3C4BA

Structure of rnaseiiib and dsrna binding domains of mouse dicer
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
263
structure length
244
Chain Sequence
DAEKTLNHLISGFETFEKKINYRFKNKAYLLQAFTHASYHYNTITDYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVKFQLEKNEEDIEVPKAMGDIFESLAGAIYMDSGMSLEVVWQVYYPMMQPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and biochemical insights into the dicing mechanism of mouse Dicer: A conserved lysine is critical for dsRNA cleavage.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Endoribonuclease Dicer
total genus 80
structure length 244
sequence length 263
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2008-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 3c4bA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3c4bA02
2EB1A 2DIXA 2YT4A 5IWAE 4JI3E 2B7VA 2N3GA 2RS7A 3C4TA 1X48A 2LJHA 4JI1E 4DV3E 4DR3E 1XMOE 1IBLE 3VYXA 1O0WA 1YZ9A 4DR6E 4GKKE 1UILA 2VQEE 2LRSA 1T4NA 4X66E 2N3HA 4NXME 2RS6A 2HHHE 4X64E 1RQ0A 3HTXA 2L2MA 2L2NA 1WHQA 1WHNA 1GQEA 2MDRA 2NUFA 2LUQA 3O2RA 1XNQE 4YHHE 5CFFE 1PKPA 2B7TA 3T1HE 3P1XA 2GSLA 1T4OA 1HNXE 2F4VE 4X65E 1ZBTA 2NUEA 4YY3E 2IHR1 4JI7E 1HR0E 2UU9E 1J26A 2E5LE 4DUZE 4JI6E 4DR4E 4X8WA 2L3CA 4JI8E 1STUA 1YYOA 1T4LB 5LMNE 4OX9E 1XNRE 1HNWE 4M2ZA 1FKAE 5LMUE 2UUAE 1J5EE 4DR1E 2LTRA 4JYAE 4B3TE 1HNZE 4K0KE 1N33E 4JI4E 2RSMA 4JI5E 4DKKA 3J7Yp 4DV7E 4DUYE 4LF9E 2UXBE 4OUNA 4GKJE 4DV2E 4DR5E 4B3RE 4WFTA 1DI2A 1QU6A 2A11A 2NA2A 2DMYA 1X47A 4DR2E 2UUBE 4LFCE 1JFZA 3ADIA 2VQFE 2B3TB 2KHXA 2L33A 3O2RB 2FFLA 4LF5E 4KHPE 3T1YE 4NXNE 4JI2E 1EKZA 3ADGA 4DR7E 4DV6E 4LFBE 4LF6E 3OTOE 2LBSB 4OOGC 1I4SA 3RV1A 4X62E 4LFAE 2DB2A 1RC5A 1RC7A 5BR8E 2UUCE 4M30A 4AQYE 4DV4E 3N3WA 4LF8E 1X49A 2CPNA 4DV0E 1YYWA 2JY9A 4B3SE 4WYQB 4LF7E 2UXDE 4LF4E 2JVAA 1IBME 2RTXA 1YYKA 4DV5E 2LTSA 4JI0E 2EZ6A 2L2KB 4DV1E 2LUPB 3C4BA 1N36E 1U61A 3LLHA 2ZM6E 1FJGE 3ADJA 3VYYA 1XMQE 2UXCE 1N34E 1N32E 3RV0A 1IBKE 4B3ME 4JV5E 2QVWA 1I94E 2L3JA 1UHZA 2NUGA 3ADLA
chains in the Genus database with same CATH superfamily
