1YYOA

Crystal structure of rnase iii mutant e110k from aquifex aeolicus complexed with double-stranded rna at 2.9-angstrom resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
220
structure length
220
Chain Sequence
MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFKALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords 5'-R(*CP*GP*CP*GP*AP*AP*UP*UP*CP*GP*CP*G)-3'
publication title Intermediate states of ribonuclease III in complex with double-stranded RNA
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 66
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2005-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 1yyoA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1yyoA02
4DV3E 4YY3E 1UHZA 4JI0E 2UUCE 2VQFE 4LF9E 2QVWA 2HHHE 1XNQE 4JI3E 2GSLA 1UILA 2RS6A 1J26A 4M30A 2A11A 4DR5E 2LTRA 2E5LE 2JY9A 2N3HA 1HNZE 4DR2E 4DV0E 1X48A 1I94E 1I4SA 1T4LB 1STUA 2NUFA 1YYOA 4DR3E 3OTOE 4YHHE 1YYWA 3O2RA 4DV5E 1QU6A 1T4NA 1YZ9A 2ZM6E 4LF8E 5LMNE 4DV7E 2L3CA 4JV5E 1XMQE 3O2RB 3T1HE 1FJGE 4GKKE 4DV2E 2UXDE 2L33A 2F4VE 1U61A 5CFFE 1N32E 4DUZE 4LF7E 2LRSA 2N3GA 2RSMA 2UU9E 3RV0A 4B3TE 4WFTA 1DI2A 2LUPB 4DR7E 4JI1E 2EZ6A 1XNRE 3ADJA 4OUNA 2UUBE 5IWAE 4JYAE 4OX9E 3T1YE 4LFAE 1YYKA 2NA2A 2LTSA 1WHNA 1RQ0A 2DB2A 4JI4E 2NUEA 4LF6E 3N3WA 4LFCE 2LJHA 1J5EE 3ADIA 1RC7A 1JFZA 2B7TA 2L3JA 4NXNE 3HTXA 1N33E 1IBKE 4DV6E 2B3TB 4B3SE 4DV1E 2UXCE 2KHXA 2RS7A 4X62E 3J7Yp 2FFLA 2L2MA 4X8WA 1XMOE 1FKAE 1EKZA 1X47A 2IHR1 4JI2E 1HR0E 3VYXA 4LF5E 3VYYA 2UXBE 2YT4A 4OOGC 4JI6E 3C4BA 1HNXE 4JI8E 2L2NA 5BR8E 1N34E 1T4OA 4JI5E 2LUQA 1IBLE 4K0KE 4X64E 3P1XA 2NUGA 2RTXA 1O0WA 2B7VA 1N36E 4DR1E 4M2ZA 4DR6E 4DV4E 4AQYE 4NXME 4GKJE 4DR4E 3LLHA 4LF4E 5LMUE 2CPNA 2DMYA 2MDRA 3ADLA 4B3ME 3C4TA 1IBME 1PKPA 4LFBE 2EB1A 4X65E 4DUYE 2JVAA 1X49A 2VQEE 2UUAE 3ADGA 2LBSB 3RV1A 1ZBTA 2DIXA 4JI7E 4X66E 1RC5A 4DKKA 4WYQB 4B3RE 4KHPE 1WHQA 2L2KB 1HNWE 1GQEA
chains in the Genus database with same CATH superfamily
