1YYOA

Crystal structure of rnase iii mutant e110k from aquifex aeolicus complexed with double-stranded rna at 2.9-angstrom resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
220
structure length
220
Chain Sequence
MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFKALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*CP*GP*CP*GP*AP*AP*UP*UP*CP*GP*CP*G)-3'
publication title Intermediate states of ribonuclease III in complex with double-stranded RNA
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
total genus 66
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2005-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 1yyoA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1yyoA02
1YZ9A 2B3TB 5LMNE 4DR6E 1YYOA 1RC7A 4JI1E 4JI2E 4NXME 1N32E 4JI0E 2LRSA 4DR4E 2UUCE 4OX9E 1UHZA 2NUEA 5BR8E 4X64E 4DR2E 1UILA 4DV2E 2N3HA 3HTXA 1IBLE 2ZM6E 1STUA 1XMQE 2UXDE 2VQFE 4LF6E 4B3TE 5IWAE 4OOGC 4YY3E 2VQEE 1GQEA 4LF4E 2N3GA 4X66E 4LFBE 2E5LE 1T4OA 2F4VE 3J7Yp 4JI8E 1RC5A 3OTOE 1O0WA 1N33E 2UUBE 3LLHA 1WHNA 3C4BA 3T1YE 4DV6E 2NUFA 3N3WA 1N36E 4JI4E 4DR1E 4DUZE 2HHHE 1PKPA 3O2RA 2LTRA 1T4NA 4DV3E 4JYAE 2CPNA 4B3RE 2LUQA 2L3CA 5LMUE 4JI6E 3ADLA 4X62E 4B3ME 3C4TA 1YYWA 3P1XA 4WFTA 2UXBE 3ADGA 4DKKA 2LUPB 2JVAA 2L2KB 2LJHA 4DV0E 1XMOE 4LF7E 4LF8E 4DV1E 2DIXA 2LBSB 4DV7E 2L2NA 4KHPE 1EKZA 4JI5E 4NXNE 2RSMA 1IBKE 4B3SE 4OUNA 2IHR1 3VYYA 2FFLA 2EB1A 2LTSA 2MDRA 1FJGE 2EZ6A 4GKKE 1DI2A 3T1HE 4YHHE 1WHQA 3ADJA 1ZBTA 4DR7E 4GKJE 1I94E 2JY9A 2QVWA 4DV4E 1HNXE 2RS6A 4X8WA 2GSLA 4WYQB 3ADIA 2B7VA 1J5EE 4JI3E 1XNRE 2YT4A 1T4LB 1IBME 2UUAE 4DR3E 3VYXA 4JI7E 2RTXA 4X65E 4DUYE 2DMYA 4LF9E 4DR5E 2DB2A 1HR0E 1X47A 1XNQE 1X49A 1J26A 2RS7A 3RV1A 4DV5E 2L33A 4JV5E 1HNWE 2KHXA 4M30A 1I4SA 4M2ZA 2B7TA 1FKAE 1RQ0A 1JFZA 4LF5E 1N34E 5CFFE 1U61A 2NUGA 3RV0A 1X48A 4LFCE 3O2RB 1YYKA 2NA2A 1HNZE 4K0KE 2A11A 2UU9E 2UXCE 4AQYE 1QU6A 4LFAE 2L2MA 2L3JA
chains in the Genus database with same CATH superfamily
