4OOGC

Crystal structure of yeast rnase iii (rnt1p) complexed with the product of dsrna processing
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
261
structure length
261
Chain Sequence
KWPPKLPEIQDLAIRARVFIHKSTIKDKVYLSGSEMINAHNERLEFLGDSILNSVMTLIIYNKFPDYSEGQLSTLRMNLVSNEQIKQWSIMYNFHEKLKTNFDLKDENSNFQNGKLKLYADVFEAYIGGLMEDDPRNNLPKIRKWLRKLAKPVIEEATRNQVALEKTDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSESVLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease 3
publication title Structure of a Eukaryotic RNase III Postcleavage Complex Reveals a Double-Ruler Mechanism for Substrate Selection.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 79
structure length 261
sequence length 261
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2014-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00035 dsrm Double-stranded RNA binding motif
C PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 4oogC01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4oogC02
4JV5E 2YT4A 4OOGC 4DV0E 1T4LB 1N34E 1N36E 4JI5E 3VYXA 2CPNA 3J7Yp 4DV3E 4DR5E 1IBLE 2LJHA 4DV5E 4JI3E 1IBME 2B3TB 2L3CA 4LFAE 4DR2E 1XMOE 1GQEA 3HTXA 1WHQA 1RC5A 2VQFE 3N3WA 2L33A 3RV1A 1I94E 4LF9E 2JVAA 1YZ9A 4KHPE 4LFBE 2LRSA 3ADLA 3T1YE 4DV4E 4X65E 1JFZA 4OX9E 2DB2A 4X62E 2N3GA 2L2MA 2RSMA 3OTOE 4LF6E 4NXME 1J26A 2L2NA 4X66E 4YY3E 4WYQB 4JI8E 2UXDE 4X64E 2E5LE 2VQEE 2RS7A 1DI2A 4DR3E 1UILA 1O0WA 1IBKE 2DMYA 1T4NA 2QVWA 4AQYE 1T4OA 1STUA 3RV0A 4GKJE 3T1HE 2RS6A 2GSLA 2MDRA 3P1XA 2IHR1 2NA2A 3ADJA 1ZBTA 1U61A 1XNQE 4LF4E 1X48A 2DIXA 4DUZE 2NUGA 3ADGA 1YYWA 1YYKA 1HNWE 2L3JA 4B3TE 2EZ6A 1X47A 4DR1E 2NUEA 2UXBE 4DR6E 5IWAE 4GKKE 2A11A 1RC7A 1HNXE 2UUCE 5BR8E 2NUFA 4JI7E 1UHZA 4LFCE 4DV1E 1FJGE 1HR0E 4JI1E 4DV7E 4X8WA 4JI0E 1EKZA 4JI4E 1J5EE 4DUYE 4DR7E 4DR4E 4DKKA 2LBSB 4DV2E 4M2ZA 2LUPB 2EB1A 3ADIA 1RQ0A 2B7VA 1I4SA 4DV6E 2L2KB 2F4VE 4NXNE 3C4TA 4B3ME 3O2RB 5CFFE 2UU9E 4LF8E 2LUQA 2HHHE 2B7TA 4JYAE 2UXCE 2KHXA 3C4BA 4M30A 1FKAE 2JY9A 2RTXA 4LF5E 5LMUE 1WHNA 4JI6E 1HNZE 2UUBE 4B3RE 2FFLA 5LMNE 1XNRE 4WFTA 1N33E 4OUNA 4YHHE 1N32E 1X49A 4LF7E 4K0KE 2ZM6E 1XMQE 2UUAE 3O2RA 2LTRA 3LLHA 3VYYA 4B3SE 4JI2E 2LTSA 2N3HA 1YYOA 1PKPA 1QU6A
chains in the Genus database with same CATH superfamily