2LJUA 2DRPA 4R03A 2V86A 4Q28A 4TUIA 3KZZA 4DR5E 2LTRA 3ECRA 2RQLA 3BF2A 4LTYA 1I4SA 2YU5A 2EM4A 3QG5C 3UK3C 3OTOE 4R2AA 4O24A 1PJQA 4ZYGA 3O2RA 2EN4A 1ZTDA 2JWOA 4DV7E 4L5NC 3KWRA 1BB8A 4KZSA 2F4VE 2GHFA 1ZR9A 2EOQA 5CFFE 2N3GA 2UU9E 5AE3A 4L8NA 2ENHA 3ADJA 4OUNA 2LO3A 1A1IA 2UUBE 3VHTB 3IWCA 3HPSA 2EN8A 2M7QA 1YYKA 2EQ1A 2EOHA 2LTSA 3FIGA 1RQ0A 1Z1BA 4JI4E 2YTQA 2V87A 4BHCA 2E1MA 4LFCE 1LLMC 2EM0A 1IBKE 5KL4A 2B3TB 4B3SE 2RS7A 1T39A 3J7Yp 1XMOE 1BBOA 2LCEA 2YRKA 2EE8A 1X47A 1YUJA 1ZU1A 4LF5E 3VYYA 2UXBE 1KYQA 1WXRA 2I13A 4OOGC 4JI6E 4WXCA 4TUGA 2EPUA 2EQ3A 4JI5E 2LUQA 1IBLE 3P1XA 1O0WA 2B7VA 2EMWA 3THNA 4AQYE 4GKJE 4DR4E 4X9JA 4LF4E 3JU0A 2WBUA 2VF1A 5LMUE 1JK1A 2DMYA 2WZOA 1KJKA 3ADLA 4R2CA 3C4TA 2MKDA 2R1FA 2ENAA 2L92A 4HTGA 2EM6A 4LU9A 2YPNA 4DUYE 2JVAA 2UUAE 3HXLA 2LBSB 4M0VA 2YSPA 1ZBTA 1RC5A 2YTFA 3KZYA 2EPMX 2EP3A 4B3RE 4KHPE 2L2KB 1HNWE 2CT1A 2EN2A 4DV3E 1X5WA 5AE2A 2JOXA 3OMLA 5TSEA 2UUCE 4JI0E 2VQFE 2EN1A 1TF3A 1WRJA 2EMIA 2YTPA 2GSLA 1UILA 4M30A 2E5LE 1MEYC 4RHBB 2WBSA 1X48A 1I94E 2EL4A 2EMKA 2NUFA 2YTDA 1YYOA 2FV4B 3J81C 1P47A 3EPKA 3EPHA 2EPLX 3F6HA 5AC4A 4BCAA 4ZYDA 3DF6A 4P78A 1DQ3A 4RH8A 2M4IA 2FGGA 2EMHA 5AC5A 4BHBA 1PJTA 2EM7A 5LMNE 4WPYA 1UN6B 1FJGE 2ENCA 1A1KA 2JOBA 1YSAC 2BBGA 1AAYA 2EN7A 2YRHA 1U61A 4F9BB 2HJJA 2NABA 1A1LA 4DMIA 3DJWA 2EOJA 2RSMA 2K7IA 4JI1E 2EZ6A 1A1GA 5IWAE 2H36X 5LL6R 4BMJA 3AUZA 5F3WA 1SFEA 3HPZA 2EN3A 2EOMA 4LF6E 2EMFA 2G7HA 3N3WA 1IQSA 2V83A 1RC7A 2L3JA 1X6HA 5KL3A 1B69A 4DV6E 1MGTA 4DV1E 3IWBA 4F6MA 1WJPA 2FFLA 2EL5A 2EPPA 2ELYA 3JTZA 4BC9A 2J7JA 1EKZA 2IHR1 1HR0E 2LT7A 1EH6A 2YTEA 5A69A 2DLQA 3C4BA 2EPKX 1HNXE 2V89A 5LLQA 2R76A 4X64E 2NUGA 2RTXA 1A1FA 4DR6E 4DV4E 2EL6A 2YWQA 2MC6A 2JR1A 1YFHA 2M9AA 1TN9A 2DLKA 2CPNA 4F9CB 2MDRA 2L6MA 2YZTA 2EPAA 2YTGA 3C6KA 4B3ME 1YPNA 3IWDA 4LFBE 2EB1A 2BB8A 1G2FC 5KL6A 1N3GA 3RV1A 2DIXA 3ZOQB 1RMDA 4X66E 2ADRA 2EORA 2EOXA 3RMPA 3EPLA 4DKKA 2EQ0A 2HC5A 1GQEA 4YY3E 3J80C 1XNQE 2N8XA 2EM3A 3C6MA 3MHHC 2B9DA 1J26A 2A11A 2YTIA 2JY9A 2N3HA 4KWYA 2EM2A 4Q35B 1L4SA 1T4LB 4BS9A 2EJ4A 2EPCA 4J8ZA 2CSHA 5A6AA 2ODRC 2GPIA 3MSWA 2EPNA 2EMZA 4YHHE 3LMLA 5A6BD 1T38A 1T4NA 2EMXA 2ZM6E 2EWLA 2PRTA 2L3CA 4WXDA 4F6NA 4JV5E 1XMQE 3T1HE 5IT9C 1G2DC 2V8QB 2MC5A 1A1JA 2UXDE 2YTOA 2WCC3 3H09A 2L33A 4BBYA 4I8OA 4GEQB 4O5GA 4LF7E 2KOUA 2RSIA 2V85A 2YTJA 4R8OA 3MHSC 4B3TE 1DI2A 3RV0A 4WFTA 3VK6A 2LUPB 4MLVA 4DR7E 4F54A 1XNRE 4R2QA 1PDAA 1X6FA 4OX9E 3BIDA 3J7AG 4IS1C 3T1YE 2L8TA 1EH7A 4LFAE 4ZYEA 2EMYA 2RPCA 2M1SA 2DGCA 2LJHA 1N33E 3HTXA 2CTDA 