1YYOA

Crystal structure of rnase iii mutant e110k from aquifex aeolicus complexed with double-stranded rna at 2.9-angstrom resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
220
structure length
220
Chain Sequence
b'MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFKALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*CP*GP*CP*GP*AP*AP*UP*UP*CP*GP*CP*G)-3'
publication title Intermediate states of ribonuclease III in complex with double-stranded RNA
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
total genus 66
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2005-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 1yyoA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1yyoA02
3N3WA 1XMQE 1YYOA 1YYKA 4M30A 4JI7E 5LMUE 4DR1E 1I4SA 3VYXA 1RC7A 2LUPB 4LF9E 1N34E 4JI0E 4DR4E 4DV0E 1IBME 4LF8E 5CFFE 4OOGC 2N3GA 1HR0E 4NXNE 4NXME 4DV2E 2LTRA 2MDRA 5BR8E 3HTXA 1STUA 4DR6E 4JI2E 1N33E 1J26A 2UUCE 1YYWA 1FKAE 2RSMA 4DV1E 2QVWA 1O0WA 2B7VA 4JI5E 2JY9A 2B3TB 4K0KE 4JI8E 4DV4E 4JI3E 4JI6E 1EKZA 1HNWE 4B3ME 2RS6A 2DB2A 3RV0A 2YT4A 2LJHA 4YHHE 3C4TA 4B3TE 1T4OA 2JVAA 1RC5A 2L2MA 2LRSA 2GSLA 4GKKE 2LTSA 2L33A 4DUYE 2EZ6A 1UHZA 3O2RB 4DR2E 1QU6A 3T1HE 4GKJE 2HHHE 1IBLE 4B3RE 4X64E 2DIXA 4DUZE 3P1XA 3OTOE 2VQFE 4JI4E 2A11A 4AQYE 3ADGA 2VQEE 1DI2A 2B7TA 4YY3E 1HNZE 4DR5E 2KHXA 1XNRE 1WHQA 3ADJA 1X49A 4LFAE 4LF6E 2RTXA 5LMNE 1HNXE 1JFZA 4DV5E 4DV3E 4M2ZA 4X65E 1GQEA 4X62E 2L3JA 1XNQE 3J7Yp 1FJGE 3ADIA 4KHPE 4DKKA 1RQ0A 2UUBE 2L2NA 1I94E 4X66E 4JV5E 2LUQA 4DR7E 1UILA 2IHR1 2NUFA 2EB1A 1XMOE 1ZBTA 4WYQB 2L2KB 1IBKE 3RV1A 4LF4E 1X48A 2E5LE 1T4LB 4JYAE 2UXBE 2NA2A 3C4BA 2FFLA 4LFCE 2ZM6E 4B3SE 4LF5E 4DV7E 1U61A 2UXDE 4OX9E 1YZ9A 3T1YE 4OUNA 1X47A 2DMYA 3O2RA 2LBSB 1WHNA 2NUGA 4DV6E 1PKPA 1J5EE 2UXCE 3LLHA 2RS7A 4X8WA 1N32E 3ADLA 1N36E 2N3HA 1T4NA 4LF7E 4LFBE 4JI1E 5IWAE 2NUEA 3VYYA 2CPNA 2UU9E 2F4VE 4DR3E 2UUAE 2L3CA 4WFTA
chains in the Genus database with same CATH superfamily
