  1X48 A;  2UUC E;  1N33 E;  3HTX A;  4X8W A;  2LTR A;  2EZ6 A;  2F4V E;  1N36 E;  4NXM E;  2A11 A;  2E5L E;  4DUZ E;  2N3G A;  3P1X A;  4DR6 E;  4LF5 E;  2NUF A;  3T1Y E;  2GSL A;  2NA2 A;  1STU A;  3J7Y p;  1RC5 A;  3OTO E;  1JFZ A;  2MDR A;  1J26 A;  2RSM A;  4JI7 E;  2IHR 1;  1IBL E;  2UUA E;  1YYW A;  4JI4 E;  1UIL A;  3VYY A;  2L3C A;  4X64 E;  1X49 A;  2FFL A;  3ADG A;  4DV6 E;  1IBM E;  4GKJ E;  4LFB E;  2UXB E;  4OUN A;  4DR2 E;  4JI6 E;  4KHP E;  4DV0 E;  4LF4 E;  3O2R B;  4JI8 E;  1XMQ E;  1FKA E;  2LJH A;  5LMN E;  1WHN A;  1XMO E;  4DV2 E;  4DV1 E;  1N32 E;  2HHH E;  4WFT A;  4OOG C;  4DUY E;  4DV7 E;  2RS6 A;  1U61 A;  1QU6 A;  2UXC E;  2L2N A;  3RV0 A;  2RTX A;  1DI2 A;  1XNR E;  3ADI A;  1O0W A;  4DV3 E;  2LTS A;  4B3M E;  4WYQ B;  4LF7 E;  4LFA E;  4OX9 E;  2ZM6 E;  1ZBT A;  4JI5 E;  3RV1 A;  4LFC E;  2N3H A;  2L2K B;  5BR8 E;  2UUB E;  4B3T E;  4DR4 E;  4LF9 E;  2DIX A;  4LF6 E;  4AQY E;  1J5E E;  1HNW E;  2LUP B;  2UU9 E;  4X65 E;  4DV5 E;  1T4N A;  4DKK A;  2B7T A;  1GQE A;  4M30 A;  4DR5 E;  1PKP A;  1HR0 E;  3O2R A;  1X47 A;  2L2M A;  3VYX A;  4B3S E;  5IWA E;  1I4S A;  2NUG A;  4JI1 E;  2VQE E;  3LLH A;  2NUE A;  2LUQ A;  4YHH E;  5LMU E;  2UXD E;  5CFF E;  4DR3 E;  1YYO A;  2JVA A;  1EKZ A;  1IBK E;  3C4T A;  2LRS A;  2KHX A;  1N34 E;  4NXN E;  2EB1 A;  4M2Z A;  1UHZ A;  1YZ9 A;  4X62 E;  1HNX E;  2VQF E;  1T4O A;  4B3R E;  4DR7 E;  2JY9 A;  1XNQ E;  3ADL A;  2L3J A;  4DR1 E;  3N3W A;  1RC7 A;  3T1H E;  2LBS B;  1T4L B;  1I94 E;  1FJG E;  1RQ0 A;  3ADJ A; 
#chains in the Genus database with same CATH topology
 2B7V A;  3KZZ A;  2QVW A;  2N8X A;  4GKK E;  5AE3 A;  3MSW A;  4JI0 E;  4BHB A;  2YWQ A;  2YT4 A;  2UUC E;  1N33 E;  2K4V A;  2WCC 3;  1L4S A;  3ZOQ B;  2LTR A;  4RHB B;  3J81 C;  3EPL A;  3AUZ A;  4HEI A;  4LF5 E;  3T1Y E;  2LJU A;  2GSL A;  1STU A;  3J7Y p;  1A1H A;  1JFZ A;  2EL6 A;  1IBL E;  2IHR 1;  1YYW A;  2WZO A;  1UIL A;  1NEI A;  2L3C A;  5AE2 A;  2EM5 A;  2EOM A;  2YTG A;  2DSY A;  