2JP9A 1N34E 4BC9A 1N36E 1AAYA 1IBLE 1PJTA 2LJHA 2M9AA 4JI3E 4DMIA 2EMZA 1GTKA 2I9IA 4BBYA 2EM7A 4LFAE 1YFHA 1XMOE 1GQEA 1MGTA 1UN6B 1WHQA 1RC5A 3EPLA 2VQFE 1KJKA 1ZU1A 1EH6A 2V8QB 2JVAA 1YZ9A 2EN1A 2LRSA 2EM2A 4X65E 2EPOA 4DV4E 2EN8A 2EOXA 2N3GA 2L2MA 2RSMA 2DGCA 5KL3A 4WYQB 2UXDE 4HEIA 2LO3A 2EL6A 4DR3E 2EMGA 1O0WA 1DGCA 4P78A 4ZYHA 1T4NA 2QVWA 1T4OA 2EPLX 4WXDA 2D9HA 3T1HE 4R03A 2MC6A 3P1XA 2IHR1 1RMDA 2EM4A 1U61A 3UK3C 1PDAA 2LJUA 1X48A 3ADGA 4BC7A 5LL6R 2VRDA 2EPNA 1EH7A 5AE3A 5IXMB 2YTIA 4DV1E 1HR0E 1J5EE 2ODRC 4DKKA 3C6MA 2LBSB 4M2ZA 2EB1A 2V87A 4NZVA 1RQ0A 2F4VE 3C4TA 4BCAA 4R8OA 3O2RB 5CFFE 2UU9E 4LF8E 2LUQA 4WPYA 1EH8A 3BF2A 4JYAE 2RSIA 1TF3A 3VHTB 3QG5C 5F3WA 2V86A 3AV0A 2JY9A 4LF5E 2EM3A 3MHHC 2MDGA 2EM6A 3J80C 2LMZA 1WHNA 5AASA 2GHFA 4JI6E 2M4IA 2YTGA 1HNZE 4B3RE 3ZOQB 2YRMA 2FFLA 1TN9A 1XNRE 1N32E 1GZ6A 1WRJA 2EJ4A 2EM0A 2MKNA 2R1FA 3THNA 1KYQA 2EMYA 2ZM6E 1XMQE 5IT9C 1A1LA 4O5GA 1Z1BA 3LLHA 5AE1A 4B3SE 2EM5A 1YYOA 2ELYA 2I13A 3F6GA 2VE7C 4R2EA 5ADZA 4DV0E 1T4LB 4JI5E 3VYXA 2CPNA 2NABA 4GEQB 4J8ZA 1IBME 2FV4B 2L3CA 4WX9A 3HTXA 2EQ0A 3N3WA 2L33A 4LF9E 2EQ1A 2EOYA 2YTDA 3EQ1A 3EPKA 4KHPE 4R2RA 3T1YE 3ADLA 1JFZA 2EOSA 4X62E 2YZTA 4NXME 2L2NA 1BB8A 4JI8E 2JPAA 2EOEA 2YPNA 1SR9A 2V85A 3JU0A 1IBKE 2WBSA 2DLQA 4AQYE 5A6KA 2EE8A 4R2QA 1STUA 5KL6A 5KL7A 2EMWA 1A1KA 1N3GA 2BBGA 4F9AB 4TUGA 1ZR9A 2MDRA 3JAMC 2EPZA 1AH5A 3ADJA 1ZBTA 3H09A 2EOIA 3RMPA 3VK6A 2L92A 2V88A 1XNQE 4Q28A 4LF4E 2NUGA 3OMLA 1A1GA 1YYKA 2EZ6A 4DR1E 4BS9A 4DR6E 2EPKX 2HC5A 2E72A 2EM9A 2DMIA 3TQMA 2UUCE 5BR8E 4LFCE 2EOZA 2ENHA 4JI1E 4JI4E 4DUYE 4DR7E 2V89A 2EN2A 1YUIA 2YTPA 4R2CA 2YTFA 1ZTDA 3LMLA 5A6BA 2B7VA 1I4SA 4L8NA 2L2KB 5A69A 4NXNE 2CTDA 2YWQA 1X5WA 2B7TA 2K7IA 3ECRA 2WBTA 4O4KA 2WCC3 2A25A 2UXCE 4M30A 2M7QA 2YSPA 2VF1A 3L00A 2DLKA 3KZYA 1X6FA 1YPNA 2EMAA 2YU8A 4F9BB 4F9CB 1BBOA 4RH8A 5LMNE 4WFTA 1N33E 4YHHE 2WBUA 4LF7E 2LVHA 4K0KE 2EMIA 2UUAE 3EPHA 3BIDA 5LLQA 3VYYA 4MLVA 2EPRA 1YSAC 2EN6A 2Q8UA 4DV6E 2CT1A 2EPUA 4LU9A 4BHCA 2KONA 2YT4A 2RQLA 2WZOA 4DV3E 4DV5E 2EMKA 2FGGA 1X6HA 1NCSA 2B3TB 3AUZA 3JTZA 5DNYA 4DR2E 2DRPA 1I94E 2EOOA 4F6NA 3DJWA 2EWLA 4IS1C 1DQ3A 4R2AA 2LT7A 4LFBE 4OX9E 2DB2A 2JWOA 2L6MA 2V83A 1J26A 3BBGA 5IV8B 1F2IG 4X64E 2VQEE 1QNTA 5KL5A 2RPCA 2RS7A 2YTQA 2L8TA 2DMYA 4N4RB 4WXCA 3RV0A 4GKJE 3IWCA 