5T6JA 1YYOA 1KJKA 2EPRA 4N4RB 3KWRA 2R76A 4DR4E 2E72A 3EPLA 4R2DA 3HTXA 1N33E 2UUCE 5A6KA 2LE2A 5TSEA 1FKAE 2GPIA 2RSMA 4DV1E 5DNYA 1WXRA 2JY9A 3J81C 4JI3E 2YTFA 4R2EA 2EM5A 4BHBA 3J80C 1BB8A 2PRTA 3UK3C 3C4TA 2JVAA 1RC5A 2LRSA 1X6FA 4R2PA 2R1FA 2EP3A 2EWLA 2JYAA 1UHZA 1YUJA 4I8OA 1G2FC 2V88A 4F6MA 2RPCA 2EN1A 5AC4A 4B3RE 3EPJA 2EPZA 3ADGA 2VQEE 2EOQA 4X9JA 2EOIA 1DI2A 2B7TA 4YY3E 2DGCA 2KHXA 2B9DA 1GTKA 1SR9A 1WHQA 4LF6E 1JFZA 2YRMA 2EOFA 1JK1A 4GEQB 3THOB 5AE1A 5IV8B 4M0VA 2LT7A 2E1MA 2EM8A 3J7Yp 4KHPE 2YU8A 2HJJA 1RQ0A 4X66E 4JV5E 4F9CB 4RH8A 4BC9A 4WYQB 2EE8A 2YSPA 1IBKE 2VRDA 4O5GA 2V85A 3OMLA 2EQ1A 1PJSA 2YU5A 3IWBA 4B3SE 1L4SA 2ODRD 2LO3A 1WRJA 2YPNA 1YZ9A 4OUNA 2EN2A 2WBUA 5IXMB 1WHNA 2EQ0A 3VK6A 2HGHA 1J5EE 5KL2A 3LLHA 4DMIA 2MC5A 1JK2A 3ADLA 2JP9A 4L5NC 5KL5A 4LFBE 2JR1A 1DGCA 4FK5C 4LU9A 2EPMX 1ZTDA 2UUAE 2L3CA 3N3WA 1YYKA 4JI7E 2EMAA 4O24A 2DLKA 1N34E 4DV0E 2EN7A 3ZOQB 1BBOA 4OOGC 2V87A 2EM9A 1HR0E 2EOYA 4NXME 4TUIA 2EMHA 4DV2E 2ADRA 4LTYA 2JPAA 1YYWA 1EH7A 1NCSA 2B7VA 2B3TB 2DMIA 3C6KA 4O43A 4DV4E 5F3WA 4JI6E 2LVHA 1HNWE 1EH8A 2RS6A 1T4OA 2RQLA 4WSPA 2EL4A 4DUYE 1UBDC 3MHHC 2FTXB 2YTPA 2MDGA 4ZYGA 1A1HA 1IBLE 2BBGA 2YTOA 2M7QA 3IWDA 4AQYE 3BGHA 2YRHA 2FGGA 5AE3A 4WX9A 1A1JA 1F2IG 2VE7C 4BBYA 1XNRE 1X5WA 3ADJA 1X49A 2EN6A 4MLVA 5LMNE 3DF6A 2WBTA 2EN3A 4L8NA 1WJPA 2EN4A 2EOMA 2L3JA 2EOJA 2EPOA 1XNQE 1T39A 3JAMC 3VHTB 1AH5A 2EMZA 4DKKA 3HXLA 3L00A 2L2NA 2EOOA 4F54A 1UN6B 2EM0A 2EMCA 2NUFA 4TUGA 2GHFA 3AUZA 1ZBTA 2L2KB 2CT1A 2EMLA 2YZTA 2EN8A 3RV1A 2EMYA 3MSWA 3C6MA 2UXBE 2YWQA 1IQOA 4LFCE 2HC5A 5A2QC 2ZM6E 1ZBQA 4LF5E 2EM7A 4DV7E 2A25A 2EM2A 1ZAAC 2EPCA 3FIGA 2H36X 4R2RA 2EPAA 2FV4B 2LBSB 1PKPA 2EQ3A 2ENAA 2EMWA 2RS7A 3BF2A 4X8WA 1N32E 2N3HA 1T4NA 4JI1E 2YTDA 5IWAE 2M1SA 1PDAA 2UU9E 2F4VE 4DR3E 4WXCA 1DQ3A 2EPUA 5AC5A 5LLQA 1XMQE 2EL5A 2I13A 3EPKA 2K7IA 5LMUE 3VYXA 1RC7A 2ENHA 5AE2A 1TF3A 2D9HA 4JI0E 5A6BA 1IBME 4LF8E 5CFFE 2N3GA 2YTEA 2DSYA 1ZU1A 2LTRA 4DR6E 4JI2E 2V86A 2MKNA 2EM6A 2L92A 1O0WA 4JI5E 2WBSA 2RSIA 2ELZA 1A1FA 2DB2A 1N3GA 2LJHA 2YT4A 1QNTA 2L2MA 2LJUA 4GKKE 5AASA 2DLQA 2MKDA 1SFEA 4Q28A 4R2SA 2EZ6A 4R2CA 4BC7A 2CTDA 2LV2A 1QU6A 3T1HE 2EL6A 4GKJE 2Q8UA 4MLQA 2HHHE 4X64E 2DIXA 3EQ1A 2A11A 2JOBA 2MC6A 4R03A 4WXDA 4R2QA 1IMUA 3LMLA 5KL4A 3BIDA 4DR5E 2N8XA 2K4VA 2ODRC 3THNA 4HEIA 2KONA 2RTXA 2YTJA 1BBGA 2EOEA 5A6JA 1X6HA 4GZNC 4DV3E 3MHSC 4X65E 4M9VC 4HTGA 4KZSA 2EOHA 5FLXC 1FJGE 2UUBE 2EOZA 2YTGA 1XMOE 1MGTA 1RMDA 4IS1C 4LF4E 2V8QB 4JYAE 1T4LB 3C4BA 2FFLA 4R2AA 2WZOA 3M99B 2EM3A 