2ELY A;  4GKJ E;  1EH6 A;  2EM0 A;  4JI6 E;  1A1J A;  2EWL A;  5LMN E;  2EPN A;  1WHN A;  1XMO E;  2DMI A;  1BBG A;  2YPN A;  4WFT A;  4GEQ B;  5A6A A;  2EQ0 A;  5KL7 A;  4Q35 B;  1U61 A;  3JTZ A;  3IWB A;  1QU6 A;  2ENA A;  2L2N A;  1X6F A;  3J7A G;  3BGH A;  2V87 A;  2YSP A;  4ZYD A;  3IWD A;  1O0W A;  2V8Q B;  4R03 A;  4O24 A;  4WYQ B;  2LV2 A;  3HQ1 A;  2L8T A;  2UUB E;  1HNW E;  4LF6 E;  4X9J A;  2E1M A;  1T4N A;  3HPZ A;  4R2R A;  2B7T A;  4M30 A;  4BBY A;  1PKP A;  5AE1 A;  2I9I A;  1PJT A;  3VYX A;  2D9H A;  4P78 A;  1I4S A;  2HC5 A;  4M9V C;  2YSO A;  1G2F C;  2Q8U A;  1GTK A;  2NUE A;  2LUQ A;  2WBS A;  2UXD E;  2ELZ A;  5CFF E;  2B9D A;  1EKZ A;  2LRS A;  1IQS A;  2JPA A;  2JOB A;  2EOS A;  2FTX B;  2I13 A;  4NHR A;  2EB1 A;  4F9A B;  1A1F A;  1YZ9 A;  2EMW A;  2E72 A;  4B3R E;  2JY9 A;  2V86 A;  3IWC A;  2V88 A;  1BBO A;  4LU9 A;  2EMF A;  1T4L B;  4WSG A;  3ADJ A;  3RMP A;  2YTQ A;  4BMJ A;  5IXM B;  4TUG A;  2R1F A;  2EMX A;  3C4B A;  1WHQ A;  4X66 E;  4JV5 E;  2DB2 A;  1AH5 A;  2EOX A;  2L33 A;  1MEY C;  4JI2 E;  3H09 A;  4HTG A;  1HNZ E;  1KJK A;  3OML A;  4TUI A;  5KL5 A;  5AC5 A;  3HTX A;  2ADR A;  4GZN C;  3ECR A;  2MKN A;  5A6B A;  2EZ6 A;  2EMZ A;  2YTE A;  2F4V E;  5TSE A;  1ZAA C;  2EP3 A;  5DNY A;  4DR6 E;  2YTJ A;  3L00 A;  5T6J A;  4FK5 C;  2EM8 A;  1RC5 A;  5IV8 B;  2JOX A;  1J26 A;  2A25 A;  3J80 C;  2UUA E;  1X3C A;  4R2D A;  4X64 E;  1X49 A;  1ZU1 A;  2F8B A;  1G2D C;  4LFB E;  2UXB E;  4WX9 A;  4DMI A;  4KHP E;  3AV0 A;  2EOF A;  2LJH A;  3EQ1 A;  3C6M A;  2EPP A;  4OOG C;  2CSH A;  4DUY E;  1A1G A;  2EE8 A;  2UXC E;  2GLI A;  2EMY A;  1Z1B A;  4P7D A;  2WBU A;  2RTX A;  3VHT B;  4IS1 C;  5KL4 A;  2ZM6 E;  4JI5 E;  3RV1 A;  4LFC E;  2M9A A;  4WSP A;  2YRM A;  5BR8 E;  4B3T E;  4DR4 E;  2EPK X;  4L8N A;  2DIX A;  4AQY E;  3EPH A;  2UU9 E;  2YTD A;  2M7Q A;  4DR5 E;  1ZTD A;  3BF2 A;  2YRH A;  1SR9 A;  4N4R B;  1X47 A;  2PRT A;  4M0V A;  2EMB A;  5FLX C;  2EMG A;  1EH8 A;  2NUG A;  2BBG A;  2VRD