3F6GA 2EN6A 4JI1E 1A1JA 4R2CA 4NXME 2YTFA 2YTOA 4DR4E 1ZBQA 2YU8A 1TF3A 4ZYEA 2UUCE 2BBGA 2NUEA 2HJJA 3L00A 5BR8E 1Z1BA 1UILA 3BBGA 2B9DA 5FLXC 4IS1C 1STUA 2EM8A 2VQFE 4LF6E 4B3TE 2N8XA 2GHFA 2EMKA 2EOOA 5A69A 4X66E 1ZTDA 2WBSA 2EQ3A 5LLQA 1N33E 1WHNA 4Q35B 2HGHA 3N3WA 2EL6A 1N36E 2EM5A 4DUZE 4F2JC 2LTRA 4RHBB 2EPMX 1G2DC 5KL5A 1AH5A 1NCSA 4B3ME 4LU9A 2EMFA 2VE7C 3THNA 5LL6R 3P1XA 4WFTA 1WXRA 2EMLA 1A1IA 4MLQA 2LT7A 3BGHA 3AV0A 1XMOE 2FV4B 2DMIA 1UBDC 1IBKE 4B3SE 2KOUA 5IT9C 2IHR1 3KWRA 2JWOA 1RMDA 1ZU1A 2YRMA 5A2QC 1UN6B 3EPHA 4GKKE 2A25A 3M99B 3EPLA 2YTPA 3T1HE 1WHQA 3ADJA 2JY9A 4DV4E 2MC6A 4P7DA 1GTKA 2GLIA 2B7VA 3EPKA 1J5EE 4JI3E 3JU0A 1XNRE 4ZYHA 2R76A 4M9VC 2UUAE 4DR3E 4F6NA 3HQ1A 4X65E 4LF9E 2DLKA 1WJPA 2EQ1A 4J8ZA 1XNQE 2MDGA 1TN9A 4ZYGA 2JR1A 2RS7A 1NEIA 3VHTB 1IQSA 2EMBA 4KZSA 2B7TA 4M2ZA 5T6JA 3RMPA 1SR9A 2EM7A 2VRDA 1JFZA 3THOB 1U61A 5CFFE 2EOMA 2EOJA 4LFCE 5F3WA 1B69A 2EM0A 2EM3A 2DGCA 4LFAE 4WX9A 2LE2A 2EMZA 1RC7A 2EL4A 2EMWA 4IJDA 3BF2A 1PJQA 2MKNA 2M7QA 2EOQA 1YPNA 2EMHA 4M0VA 1YFHA 3J80C 2ODRD 3HTXA 1IBLE 1WRJA 1XMQE 2UXDE 2D9HA 1IQOA 4TUGA 3IWCA 1A1LA 4N4RB 4LF4E 1SFEA 4BC9A 3OTOE 4JI8E 1RC5A 2EOXA 1O0WA 4LTYA 2UUBE 4R8OA 2EPOA 1X6FA 2V8QB 2ELZA 2LVHA 1T4NA 2ENAA 4DV3E 4JYAE 4O4KA 4B3RE 2L3CA 4JI6E 4R2EA 4GZNC 4WXCA 3TQMA 4NZVA 4LF7E 4LF8E 4ZYDA 2YZTA 3HPZA 2L2NA 2DSYA 2EMIA 2H36X 2YWQA 2RQLA 4OUNA 3JAMC 2LO3A 2ODRC 3KZYA 3ZOQB 2FTXB 2MKDA 5AC4A 5TSEA 2EZ6A 3AUZA 2JOBA 1DI2A 2V83A 2CSHA 2ENCA 1ZBTA 4DR7E 4GKJE 1JK1A 2EN4A 1I94E 3C6MA 1X6HA 4F6MA 2M1SA 2NABA 1HNXE 2EN2A 1EH8A 1KJKA 2GSLA 3ADIA 2YT4A 2BB8A 1T4LB 3EQ1A 4BHCA 2EOEA 3VYXA 3C6KA 2RTXA 2DMYA 1YUJA 4DR5E 1KYQA 3MSWA 1ZR9A 5DNYA 2EPKX 1AAYA 1N3GA 4DV5E 5IXMB 4JV5E 2CT1A 1FKAE 3EPJA 5AE3A 1RQ0A 4LF5E 1MGTA 5AE1A 2EOZA 2EOSA 2NUGA 3RV0A 1X48A 1PJSA 1YYKA 1GZ6A 4K0KE 2A11A 5AE2A 2UU9E 4BHBA 4AQYE 2EPPA 2M4IA 1A1GA 2V89A 2L2MA 2EPRA 5AC5A 1YZ9A 2EP3A 1A1KA 5LMNE 2RPCA 4DR6E 1T38A 4JI2E 1N32E 4JI0E 2LRSA 4BC7A 2EQ0A 2EN7A 4DV2E 5A6KA 2WBTA 2ADRA 2ZM6E 4WSGA 5IWAE 2VQEE 1F2IG 1GQEA 2N3GA 5KL3A 4LFBE 2F8BA 4HEIA 3VK6A 1T4OA 4WSPA 2EMGA 4P78A 2EJ4A 2NUFA 4JI4E 1EH6A 2JPAA 4DR1E 2I9IA 2HHHE 3BIDA 1PKPA 3O2RA 2DLQA 2EMAA 1QNTA 2J7JA 2LUQA 3ADLA 4BCAA 1YYWA 2EMXA 4O24A 3HXLA 2UXBE 4DKKA 4R2PA 2YRKA 2LUPB 2YU5A 4HTGA 2KONA 2LCEA 2JOXA 4DV1E 2LBSB 2EPAA 5A6AA 2E1MA 5A6BA 1YUIA 2EN1A 4NXNE 2EOHA 2RSMA 4NHRA 1X3CA 3FIGA 2YTGA 5KL7A 2EB1A 4BS9A 2ENHA 2L8TA 4YHHE 4F9AB 3J7AG 2JXPA 3MHHC 1EH7A 2ELYA 3H09A 2I13A 4X8WA 4WYQB 2WZOA 4JI7E 1DQ3A 