1TN9A 1U61A 2V89A 1A1IA 2UXDE 2M4IA 4WSGA 2YSOA 4OX9E 3T1YE 1X6EA 1X3CA 1X47A 2YTIA 2DMYA 3O2RA 4ZYDA 2NUGA 4DV6E 1YPNA 3HPZA 3JTZA 2EMFA 1A1KA 4ZYEA 3RMPA 4P7DA 1IQSA 1NEIA 4Q35B 2CSHA 2EMBA 4M30A 2YTNA 2EPNA 1I4SA 2EOXA 4DR1E 1B69A 2LUPB 5A69A 4LF9E 4NXNE 5ADZA 5BR8E 2MDRA 1STUA 1J26A 3BBGA 2QVWA 5KL3A 3F6HA 2F8BA 4NZVA 4JI8E 4BS9A 4K0KE 2M9AA 1EKZA 3F6GA 5KL6A 2EORA 2LCEA 4BMJA 4B3ME 3RV0A 4YHHE 3AV0A 4B3TE 4NHRA 2YRKA 2GSLA 2L6MA 1YUIA 2G7HA 2LTSA 3JU0A 4J8ZA 2KOUA 2L33A 3KZZA 3O2RB 2I9IA 2V83A 4DR2E 1Z1BA 3HQ1A 2EPPA 1YSAC 4DUZE 3P1XA 3OTOE 2VQFE 3TQMA 4JI4E 2EPXA 4F2JC 5A6AA 1YFHA 3HPSA 1AAYA 1G2DC 2ELYA 1HNZE 2GLIA 4O4KA 2VF1A 2ENCA 4WPYA 2JXPA 4LFAE 1KYQA 4BCAA 2WCC3 4ZYHA 4DV5E 1LLMC 1A1LA 1TF6A 4M2ZA 3IWCA 2DRPA 2EPLX 1GQEA 2EM4A 2YTQA 4X62E 2J7JA 3KZYA 3ADIA 4P78A 2JWOA 5KL7A 2LMZA 1I94E 1PJTA 1T38A 3K6QA 2LUQA 4KWYA 2NABA 4DR7E 1UILA 1EH6A 2IHR1 2EMGA 2EB1A 2EOSA 5A6BD 2EJ4A 3ECRA 2EPKX 1X48A 2E5LE 5LL6R 2NA2A 1A1GA 1MEYC 4IJDA 2EMIA 1P47A 2BB8A 3H09A 4RHBB 1ZR9A 2EMXA 2L8TA 3DJWA 3QG5C 2UXCE 4F9AB 1GZ6A 1N36E 2JOXA 4LF7E 3J7AG 4F9BB 2NUEA 3VYYA 2CPNA 1PJQA 3EPHA 4R8OA 5IT9C 2EMKA 1HNXE 4BHCA 4WFTA 4F6NA
chains in the Genus database with same CATH topology
3N3WA 5T6JA 1YYOA 1XMQE 1YYKA 4M30A 4JI7E 5LMUE 4DR1E 1I4SA 3KWRA 3VYXA 1RC7A 5AE2A 2LUPB 4LF9E 1N34E 4JI0E 4DR4E 4DV0E 1IBME 4LF8E 3ZOQB 5CFFE 4OOGC 2N3GA 2V87A 1HR0E 4NXNE 2DSYA 5ADZA 4NXME 4TUIA 4DV2E 2LTRA 2MDRA 4LTYA 5BR8E 1STUA 3HTXA 4JI2E 2V86A 4DR6E 2UUCE 1N33E 1J26A 2LE2A 1YYWA 1FKAE 2RSMA 2L92A 2QVWA 1O0WA 2B7VA 5DNYA 3F6HA 4DV1E 4JI5E 1WXRA 2JY9A 2B3TB 2F8BA 4JI8E 4BS9A 3J81C 4DV4E 5F3WA 4JI3E 4JI6E 4K0KE 1EKZA 3J80C 3F6GA 4B3ME 2RS6A 4BMJA 2DB2A 1HNWE 3RV0A 2LJHA 2YT4A 3AV0A 3C4TA 4YHHE 4B3TE 1T4OA 2JVAA 1RC5A 2L2MA 2LRSA 2GSLA 2L6MA 4WSPA 2G7HA 2LTSA 3JU0A 4J8ZA 2KOUA 4Q28A 5AASA 2L33A 4DUYE 4GKKE 2EZ6A 2EWLA 1UHZA 4BC7A 4I8OA 3O2RB 2V83A 4DR2E 1QU6A 2FTXB 3HQ1A 3T1HE 2V88A 4GKJE 2HHHE 1IBLE 4B3RE 4X64E 2DIXA 4DUZE 3P1XA 3OTOE 2VQFE 4JI4E 2M7QA 2A11A 2JOBA 2MC6A 3IWDA 4R03A 4AQYE 3ADGA 2VQEE 2FGGA 5AE3A 1DI2A 3HPSA 3LMLA 2B7TA 4YY3E 1HNZE 2VE7C 4BBYA 4DR5E 2KHXA 1XNRE 2B9DA 2K4VA 2VF1A 2ODRC 1SR9A 1WHQA 3ADJA 4WPYA 1X49A 4LFAE 4LF6E 2KONA 2RTXA 5LMNE 1HNXE 3DF6A 