1X3CA 2EMGA 3HQ1A 4X62E 3F6GA 2L2MA 2EM5A 4F9AB 4JI2E 2ODRD 2YT4A 5A6KA 1GZ6A 2LV2A 5BR8E 4P7DA 1ZBQA 4ZYHA 1A1HA 1T4OA 2EPXA 3BGHA 1BBGA 1N36E 4DR1E 4M2ZA 2LE2A 2EOZA 3LLHA 4NZVA 2KONA 4F2JC 1UBDC 2LMZA 4WSGA 2YSOA 3M99B 5KL7A 1X6EA 1AH5A 3ADGA 4R2RA 5A6JA 1PJSA 4JI7E 1JK2A 3EQ1A 4O4KA 4WYQB 3AV0A 4R2EA 5KL2A 1UHZA 2ELZA 5IXMB 4LF9E 2QVWA 2HHHE 2EPRA 4JI3E 1NCSA 2RS6A 2DMIA 2EOFA 4WSPA 2V88A 5KL5A 2D9HA 1HNZE 4DR2E 4O43A 2I9IA 4DV0E 5AE1A 1STUA 4DR3E 5A6BA 3TQMA 2JP9A 2EMAA 2EMLA 4R2SA 2DSYA 1YYWA 1SR9A 1QNTA 4BC7A 4DV5E 2EOYA 1QU6A 2LVHA 1YZ9A 4LF8E 5ADZA 1TF6A 1EH8A 5A2QC 1NEIA 3O2RB 4GKKE 4MLQA 5IV8B 4DV2E 2EPZA 2JXPA 2EN6A 5FLXC 2VE7C 1ZAAC 1N32E 4DUZE 2FTXB 2WBTA 2EPOA 2LRSA 2EM8A 4WX9A 5DNYA 2HGHA 2EMCA 4JYAE 3EPJA 3K6QA 3JAMC 2NA2A 1WHNA 2DB2A 2EOEA 2YRMA 2GLIA 1YUIA 4M9VC 2NUEA 5AASA 3THOB 2EMBA 1F2IG 1J5EE 3ADIA 1JFZA 2B7TA 2A25A 4NXNE 4R2DA 2MKNA 3L00A 4HEIA 4R2PA 1GTKA 2UXCE 2KHXA 2Q8UA 4X8WA 1FKAE 2JPAA 2YTNA 2JYAA 3VYXA 4NHRA 2EM9A 2YU8A 2K4VA 1IQOA 4JI8E 2L2NA 4FK5C 1N34E 1DGCA 2VRDA 4K0KE 4NXME 1IMUA 4GZNC 1IBME 4IJDA 1PKPA 2F8BA 5T6JA 2E72A 4X65E 1X49A 2VQEE 2EOIA 4N4RB 2EOSA 2EOOA 2MDGA 3BBGA 1WHQA
chains in the Genus database with same CATH topology
4DV3E 4YY3E 1UHZA 5AE2A 2JOXA 3OMLA 2UUCE 4JI0E 3J80C 2VQFE 2QVWA 2HHHE 4LF9E 1XNQE 4JI3E 4R03A 2V86A 4Q28A 2GSLA 1UILA 2RS6A 2B9DA 4WSPA 4M30A 2A11A 4TUIA 4DR5E 2V88A 2LTRA 1J26A 2E5LE 2JY9A 2N3HA 1HNZE 4DR2E 4DV0E 1X48A 5AE1A 4LTYA 1I4SA 1I94E 1T4LB 4BS9A 1STUA 4J8ZA 2NUFA 1YYOA 2FV4B 3J81C 4DR3E 2ODRC 3F6HA 3MSWA 4BCAA 3OTOE 2DSYA 4YHHE 1YYWA 3LMLA 3DF6A 4P78A 1DQ3A 1SR9A 3O2RA 4BC7A 4DV5E 2M4IA 1QU6A 2FGGA 1T4NA 1YZ9A 2ZM6E 2EWLA 4LF8E 5ADZA 2JWOA 5LMNE 4DV7E 5A2QC 2L3CA 4JV5E 4WPYA 3O2RB 3T1HE 5IT9C 1XMQE 4L5NC 1FJGE 4GKKE 2V8QB 2MC5A 3KWRA 4DV2E 2UXDE 2JOBA 3H09A 2L33A 4KZSA 5FLXC 2F4VE 2VE7C 1U61A 4BBYA 4F9BB 5CFFE 1N32E 4I8OA 4GEQB 2FTXB 4DUZE 2KOUA 4DMIA 4LF7E 2LRSA 2V85A 3DJWA 2N3GA 4R8OA 2RSMA 2UU9E 3RV0A 4B3TE 4WFTA 3VK6A 5DNYA 1DI2A 2LUPB 5AE3A 4L8NA 4DR7E 4JI1E 2EZ6A 4F54A 1XNRE 3ADJA 4OUNA 2UUBE 5IWAE 4JYAE 3IWCA 4OX9E 3HPSA 3K6QA 2H36X 3J7AG 5LL6R 4BMJA 3JAMC 2L8TA 2M7QA 3T1YE 4LFAE 3AUZA 1YYKA 2NA2A 2LTSA 1WHNA 3FIGA 1RQ0A 2DB2A 5F3WA 4JI4E 2M1SA 3HPZA 2NUEA 