3LMLA 2G7HA 2LJUA 2DB2A 1X47A 2GPIA 1X49A 2YSOA 2EN3A 2YTJA 2EL5A 4O43A 1L4SA 1YSAC 1T39A 2L33A 1HNWE 2EM2A 4M30A 1I4SA 2EPUA 2JP9A 2EOFA 2YTQA 4RH8A 2E72A 4R2DA 4BBYA 1TF6A 3QG5C 1HNZE 4O5GA 4Q28A 2Q8UA 5AASA 2V87A 2L3JA 1G2FC 4DMIA 2EN8A 2B3TB 1YYOA 1LLMC 2EE8A 2L92A 2V85A 3MHSC 4OX9E 1PJTA 1UHZA 2V86A 4X64E 4DR2E 4I8OA 2N3HA 3DF6A 4R2RA 2YTDA 3OMLA 2EORA 4OOGC 4YY3E 1ZAAC 5KL4A 4R03A 3J81C 1JK2A 2E5LE 1X6EA 2F4VE 2CTDA 3J7Yp 4BMJA 2L6MA 4F9CB 4TUIA 3LLHA 3UK3C 3HPSA 3C4BA 3T1YE 4DV6E 3DJWA 4L8NA 2LV2A 2YTNA 1X5WA 2K7IA 2PRTA 1BBOA 2EPLX 2CPNA 3IWDA 4R2QA 5LMUE 4X62E 2MC5A 2FGGA 3C4TA 2EM9A 5KL2A 2EM4A 3ADGA 2WBUA 4GEQB 2JVAA 2YTIA 2LJHA 3KZZA 4F9BB 2L2KB 2LMZA 4DV0E 2DIXA 2HC5A 2EPZA 4DV7E 4KHPE 5ADZA 1EKZA 2EMYA 4JI5E 2EM6A 5KL6A 5IV8B 4KWYA 5A6JA 3VYYA 2VF1A 2FFLA 1A1HA 2LTSA 2MDRA 1FJGE 2JYAA 2EPXA 2YSPA 1A1FA 3ECRA 2EWLA 5A6BD 2QVWA 2EOYA 2YTEA 2RS6A 2EMCA 2EOIA 2EPNA 3F6HA 4R2AA 1IBME 2EPCA 3K6QA 4DUYE 4WXDA 2DRPA 1HR0E 1PDAA 2V88A 3JTZA 1J26A 2K4VA 4F54A 3RV1A 4MLVA 2KHXA 2RSIA 4FK5C 1BB8A 1IMUA 1N34E 2R1FA 4L5NC 1P47A 3O2RB 2M9AA 2NA2A 2YRHA 1DGCA 2UXCE 4X9JA 2WCC3 1QU6A 3IWBA 4R2SA 2YPNA 1BBGA 4WPYA 1MEYC
chains in the Genus database with same CATH topology
1YZ9A 2B3TB 3F6GA 5LMNE 4DR6E 2LE2A 1YYOA 1RC7A 4JI1E 4JI2E 4NXME 1N32E 2M7QA 4JI0E 2LRSA 4DR4E 2L92A 2V85A 1ZBQA 4BC7A 2UUCE 4OX9E 1UHZA 2NUEA 2V86A 5BR8E 4M0VA 4X64E 1UILA 3J80C 4DV2E 4DR2E 4I8OA 2N3HA 3DF6A 2B9DA 5FLXC 2ODRD 3HTXA 1IBLE 3OMLA 1STUA 2ZM6E 1XMQE 2UXDE 2VQFE 4LF6E 4B3TE 4TUGA 5IWAE 4OOGC 4YY3E 3IWCA 3OTOE 2VQEE 1GQEA 4R03A 4LF4E 2N3GA 4X66E 3J81C 4LFBE 2E5LE 2F8BA 4BC9A 3VK6A 1T4OA 2F4VE 3J7Yp 4JI8E 1RC5A 2L6MA 4BMJA 1O0WA 4WSPA 4F9CB 4LTYA 4TUIA 2UUBE 1N33E 3LLHA 4P78A 4R8OA 1WHNA 3HPSA 3C4BA 3T1YE 4DV6E 2NUFA 3DJWA 4L8NA 3N3WA 1N36E 4JI4E 2V8QB 4DR1E 4DUZE 2HHHE 1PKPA 3O2RA 2LTRA 1T4NA 4DV3E 4JYAE 2CPNA 3IWDA 4B3RE 2LUQA 2L3CA 5LMUE 4JI6E 3ADLA 4X62E 2MC5A 4B3ME 2FGGA 4LU9A 3C4TA 1YYWA 2VE7C 5LL6R 3P1XA 4WFTA 4BCAA 1WXRA 3HXLA 2UXBE 4LF8E 3ADGA 4DKKA 2LUPB 3AV0A 4GEQB 2JVAA 2KONA 2L2KB 2LJHA 4F9BB 4DV0E 1XMOE 2LMZA 2JOXA 2FV4B 2DIXA 2YZTA 3HPZA 4DV1E 2LBSB 4DV7E 2L2NA 4KHPE 2E1MA 5ADZA 1EKZA 4JI5E 2DSYA 4NXNE 2H36X 2RSMA 1IBKE 4B3SE 2KOUA 5IT9C 4OUNA 2IHR1 