4P7DA 4F6MA 3DF6A 2RS6A 2GSLA 2LE2A 2EMBA 2NA2A 5A2QC 4HTGA 4DUZE 2DIXA 2BB8A 2YTNA 2K4VA 3J81C 1HNWE 2DSYA 2L3JA 4NHRA 4B3TE 5A6BD 2EOHA 1TF6A 2YTOA 2FTXB 4KWYA 5T6JA 2EN3A 1RC7A 2CSHA 4ZYGA 4F54A 2HGHA 1FJGE 4DV7E 4X8WA 4JI0E 1EKZA 5AE2A 2ADRA 4DR4E 4RHBB 1WXRA 2HJJA 2LUPB 4BMJA 2YTEA 1IQSA 4GZNC 2JR1A 4R2DA 1A1JA 2MC5A 4FK5C 4WSPA 4R2SA 4B3ME 2EORA 2JOXA 2HHHE 4M9VC 2EPCA 2EMXA 1PJQA 3C4BA 2KHXA 1X3CA 4I8OA 3IWBA 2RTXA 4ZYEA 2EOMA 2EQ3A 2ELZA 2KOUA 2EN7A 2LCEA 1NEIA 2YU5A 3HXLA 1A1HA 3O2RA 4IJDA 4O43A 5FLXC 4JI2E 3C6KA 5A6JA 2LTSA 2N3HA 2ENAA 4F2JC 3HPSA 2JYAA 4LTYA 4L5NC 1T38A 4JV5E 4OOGC 2EN4A 2N8XA 4X9JA 3J7Yp 4DR5E 2EOJA 2MKDA 5AC5A 2EP3A 1IMUA 2JOBA 3THOB 3RV1A 2YRKA 3KZZA 2YRHA 2F8BA 3OTOE 1YUJA 4LF6E 4X66E 2EPPA 4YY3E 2E5LE 3EPJA 2EMLA 2EMCA 1DI2A 1UILA 3J7AG 2J7JA 2H36X 2EL4A 2E1MA 1A1IA 1G2FC 1G2DC 1A1FA 1ZBQA 1WJPA 2YSOA 3HPZA 1YYWA 3BGHA 1X47A 4TUIA 2NUEA 2UXBE 2JXPA 5IWAE 4Q35B 5KL2A 4GKKE 2A11A 1HNXE 3F6HA 4ZYDA 2EPAA 2NUFA 1BBGA 1UHZA 5TSEA 4JI7E 5A6AA 1PJSA 2EMFA 1ZAAC 4DV2E 3M99B 3ADIA 2EL5A 2ENCA 3MSWA 3FIGA 2PRTA 3IWDA 2EPXA 2GLIA 3MHSC 1JK1A 1T39A 2EOQA 2EMHA 3HQ1A 1FKAE 2M1SA 4KZSA 1UBDC 1B69A 5LMUE 2GPIA 4O24A 1IQOA 2G7HA 3KWRA 2EPMX 2YTJA 1MEYC 1SFEA 1L4SA 1X6EA 2ODRD 4M0VA 2B9DA 2UUBE 4BHBA 2R76A 4MLQA 2EM8A 4OUNA 2LV2A 4WSGA 1X49A 1JK2A 5AC4A 2EOFA 2LTRA 5KL4A 3K6QA 4R2PA 1LLMC 1PKPA 1QU6A 1P47A
chains in the Genus database with same CATH topology
4L5NC 4JV5E 2KONA 2VE7C 4OOGC 2YT4A 3F6GA 4BC9A 5ADZA 4DV0E 2WZOA 2CPNA 3J7Yp 4DV3E 4DR5E 1N36E 2LJHA 4DV5E 2FGGA 1IBLE 4JI3E 4DMIA 4GEQB 4J8ZA 1IBME 2B3TB 2FV4B 3AUZA 3JTZA 4BBYA 5DNYA 2L3CA 4LFAE 4DR2E 1XMOE 1GQEA 3HTXA 1WHQA 1RC5A 2VQFE 3N3WA 2JOBA 2L33A 3RV1A 1I94E 2V8QB 4LF9E 2JVAA 1YZ9A 3DJWA 2EWLA 1DQ3A 4KHPE 4LFBE 2LRSA 3ADLA 3T1YE 4DV4E 4X65E 1JFZA 4OX9E 2DB2A 2JWOA 2N3GA 2YZTA 4X62E 2L2MA 2F8BA 2RSMA 3OTOE 2L6MA 4LF6E 4NXME 2V83A 1J26A 2L2NA 4X66E 4YY3E 4WYQB 4JI8E 2UXDE 4X64E 2E5LE 2VQEE 2RS7A 1DI2A 1SR9A 4DR3E 1UILA 2V85A 3JU0A 1O0WA 3J7AG 2L8TA 2DMYA 4P78A 1IBKE 1T4NA 2QVWA 4AQYE 1T4OA 3HPSA 1STUA 3RV0A 2H36X 4GKJE 3IWCA 3T1HE 4F9AB 4P7DA 3DF6A 2RS6A 2GSLA 2MDRA 4TUGA 2LE2A 2MC6A 3P1XA 4R03A 2IHR1 3JAMC 2NA2A 3ADJA 2E1MA 1ZBTA 5A2QC 1U61A 3H09A 3RMPA 3VK6A 2L92A 2V88A 1XNQE 4Q28A 1X48A 2DIXA 