5AASA 4LF6E 2G7HA 2V87A 2E1MA 3N3WA 4LFCE 2LJHA 2V83A 1J5EE 3ADIA 1RC7A 1JFZA 2B7TA 2L3JA 4NXNE 3HTXA 1N33E 1IBKE 4DV6E 2B3TB 4B3SE 3HQ1A 4DV1E 2UXCE 2KHXA 2RS7A 4X62E 3J7Yp 3IWBA 3F6GA 2FFLA 2L2MA 4X8WA 1XMOE 3JTZA 4BC9A 1FKAE 4F9AB 1EKZA 1X47A 2IHR1 4JI2E 1HR0E 3VYXA 2ODRD 4LF5E 3VYYA 2UXBE 1WXRA 2YT4A 4OOGC 1GZ6A 4JI6E 2K4VA 3C4BA 4TUGA 4JI8E 1HNXE 2L2NA 5BR8E 4P7DA 1N34E 1ZBQA 2V89A 1T4OA 4JI5E 2LUQA 1IBLE 4K0KE 4X64E 3P1XA 2NUGA 2RTXA 1O0WA 2B7VA 1N36E 4DR1E 4M2ZA 4DR6E 4DV4E 4AQYE 2LE2A 4NXME 2MC6A 2JR1A 4GKJE 4DR4E 3LLHA 4LF4E 2KONA 3JU0A 2VF1A 5LMUE 2CPNA 4F9CB 2DMYA 2LMZA 2MDRA 2L6MA 2WZOA 2YZTA 4B3ME 3ADLA 3C4TA 1IBME 1PKPA 2F8BA 5T6JA 2L92A 3IWDA 4LFBE 2EB1A 4LU9A 4X65E 4DUYE 2JVAA 1X49A 3HXLA 2VQEE 2UUAE 3ADGA 2LBSB 3RV1A 4M0VA 1ZBTA 2DIXA 4JI7E 3ZOQB 4X66E 1RC5A 3RMPA 4DKKA 4WYQB 4B3RE 3AV0A 4KHPE 1WHQA 2L2KB 1HNWE 1GQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 E;  4YY3 E;  1UHZ A;  4JI0 E;  2UUC E;  2VQF E;  4LF9 E;  2QVW A;  2HHH E;  1XNQ E;  4JI3 E;  2GSL A;  1UIL A;  2RS6 A;  1J26 A;  4M30 A;  2A11 A;  4DR5 E;  2LTR A;  2E5L E;  2JY9 A;  2N3H A;  1HNZ E;  4DR2 E;  4DV0 E;  1X48 A;  1I94 E;  1I4S A;  1T4L B;  1STU A;  2NUF A;  1YYO A;  4DR3 E;  3OTO E;  4YHH E;  1YYW A;  3O2R A;  4DV5 E;  1QU6 A;  1T4N A;  1YZ9 A;  2ZM6 E;  4LF8 E;  5LMN E;  4DV7 E;  2L3C A;  4JV5 E;  1XMQ E;  3O2R B;  3T1H E;  1FJG E;  4GKK E;  4DV2 E;  2UXD E;  2L33 A;  2F4V E;  1U61 A;  5CFF E;  1N32 E;  4DUZ E;  4LF7 E;  2LRS A;  2N3G A;  2RSM A;  2UU9 E;  3RV0 A;  4B3T E;  4WFT A;  1DI2 A;  2LUP B;  4DR7 E;  4JI1 E;  2EZ6 A;  1XNR E;  3ADJ A;  4OUN A;  2UUB E;  5IWA E;  4JYA E;  4OX9 E;  3T1Y E;  4LFA E;  1YYK A;  2NA2 A;  2LTS A;  1WHN A;  1RQ0 A;  2DB2 A;  4JI4 E;  2NUE A;  4LF6 E;  3N3W A;  4LFC E;  2LJH A;  1J5E E;  3ADI A;  1RC7 A;  1JFZ A;  2B7T A;  2L3J A;  4NXN E;  3HTX A;  1N33 E;  1IBK E;  4DV6 E;  2B3T B;  4B3S E;  4DV1 E;  2UXC E;  2KHX A;  2RS7 A;  4X62 E;  3J7Y p;  2FFL A;  2L2M A;  4X8W A;  1XMO E;  1FKA E;  1EKZ A;  1X47 A;  2IHR 1;  4JI2 E;  1HR0 E;  3VYX A;  4LF5 E;  3VYY A;  2UXB E;  2YT4 A;  4OOG C;  4JI6 E;  3C4B A;  1HNX E;  4JI8 E;  2L2N A;  5BR8 E;  1N34 E;  1T4O A;  4JI5 E;  2LUQ A;  1IBL E;  4K0K E;  4X64 E;  3P1X A;  