A;  4MLV A;  3LLH A;  3THN A;  2JVA A;  2ODR D;  1IBK E;  2DGC A;  2EPX A;  2EMK A;  2YU8 A;  2RQL A;  1YPN A;  4X62 E;  5A6J A;  1F2I G;  4L5N C;  2EM2 A;  3F6G A;  2HGH A;  2LMZ A;  2L3J A;  2EOZ A;  2EOY A;  4O43 A;  3T1H E;  1RC7 A;  2LBS B;  1PDA A;  2YTP A;  2EPA A;  3JAM C;  2EN3 A;  1ZR9 A;  4JI3 E;  1YYK A;  4JYA E;  1X6E A;  4IJD A;  4YY3 E;  2CPN A;  2EPM X;  4BHC A;  2EN6 A;  2RS7 A;  4R2E A;  4DV4 E;  1QNT A;  2EQ3 A;  4K0K E;  2EPR A;  2MDG A;  3C6K A;  1X48 A;  2EPL X;  2EPC A;  1X6H A;  1T39 A;  1N36 E;  1DQ3 A;  2A11 A;  4R2S A;  3TQM A;  3EPJ A;  4DUZ E;  2N3G A;  3P1X A;  3HPS A;  5LLQ A;  2YZT A;  2ENH A;  1GZ6 A;  2L6M A;  2JP9 A;  3UK3 C;  4Q28 A;  4F9B B;  2EM6 A;  2EPO A;  2KON A;  4JI7 E;  4I8O A;  1YSA C;  1ZBQ A;  2FV4 B;  1IBM E;  2G7H A;  4DR2 E;  4DV0 E;  4JI8 E;  1XMQ E;  2EOJ A;  4DV2 E;  4DV1 E;  1N32 E;  2HHH E;  4BCA A;  2H36 X;  2EMA A;  5A6K A;  2RS6 A;  2VF1 A;  2EOR A;  5A69 A;  2EMC A;  3RV0 A;  1TF6 A;  1WRJ A;  4KZS A;  4R8O A;  3HXL A;  1DI2 A;  4NZV A;  3ADI A;  4DV3 E;  2L92 A;  2LE2 A;  2EN2 A;  4LTY A;  2L2K B;  2V83 A;  2EM7 A;  2ENC A;  2CT1 A;  5LL6 R;  2LUP B;  2YTO A;  1EH7 A;  4X65 E;  1A1I A;  4DKK A;  2EN8 A;  1GQE A;  1IMU A;  5ADZ A;  1YUI A;  2EMI A;  1HR0 E;  3O2R A;  3MHH C;  5IT9 C;  2V85 A;  2L2M A;  2DLK A;  4B3S E;  1TN9 A;  5IWA E;  1PJS A;  1YUJ A;  2EN7 A;  2EL4 A;  1KYQ A;  2ODR C;  3QG5 C;  4YHH E;  5LMU E;  4O5G A;  4BS9 A;  1YYO A;  5KL2 A;  4DR3 E;  2M4I A;  2JYA A;  3THO B;  2KHX A;  2EM9 A;  3F6H A;  2YTF A;  2WBT A;  2EJ4 A;  2FGG A;  2EML A;  1N3G A;  3MHS C;  3LML A;  1P47 A;  4DR7 E;  2JR1 A;  1XNQ E;  2VE7 C;  1NCS A;  4MLQ A;  3N3W A;  2EQ1 A;  3JU0 A;  2V89 A;  1TF3 A;  2EOE A;  2GHF A;  2DLQ A;  2YU5 A;  2R76 A;  4R2A A;  1WXR A;  2YRK A;  2B3T B;  2JXP A;  4F6N A;  4R2C A;  2MKD A;  2DMY A;  4LF8 E;  2EOO A;  5A6B D;  1DGC A;  1X5W A;  4KWY A;  1BB8 A;  2K7I A;  5KL6 A;  4X8W A;  3BBG A;  5KL3 A;  4WPY A;  3DF6 A;  2EPZ A;  2RSI A;  4WXC A;  