1JFZA 4BCAA 4L8NA 4GEQB 4DV5E 4DV3E 4M2ZA 3IWCA 4X65E 5AE1A 1GQEA 4X62E 4M0VA 4KZSA 2L3JA 1XNQE 2E1MA 3JAMC 5FLXC 3J7Yp 1FJGE 3ADIA 4KHPE 4P78A 4DKKA 1RQ0A 3HXLA 2JWOA 2UUBE 2L2NA 2LMZA 4X66E 4F54A 1I94E 3K6QA 2LUQA 4F9CB 4JV5E 4BC9A 1UILA 4DR7E 2IHR1 2NUFA 2EB1A 4TUGA 1XMOE 3AUZA 1ZBTA 4WYQB 2L2KB 2YZTA 3MSWA 3RV1A 1IBKE 4LF4E 2V8QB 1X48A 2E5LE 1T4LB 2V85A 3OMLA 4JYAE 5LL6R 2NA2A 2UXBE 3C4BA 2FFLA 3IWBA 4LFCE 5A2QC 2ZM6E 2WZOA 4B3SE 1ZBQA 4LF5E 4DV7E 1U61A 2V89A 2ODRD 2UXDE 2M4IA 4OX9E 1YZ9A 3FIGA 2L3CA 3T1YE 4OUNA 1X47A 2DMYA 2H36X 3H09A 2FV4B 2L8TA 3O2RA 3DJWA 2LBSB 1WHNA 2NUGA 4DV6E 1PKPA 3VK6A 1J5EE 2UXCE 3LLHA 2RS7A 4DMIA 3HPZA 4X8WA 2MC5A 4F9AB 1N32E 1GZ6A 3ADLA 3JTZA 1N36E 2JOXA 1T4NA 2N3HA 4L5NC 4JI1E 4LF7E 3J7AG 5IWAE 2JR1A 4F9BB 4LFBE 2NUEA 3RMPA 2M1SA 3VYYA 4P7DA 2CPNA 4LU9A 2UU9E 4DR3E 2F4VE 4R8OA 5IT9C 2UUAE 1DQ3A 4WFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N3W A;  1XMQ E;  1YYO A;  1YYK A;  4M30 A;  4JI7 E;  5LMU E;  4DR1 E;  1I4S A;  3VYX A;  1RC7 A;  2LUP B;  4LF9 E;  1N34 E;  4JI0 E;  4DR4 E;  4DV0 E;  1IBM E;  4LF8 E;  5CFF E;  4OOG C;  2N3G A;  1HR0 E;  4NXN E;  4NXM E;  4DV2 E;  2LTR A;  2MDR A;  5BR8 E;  3HTX A;  1STU A;  4DR6 E;  4JI2 E;  1N33 E;  1J26 A;  2UUC E;  1YYW A;  1FKA E;  2RSM A;  4DV1 E;  2QVW A;  1O0W A;  2B7V A;  4JI5 E;  2JY9 A;  2B3T B;  4K0K E;  4JI8 E;  4DV4 E;  4JI3 E;  4JI6 E;  1EKZ A;  1HNW E;  4B3M E;  2RS6 A;  2DB2 A;  3RV0 A;  2YT4 A;  2LJH A;  4YHH E;  3C4T A;  4B3T E;  1T4O A;  2JVA A;  1RC5 A;  2L2M A;  2LRS A;  2GSL A;  4GKK E;  2LTS A;  2L33 A;  4DUY E;  2EZ6 A;  1UHZ A;  3O2R B;  4DR2 E;  1QU6 A;  3T1H E;  4GKJ E;  2HHH E;  1IBL E;  4B3R E;  4X64 E;  2DIX A;  4DUZ E;  3P1X A;  3OTO E;  2VQF E;  4JI4 E;  2A11 A;  4AQY E;  3ADG A;  2VQE E;  1DI2 A;  2B7T A;  4YY3 E;  1HNZ E;  4DR5 E;  2KHX A;  1XNR E;  1WHQ A;  3ADJ A;  1X49 A;  4LFA E;  4LF6 E;  2RTX A;  5LMN E;  1HNX E;  1JFZ A;  4DV5 E;  4DV3 E;  4M2Z A;  4X65 E;  1GQE A;  4X62 E;  2L3J A;  1XNQ E;  3J7Y p;  1FJG E;  3ADI A;  4KHP E;  4DKK A;  1RQ0 A;  2UUB E;  2L2N A;  1I94 E;  4X66 E;  4JV5 E;  2LUQ A;  4DR7 E;  1UIL A;  2IHR 1;  2NUF A;  2EB1 A;  1XMO E;  1ZBT A;  4WYQ B;  2L2K B;  1IBK E;  3RV1 A;  4LF4 E;  1X48 A;  2E5L