2NUG A;  2RTX A;  1O0W A;  2B7V A;  1N36 E;  4DR1 E;  4M2Z A;  4DR6 E;  4DV4 E;  4AQY E;  4NXM E;  4GKJ E;  4DR4 E;  3LLH A;  4LF4 E;  5LMU E;  2CPN A;  2DMY A;  2MDR A;  3ADL A;  4B3M E;  3C4T A;  1IBM E;  1PKP A;  4LFB E;  2EB1 A;  4X65 E;  4DUY E;  2JVA A;  1X49 A;  2VQE E;  2UUA E;  3ADG A;  2LBS B;  3RV1 A;  1ZBT A;  2DIX A;  4JI7 E;  4X66 E;  1RC5 A;  4DKK A;  4WYQ B;  4B3R E;  4KHP E;  1WHQ A;  2L2K B;  1HNW E;  1GQE A; 
#chains in the Genus database with same CATH topology
 2LJU A;  2DRP A;  4R03 A;  2V86 A;  4Q28 A;  4TUI A;  3KZZ A;  4DR5 E;  2LTR A;  3ECR A;  2RQL A;  3BF2 A;  4LTY A;  1I4S A;  2YU5 A;  2EM4 A;  3QG5 C;  3UK3 C;  3OTO E;  4R2A A;  4O24 A;  1PJQ A;  4ZYG A;  3O2R A;  2EN4 A;  1ZTD A;  2JWO A;  4DV7 E;  4L5N C;  3KWR A;  1BB8 A;  4KZS A;  2F4V E;  2GHF A;  1ZR9 A;  2EOQ A;  5CFF E;  2N3G A;  2UU9 E;  5AE3 A;  4L8N A;  2ENH A;  3ADJ A;  4OUN A;  2LO3 A;  1A1I A;  2UUB E;  3VHT B;  3IWC A;  3HPS A;  2EN8 A;  2M7Q A;  1YYK A;  2EQ1 A;  2EOH A;  2LTS A;  3FIG A;  1RQ0 A;  1Z1B A;  4JI4 E;  2YTQ A;  2V87 A;  4BHC A;  2E1M A;  4LFC E;  1LLM C;  2EM0 A;  1IBK E;  5KL4 A;  2B3T B;  4B3S E;  2RS7 A;  1T39 A;  3J7Y p;  1XMO E;  1BBO A;  2LCE A;  2YRK A;  2EE8 A;  1X47 A;  1YUJ A;  1ZU1 A;  4LF5 E;  3VYY A;  2UXB E;  1KYQ A;  1WXR A;  2I13 A;  4OOG C;  4JI6 E;  4WXC A;  4TUG A;  2EPU A;  2EQ3 A;  4JI5 E;  2LUQ A;  1IBL E;  3P1X A;  1O0W A;  2B7V A;  2EMW A;  3THN A;  4AQY E;  4GKJ E;  4DR4 E;  4X9J A;  4LF4 E;  3JU0 A;  2WBU A;  2VF1 A;  5LMU E;  1JK1 A;  2DMY A;  2WZO A;  1KJK A;  3ADL A;  4R2C A;  3C4T A;  2MKD A;  2R1F A;  2ENA A;  2L92 A;  4HTG A;  2EM6 A;  4LU9 A;  2YPN A;  4DUY E;  2JVA A;  2UUA E;  3HXL A;  2LBS B;  4M0V A;  2YSP A;  1ZBT A;  1RC5 A;  2YTF A;  3KZY A;  2EPM X;  2EP3 A;  4B3R E;  4KHP E;  2L2K B;  1HNW E;  2CT1 A;  2EN2 A;  4DV3 E;  1X5W A;  5AE2 A;  2JOX A;  3OML A;  5TSE A;  2UUC E;  4JI0 E;  2VQF E;  2EN1 A;  1TF3 A;  1WRJ A;  2EMI A;  2YTP A;  2GSL A;  1UIL A;  4M30 A;  2E5L E;  1MEY C;  4RHB B;  2WBS A;  1X48 A;  1I94 E;  2EL4 A;  2EMK A;  2NUF A;  2YTD A;  1YYO A;  2FV4 B;  3J81 C;  1P47 A;  3EPK A;  3EPH A;  2EPL X;  3F6H A;  5AC4 A;  4BCA A;  4ZYD A;  3DF6 A;  4P78 A;  1DQ3 A;  4RH8 A;  2M4I A;  