3K6QA 4JI3E 4WSGA 2EN8A 2LVHA 2EOEA 1A1FA 4HTGA 5KL4A 2EPRA 4DR3E 1DQ3A 2V89A 3EPKA 3J81C 2YRKA 2DLKA 5A69A 2EP3A 2RS6A 3DJWA 1AH5A 1RQ0A 2EORA 2L2NA 2LO3A 4IJDA 3BIDA 1XNQE 4O4KA 2B7TA 2JYAA 2V8QB 4F9CB 1DGCA 4BMJA 1YFHA 2NUEA 5A6JA 2IHR1 2UU9E 2E5LE 2FGGA 2YZTA 4JI6E 4BC9A 2DSYA 3JU0A 4X8WA 2L3CA 5IT9C 3J7AG 1YYOA 3IWDA 5KL5A 1T4LB 5IXMB 2LCEA 2EOZA 5AE3A 2EMZA 2YU8A 2YRHA 4Q35B 3KZZA 2LTRA 5IV8B 2ADRA 4JYAE 2YSOA 2GLIA 5LL6R 1N33E 4JI4E 3J7Yp 4DV7E 1MGTA 2UXBE 4GKJE 2B9DA 4KWYA 5AE2A 4B3RE 1DI2A 1QU6A 2CT1A 2DMYA 4DR2E 2UUBE 3HPSA 4N4RB 1YUJA 2VQFE 2EMLA 2L33A 5AE1A 2M4IA 1EKZA 2EM6A 4JI2E 2JPAA 1EH7A 4DR7E 1QNTA 1MEYC 1TF6A 2YTGA 1I4SA 3RV1A 4I8OA 4X62E 4AQYE 2L6MA 3AUZA 1YSAC 3MSWA 2YTEA 2HGHA 4L5NC 4DV0E 2JXPA 1EH8A 2DRPA 2L92A 4GEQB 3M99B 2YPNA 2JVAA 1IBME 4WXCA 1AAYA 1YYKA 4DV5E 4F6MA 2LTSA 2LUPB 1N36E 1IBKE 4F9BB 4B3ME 2EPUA 1I94E 3F6GA 1A1GA 2DLQA 5IWAE 3EPJA 5KL6A 2K7IA 2R76A 2YTJA 2WBSA 1JK1A 2YTOA 4KZSA 3KZYA 3VYXA 5A6KA 2VQEE 4IS1C 2V87A 2WZOA 4NXME 2EN1A 2Q8UA 2HHHE 4X64E 2EPNA 1WHNA 4R2PA 1T38A 5A6AA 4BCAA 2EOMA 4YHHE 2H36X 5CFFE 3BBGA 3MHHC 3P1XA 4WPYA 2EPAA 5KL2A 2WBTA 5F3WA 4X65E 1ZBTA 2YSPA 2EL4A 2YTIA 2LV2A 3L00A 2EMAA 3VK6A 4DR4E 2EM5A 2EM8A 1WXRA 1STUA 4O24A 4ZYEA 5LMNE 4OX9E 1HNWE 3FIGA 4M2ZA 5LMUE 2MC5A 4B3TE 1HNZE 2EPMX 4R2QA 2M7QA 4DKKA 1WJPA 2EMXA 2GHFA 1ZTDA 2J7JA 2JWOA 4DUYE 4LF9E 2EOFA 1IMUA 1SR9A 1ZU1A 2EM4A 2A11A 4R2RA 2YTPA 4X9JA 2ODRC 3ADIA 2VRDA 2EN3A 2EM9A 3EPLA 2FFLA 1WRJA 3THNA 4TUGA 1BB8A 4NXNE 2EM3A 1G2FC 3ADGA 2YRMA 4DV6E 4LFBE 2G7HA 4P7DA 2EM0A 4F9AB 1UBDC 2LBSB 4M9VC 1PJQA 1PDAA 2EN4A 4LFAE 4BS9A 1RC5A 2EMBA 2V86A 5BR8E 4R2SA 2I9IA 4Q28A 1IQSA 3J80C 3MHSC 2CPNA 2EPZA 2JY9A 4WYQB 2UXDE 2V85A 2EPKX 1ZBQA 2RTXA 2ENCA 2F8BA 2CSHA 2EE8A 2EL6A 2NABA 1PJSA 2EOJA 2ZM6E 3ADJA 3KWRA 3VYYA 2UXCE 4RH8A 3RMPA 2EN7A 3C6MA 1TN9A 2NUGA 2JOXA 2DIXA 2YT4A 3BGHA 1F2IG 4RHBB 3F6HA 1EH6A 1BBGA 1YPNA 2N3GA 2RS7A 3C4TA 2EN2A 4F2JC 1A1JA 2EOQA 4NHRA 4DV3E 1XMOE 2EOYA 1YZ9A 2ENAA 4GKKE 1UILA 1NCSA 2LRSA 1T4NA 2RSIA 3IWBA 2N3HA 2L2MA 2ENHA 2EOXA 1GQEA 5KL3A 5DNYA 4LU9A 5AASA 1PKPA 1A1IA 2GSLA 2E72A 4MLQA 1P47A 1HNXE 1N3GA 2EPOA 2EOSA 3H09A 1PJTA 1X6FA 2R1FA 1JK2A 1XNRE 2FV4B 4ZYDA 1FKAE 1J5EE 