E;  1T4L B;  4JYA E;  2UXB E;  2NA2 A;  3C4B A;  2FFL A;  4LFC E;  2ZM6 E;  4B3S E;  4LF5 E;  4DV7 E;  1U61 A;  2UXD E;  4OX9 E;  1YZ9 A;  3T1Y E;  4OUN A;  1X47 A;  2DMY A;  3O2R A;  2LBS B;  1WHN A;  2NUG A;  4DV6 E;  1PKP A;  1J5E E;  2UXC E;  3LLH A;  2RS7 A;  4X8W A;  1N32 E;  3ADL A;  1N36 E;  2N3H A;  1T4N A;  4LF7 E;  4LFB E;  4JI1 E;  5IWA E;  2NUE A;  3VYY A;  2CPN A;  2UU9 E;  2F4V E;  4DR3 E;  2UUA E;  2L3C A;  4WFT A; 
#chains in the Genus database with same CATH topology
 5T6J A;  1YYO A;  1KJK A;  2EPR A;  4N4R B;  3KWR A;  2R76 A;  4DR4 E;  2E72 A;  3EPL A;  4R2D A;  3HTX A;  1N33 E;  2UUC E;  5A6K A;  2LE2 A;  5TSE A;  1FKA E;  2GPI A;  2RSM A;  4DV1 E;  5DNY A;  1WXR A;  2JY9 A;  3J81 C;  4JI3 E;  2YTF A;  4R2E A;  2EM5 A;  4BHB A;  3J80 C;  1BB8 A;  2PRT A;  3UK3 C;  3C4T A;  2JVA A;  1RC5 A;  2LRS A;  1X6F A;  4R2P A;  2R1F A;  2EP3 A;  2EWL A;  2JYA A;  1UHZ A;  1YUJ A;  4I8O A;  1G2F C;  2V88 A;  4F6M A;  2RPC A;  2EN1 A;  5AC4 A;  4B3R E;  3EPJ A;  2EPZ A;  3ADG A;  2VQE E;  2EOQ A;  4X9J A;  2EOI A;  1DI2 A;  2B7T A;  4YY3 E;  2DGC A;  2KHX A;  2B9D A;  1GTK A;  1SR9 A;  1WHQ A;  4LF6 E;  1JFZ A;  2YRM A;  2EOF A;  1JK1 A;  4GEQ B;  3THO B;  5AE1 A;  5IV8 B;  4M0V A;  2LT7 A;  2E1M A;  2EM8 A;  3J7Y p;  4KHP E;  2YU8 A;  2HJJ A;  1RQ0 A;  4X66 E;  4JV5 E;  4F9C B;  4RH8 A;  4BC9 A;  4WYQ B;  2EE8 A;  2YSP A;  1IBK E;  2VRD A;  4O5G A;  2V85 A;  3OML A;  2EQ1 A;  1PJS A;  2YU5 A;  3IWB A;  4B3S E;  1L4S A;  2ODR D;  2LO3 A;  1WRJ A;  2YPN A;  1YZ9 A;  4OUN A;  2EN2 A;  2WBU A;  5IXM B;  1WHN A;  2EQ0 A;  3VK6 A;  2HGH A;  1J5E E;  5KL2 A;  3LLH A;  4DMI A;  2MC5 A;  1JK2 A;  3ADL A;  2JP9 A;  4L5N C;  5KL5 A;  4LFB E;  2JR1 A;  1DGC A;  4FK5 C;  4LU9 A;  2EPM X;  1ZTD A;  2UUA E;  2L3C A;  3N3W A;  1YYK A;  4JI7 E;  2EMA A;  4O24 A;  2DLK A;  1N34 E;  4DV0 E;  2EN7 A;  3ZOQ B;  1BBO A;  4OOG C;  2V87 A;  2EM9 A;  1HR0 E;  2EOY A;  4NXM E;  4TUI A;  2EMH A;  4DV2 E;  2ADR A;  4LTY A;  2JPA A;  1YYW A;  1EH7 A;  1NCS A;  2B7V A;  2B3T B;  2DMI A;  3C6K A;  4O43 A;  4DV4 E;  5F3W A;  4JI6 E;  2LVH A;  1HNW E;  1EH8 A;  2RS6 A;  1T4O A;  2RQL A;  4WSP A;  2EL4 A;  4DUY E;  1UBD C;  3MHH C;  2FTX B;  2YTP A;  2MDG A;  4ZYG