2FGG A;  2EMH A;  5AC5 A;  4BHB A;  1PJT A;  2EM7 A;  5LMN E;  4WPY A;  1UN6 B;  1FJG E;  2ENC A;  1A1K A;  2JOB A;  1YSA C;  2BBG A;  1AAY A;  2EN7 A;  2YRH A;  1U61 A;  4F9B B;  2HJJ A;  2NAB A;  1A1L A;  4DMI A;  3DJW A;  2EOJ A;  2RSM A;  2K7I A;  4JI1 E;  2EZ6 A;  1A1G A;  5IWA E;  2H36 X;  5LL6 R;  4BMJ A;  3AUZ A;  5F3W A;  1SFE A;  3HPZ A;  2EN3 A;  2EOM A;  4LF6 E;  2EMF A;  2G7H A;  3N3W A;  1IQS A;  2V83 A;  1RC7 A;  2L3J A;  1X6H A;  5KL3 A;  1B69 A;  4DV6 E;  1MGT A;  4DV1 E;  3IWB A;  4F6M A;  1WJP A;  2FFL A;  2EL5 A;  2EPP A;  2ELY A;  3JTZ A;  4BC9 A;  2J7J A;  1EKZ A;  2IHR 1;  1HR0 E;  2LT7 A;  1EH6 A;  2YTE A;  5A69 A;  2DLQ A;  3C4B A;  2EPK X;  1HNX E;  2V89 A;  5LLQ A;  2R76 A;  4X64 E;  2NUG A;  2RTX A;  1A1F A;  4DR6 E;  4DV4 E;  2EL6 A;  2YWQ A;  2MC6 A;  2JR1 A;  1YFH A;  2M9A A;  1TN9 A;  2DLK A;  2CPN A;  4F9C B;  2MDR A;  2L6M A;  2YZT A;  2EPA A;  2YTG A;  3C6K A;  4B3M E;  1YPN A;  3IWD A;  4LFB E;  2EB1 A;  2BB8 A;  1G2F C;  5KL6 A;  1N3G A;  3RV1 A;  2DIX A;  3ZOQ B;  1RMD A;  4X66 E;  2ADR A;  2EOR A;  2EOX A;  3RMP A;  3EPL A;  4DKK A;  2EQ0 A;  2HC5 A;  1GQE A;  4YY3 E;  3J80 C;  1XNQ E;  2N8X A;  2EM3 A;  3C6M A;  3MHH C;  2B9D A;  1J26 A;  2A11 A;  2YTI A;  2JY9 A;  2N3H A;  4KWY A;  2EM2 A;  4Q35 B;  1L4S A;  1T4L B;  4BS9 A;  2EJ4 A;  2EPC A;  4J8Z A;  2CSH A;  5A6A A;  2ODR C;  2GPI A;  3MSW A;  2EPN A;  2EMZ A;  4YHH E;  3LML A;  5A6B D;  1T38 A;  1T4N A;  2EMX A;  2ZM6 E;  2EWL A;  2PRT A;  2L3C A;  4WXD A;  4F6N A;  4JV5 E;  1XMQ E;  3T1H E;  5IT9 C;  1G2D C;  2V8Q B;  2MC5 A;  1A1J A;  2UXD E;  2YTO A;  2WCC 3;  3H09 A;  2L33 A;  4BBY A;  4I8O A;  4GEQ B;  4O5G A;  4LF7 E;  2KOU A;  2RSI A;  2V85 A;  2YTJ A;  4R8O A;  3MHS C;  4B3T E;  1DI2 A;  3RV0 A;  4WFT A;  3VK6 A;  2LUP B;  4MLV A;  4DR7 E;  4F54 A;  1XNR E;  4R2Q A;  1PDA A;  1X6F A;  4OX9 E;  3BID A;  3J7A G;  4IS1 C;  3T1Y E;  2L8T A;  1EH7 A;  4LFA E;  4ZYE A;  2EMY A;  2RPC A;  2M1S A;  2DGC A;  2LJH A;  1N33 E;  3HTX A;  2CTD A;  1X3C A;  2EMG A;  3HQ1 A;  4X62 E;  3F6G A;  2L2M A;  2EM5 A;  4F9A B;  4JI2 E;  2ODR D;  2YT4 A;  5A6K A;  1GZ6 A;  2LV2 A;  5BR8 E;  4P7D A;  1ZBQ A;  4ZYH A;  1A1H A;  1T4O A;  2EPX A;  3BGH A;  1BBG