3KWRA 2JWOA 3FIGA 3JAMC 2VF1A 3VYYA 2FFLA 2ODRC 3ZOQB 2FTXB 2EB1A 2LTSA 2MDRA 5A2QC 1FJGE 2EZ6A 3AUZA 2JOBA 4BS9A 4GKKE 2L8TA 3T1HE 4YHHE 1WHQA 2V83A 4F9AB 3J7AG 3ADJA 1DI2A 1ZBTA 4DR7E 4GKJE 2EWLA 1I94E 3H09A 2JY9A 2QVWA 2M1SA 4DV4E 2MC6A 3F6HA 2RS6A 1HNXE 4X8WA 4P7DA 2GSLA 4WYQB 3ADIA 2B7VA 1J5EE 4JI3E 1XNRE 2YT4A 3JU0A 1T4LB 2WZOA 1IBME 2UUAE 4DR3E 3VYXA 4JI7E 3K6QA 1DQ3A 3HQ1A 2RTXA 4X65E 3LMLA 2DMYA 2G7HA 4DUYE 4LF9E 4DR5E 2DB2A 1HR0E 4J8ZA 1X47A 3MSWA 2V88A 1XNQE 3JTZA 2JR1A 1X49A 2K4VA 5DNYA 2RS7A 4F54A 1J26A 3RV1A 4DV5E 2L33A 4JV5E 1HNWE 2KHXA 4M30A 1I4SA 4M2ZA 2B7TA 4KZSA 5T6JA 1FKAE 4LF7E 3RMPA 1SR9A 5AE3A 1RQ0A 1JFZA 4LF5E 1N34E 5AE1A 5CFFE 1U61A 2NUGA 4BBYA 3RV0A 4L5NC 1X48A 4LFCE 5F3WA 3O2RB 1YYKA 1GZ6A 2NA2A 1HNZE 4K0KE 2A11A 5AE2A 2UU9E 2UXCE 4Q28A 4AQYE 2M4IA 2V89A 5AASA 1QU6A 4LFAE 2L2MA 2V87A 2L3JA 3IWBA 4WPYA 4DMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YZ9 A;  2B3T B;  5LMN E;  4DR6 E;  1YYO A;  1RC7 A;  4JI1 E;  4JI2 E;  4NXM E;  1N32 E;  4JI0 E;  2LRS A;  4DR4 E;  2UUC E;  4OX9 E;  1UHZ A;  2NUE A;  5BR8 E;  4X64 E;  4DR2 E;  1UIL A;  4DV2 E;  2N3H A;  3HTX A;  1IBL E;  2ZM6 E;  1STU A;  1XMQ E;  2UXD E;  2VQF E;  4LF6 E;  4B3T E;  5IWA E;  4OOG C;  4YY3 E;  2VQE E;  1GQE A;  4LF4 E;  2N3G A;  4X66 E;  4LFB E;  2E5L E;  1T4O A;  2F4V E;  3J7Y p;  4JI8 E;  1RC5 A;  3OTO E;  1O0W A;  1N33 E;  2UUB E;  3LLH A;  1WHN A;  3C4B A;  3T1Y E;  4DV6 E;  2NUF A;  3N3W A;  1N36 E;  4JI4 E;  4DR1 E;  4DUZ E;  2HHH E;  1PKP A;  3O2R A;  2LTR A;  1T4N A;  4DV3 E;  4JYA E;  2CPN A;  4B3R E;  2LUQ A;  2L3C A;  5LMU E;  4JI6 E;  3ADL A;  4X62 E;  4B3M E;  3C4T A;  1YYW A;  3P1X A;  4WFT A;  2UXB E;  3ADG A;  4DKK A;  2LUP B;  2JVA A;  2L2K B;  2LJH A;  4DV0 E;  1XMO E;  4LF7 E;  4LF8 E;  4DV1 E;  2DIX A;  2LBS B;  4DV7 E;  2L2N A;  4KHP E;  1EKZ A;  4JI5 E;  4NXN E;  2RSM A;  1IBK E;  4B3S E;  4OUN A;  2IHR 1;  3VYY A;  2FFL A;  2EB1 A;  2LTS A;  2MDR A;  1FJG E;  2EZ6 A;  4GKK E;  1DI2 A;  3T1H E;  4YHH E;  1WHQ A;  3ADJ A;  1ZBT A;  4DR7 E;  4GKJ E;  1I94 E;  2JY9 A;  2QVW A;  4DV4 E;  1HNX E;  2RS6 A;  4X8W A;  2GSL A;  4WYQ B;  3ADI A;  2B7V A;  1J5E E;  4JI3 E;  1XNR E;  2YT4 A;  1T4L B;  1IBM E;  2UUA E;  4DR3 E;  3VYX