A;  1A1H A;  1IBL E;  2BBG A;  2YTO A;  2M7Q A;  3IWD A;  4AQY E;  3BGH A;  2YRH A;  2FGG A;  5AE3 A;  4WX9 A;  1A1J A;  1F2I G;  2VE7 C;  4BBY A;  1XNR E;  1X5W A;  3ADJ A;  1X49 A;  2EN6 A;  4MLV A;  5LMN E;  3DF6 A;  2WBT A;  2EN3 A;  4L8N A;  1WJP A;  2EN4 A;  2EOM A;  2L3J A;  2EOJ A;  2EPO A;  1XNQ E;  1T39 A;  3JAM C;  3VHT B;  1AH5 A;  2EMZ A;  4DKK A;  3HXL A;  3L00 A;  2L2N A;  2EOO A;  4F54 A;  1UN6 B;  2EM0 A;  2EMC A;  2NUF A;  4TUG A;  2GHF A;  3AUZ A;  1ZBT A;  2L2K B;  2CT1 A;  2EML A;  2YZT A;  2EN8 A;  3RV1 A;  2EMY A;  3MSW A;  3C6M A;  2UXB E;  2YWQ A;  1IQO A;  4LFC E;  2HC5 A;  5A2Q C;  2ZM6 E;  1ZBQ A;  4LF5 E;  2EM7 A;  4DV7 E;  2A25 A;  2EM2 A;  1ZAA C;  2EPC A;  3FIG A;  2H36 X;  4R2R A;  2EPA A;  2FV4 B;  2LBS B;  1PKP A;  2EQ3 A;  2ENA A;  2EMW A;  2RS7 A;  3BF2 A;  4X8W A;  1N32 E;  2N3H A;  1T4N A;  4JI1 E;  2YTD A;  5IWA E;  2M1S A;  1PDA A;  2UU9 E;  2F4V E;  4DR3 E;  4WXC A;  1DQ3 A;  2EPU A;  5AC5 A;  5LLQ A;  1XMQ E;  2EL5 A;  2I13 A;  3EPK A;  2K7I A;  5LMU E;  3VYX A;  1RC7 A;  2ENH A;  5AE2 A;  1TF3 A;  2D9H A;  4JI0 E;  5A6B A;  1IBM E;  4LF8 E;  5CFF E;  2N3G A;  2YTE A;  2DSY A;  1ZU1 A;  2LTR A;  4DR6 E;  4JI2 E;  2V86 A;  2MKN A;  2EM6 A;  2L92 A;  1O0W A;  4JI5 E;  2WBS A;  2RSI A;  2ELZ A;  1A1F A;  2DB2 A;  1N3G A;  2LJH A;  2YT4 A;  1QNT A;  2L2M A;  2LJU A;  4GKK E;  5AAS A;  2DLQ A;  2MKD A;  1SFE A;  4Q28 A;  4R2S A;  2EZ6 A;  4R2C A;  4BC7 A;  2CTD A;  2LV2 A;  1QU6 A;  3T1H E;  2EL6 A;  4GKJ E;  2Q8U A;  4MLQ A;  2HHH E;  4X64 E;  2DIX A;  3EQ1 A;  2A11 A;  2JOB A;  2MC6 A;  4R03 A;  4WXD A;  4R2Q A;  1IMU A;  3LML A;  5KL4 A;  3BID A;  4DR5 E;  2N8X A;  2K4V A;  2ODR C;  3THN A;  4HEI A;  2KON A;  2RTX A;  2YTJ A;  1BBG A;  2EOE A;  5A6J A;  1X6H A;  4GZN C;  4DV3 E;  3MHS C;  4X65 E;  4M9V C;  4HTG A;  4KZS A;  2EOH A;  5FLX C;  1FJG E;  2UUB E;  2EOZ A;  2YTG A;  1XMO E;  1MGT A;  1RMD A;  4IS1 C;  4LF4 E;  2V8Q B;  4JYA E;  1T4L B;  3C4B A;  2FFL A;  4R2A A;  2WZO A;  3M99 B;  2EM3 A;  1TN9 A;  1U61 A;  2V89 A;  1A1I A;  2UXD E;  2M4I A;  4WSG A;  2YSO A;  4OX9 E;  3T1Y E;  1X6E A;  1X3C A;  1X47 A;  2YTI A;  2DMY A;  3O2R A;  4ZYD A;  2NUG A;  4DV6 E;  1YPN A;  3HPZ A;  3JTZ A;  2EMF