1SFEA 3VHTB 3ECRA 2EMHA 1TF3A 4K0KE 4JI5E 2RPCA 4TUIA 4HEIA 1X3CA 5KL7A 5A2QC 4OUNA 4DV2E 1T39A 4WFTA 2LE2A 3LMLA 2EM7A 1KJKA 2N8XA 2VE7C 1LLMC 1ZAAC 2M1SA 2KHXA 2DMIA 4DMIA 3THOB 2DGCA 2CTDA 1ZR9A 4LF5E 3T1YE 3HPZA 4BBYA 4ZYGA 2ODRD 4BC7A 4NZVA 5A6BA 4OOGC 2DB2A 2EPLX 2UUCE 2MC6A 4R03A 4M30A 2HC5A 2M9AA 2L8TA 4DV4E 1X49A 4MLVA 4B3SE 4LF7E 2YU5A 2EWLA 4L8NA 4LF4E 3AV0A 2LJUA 2EMFA 4JI0E 2L2KB 4DV1E 1X5WA 2EOIA 1U61A 3LLHA 1YUIA 1FJGE 3RV0A 2D9HA 3OMLA 4JV5E 1IQOA 4O43A 4M0VA 2YTFA 2I13A 2JP9A 3ADLA 4ZYHA 2EB1A 2EQ1A 3DF6A 2B7VA 2BB8A 2LMZA 2ELZA 2EPXA 2EQ0A 1X48A 1NEIA 2LJHA 4JI1E 2FTXB 2EMGA 2HJJA 1IBLE 1O0WA 4DR6E 3TQMA 1UN6B 4X66E 4WXDA 4F54A 2EMWA 2KONA 3QG5C 3HTXA 2EL5A 2JOBA 3JAMC 1WHQA 2YTNA 2MDRA 1G2DC 3IWCA 2NUFA 2LUQA 2LT7A 3O2RA 4O5GA 2EMYA 2GPIA 2K4VA 3T1HE 1BBOA 4WSPA 1T4OA 2EM2A 2F4VE 2YTDA 4YY3E 2KOUA 4JI7E 1HR0E 1J26A 2V88A 4DUZE 4JI8E 2EMIA 2YWQA 2YTQA 3ZOQB 3EPHA 3BF2A 2UUAE 2EN6A 2RQLA 4DR1E 5A6BD 5T6JA 3UK3C 2EMCA 1A1KA 1RMDA 2RSMA 5FLXC 2WBUA 4BHCA 1Z1BA 2JR1A 2WCC3 4DR5E 2EOOA 4GZNC 4J8ZA 2NA2A 1X47A 5LLQA 3HQ1A 4LFCE 2MDGA 1JFZA 2E1MA 1KYQA 1X6EA 2B3TB 4R2CA 4BHBA 1B69A 3O2RB 2BBGA 4LTYA 4F6NA 4KHPE 2V83A 4FK5C 3C6KA 1GTKA 4LF6E 3OTOE 4WX9A 2PRTA 2VF1A 2EOHA 3HXLA 5TSEA 2EQ3A 4R8OA 1X6HA 1RC7A 4R2EA 2EJ4A 2ELYA 3JTZA 2MKDA 3N3WA 4LF8E 5AC4A 4R2DA 1YYWA 1A1LA 2EPCA 2MKNA 2EMKA 1L4SA 2EPPA 2EZ6A 4P78A 3C4BA 1GZ6A 4R2AA 2A25A 1A1HA 1XMQE 1N34E 1N32E 3EQ1A 5AC5A 2QVWA 2L3JA 5ADZA 1UHZA
chains in the Genus database with same CATH topology
2EB1A 2DIXA 3K6QA 2YT4A 5IWAE 4JI3E 3DF6A 2B7VA 3F6HA 2N3GA 2RS7A 3C4TA 2LMZA 1X48A 4KZSA 2LJHA 4JI1E 2FTXB 4DV3E 4DR3E 1XMOE 1IBLE 1DQ3A 3VYXA 1O0WA 2V89A 1YZ9A 4DR6E 4GKKE 3J81C 1UILA 2VQEE 2LRSA 3IWBA 1T4NA 2V87A 4X66E 2N3HA 2WZOA 4F54A 4NXME 2RS6A 2KONA 3DJWA 2HHHE 4X64E 1RQ0A 3HTXA 2L2MA 2L2NA 2JOBA 3JAMC 1WHQA 1WHNA 1GQEA 2MDRA 5DNYA 4BCAA 3IWCA 4LU9A 2NUFA 2LUQA 3O2RA 1XNQE 5AASA 4YHHE 2H36X 1PKPA 2K4VA 2B7TA 2V8QB 3P1XA 4WSPA 4F9CB 5CFFE 3T1HE 2GSLA 1T4OA 4WPYA 1HNXE 2F4VE 5F3WA 4X65E 1ZBTA 4BMJA 2NUEA 4YY3E 2IHR1 3H09A 2KOUA 4JI7E 1HR0E 2UU9E 1J26A 2E5LE 2V88A 2FGGA 2YZTA 