A;  4JI7 E;  2RTX A;  4X65 E;  4DUY E;  2DMY A;  4LF9 E;  4DR5 E;  2DB2 A;  1HR0 E;  1X47 A;  1XNQ E;  1X49 A;  1J26 A;  2RS7 A;  3RV1 A;  4DV5 E;  2L33 A;  4JV5 E;  1HNW E;  2KHX A;  4M30 A;  1I4S A;  4M2Z A;  2B7T A;  1FKA E;  1RQ0 A;  1JFZ A;  4LF5 E;  1N34 E;  5CFF E;  1U61 A;  2NUG A;  3RV0 A;  1X48 A;  4LFC E;  3O2R B;  1YYK A;  2NA2 A;  1HNZ E;  4K0K E;  2A11 A;  2UU9 E;  2UXC E;  4AQY E;  1QU6 A;  4LFA E;  2L2M A;  2L3J A; 
#chains in the Genus database with same CATH topology
 3F6G A;  2EN6 A;  4JI1 E;  1A1J A;  4R2C A;  4NXM E;  2YTF A;  2YTO A;  4DR4 E;  1ZBQ A;  2YU8 A;  1TF3 A;  4ZYE A;  2UUC E;  2BBG A;  2NUE A;  2HJJ A;  3L00 A;  5BR8 E;  1Z1B A;  1UIL A;  3BBG A;  2B9D A;  5FLX C;  4IS1 C;  1STU A;  2EM8 A;  2VQF E;  4LF6 E;  4B3T E;  2N8X A;  2GHF A;  2EMK A;  2EOO A;  5A69 A;  4X66 E;  1ZTD A;  2WBS A;  2EQ3 A;  5LLQ A;  1N33 E;  1WHN A;  4Q35 B;  2HGH A;  3N3W A;  2EL6 A;  1N36 E;  2EM5 A;  4DUZ E;  4F2J C;  2LTR A;  4RHB B;  2EPM X;  1G2D C;  5KL5 A;  1AH5 A;  1NCS A;  4B3M E;  4LU9 A;  2EMF A;  2VE7 C;  3THN A;  5LL6 R;  3P1X A;  4WFT A;  1WXR A;  2EML A;  1A1I A;  4MLQ A;  2LT7 A;  3BGH A;  3AV0 A;  1XMO E;  2FV4 B;  2DMI A;  1UBD C;  1IBK E;  4B3S E;  2KOU A;  5IT9 C;  2IHR 1;  3KWR A;  2JWO A;  1RMD A;  1ZU1 A;  2YRM A;  5A2Q C;  1UN6 B;  3EPH A;  4GKK E;  2A25 A;  3M99 B;  3EPL A;  2YTP A;  3T1H E;  1WHQ A;  3ADJ A;  2JY9 A;  4DV4 E;  2MC6 A;  4P7D A;  1GTK A;  2GLI A;  2B7V A;  3EPK A;  1J5E E;  4JI3 E;  3JU0 A;  1XNR E;  4ZYH A;  2R76 A;  4M9V C;  2UUA E;  4DR3 E;  4F6N A;  3HQ1 A;  4X65 E;  4LF9 E;  2DLK A;  1WJP A;  2EQ1 A;  4J8Z A;  1XNQ E;  2MDG A;  1TN9 A;  4ZYG A;  2JR1 A;  2RS7 A;  1NEI A;  3VHT B;  1IQS A;  2EMB A;  4KZS A;  2B7T A;  4M2Z A;  5T6J A;  3RMP A;  1SR9 A;  2EM7 A;  2VRD A;  1JFZ A;  3THO B;  1U61 A;  5CFF E;  2EOM A;  2EOJ A;  4LFC E;  5F3W A;  1B69 A;  2EM0 A;  2EM3 A;  2DGC A;  4LFA E;  4WX9 A;  2LE2 A;  2EMZ A;  1RC7 A;  2EL4 A;  2EMW A;  4IJD A;  3BF2 A;  1PJQ A;  2MKN A;  2M7Q A;  2EOQ A;  1YPN A;  2EMH A;  4M0V A;  1YFH A;  3J80 C;  2ODR D;  3HTX A;  1IBL E;  1WRJ A;  1XMQ E;  2UXD E;  2D9H A;  1IQO A;  4TUG A;  3IWC A;  1A1L A;  4N4R B;  4LF4 E;  1SFE A;  4BC9 A;  3OTO E;  4JI8 E;  1RC5 