A;  1N36 E;  4DR1 E;  4M2Z A;  2LE2 A;  2EOZ A;  3LLH A;  4NZV A;  2KON A;  4F2J C;  1UBD C;  2LMZ A;  4WSG A;  2YSO A;  3M99 B;  5KL7 A;  1X6E A;  1AH5 A;  3ADG A;  4R2R A;  5A6J A;  1PJS A;  4JI7 E;  1JK2 A;  3EQ1 A;  4O4K A;  4WYQ B;  3AV0 A;  4R2E A;  5KL2 A;  1UHZ A;  2ELZ A;  5IXM B;  4LF9 E;  2QVW A;  2HHH E;  2EPR A;  4JI3 E;  1NCS A;  2RS6 A;  2DMI A;  2EOF A;  4WSP A;  2V88 A;  5KL5 A;  2D9H A;  1HNZ E;  4DR2 E;  4O43 A;  2I9I A;  4DV0 E;  5AE1 A;  1STU A;  4DR3 E;  5A6B A;  3TQM A;  2JP9 A;  2EMA A;  2EML A;  4R2S A;  2DSY A;  1YYW A;  1SR9 A;  1QNT A;  4BC7 A;  4DV5 E;  2EOY A;  1QU6 A;  2LVH A;  1YZ9 A;  4LF8 E;  5ADZ A;  1TF6 A;  1EH8 A;  5A2Q C;  1NEI A;  3O2R B;  4GKK E;  4MLQ A;  5IV8 B;  4DV2 E;  2EPZ A;  2JXP A;  2EN6 A;  5FLX C;  2VE7 C;  1ZAA C;  1N32 E;  4DUZ E;  2FTX B;  2WBT A;  2EPO A;  2LRS A;  2EM8 A;  4WX9 A;  5DNY A;  2HGH A;  2EMC A;  4JYA E;  3EPJ A;  3K6Q A;  3JAM C;  2NA2 A;  1WHN A;  2DB2 A;  2EOE A;  2YRM A;  2GLI A;  1YUI A;  4M9V C;  2NUE A;  5AAS A;  3THO B;  2EMB A;  1F2I G;  1J5E E;  3ADI A;  1JFZ A;  2B7T A;  2A25 A;  4NXN E;  4R2D A;  2MKN A;  3L00 A;  4HEI A;  4R2P A;  1GTK A;  2UXC E;  2KHX A;  2Q8U A;  4X8W A;  1FKA E;  2JPA A;  2YTN A;  2JYA A;  3VYX A;  4NHR A;  2EM9 A;  2YU8 A;  2K4V A;  1IQO A;  4JI8 E;  2L2N A;  4FK5 C;  1N34 E;  1DGC A;  2VRD A;  4K0K E;  4NXM E;  1IMU A;  4GZN C;  1IBM E;  4IJD A;  1PKP A;  2F8B A;  5T6J A;  2E72 A;  4X65 E;  1X49 A;  2VQE E;  2EOI A;  4N4R B;  2EOS A;  2EOO A;  2MDG A;  3BBG A;  1WHQ A; 
#chains in the Genus database with same CATH homology
 4DV3 E;  4YY3 E;  1UHZ A;  5AE2 A;  2JOX A;  3OML A;  2UUC E;  4JI0 E;  3J80 C;  2VQF E;  2QVW A;  2HHH E;  4LF9 E;  1XNQ E;  4JI3 E;  4R03 A;  2V86 A;  4Q28 A;  2GSL A;  1UIL A;  2RS6 A;  2B9D A;  4WSP A;  4M30 A;  2A11 A;  4TUI A;  4DR5 E;  2V88 A;  2LTR A;  1J26 A;  2E5L E;  2JY9 A;  2N3H A;  1HNZ E;  4DR2 E;  4DV0 E;  1X48 A;  5AE1 A;  4LTY A;  1I4S A;  1I94 E;  1T4L B;  4BS9 A;  1STU A;  4J8Z A;  2NUF A;  1YYO A;  2FV4 B;  3J81 C;  4DR3 E;  2ODR C;  3F6H A;  3MSW A;  4BCA A;  3OTO E;  2DSY A;  4YHH E;  1YYW A;  3LML A;  3DF6 A;  4P78 A;  1DQ3 A;  1SR9 A;  3O2R A;  4BC7 A;  4DV5 E;  2M4I A;  1QU6 A;  2FGG A;  1T4N