4DUZE 2NUGA 1ZBQA 3ADGA 3OMLA 4LF4E 3HPZA 1YYWA 2K4VA 1YYKA 5LL6R 2DSYA 4BC7A 3J81C 2L3JA 4B3TE 1HNWE 2EZ6A 1X47A 4BS9A 2NUEA 4TUIA 4DR1E 4DR6E 2UXBE 5IWAE 4JI5E 2FTXB 5T6JA 4GKKE 2A11A 1RC7A 1HNXE 3F6HA 5AE3A 2UUCE 5BR8E 2NUFA 4JI7E 1UHZA 4F54A 4DV1E 4LFCE 1FJGE 1HR0E 4JI1E 4DV7E 4X8WA 1N34E 1EKZA 4JI0E 1J5EE 5AE2A 4DUYE 4JI4E 4DR7E 2ODRC 2V89A 4DR4E 4DKKA 1WXRA 4DV2E 2LBSB 4M2ZA 2LUPB 4BMJA 2EB1A 3ADIA 3LMLA 2V87A 3MSWA 2JR1A 1RQ0A 2B7VA 1I4SA 4L8NA 2L2KB 4DV6E 2MC5A 3FIGA 3C4TA 3IWDA 4R8OA 4BCAA 4WSPA 4NXNE 4B3ME 2F4VE 3O2RB 5CFFE 2UU9E 4LF8E 2JOXA 2LUQA 2HHHE 2B7TA 4WPYA 4JYAE 3VYXA 2UXCE 2KHXA 3C4BA 4M30A 3HQ1A 5F3WA 2M7QA 2V86A 1FKAE 3AV0A 2M1SA 4I8OA 2JY9A 3IWBA 2VF1A 4KZSA 2RTXA 4LF5E 5LMUE 3J80C 2LMZA 1WHNA 2G7HA 5AASA 3KWRA 4JI6E 2M4IA 1HNZE 2KOUA 4F9BB 2ODRD 4M0VA 2B9DA 3ZOQB 4F9CB 1T4LB 2UUBE 4B3RE 2FFLA 5LMNE 1XNRE 4WFTA 1N33E 4OUNA 4YHHE 1N32E 1GZ6A 3HXLA 1X49A 4LF7E 4K0KE 2ZM6E 1XMQE 5IT9C 2UUAE 3O2RA 2LTRA 3LLHA 5FLXC 3K6QA 5AE1A 3VYYA 4B3SE 4JI2E 2LTSA 2N3HA 1YYOA 1PKPA 1QU6A 4LTYA 4LU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 E;  2YT4 A;  4OOG C;  4DV0 E;  1T4L B;  1N34 E;  1N36 E;  4JI5 E;  3VYX A;  2CPN A;  3J7Y p;  4DV3 E;  4DR5 E;  1IBL E;  2LJH A;  4DV5 E;  4JI3 E;  1IBM E;  2B3T B;  2L3C A;  4LFA E;  4DR2 E;  1XMO E;  1GQE A;  3HTX A;  1WHQ A;  1RC5 A;  2VQF E;  3N3W A;  2L33 A;  3RV1 A;  1I94 E;  4LF9 E;  2JVA A;  1YZ9 A;  4KHP E;  4LFB E;  2LRS A;  3ADL A;  3T1Y E;  4DV4 E;  4X65 E;  1JFZ A;  4OX9 E;  2DB2 A;  4X62 E;  2N3G A;  2L2M A;  2RSM A;  3OTO E;  4LF6 E;  4NXM E;  1J26 A;  2L2N A;  4X66 E;  4YY3 E;  4WYQ B;  4JI8 E;  2UXD E;  4X64 E;  2E5L E;  2VQE E;  2RS7 A;  1DI2 A;  4DR3 E;  1UIL A;  1O0W A;  1IBK E;  2DMY A;  1T4N A;  2QVW A;  4AQY E;  1T4O A;  1STU A;  3RV0 A;  4GKJ E;  3T1H E;  2RS6 A;  2GSL A;  2MDR A;  3P1X A;  2IHR 1;  2NA2 A;  3ADJ A;  1ZBT A;  1U61 A;  1XNQ E;  4LF4 E;  1X48 A;  2DIX A;  4DUZ E;  2NUG A;  3ADG A;  1YYW A;  1YYK A;  1HNW E;  2L3J A;  4B3T E;  2EZ6 A;  1X47 A;  4DR1 E;  2NUE A;  2UXB E;  4DR6 E;  5IWA E;  4GKK E;  2A11 A;  1RC7 A;  1HNX E;  2UUC E;  5BR8 E;  2NUF A;  4JI7 E;  1UHZ A;  4LFC E;  4DV1 E;  1FJG E;  1HR0 E;  4JI1 E;  4DV7 E;  4X8W A;  4JI0 E;  1EKZ A;  4JI4 E;  1J5E E;  4DUY E;  4DR7 E;  4DR4 