A;  2EOX A;  1O0W A;  4LTY A;  2UUB E;  4R8O A;  2EPO A;  1X6F A;  2V8Q B;  2ELZ A;  2LVH A;  1T4N A;  2ENA A;  4DV3 E;  4JYA E;  4O4K A;  4B3R E;  2L3C A;  4JI6 E;  4R2E A;  4GZN C;  4WXC A;  3TQM A;  4NZV A;  4LF7 E;  4LF8 E;  4ZYD A;  2YZT A;  3HPZ A;  2L2N A;  2DSY A;  2EMI A;  2H36 X;  2YWQ A;  2RQL A;  4OUN A;  3JAM C;  2LO3 A;  2ODR C;  3KZY A;  3ZOQ B;  2FTX B;  2MKD A;  5AC4 A;  5TSE A;  2EZ6 A;  3AUZ A;  2JOB A;  1DI2 A;  2V83 A;  2CSH A;  2ENC A;  1ZBT A;  4DR7 E;  4GKJ E;  1JK1 A;  2EN4 A;  1I94 E;  3C6M A;  1X6H A;  4F6M A;  2M1S A;  2NAB A;  1HNX E;  2EN2 A;  1EH8 A;  1KJK A;  2GSL A;  3ADI A;  2YT4 A;  2BB8 A;  1T4L B;  3EQ1 A;  4BHC A;  2EOE A;  3VYX A;  3C6K A;  2RTX A;  2DMY A;  1YUJ A;  4DR5 E;  1KYQ A;  3MSW A;  1ZR9 A;  5DNY A;  2EPK X;  1AAY A;  1N3G A;  4DV5 E;  5IXM B;  4JV5 E;  2CT1 A;  1FKA E;  3EPJ A;  5AE3 A;  1RQ0 A;  4LF5 E;  1MGT A;  5AE1 A;  2EOZ A;  2EOS A;  2NUG A;  3RV0 A;  1X48 A;  1PJS A;  1YYK A;  1GZ6 A;  4K0K E;  2A11 A;  5AE2 A;  2UU9 E;  4BHB A;  4AQY E;  2EPP A;  2M4I A;  1A1G A;  2V89 A;  2L2M A;  2EPR A;  5AC5 A;  1YZ9 A;  2EP3 A;  1A1K A;  5LMN E;  2RPC A;  4DR6 E;  1T38 A;  4JI2 E;  1N32 E;  4JI0 E;  2LRS A;  4BC7 A;  2EQ0 A;  2EN7 A;  4DV2 E;  5A6K A;  2WBT A;  2ADR A;  2ZM6 E;  4WSG A;  5IWA E;  2VQE E;  1F2I G;  1GQE A;  2N3G A;  5KL3 A;  4LFB E;  2F8B A;  4HEI A;  3VK6 A;  1T4O A;  4WSP A;  2EMG A;  4P78 A;  2EJ4 A;  2NUF A;  4JI4 E;  1EH6 A;  2JPA A;  4DR1 E;  2I9I A;  2HHH E;  3BID A;  1PKP A;  3O2R A;  2DLQ A;  2EMA A;  1QNT A;  2J7J A;  2LUQ A;  3ADL A;  4BCA A;  1YYW A;  2EMX A;  4O24 A;  3HXL A;  2UXB E;  4DKK A;  4R2P A;  2YRK A;  2LUP B;  2YU5 A;  4HTG A;  2KON A;  2LCE A;  2JOX A;  4DV1 E;  2LBS B;  2EPA A;  5A6A A;  2E1M A;  5A6B A;  1YUI A;  2EN1 A;  4NXN E;  2EOH A;  2RSM A;  4NHR A;  1X3C A;  3FIG A;  2YTG A;  5KL7 A;  2EB1 A;  4BS9 A;  2ENH A;  2L8T A;  4YHH E;  4F9A B;  3J7A G;  2JXP A;  3MHH C;  1EH7 A;  2ELY A;  3H09 A;  2I13 A;  4X8W A;  4WYQ B;  2WZO A;  4JI7 E;  1DQ3 A;  3LML A;  2G7H A;  2LJU A;  2DB2 A;  1X47 A;  2GPI A;  1X49 A;  2YSO A;  2EN3 A;  2YTJ A;  2EL5 A;  4O43 A;  1L4S A;  1YSA C;  1T39 A;  2L33 A;  1HNW E;  2EM2 A;  4M30 A;  1I4S A;  2EPU A;  2JP9 A;  2EOF