4DUZE 4JI6E 4BC9A 3VK6A 2DSYA 3JU0A 4X8WA 2L3CA 4JI8E 5IT9C 4DR4E 1WXRA 1STUA 3J7AG 1YYOA 3IWDA 1T4LB 5LMNE 4OX9E 1XNRE 2FV4B 3ZOQB 1HNWE 3FIGA 4M2ZA 5AE3A 1FKAE 5LMUE 2UUAE 1J5EE 4DR1E 2LTRA 2MC5A 4JYAE 4B3TE 1HNZE 4K0KE 5T6JA 5LL6R 2M7QA 4JI4E 2RSMA 5FLXC 4DKKA 4JI5E 1N33E 3J7Yp 2JWOA 4DV7E 4TUIA 4DUYE 4LF9E 5A2QC 2UXBE 2JR1A 4OUNA 4GKJE 2B9DA 4DV2E 4DR5E 5AE2A 1SR9A 4B3RE 4WFTA 2LE2A 3LMLA 1QU6A 1DI2A 2A11A 4J8ZA 2NA2A 2DMYA 1X47A 4DR2E 2UUBE 3HQ1A 3HPSA 4LFCE 2VE7C 1JFZA 2E1MA 2ODRC 3ADIA 2VQFE 2B3TB 2KHXA 2L33A 2M1SA 3O2RB 2FFLA 4LTYA 4DMIA 5AE1A 4TUGA 4LF5E 2V83A 3T1YE 4KHPE 3HPZA 4NXNE 2M4IA 1EKZA 4JI2E 3ADGA 4BBYA 4DR7E 2ODRD 4BC7A 4DV6E 4LFBE 2G7HA 4P7DA 4LF6E 3OTOE 4F9AB 2LBSB 2VF1A 3HXLA 4OOGC 1I4SA 3RV1A 4I8OA 4X62E 4LFAE 2DB2A 4BS9A 1RC5A 4R8OA 2V86A 1RC7A 5BR8E 2UUCE 2MC6A 4Q28A 3JTZA 4R03A 4M30A 3J80C 4AQYE 2L6MA 2L8TA 3AUZA 4DV4E 3N3WA 3MSWA 4LF8E 1X49A 2CPNA 4L5NC 4DV0E 1YYWA 2JY9A 4B3SE 4WYQB 2L92A 4LF7E 2UXDE 2EWLA 2V85A 4GEQB 4L8NA 1ZBQA 4LF4E 2JVAA 1IBME 2RTXA 1YYKA 3AV0A 4DV5E 2LTSA 4JI0E 2EZ6A 4P78A 2F8BA 2L2KB 4DV1E 2LUPB 3C4BA 1N36E 1U61A 1GZ6A 3LLHA 2ZM6E 1FJGE 3ADJA 3KWRA 3VYYA 1XMQE 2UXCE 1N34E 1N32E 3RV0A 1IBKE 4F9BB 3OMLA 3RMPA 2QVWA 1I94E 2L3JA 4B3ME 5ADZA 3F6GA 4JV5E 4M0VA 1UHZA 2NUGA 2JOXA 3ADLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EB1 A;  2DIX A;  2YT4 A;  5IWA E;  4JI3 E;  2B7V A;  2N3G A;  2RS7 A;  3C4T A;  1X48 A;  2LJH A;  4JI1 E;  4DV3 E;  4DR3 E;  1XMO E;  1IBL E;  3VYX A;  1O0W A;  1YZ9 A;  4DR6 E;  4GKK E;  1UIL A;  2VQE E;  2LRS A;  1T4N A;  4X66 E;  2N3H A;  4NXM E;  2RS6 A;  2HHH E;  4X64 E;  1RQ0 A;  3HTX A;  2L2M A;  2L2N A;  1WHQ A;  1WHN A;  1GQE A;  2MDR A;  2NUF A;  2LUQ A;  3O2R A;  1XNQ E;  4YHH E;  5CFF E;  1PKP A;  2B7T A;  3T1H E;  3P1X A;  2GSL A;  1T4O A;  1HNX E;  2F4V E;  4X65 E;  1ZBT A;  2NUE A;  4YY3 E;  2IHR 1;  4JI7 E;  1HR0 E;  2UU9 E;  1J26 A;  2E5L E;  4DUZ E;  4JI6 E;  4DR4 E;  4X8W A;  2L3C A;  4JI8 E;  1STU A;  1YYO A;  1T4L B;  5LMN E;  4OX9 E;  1XNR E;  1HNW E;  4M2Z A;  1FKA E;  5LMU E;  2UUA E;  1J5E E;  4DR1 E;  2LTR A;  4JYA E;  4B3T E;  1HNZ E;  