A;  1YZ9 A;  2ZM6 E;  2EWL A;  4LF8 E;  5ADZ A;  2JWO A;  5LMN E;  4DV7 E;  5A2Q C;  2L3C A;  4JV5 E;  4WPY A;  3O2R B;  3T1H E;  5IT9 C;  1XMQ E;  4L5N C;  1FJG E;  4GKK E;  2V8Q B;  2MC5 A;  3KWR A;  4DV2 E;  2UXD E;  2JOB A;  3H09 A;  2L33 A;  4KZS A;  5FLX C;  2F4V E;  2VE7 C;  1U61 A;  4BBY A;  4F9B B;  5CFF E;  1N32 E;  4I8O A;  4GEQ B;  2FTX B;  4DUZ E;  2KOU A;  4DMI A;  4LF7 E;  2LRS A;  2V85 A;  3DJW A;  2N3G A;  4R8O A;  2RSM A;  2UU9 E;  3RV0 A;  4B3T E;  4WFT A;  3VK6 A;  5DNY A;  1DI2 A;  2LUP B;  5AE3 A;  4L8N A;  4DR7 E;  4JI1 E;  2EZ6 A;  4F54 A;  1XNR E;  3ADJ A;  4OUN A;  2UUB E;  5IWA E;  4JYA E;  3IWC A;  4OX9 E;  3HPS A;  3K6Q A;  2H36 X;  3J7A G;  5LL6 R;  4BMJ A;  3JAM C;  2L8T A;  2M7Q A;  3T1Y E;  4LFA E;  3AUZ A;  1YYK A;  2NA2 A;  2LTS A;  1WHN A;  3FIG A;  1RQ0 A;  2DB2 A;  5F3W A;  4JI4 E;  2M1S A;  3HPZ A;  2NUE A;  5AAS A;  4LF6 E;  2G7H A;  2V87 A;  2E1M A;  3N3W A;  4LFC E;  2LJH A;  2V83 A;  1J5E E;  3ADI A;  1RC7 A;  1JFZ A;  2B7T A;  2L3J A;  4NXN E;  3HTX A;  1N33 E;  1IBK E;  4DV6 E;  2B3T B;  4B3S E;  3HQ1 A;  4DV1 E;  2UXC E;  2KHX A;  2RS7 A;  4X62 E;  3J7Y p;  3IWB A;  3F6G A;  2FFL A;  2L2M A;  4X8W A;  1XMO E;  3JTZ A;  4BC9 A;  1FKA E;  4F9A B;  1EKZ A;  1X47 A;  2IHR 1;  4JI2 E;  1HR0 E;  3VYX A;  2ODR D;  4LF5 E;  3VYY A;  2UXB E;  1WXR A;  2YT4 A;  4OOG C;  1GZ6 A;  4JI6 E;  2K4V A;  3C4B A;  4TUG A;  4JI8 E;  1HNX E;  2L2N A;  5BR8 E;  4P7D A;  1N34 E;  1ZBQ A;  2V89 A;  1T4O A;  4JI5 E;  2LUQ A;  1IBL E;  4K0K E;  4X64 E;  3P1X A;  2NUG A;  2RTX A;  1O0W A;  2B7V A;  1N36 E;  4DR1 E;  4M2Z A;  4DR6 E;  4DV4 E;  4AQY E;  2LE2 A;  4NXM E;  2MC6 A;  2JR1 A;  4GKJ E;  4DR4 E;  3LLH A;  4LF4 E;  2KON A;  3JU0 A;  2VF1 A;  5LMU E;  2CPN A;  4F9C B;  2DMY A;  2LMZ A;  2MDR A;  2L6M A;  2WZO A;  2YZT A;  4B3M E;  3ADL A;  3C4T A;  1IBM E;  1PKP A;  2F8B A;  5T6J A;  2L92 A;  3IWD A;  4LFB E;  2EB1 A;  4LU9 A;  4X65 E;  4DUY E;  2JVA A;  1X49 A;  3HXL A;  2VQE E;  2UUA E;  3ADG A;  2LBS B;  3RV1 A;  4M0V A;  1ZBT A;  2DIX A;  4JI7 E;  3ZOQ B;  4X66 E;  1RC5 A;  3RMP A;  4DKK A;  4WYQ B;  4B3R E;  3AV0 A;  4KHP E;  1WHQ A;  2L2K B;  1HNW E;  1GQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...