2E5L E;  4NXM E;  3DJW A;  2M1S A;  2RPC A;  2NUF A;  2NA2 A;  2MC6 A;  2EN1 A;  3OTO E;  1B69 A;  2MDR A;  1AAY A;  2LVH A;  2RSM A;  1YFH A;  4JI4 E;  3VYY A;  2FFL A;  3ADG A;  4F9C B;  4DV6 E;  2EN4 A;  1A1K A;  4OUN A;  2EL5 A;  2CTD A;  4F2J C;  4LF4 E;  3O2R B;  4ZYH A;  3VK6 A;  1FKA E;  1A1L A;  2LT7 A;  2GPI A;  4DV7 E;  1RMD A;  1LLM C;  1IQO A;  4F54 A;  1PJQ A;  5AAS A;  1XNR E;  2LO3 A;  4RH8 A;  2LTS A;  4B3M E;  4LF7 E;  4LFA E;  4OX9 E;  2EM4 A;  1UBD C;  1ZBT A;  3KZY A;  4ZYG A;  2MC5 A;  2HJJ A;  2N3H A;  3BID A;  4J8Z A;  4R2P A;  1WJP A;  2BB8 A;  4WXD A;  4F6M A;  2DRP A;  4LF9 E;  2EM3 A;  2JWO A;  1J5E E;  4DV5 E;  3FIG A;  2YTN A;  5F3W A;  3K6Q A;  4R2Q A;  1T38 A;  2EPU A;  2EOH A;  2EMH A;  4JI1 E;  2VQE E;  1JK1 A;  1SFE A;  2NAB A;  3KWR A;  1JK2 A;  3C4T A;  2EOQ A;  1N34 E;  4NXN E;  5A2Q C;  2LCE A;  1UN6 B;  4BC7 A;  1UHZ A;  4M2Z A;  4BC9 A;  1HNX E;  5AC4 A;  2VQF E;  1T4O A;  4ZYE A;  2KOU A;  1MGT A;  2YTI A;  3ADL A;  4O4K A;  2J7J A;  2EOI A;  4DR1 E;  1I94 E;  3M99 B;  1FJG E;  3EPK A;  1RQ0 A; 
#chains in the Genus database with same CATH homology
 4JI3 E;  2B7V A;  1YYK A;  4JYA E;  3C4B A;  1WXR A;  4YY3 E;  2QVW A;  2CPN A;  1WHQ A;  4X66 E;  4GKK E;  2DB2 A;  2L33 A;  4JV5 E;  2B3T B;  5AE3 A;  4JI2 E;  3MSW A;  2RS7 A;  3H09 A;  2DMY A;  1HNZ E;  4DV4 E;  4JI0 E;  4LF8 E;  3OML A;  4K0K E;  4TUI A;  4TUG A;  2YT4 A;  1X48 A;  2UUC E;  1N33 E;  2K4V A;  4X8W A;  3HTX A;  3ZOQ B;  2LTR A;  2EZ6 A;  4WPY A;  3DF6 A;  2F4V E;  3J81 C;  1N36 E;  1DQ3 A;  4NXM E;  2A11 A;  2E5L E;  3DJW A;  4DUZ E;  3AUZ A;  2N3G A;  3P1X A;  5DNY A;  2M1S A;  3HPS A;  4LF5 E;  5T6J A;  4DR6 E;  2YZT A;  1GZ6 A;  2NUF A;  2L6M A;  2GSL A;  1STU A;  2MC6 A;  2NA2 A;  1RC5 A;  4Q28 A;  4F9B B;  1JFZ A;  2JOX A;  2MDR A;  3J7Y p;  1J26 A;  2RSM A;  3J80 C;  2KON A;  4JI7 E;  2IHR 1;  1IBL E;  2UUA E;  1YYW A;  4JI4 E;  2WZO A;  4I8O A;  1UIL A;  3VYY A;  1ZBQ A;  2L3C A;  5AE2 A;  2FV4 B;  4X64 E;  