4K0K E;  1N33 E;  4JI4 E;  2RSM A;  4JI5 E;  4DKK A;  3J7Y p;  4DV7 E;  4DUY E;  4LF9 E;  2UXB E;  4OUN A;  4GKJ E;  4DV2 E;  4DR5 E;  4B3R E;  4WFT A;  1DI2 A;  1QU6 A;  2A11 A;  2NA2 A;  2DMY A;  1X47 A;  4DR2 E;  2UUB E;  4LFC E;  1JFZ A;  3ADI A;  2VQF E;  2B3T B;  2KHX A;  2L33 A;  3O2R B;  2FFL A;  4LF5 E;  4KHP E;  3T1Y E;  4NXN E;  4JI2 E;  1EKZ A;  3ADG A;  4DR7 E;  4DV6 E;  4LFB E;  4LF6 E;  3OTO E;  2LBS B;  4OOG C;  1I4S A;  3RV1 A;  4X62 E;  4LFA E;  2DB2 A;  1RC5 A;  1RC7 A;  5BR8 E;  2UUC E;  4M30 A;  4AQY E;  4DV4 E;  3N3W A;  4LF8 E;  1X49 A;  2CPN A;  4DV0 E;  1YYW A;  2JY9 A;  4B3S E;  4WYQ B;  4LF7 E;  2UXD E;  4LF4 E;  2JVA A;  1IBM E;  2RTX A;  1YYK A;  4DV5 E;  2LTS A;  4JI0 E;  2EZ6 A;  2L2K B;  4DV1 E;  2LUP B;  3C4B A;  1N36 E;  1U61 A;  3LLH A;  2ZM6 E;  1FJG E;  3ADJ A;  3VYY A;  1XMQ E;  2UXC E;  1N34 E;  1N32 E;  3RV0 A;  1IBK E;  4B3M E;  4JV5 E;  2QVW A;  1I94 E;  2L3J A;  1UHZ A;  2NUG A;  3ADL A; 
#chains in the Genus database with same CATH topology
 3K6Q A;  4JI3 E;  4WSG A;  2EN8 A;  2LVH A;  2EOE A;  1A1F A;  4HTG A;  5KL4 A;  2EPR A;  4DR3 E;  1DQ3 A;  2V89 A;  3EPK A;  3J81 C;  2YRK A;  2DLK A;  5A69 A;  2EP3 A;  2RS6 A;  3DJW A;  1AH5 A;  1RQ0 A;  2EOR A;  2L2N A;  2LO3 A;  4IJD A;  3BID A;  1XNQ E;  4O4K A;  2B7T A;  2JYA A;  2V8Q B;  4F9C B;  1DGC A;  4BMJ A;  1YFH A;  2NUE A;  5A6J A;  2IHR 1;  2UU9 E;  2E5L E;  2FGG A;  2YZT A;  4JI6 E;  4BC9 A;  2DSY A;  3JU0 A;  4X8W A;  2L3C A;  5IT9 C;  3J7A G;  1YYO A;  3IWD A;  5KL5 A;  1T4L B;  5IXM B;  2LCE A;  2EOZ A;  5AE3 A;  2EMZ A;  2YU8 A;  2YRH A;  4Q35 B;  3KZZ A;  2LTR A;  5IV8 B;  2ADR A;  4JYA E;  2YSO A;  2GLI A;  5LL6 R;  1N33 E;  4JI4 E;  3J7Y p;  4DV7 E;  1MGT A;  2UXB E;  4GKJ E;  2B9D A;  4KWY A;  5AE2 A;  4B3R E;  1DI2 A;  1QU6 A;  2CT1 A;  2DMY A;  4DR2 E;  2UUB E;  3HPS A;  4N4R B;  1YUJ A;  2VQF E;  2EML A;  2L33 A;  5AE1 A;  2M4I A;  1EKZ A;  2EM6 A;  4JI2 E;  2JPA A;  1EH7 A;  4DR7 E;  1QNT A;  1MEY C;  1TF6 A;  2YTG A;  1I4S A;  3RV1 A;  4I8O A;  4X62 E;  4AQY E;  2L6M A;  3AUZ A;  1YSA C;  3MSW A;  2YTE A;  2HGH A;  4L5N C;  