A;  1A1K A;  4ZYE A;  3RMP A;  4P7D A;  1IQS A;  1NEI A;  4Q35 B;  2CSH A;  2EMB A;  4M30 A;  2YTN A;  2EPN A;  1I4S A;  2EOX A;  4DR1 E;  1B69 A;  2LUP B;  5A69 A;  4LF9 E;  4NXN E;  5ADZ A;  5BR8 E;  2MDR A;  1STU A;  1J26 A;  3BBG A;  2QVW A;  5KL3 A;  3F6H A;  2F8B A;  4NZV A;  4JI8 E;  4BS9 A;  4K0K E;  2M9A A;  1EKZ A;  3F6G A;  5KL6 A;  2EOR A;  2LCE A;  4BMJ A;  4B3M E;  3RV0 A;  4YHH E;  3AV0 A;  4B3T E;  4NHR A;  2YRK A;  2GSL A;  2L6M A;  1YUI A;  2G7H A;  2LTS A;  3JU0 A;  4J8Z A;  2KOU A;  2L33 A;  3KZZ A;  3O2R B;  2I9I A;  2V83 A;  4DR2 E;  1Z1B A;  3HQ1 A;  2EPP A;  1YSA C;  4DUZ E;  3P1X A;  3OTO E;  2VQF E;  3TQM A;  4JI4 E;  2EPX A;  4F2J C;  5A6A A;  1YFH A;  3HPS A;  1AAY A;  1G2D C;  2ELY A;  1HNZ E;  2GLI A;  4O4K A;  2VF1 A;  2ENC A;  4WPY A;  2JXP A;  4LFA E;  1KYQ A;  4BCA A;  2WCC 3;  4ZYH A;  4DV5 E;  1LLM C;  1A1L A;  1TF6 A;  4M2Z A;  3IWC A;  2DRP A;  2EPL X;  1GQE A;  2EM4 A;  2YTQ A;  4X62 E;  2J7J A;  3KZY A;  3ADI A;  4P78 A;  2JWO A;  5KL7 A;  2LMZ A;  1I94 E;  1PJT A;  1T38 A;  3K6Q A;  2LUQ A;  4KWY A;  2NAB A;  4DR7 E;  1UIL A;  1EH6 A;  2IHR 1;  2EMG A;  2EB1 A;  2EOS A;  5A6B D;  2EJ4 A;  3ECR A;  2EPK X;  1X48 A;  2E5L E;  5LL6 R;  2NA2 A;  1A1G A;  1MEY C;  4IJD A;  2EMI A;  1P47 A;  2BB8 A;  3H09 A;  4RHB B;  1ZR9 A;  2EMX A;  2L8T A;  3DJW A;  3QG5 C;  2UXC E;  4F9A B;  1GZ6 A;  1N36 E;  2JOX A;  4LF7 E;  3J7A G;  4F9B B;  2NUE A;  3VYY A;  2CPN A;  1PJQ A;  3EPH A;  4R8O A;  5IT9 C;  2EMK A;  1HNX E;  4BHC A;  4WFT A;  4F6N A; 
#chains in the Genus database with same CATH homology
 3N3W A;  5T6J A;  1YYO A;  1XMQ E;  1YYK A;  4M30 A;  4JI7 E;  5LMU E;  4DR1 E;  1I4S A;  3KWR A;  3VYX A;  1RC7 A;  5AE2 A;  2LUP B;  4LF9 E;  1N34 E;  4JI0 E;  4DR4 E;  4DV0 E;  1IBM E;  4LF8 E;  3ZOQ B;  5CFF E;  4OOG C;  2N3G A;  2V87 A;  1HR0 E;  4NXN E;  2DSY A;  5ADZ A;  4NXM E;  4TUI A;  4DV2 E;  2LTR A;  2MDR A;  4LTY A;  5BR8 E;  1STU A;  3HTX A;  4JI2 E;  2V86 A;  4DR6 E;  2UUC E;  1N33 E;  1J26 A;  2LE2 A;  1YYW A;  1FKA E;  2RSM A;  2L92 A;  2QVW A;  1O0W A;  2B7V A;  5DNY A;  3F6H A;  4DV1 E;  4JI5 E;  1WXR A;  2JY9 A;  2B3T B;  2F8B A;  4JI8 E;  4BS9 A;  3J81 C;  4DV4 E;  5F3W A;  4JI3 E;  4JI6 E;  4K0K