E;  4DKK A;  2LBS B;  4DV2 E;  4M2Z A;  2LUP B;  2EB1 A;  3ADI A;  1RQ0 A;  2B7V A;  1I4S A;  4DV6 E;  2L2K B;  2F4V E;  4NXN E;  3C4T A;  4B3M E;  3O2R B;  5CFF E;  2UU9 E;  4LF8 E;  2LUQ A;  2HHH E;  2B7T A;  4JYA E;  2UXC E;  2KHX A;  3C4B A;  4M30 A;  1FKA E;  2JY9 A;  2RTX A;  4LF5 E;  5LMU E;  1WHN A;  4JI6 E;  1HNZ E;  2UUB E;  4B3R E;  2FFL A;  5LMN E;  1XNR E;  4WFT A;  1N33 E;  4OUN A;  4YHH E;  1N32 E;  1X49 A;  4LF7 E;  4K0K E;  2ZM6 E;  1XMQ E;  2UUA E;  3O2R A;  2LTR A;  3LLH A;  3VYY A;  4B3S E;  4JI2 E;  2LTS A;  2N3H A;  1YYO A;  1PKP A;  1QU6 A; 
#chains in the Genus database with same CATH topology
 2JP9 A;  1N34 E;  4BC9 A;  1N36 E;  1AAY A;  1IBL E;  1PJT A;  2LJH A;  2M9A A;  4JI3 E;  4DMI A;  2EMZ A;  1GTK A;  2I9I A;  4BBY A;  2EM7 A;  4LFA E;  1YFH A;  1XMO E;  1GQE A;  1MGT A;  1UN6 B;  1WHQ A;  1RC5 A;  3EPL A;  2VQF E;  1KJK A;  1ZU1 A;  1EH6 A;  2V8Q B;  2JVA A;  1YZ9 A;  2EN1 A;  2LRS A;  2EM2 A;  4X65 E;  2EPO A;  4DV4 E;  2EN8 A;  2EOX A;  2N3G A;  2L2M A;  2RSM A;  2DGC A;  5KL3 A;  4WYQ B;  2UXD E;  4HEI A;  2LO3 A;  2EL6 A;  4DR3 E;  2EMG A;  1O0W A;  1DGC A;  4P78 A;  4ZYH A;  1T4N A;  2QVW A;  1T4O A;  2EPL X;  4WXD A;  2D9H A;  3T1H E;  4R03 A;  2MC6 A;  3P1X A;  2IHR 1;  1RMD A;  2EM4 A;  1U61 A;  3UK3 C;  1PDA A;  2LJU A;  1X48 A;  3ADG A;  4BC7 A;  5LL6 R;  2VRD A;  2EPN A;  1EH7 A;  5AE3 A;  5IXM B;  2YTI A;  4DV1 E;  1HR0 E;  1J5E E;  2ODR C;  4DKK A;  3C6M A;  2LBS B;  4M2Z A;  2EB1 A;  2V87 A;  4NZV A;  1RQ0 A;  2F4V E;  3C4T A;  4BCA A;  4R8O A;  3O2R B;  5CFF E;  2UU9 E;  4LF8 E;  2LUQ A;  4WPY A;  1EH8 A;  3BF2 A;  4JYA E;  2RSI A;  1TF3 A;  3VHT B;  3QG5 C;  5F3W A;  2V86 A;  3AV0 A;  2JY9 A;  4LF5 E;  2EM3 A;  3MHH C;  2MDG A;  2EM6 A;  3J80 C;  2LMZ A;  1WHN A;  5AAS A;  2GHF A;  4JI6 E;  2M4I A;  2YTG A;  1HNZ E;  4B3R E;  3ZOQ B;  2YRM A;  2FFL A;  1TN9 A;  1XNR E;  1N32 E;  1GZ6 A;  1WRJ A;  2EJ4 A;  2EM0 A;  2MKN A;  2R1F A;  3THN A;  1KYQ A;  2EMY A;  2ZM6 E;  1XMQ E;  5IT9 C;  1A1L A;  4O5G A;  1Z1B A;  3LLH A;  5AE1 A;  4B3S E;  2EM5 A;  1YYO A;  2ELY A;  2I13 A;  3F6G A;  2VE7 C;  4R2E A;  5ADZ A;  4DV0 E;  1T4L B;  4JI5 E;  3VYX A;  2CPN A;  2NAB A;  4GEQ B;  4J8Z A;  1IBM E;  2FV4 B;  2L3C A;  4WX9 A;  3HTX A;  