4DV0 E;  2JXP A;  1EH8 A;  2DRP A;  2L92 A;  4GEQ B;  3M99 B;  2YPN A;  2JVA A;  1IBM E;  4WXC A;  1AAY A;  1YYK A;  4DV5 E;  4F6M A;  2LTS A;  2LUP B;  1N36 E;  1IBK E;  4F9B B;  4B3M E;  2EPU A;  1I94 E;  3F6G A;  1A1G A;  2DLQ A;  5IWA E;  3EPJ A;  5KL6 A;  2K7I A;  2R76 A;  2YTJ A;  2WBS A;  1JK1 A;  2YTO A;  4KZS A;  3KZY A;  3VYX A;  5A6K A;  2VQE E;  4IS1 C;  2V87 A;  2WZO A;  4NXM E;  2EN1 A;  2Q8U A;  2HHH E;  4X64 E;  2EPN A;  1WHN A;  4R2P A;  1T38 A;  5A6A A;  4BCA A;  2EOM A;  4YHH E;  2H36 X;  5CFF E;  3BBG A;  3MHH C;  3P1X A;  4WPY A;  2EPA A;  5KL2 A;  2WBT A;  5F3W A;  4X65 E;  1ZBT A;  2YSP A;  2EL4 A;  2YTI A;  2LV2 A;  3L00 A;  2EMA A;  3VK6 A;  4DR4 E;  2EM5 A;  2EM8 A;  1WXR A;  1STU A;  4O24 A;  4ZYE A;  5LMN E;  4OX9 E;  1HNW E;  3FIG A;  4M2Z A;  5LMU E;  2MC5 A;  4B3T E;  1HNZ E;  2EPM X;  4R2Q A;  2M7Q A;  4DKK A;  1WJP A;  2EMX A;  2GHF A;  1ZTD A;  2J7J A;  2JWO A;  4DUY E;  4LF9 E;  2EOF A;  1IMU A;  1SR9 A;  1ZU1 A;  2EM4 A;  2A11 A;  4R2R A;  2YTP A;  4X9J A;  2ODR C;  3ADI A;  2VRD A;  2EN3 A;  2EM9 A;  3EPL A;  2FFL A;  1WRJ A;  3THN A;  4TUG A;  1BB8 A;  4NXN E;  2EM3 A;  1G2F C;  3ADG A;  2YRM A;  4DV6 E;  4LFB E;  2G7H A;  4P7D A;  2EM0 A;  4F9A B;  1UBD C;  2LBS B;  4M9V C;  1PJQ A;  1PDA A;  2EN4 A;  4LFA E;  4BS9 A;  1RC5 A;  2EMB A;  2V86 A;  5BR8 E;  4R2S A;  2I9I A;  4Q28 A;  1IQS A;  3J80 C;  3MHS C;  2CPN A;  2EPZ A;  2JY9 A;  4WYQ B;  2UXD E;  2V85 A;  2EPK X;  1ZBQ A;  2RTX A;  2ENC A;  2F8B A;  2CSH A;  2EE8 A;  2EL6 A;  2NAB A;  1PJS A;  2EOJ A;  2ZM6 E;  3ADJ A;  3KWR A;  3VYY A;  2UXC E;  4RH8 A;  3RMP A;  2EN7 A;  3C6M A;  1TN9 A;  2NUG A;  2JOX A;  2DIX A;  2YT4 A;  3BGH A;  1F2I G;  4RHB B;  3F6H A;  1EH6 A;  1BBG A;  1YPN A;  2N3G A;  2RS7 A;  3C4T A;  2EN2 A;  4F2J C;  1A1J A;  2EOQ A;  4NHR A;  4DV3 E;  1XMO E;  2EOY A;  1YZ9 A;  2ENA A;  4GKK E;  1UIL A;  1NCS A;  2LRS A;  1T4N A;  2RSI A;  3IWB A;  2N3H A;  2L2M A;  2ENH A;  2EOX A;  1GQE A;  5KL3 A;  5DNY A;  4LU9 A;  5AAS A;  1PKP A;  1A1I A;  2GSL A;  2E72 A;  4MLQ A;  1P47 A;  1HNX E;  1N3G A;  2EPO A;  2EOS A;  3H09 A;  