A;  2YTQ A;  4RH8 A;  2E72 A;  4R2D A;  4BBY A;  1TF6 A;  3QG5 C;  1HNZ E;  4O5G A;  4Q28 A;  2Q8U A;  5AAS A;  2V87 A;  2L3J A;  1G2F C;  4DMI A;  2EN8 A;  2B3T B;  1YYO A;  1LLM C;  2EE8 A;  2L92 A;  2V85 A;  3MHS C;  4OX9 E;  1PJT A;  1UHZ A;  2V86 A;  4X64 E;  4DR2 E;  4I8O A;  2N3H A;  3DF6 A;  4R2R A;  2YTD A;  3OML A;  2EOR A;  4OOG C;  4YY3 E;  1ZAA C;  5KL4 A;  4R03 A;  3J81 C;  1JK2 A;  2E5L E;  1X6E A;  2F4V E;  2CTD A;  3J7Y p;  4BMJ A;  2L6M A;  4F9C B;  4TUI A;  3LLH A;  3UK3 C;  3HPS A;  3C4B A;  3T1Y E;  4DV6 E;  3DJW A;  4L8N A;  2LV2 A;  2YTN A;  1X5W A;  2K7I A;  2PRT A;  1BBO A;  2EPL X;  2CPN A;  3IWD A;  4R2Q A;  5LMU E;  4X62 E;  2MC5 A;  2FGG A;  3C4T A;  2EM9 A;  5KL2 A;  2EM4 A;  3ADG A;  2WBU A;  4GEQ B;  2JVA A;  2YTI A;  2LJH A;  3KZZ A;  4F9B B;  2L2K B;  2LMZ A;  4DV0 E;  2DIX A;  2HC5 A;  2EPZ A;  4DV7 E;  4KHP E;  5ADZ A;  1EKZ A;  2EMY A;  4JI5 E;  2EM6 A;  5KL6 A;  5IV8 B;  4KWY A;  5A6J A;  3VYY A;  2VF1 A;  2FFL A;  1A1H A;  2LTS A;  2MDR A;  1FJG E;  2JYA A;  2EPX A;  2YSP A;  1A1F A;  3ECR A;  2EWL A;  5A6B D;  2QVW A;  2EOY A;  2YTE A;  2RS6 A;  2EMC A;  2EOI A;  2EPN A;  3F6H A;  4R2A A;  1IBM E;  2EPC A;  3K6Q A;  4DUY E;  4WXD A;  2DRP A;  1HR0 E;  1PDA A;  2V88 A;  3JTZ A;  1J26 A;  2K4V A;  4F54 A;  3RV1 A;  4MLV A;  2KHX A;  2RSI A;  4FK5 C;  1BB8 A;  1IMU A;  1N34 E;  2R1F A;  4L5N C;  1P47 A;  3O2R B;  2M9A A;  2NA2 A;  2YRH A;  1DGC A;  2UXC E;  4X9J A;  2WCC 3;  1QU6 A;  3IWB A;  4R2S A;  2YPN A;  1BBG A;  4WPY A;  1MEY C; 
#chains in the Genus database with same CATH homology
 1YZ9 A;  2B3T B;  3F6G A;  5LMN E;  4DR6 E;  2LE2 A;  1YYO A;  1RC7 A;  4JI1 E;  4JI2 E;  4NXM E;  1N32 E;  2M7Q A;  4JI0 E;  2LRS A;  4DR4 E;  2L92 A;  2V85 A;  1ZBQ A;  4BC7 A;  2UUC E;  4OX9 E;  1UHZ A;  2NUE A;  2V86 A;  5BR8 E;  4M0V A;  4X64 E;  1UIL A;  3J80 C;  4DV2 E;  4DR2 E;  4I8O A;  2N3H A;  3DF6 A;  2B9D A;  5FLX C;  2ODR D;  3HTX A;  1IBL E;  3OML A;  1STU A;  2ZM6 E;  1XMQ E;  2UXD E;  2VQF E;  4LF6 E;  4B3T E;  4TUG A;  5IWA E;  4OOG C;  4YY3 E;  3IWC A;  3OTO E;  2VQE E;  1GQE A;  4R03 A;  4LF4 E;  2N3G A;  4X66 E;  3J81 C;  4LFB E;  2E5L E;  2F8B A;  4BC9 A;  3VK6 A;  1T4O A;  2F4V E;  3J7Y p;  4JI8 