2EQ0 A;  3N3W A;  2L33 A;  4LF9 E;  2EQ1 A;  2EOY A;  2YTD A;  3EQ1 A;  3EPK A;  4KHP E;  4R2R A;  3T1Y E;  3ADL A;  1JFZ A;  2EOS A;  4X62 E;  2YZT A;  4NXM E;  2L2N A;  1BB8 A;  4JI8 E;  2JPA A;  2EOE A;  2YPN A;  1SR9 A;  2V85 A;  3JU0 A;  1IBK E;  2WBS A;  2DLQ A;  4AQY E;  5A6K A;  2EE8 A;  4R2Q A;  1STU A;  5KL6 A;  5KL7 A;  2EMW A;  1A1K A;  1N3G A;  2BBG A;  4F9A B;  4TUG A;  1ZR9 A;  2MDR A;  3JAM C;  2EPZ A;  1AH5 A;  3ADJ A;  1ZBT A;  3H09 A;  2EOI A;  3RMP A;  3VK6 A;  2L92 A;  2V88 A;  1XNQ E;  4Q28 A;  4LF4 E;  2NUG A;  3OML A;  1A1G A;  1YYK A;  2EZ6 A;  4DR1 E;  4BS9 A;  4DR6 E;  2EPK X;  2HC5 A;  2E72 A;  2EM9 A;  2DMI A;  3TQM A;  2UUC E;  5BR8 E;  4LFC E;  2EOZ A;  2ENH A;  4JI1 E;  4JI4 E;  4DUY E;  4DR7 E;  2V89 A;  2EN2 A;  1YUI A;  2YTP A;  4R2C A;  2YTF A;  1ZTD A;  3LML A;  5A6B A;  2B7V A;  1I4S A;  4L8N A;  2L2K B;  5A69 A;  4NXN E;  2CTD A;  2YWQ A;  1X5W A;  2B7T A;  2K7I A;  3ECR A;  2WBT A;  4O4K A;  2WCC 3;  2A25 A;  2UXC E;  4M30 A;  2M7Q A;  2YSP A;  2VF1 A;  3L00 A;  2DLK A;  3KZY A;  1X6F A;  1YPN A;  2EMA A;  2YU8 A;  4F9B B;  4F9C B;  1BBO A;  4RH8 A;  5LMN E;  4WFT A;  1N33 E;  4YHH E;  2WBU A;  4LF7 E;  2LVH A;  4K0K E;  2EMI A;  2UUA E;  3EPH A;  3BID A;  5LLQ A;  3VYY A;  4MLV A;  2EPR A;  1YSA C;  2EN6 A;  2Q8U A;  4DV6 E;  2CT1 A;  2EPU A;  4LU9 A;  4BHC A;  2KON A;  2YT4 A;  2RQL A;  2WZO A;  4DV3 E;  4DV5 E;  2EMK A;  2FGG A;  1X6H A;  1NCS A;  2B3T B;  3AUZ A;  3JTZ A;  5DNY A;  4DR2 E;  2DRP A;  1I94 E;  2EOO A;  4F6N A;  3DJW A;  2EWL A;  4IS1 C;  1DQ3 A;  4R2A A;  2LT7 A;  4LFB E;  4OX9 E;  2DB2 A;  2JWO A;  2L6M A;  2V83 A;  1J26 A;  3BBG A;  5IV8 B;  1F2I G;  4X64 E;  2VQE E;  1QNT A;  5KL5 A;  2RPC A;  2RS7 A;  2YTQ A;  2L8T A;  2DMY A;  4N4R B;  4WXC A;  3RV0 A;  4GKJ E;  3IWC A;  4P7D A;  4F6M A;  3DF6 A;  2RS6 A;  2GSL A;  2LE2 A;  2EMB A;  2NA2 A;  5A2Q C;  4HTG A;  4DUZ E;  2DIX A;  2BB8 A;  2YTN A;  2K4V A;  3J81 C;  1HNW E;  2DSY A;  2L3J A;  4NHR A;  4B3T E;  5A6B D;  2EOH A;  1TF6 A;  2YTO A;  2FTX B;  4KWY A;  5T6J A;  2EN3 A;  1RC7 A;  2CSH A;  4ZYG A;  4F54 A;  2HGH A;  1FJG E;  4DV7 E;  4X8W A;  4JI0 E;  1EKZ A;  5AE2 A;  2ADR A;  4DR4 E;  4RHB B;  1WXR A;  2HJJ A;  2LUP B;  4BMJ A;  2YTE A;  1IQS A;  4GZN C;  