1PJT A;  1X6F A;  2R1F A;  1JK2 A;  1XNR E;  2FV4 B;  4ZYD A;  1FKA E;  1J5E E;  1SFE A;  3VHT B;  3ECR A;  2EMH A;  1TF3 A;  4K0K E;  4JI5 E;  2RPC A;  4TUI A;  4HEI A;  1X3C A;  5KL7 A;  5A2Q C;  4OUN A;  4DV2 E;  1T39 A;  4WFT A;  2LE2 A;  3LML A;  2EM7 A;  1KJK A;  2N8X A;  2VE7 C;  1LLM C;  1ZAA C;  2M1S A;  2KHX A;  2DMI A;  4DMI A;  3THO B;  2DGC A;  2CTD A;  1ZR9 A;  4LF5 E;  3T1Y E;  3HPZ A;  4BBY A;  4ZYG A;  2ODR D;  4BC7 A;  4NZV A;  5A6B A;  4OOG C;  2DB2 A;  2EPL X;  2UUC E;  2MC6 A;  4R03 A;  4M30 A;  2HC5 A;  2M9A A;  2L8T A;  4DV4 E;  1X49 A;  4MLV A;  4B3S E;  4LF7 E;  2YU5 A;  2EWL A;  4L8N A;  4LF4 E;  3AV0 A;  2LJU A;  2EMF A;  4JI0 E;  2L2K B;  4DV1 E;  1X5W A;  2EOI A;  1U61 A;  3LLH A;  1YUI A;  1FJG E;  3RV0 A;  2D9H A;  3OML A;  4JV5 E;  1IQO A;  4O43 A;  4M0V A;  2YTF A;  2I13 A;  2JP9 A;  3ADL A;  4ZYH A;  2EB1 A;  2EQ1 A;  3DF6 A;  2B7V A;  2BB8 A;  2LMZ A;  2ELZ A;  2EPX A;  2EQ0 A;  1X48 A;  1NEI A;  2LJH A;  4JI1 E;  2FTX B;  2EMG A;  2HJJ A;  1IBL E;  1O0W A;  4DR6 E;  3TQM A;  1UN6 B;  4X66 E;  4WXD A;  4F54 A;  2EMW A;  2KON A;  3QG5 C;  3HTX A;  2EL5 A;  2JOB A;  3JAM C;  1WHQ A;  2YTN A;  2MDR A;  1G2D C;  3IWC A;  2NUF A;  2LUQ A;  2LT7 A;  3O2R A;  4O5G A;  2EMY A;  2GPI A;  2K4V A;  3T1H E;  1BBO A;  4WSP A;  1T4O A;  2EM2 A;  2F4V E;  2YTD A;  4YY3 E;  2KOU A;  4JI7 E;  1HR0 E;  1J26 A;  2V88 A;  4DUZ E;  4JI8 E;  2EMI A;  2YWQ A;  2YTQ A;  3ZOQ B;  3EPH A;  3BF2 A;  2UUA E;  2EN6 A;  2RQL A;  4DR1 E;  5A6B D;  5T6J A;  3UK3 C;  2EMC A;  1A1K A;  1RMD A;  2RSM A;  5FLX C;  2WBU A;  4BHC A;  1Z1B A;  2JR1 A;  2WCC 3;  4DR5 E;  2EOO A;  4GZN C;  4J8Z A;  2NA2 A;  1X47 A;  5LLQ A;  3HQ1 A;  4LFC E;  2MDG A;  1JFZ A;  2E1M A;  1KYQ A;  1X6E A;  2B3T B;  4R2C A;  4BHB A;  1B69 A;  3O2R B;  2BBG A;  4LTY A;  4F6N A;  4KHP E;  2V83 A;  4FK5 C;  3C6K A;  1GTK A;  4LF6 E;  3OTO E;  4WX9 A;  2PRT A;  2VF1 A;  2EOH A;  3HXL A;  5TSE A;  2EQ3 A;  4R8O A;  1X6H A;  1RC7 A;  4R2E A;  2EJ4 A;  2ELY A;  3JTZ A;  2MKD A;  3N3W A;  4LF8 E;  5AC4 A;  4R2D A;  1YYW A;  1A1L A;  2EPC A;  2MKN A;  2EMK A;  1L4S A;  2EPP A;  2EZ6 A;  4P78 A;  3C4B A;  1GZ6 A;  4R2A A;  2A25 A;  1A1H A;  1XMQ E;  1N34 E;  1N32 E;  3EQ1 A;  5AC5 A;  2QVW A;  2L3J A;  5ADZ A;  1UHZ A; 