E;  1RC5 A;  2L6M A;  4BMJ A;  1O0W A;  4WSP A;  4F9C B;  4LTY A;  4TUI A;  2UUB E;  1N33 E;  3LLH A;  4P78 A;  4R8O A;  1WHN A;  3HPS A;  3C4B A;  3T1Y E;  4DV6 E;  2NUF A;  3DJW A;  4L8N A;  3N3W A;  1N36 E;  4JI4 E;  2V8Q B;  4DR1 E;  4DUZ E;  2HHH E;  1PKP A;  3O2R A;  2LTR A;  1T4N A;  4DV3 E;  4JYA E;  2CPN A;  3IWD A;  4B3R E;  2LUQ A;  2L3C A;  5LMU E;  4JI6 E;  3ADL A;  4X62 E;  2MC5 A;  4B3M E;  2FGG A;  4LU9 A;  3C4T A;  1YYW A;  2VE7 C;  5LL6 R;  3P1X A;  4WFT A;  4BCA A;  1WXR A;  3HXL A;  2UXB E;  4LF8 E;  3ADG A;  4DKK A;  2LUP B;  3AV0 A;  4GEQ B;  2JVA A;  2KON A;  2L2K B;  2LJH A;  4F9B B;  4DV0 E;  1XMO E;  2LMZ A;  2JOX A;  2FV4 B;  2DIX A;  2YZT A;  3HPZ A;  4DV1 E;  2LBS B;  4DV7 E;  2L2N A;  4KHP E;  2E1M A;  5ADZ A;  1EKZ A;  4JI5 E;  2DSY A;  4NXN E;  2H36 X;  2RSM A;  1IBK E;  4B3S E;  2KOU A;  5IT9 C;  4OUN A;  2IHR 1;  3KWR A;  2JWO A;  3FIG A;  3JAM C;  2VF1 A;  3VYY A;  2FFL A;  2ODR C;  3ZOQ B;  2FTX B;  2EB1 A;  2LTS A;  2MDR A;  5A2Q C;  1FJG E;  2EZ6 A;  3AUZ A;  2JOB A;  4BS9 A;  4GKK E;  2L8T A;  3T1H E;  4YHH E;  1WHQ A;  2V83 A;  4F9A B;  3J7A G;  3ADJ A;  1DI2 A;  1ZBT A;  4DR7 E;  4GKJ E;  2EWL A;  1I94 E;  3H09 A;  2JY9 A;  2QVW A;  2M1S A;  4DV4 E;  2MC6 A;  3F6H A;  2RS6 A;  1HNX E;  4X8W A;  4P7D A;  2GSL A;  4WYQ B;  3ADI A;  2B7V A;  1J5E E;  4JI3 E;  1XNR E;  2YT4 A;  3JU0 A;  1T4L B;  2WZO A;  1IBM E;  2UUA E;  4DR3 E;  3VYX A;  4JI7 E;  3K6Q A;  1DQ3 A;  3HQ1 A;  2RTX A;  4X65 E;  3LML A;  2DMY A;  2G7H A;  4DUY E;  4LF9 E;  4DR5 E;  2DB2 A;  1HR0 E;  4J8Z A;  1X47 A;  3MSW A;  2V88 A;  1XNQ E;  3JTZ A;  2JR1 A;  1X49 A;  2K4V A;  5DNY A;  2RS7 A;  4F54 A;  1J26 A;  3RV1 A;  4DV5 E;  2L33 A;  4JV5 E;  1HNW E;  2KHX A;  4M30 A;  1I4S A;  4M2Z A;  2B7T A;  4KZS A;  5T6J A;  1FKA E;  4LF7 E;  3RMP A;  1SR9 A;  5AE3 A;  1RQ0 A;  1JFZ A;  4LF5 E;  1N34 E;  5AE1 A;  5CFF E;  1U61 A;  2NUG A;  4BBY A;  3RV0 A;  4L5N C;  1X48 A;  4LFC E;  5F3W A;  3O2R B;  1YYK A;  1GZ6 A;  2NA2 A;  1HNZ E;  4K0K E;  2A11 A;  5AE2 A;  2UU9 E;  2UXC E;  4Q28 A;  4AQY E;  2M4I A;  2V89 A;  5AAS A;  1QU6 A;  4LFA E;  2L2M A;  2V87 A;  2L3J A;  3IWB A;  4WPY A;  4DMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...