2JR1 A;  4R2D A;  1A1J A;  2MC5 A;  4FK5 C;  4WSP A;  4R2S A;  4B3M E;  2EOR A;  2JOX A;  2HHH E;  4M9V C;  2EPC A;  2EMX A;  1PJQ A;  3C4B A;  2KHX A;  1X3C A;  4I8O A;  3IWB A;  2RTX A;  4ZYE A;  2EOM A;  2EQ3 A;  2ELZ A;  2KOU A;  2EN7 A;  2LCE A;  1NEI A;  2YU5 A;  3HXL A;  1A1H A;  3O2R A;  4IJD A;  4O43 A;  5FLX C;  4JI2 E;  3C6K A;  5A6J A;  2LTS A;  2N3H A;  2ENA A;  4F2J C;  3HPS A;  2JYA A;  4LTY A;  4L5N C;  1T38 A;  4JV5 E;  4OOG C;  2EN4 A;  2N8X A;  4X9J A;  3J7Y p;  4DR5 E;  2EOJ A;  2MKD A;  5AC5 A;  2EP3 A;  1IMU A;  2JOB A;  3THO B;  3RV1 A;  2YRK A;  3KZZ A;  2YRH A;  2F8B A;  3OTO E;  1YUJ A;  4LF6 E;  4X66 E;  2EPP A;  4YY3 E;  2E5L E;  3EPJ A;  2EML A;  2EMC A;  1DI2 A;  1UIL A;  3J7A G;  2J7J A;  2H36 X;  2EL4 A;  2E1M A;  1A1I A;  1G2F C;  1G2D C;  1A1F A;  1ZBQ A;  1WJP A;  2YSO A;  3HPZ A;  1YYW A;  3BGH A;  1X47 A;  4TUI A;  2NUE A;  2UXB E;  2JXP A;  5IWA E;  4Q35 B;  5KL2 A;  4GKK E;  2A11 A;  1HNX E;  3F6H A;  4ZYD A;  2EPA A;  2NUF A;  1BBG A;  1UHZ A;  5TSE A;  4JI7 E;  5A6A A;  1PJS A;  2EMF A;  1ZAA C;  4DV2 E;  3M99 B;  3ADI A;  2EL5 A;  2ENC A;  3MSW A;  3FIG A;  2PRT A;  3IWD A;  2EPX A;  2GLI A;  3MHS C;  1JK1 A;  1T39 A;  2EOQ A;  2EMH A;  3HQ1 A;  1FKA E;  2M1S A;  4KZS A;  1UBD C;  1B69 A;  5LMU E;  2GPI A;  4O24 A;  1IQO A;  2G7H A;  3KWR A;  2EPM X;  2YTJ A;  1MEY C;  1SFE A;  1L4S A;  1X6E A;  2ODR D;  4M0V A;  2B9D A;  2UUB E;  4BHB A;  2R76 A;  4MLQ A;  2EM8 A;  4OUN A;  2LV2 A;  4WSG A;  1X49 A;  1JK2 A;  5AC4 A;  2EOF A;  2LTR A;  5KL4 A;  3K6Q A;  4R2P A;  1LLM C;  1PKP A;  1QU6 A;  1P47 A; 
#chains in the Genus database with same CATH homology
 4L5N C;  4JV5 E;  2KON A;  2VE7 C;  4OOG C;  2YT4 A;  3F6G A;  4BC9 A;  5ADZ A;  4DV0 E;  2WZO A;  2CPN A;  3J7Y p;  4DV3 E;  4DR5 E;  1N36 E;  2LJH A;  4DV5 E;  2FGG A;  1IBL E;  4JI3 E;  4DMI A;  4GEQ B;  4J8Z A;  1IBM E;  2B3T B;  2FV4 B;  3AUZ A;  3JTZ A;  4BBY A;  5DNY A;  2L3C A;  4LFA E;  4DR2 E;  1XMO E;  1GQE A;  3HTX A;  1WHQ A;  1RC5 A;  2VQF E;  3N3W A;  2JOB A;  2L33 A;  3RV1 A;  1I94 E;  2V8Q B;  4LF9 E;  2JVA A;  1YZ9 A;  3DJW A;  2EWL A;  1DQ3 A;  4KHP E;  4LFB E;  2LRS A;  3ADL A;  3T1Y E;  4DV4 E;  4X65 E;  1JFZ A;  4OX9 E;  2DB2 A;  2JWO A;  2N3G A;  2YZT A;  4X62 