1X49 A;  2FFL A;  3ADG A;  4F9C B;  3OTO E;  2DSY A;  4DV6 E;  1IBM E;  2F8B A;  4GKJ E;  4LFB E;  2UXB E;  4OUN A;  2G7H A;  4DMI A;  4DR2 E;  4JI6 E;  4KHP E;  3AV0 A;  4DV0 E;  2EWL A;  4LF4 E;  3O2R B;  4JI8 E;  1XMQ E;  3VK6 A;  2LJH A;  5LMN E;  1FKA E;  1WHN A;  1XMO E;  4DV2 E;  4DV1 E;  1N32 E;  2HHH E;  4WFT A;  4OOG C;  2H36 X;  4GEQ B;  4BCA A;  4DUY E;  3T1Y E;  4DV7 E;  2RS6 A;  1U61 A;  3JTZ A;  3IWB A;  2VF1 A;  1QU6 A;  2UXC E;  2L2N A;  3RV0 A;  4F54 A;  4R8O A;  4KZS A;  4P7D A;  5AAS A;  2RTX A;  3HXL A;  3J7A G;  1XNR E;  1DI2 A;  2V87 A;  3ADI A;  3IWD A;  1O0W A;  4DV3 E;  2LTS A;  2V8Q B;  4R03 A;  4WYQ B;  2L92 A;  4B3M E;  4LF7 E;  4LFA E;  2ZM6 E;  1ZBT A;  2LE2 A;  4JI5 E;  4OX9 E;  3RV1 A;  4LFC E;  2MC5 A;  4J8Z A;  2N3H A;  3HQ1 A;  2L8T A;  4LTY A;  4WSP A;  2L2K B;  5BR8 E;  2V83 A;  2UUB E;  4B3T E;  4DR4 E;  4LF9 E;  4L8N A;  2DIX A;  4LF6 E;  4AQY E;  2JWO A;  5LL6 R;  1J5E E;  1HNW E;  2LUP B;  2UU9 E;  2E1M A;  4X65 E;  4DV5 E;  1T4N A;  3FIG A;  3HPZ A;  2M7Q A;  2B7T A;  1GQE A;  3K6Q A;  4DKK A;  5F3W A;  5ADZ A;  4M30 A;  4BBY A;  4DR5 E;  1PKP A;  1HR0 E;  3O2R A;  1SR9 A;  5AE1 A;  5IT9 C;  2V85 A;  1X47 A;  2L2M A;  3VYX A;  4M0V A;  4B3S E;  5IWA E;  4P78 A;  1I4S A;  5FLX C;  2NUG A;  4JI1 E;  2VQE E;  3LLH A;  2NUE A;  2LUQ A;  4YHH E;  2ODR C;  5LMU E;  2UXD E;  5CFF E;  4DR3 E;  4BS9 A;  1YYO A;  2B9D A;  2JVA A;  3KWR A;  1EKZ A;  2ODR D;  2M4I A;  1IBK E;  3C4T A;  2LRS A;  2JOB A;  2KHX A;  1N34 E;  4NXN E;  2FTX B;  5A2Q C;  3F6H A;  4BC7 A;  2EB1 A;  4M2Z A;  1UHZ A;  4BC9 A;  4F9A B;  1YZ9 A;  4X62 E;  1HNX E;  2FGG A;  2VQF E;  1T4O A;  4B3R E;  4DR7 E;  3LML A;  4L5N C;  2JR1 A;  2KOU A;  2JY9 A;  2V86 A;  3IWC A;  3F6G A;  1XNQ E;  2LMZ A;  3ADL A;  2L3J A;  2V88 A;  2VE7 C;  4LU9 A;  3N3W A;  1RC7 A;  4DR1 E;  3T1H E;  2LBS B;  3JU0 A;  1T4L B;  1I94 E;  1FJG E;  1RQ0 A;  2V89 A;  3ADJ A;  3JAM C;  3RMP A;  4BMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...