E;  1EKZ A;  3J80 C;  3F6G A;  4B3M E;  2RS6 A;  4BMJ A;  2DB2 A;  1HNW E;  3RV0 A;  2LJH A;  2YT4 A;  3AV0 A;  3C4T A;  4YHH E;  4B3T E;  1T4O A;  2JVA A;  1RC5 A;  2L2M A;  2LRS A;  2GSL A;  2L6M A;  4WSP A;  2G7H A;  2LTS A;  3JU0 A;  4J8Z A;  2KOU A;  4Q28 A;  5AAS A;  2L33 A;  4DUY E;  4GKK E;  2EZ6 A;  2EWL A;  1UHZ A;  4BC7 A;  4I8O A;  3O2R B;  2V83 A;  4DR2 E;  1QU6 A;  2FTX B;  3HQ1 A;  3T1H E;  2V88 A;  4GKJ E;  2HHH E;  1IBL E;  4B3R E;  4X64 E;  2DIX A;  4DUZ E;  3P1X A;  3OTO E;  2VQF E;  4JI4 E;  2M7Q A;  2A11 A;  2JOB A;  2MC6 A;  3IWD A;  4R03 A;  4AQY E;  3ADG A;  2VQE E;  2FGG A;  5AE3 A;  1DI2 A;  3HPS A;  3LML A;  2B7T A;  4YY3 E;  1HNZ E;  2VE7 C;  4BBY A;  4DR5 E;  2KHX A;  1XNR E;  2B9D A;  2K4V A;  2VF1 A;  2ODR C;  1SR9 A;  1WHQ A;  3ADJ A;  4WPY A;  1X49 A;  4LFA E;  4LF6 E;  2KON A;  2RTX A;  5LMN E;  1HNX E;  3DF6 A;  1JFZ A;  4BCA A;  4L8N A;  4GEQ B;  4DV5 E;  4DV3 E;  4M2Z A;  3IWC A;  4X65 E;  5AE1 A;  1GQE A;  4X62 E;  4M0V A;  4KZS A;  2L3J A;  1XNQ E;  2E1M A;  3JAM C;  5FLX C;  3J7Y p;  1FJG E;  3ADI A;  4KHP E;  4P78 A;  4DKK A;  1RQ0 A;  3HXL A;  2JWO A;  2UUB E;  2L2N A;  2LMZ A;  4X66 E;  4F54 A;  1I94 E;  3K6Q A;  2LUQ A;  4F9C B;  4JV5 E;  4BC9 A;  1UIL A;  4DR7 E;  2IHR 1;  2NUF A;  2EB1 A;  4TUG A;  1XMO E;  3AUZ A;  1ZBT A;  4WYQ B;  2L2K B;  2YZT A;  3MSW A;  3RV1 A;  1IBK E;  4LF4 E;  2V8Q B;  1X48 A;  2E5L E;  1T4L B;  2V85 A;  3OML A;  4JYA E;  5LL6 R;  2NA2 A;  2UXB E;  3C4B A;  2FFL A;  3IWB A;  4LFC E;  5A2Q C;  2ZM6 E;  2WZO A;  4B3S E;  1ZBQ A;  4LF5 E;  4DV7 E;  1U61 A;  2V89 A;  2ODR D;  2UXD E;  2M4I A;  4OX9 E;  1YZ9 A;  3FIG A;  2L3C A;  3T1Y E;  4OUN A;  1X47 A;  2DMY A;  2H36 X;  3H09 A;  2FV4 B;  2L8T A;  3O2R A;  3DJW A;  2LBS B;  1WHN A;  2NUG A;  4DV6 E;  1PKP A;  3VK6 A;  1J5E E;  2UXC E;  3LLH A;  2RS7 A;  4DMI A;  3HPZ A;  4X8W A;  2MC5 A;  4F9A B;  1N32 E;  1GZ6 A;  3ADL A;  3JTZ A;  1N36 E;  2JOX A;  1T4N A;  2N3H A;  4L5N C;  4JI1 E;  4LF7 E;  3J7A G;  5IWA E;  2JR1 A;  4F9B B;  4LFB E;  2NUE A;  3RMP A;  2M1S A;  3VYY A;  4P7D A;  2CPN A;  4LU9 A;  2UU9 E;  4DR3 E;  2F4V E;  4R8O A;  5IT9 C;  2UUA E;  1DQ3 A;  4WFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...