E;  2L2M A;  2F8B A;  2RSM A;  3OTO E;  2L6M A;  4LF6 E;  4NXM E;  2V83 A;  1J26 A;  2L2N A;  4X66 E;  4YY3 E;  4WYQ B;  4JI8 E;  2UXD E;  4X64 E;  2E5L E;  2VQE E;  2RS7 A;  1DI2 A;  1SR9 A;  4DR3 E;  1UIL A;  2V85 A;  3JU0 A;  1O0W A;  3J7A G;  2L8T A;  2DMY A;  4P78 A;  1IBK E;  1T4N A;  2QVW A;  4AQY E;  1T4O A;  3HPS A;  1STU A;  3RV0 A;  2H36 X;  4GKJ E;  3IWC A;  3T1H E;  4F9A B;  4P7D A;  3DF6 A;  2RS6 A;  2GSL A;  2MDR A;  4TUG A;  2LE2 A;  2MC6 A;  3P1X A;  4R03 A;  2IHR 1;  3JAM C;  2NA2 A;  3ADJ A;  2E1M A;  1ZBT A;  5A2Q C;  1U61 A;  3H09 A;  3RMP A;  3VK6 A;  2L92 A;  2V88 A;  1XNQ E;  4Q28 A;  1X48 A;  2DIX A;  4DUZ E;  2NUG A;  1ZBQ A;  3ADG A;  3OML A;  4LF4 E;  3HPZ A;  1YYW A;  2K4V A;  1YYK A;  5LL6 R;  2DSY A;  4BC7 A;  3J81 C;  2L3J A;  4B3T E;  1HNW E;  2EZ6 A;  1X47 A;  4BS9 A;  2NUE A;  4TUI A;  4DR1 E;  4DR6 E;  2UXB E;  5IWA E;  4JI5 E;  2FTX B;  5T6J A;  4GKK E;  2A11 A;  1RC7 A;  1HNX E;  3F6H A;  5AE3 A;  2UUC E;  5BR8 E;  2NUF A;  4JI7 E;  1UHZ A;  4F54 A;  4DV1 E;  4LFC E;  1FJG E;  1HR0 E;  4JI1 E;  4DV7 E;  4X8W A;  1N34 E;  1EKZ A;  4JI0 E;  1J5E E;  5AE2 A;  4DUY E;  4JI4 E;  4DR7 E;  2ODR C;  2V89 A;  4DR4 E;  4DKK A;  1WXR A;  4DV2 E;  2LBS B;  4M2Z A;  2LUP B;  4BMJ A;  2EB1 A;  3ADI A;  3LML A;  2V87 A;  3MSW A;  2JR1 A;  1RQ0 A;  2B7V A;  1I4S A;  4L8N A;  2L2K B;  4DV6 E;  2MC5 A;  3FIG A;  3C4T A;  3IWD A;  4R8O A;  4BCA A;  4WSP A;  4NXN E;  4B3M E;  2F4V E;  3O2R B;  5CFF E;  2UU9 E;  4LF8 E;  2JOX A;  2LUQ A;  2HHH E;  2B7T A;  4WPY A;  4JYA E;  3VYX A;  2UXC E;  2KHX A;  3C4B A;  4M30 A;  3HQ1 A;  5F3W A;  2M7Q A;  2V86 A;  1FKA E;  3AV0 A;  2M1S A;  4I8O A;  2JY9 A;  3IWB A;  2VF1 A;  4KZS A;  2RTX A;  4LF5 E;  5LMU E;  3J80 C;  2LMZ A;  1WHN A;  2G7H A;  5AAS A;  3KWR A;  4JI6 E;  2M4I A;  1HNZ E;  2KOU A;  4F9B B;  2ODR D;  4M0V A;  2B9D A;  3ZOQ B;  4F9C B;  1T4L B;  2UUB E;  4B3R E;  2FFL A;  5LMN E;  1XNR E;  4WFT A;  1N33 E;  4OUN A;  4YHH E;  1N32 E;  1GZ6 A;  3HXL A;  1X49 A;  4LF7 E;  4K0K E;  2ZM6 E;  1XMQ E;  5IT9 C;  2UUA E;  3O2R A;  2LTR A;  3LLH A;  5FLX C;  3K6Q A;  5AE1 A;  3VYY A;  4B3S E;  4JI2 E;  2LTS A;  2N3H A;  1YYO A;  1PKP A;  1QU6 A;  4LTY A;  4LU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...