#chains in the Genus database with same CATH homology
 2EB1 A;  2DIX A;  3K6Q A;  2YT4 A;  5IWA E;  4JI3 E;  3DF6 A;  2B7V A;  3F6H A;  2N3G A;  2RS7 A;  3C4T A;  2LMZ A;  1X48 A;  4KZS A;  2LJH A;  4JI1 E;  2FTX B;  4DV3 E;  4DR3 E;  1XMO E;  1IBL E;  1DQ3 A;  3VYX A;  1O0W A;  2V89 A;  1YZ9 A;  4DR6 E;  4GKK E;  3J81 C;  1UIL A;  2VQE E;  2LRS A;  3IWB A;  1T4N A;  2V87 A;  4X66 E;  2N3H A;  2WZO A;  4F54 A;  4NXM E;  2RS6 A;  2KON A;  3DJW A;  2HHH E;  4X64 E;  1RQ0 A;  3HTX A;  2L2M A;  2L2N A;  2JOB A;  3JAM C;  1WHQ A;  1WHN A;  1GQE A;  2MDR A;  5DNY A;  4BCA A;  3IWC A;  4LU9 A;  2NUF A;  2LUQ A;  3O2R A;  1XNQ E;  5AAS A;  4YHH E;  2H36 X;  1PKP A;  2K4V A;  2B7T A;  2V8Q B;  3P1X A;  4WSP A;  4F9C B;  5CFF E;  3T1H E;  2GSL A;  1T4O A;  4WPY A;  1HNX E;  2F4V E;  5F3W A;  4X65 E;  1ZBT A;  4BMJ A;  2NUE A;  4YY3 E;  2IHR 1;  3H09 A;  2KOU A;  4JI7 E;  1HR0 E;  2UU9 E;  1J26 A;  2E5L E;  2V88 A;  2FGG A;  2YZT A;  4DUZ E;  4JI6 E;  4BC9 A;  3VK6 A;  2DSY A;  3JU0 A;  4X8W A;  2L3C A;  4JI8 E;  5IT9 C;  4DR4 E;  1WXR A;  1STU A;  3J7A G;  1YYO A;  3IWD A;  1T4L B;  5LMN E;  4OX9 E;  1XNR E;  2FV4 B;  3ZOQ B;  1HNW E;  3FIG A;  4M2Z A;  5AE3 A;  1FKA E;  5LMU E;  2UUA E;  1J5E E;  4DR1 E;  2LTR A;  2MC5 A;  4JYA E;  4B3T E;  1HNZ E;  4K0K E;  5T6J A;  5LL6 R;  2M7Q A;  4JI4 E;  2RSM A;  5FLX C;  4DKK A;  4JI5 E;  1N33 E;  3J7Y p;  2JWO A;  4DV7 E;  4TUI A;  4DUY E;  4LF9 E;  5A2Q C;  2UXB E;  2JR1 A;  4OUN A;  4GKJ E;  2B9D A;  4DV2 E;  4DR5 E;  5AE2 A;  1SR9 A;  4B3R E;  4WFT A;  2LE2 A;  3LML A;  1QU6 A;  1DI2 A;  2A11 A;  4J8Z A;  2NA2 A;  2DMY A;  1X47 A;  4DR2 E;  2UUB E;  3HQ1 A;  3HPS A;  4LFC E;  2VE7 C;  1JFZ A;  2E1M A;  2ODR C;  3ADI A;  2VQF E;  2B3T B;  2KHX A;  2L33 A;  2M1S A;  3O2R B;  2FFL A;  4LTY A;  4DMI A;  5AE1 A;  4TUG A;  4LF5 E;  2V83 A;  3T1Y E;  4KHP E;  3HPZ A;  4NXN E;  2M4I A;  1EKZ A;  4JI2 E;  3ADG A;  4BBY A;  4DR7 E;  2ODR D;  4BC7 A;  4DV6 E;  4LFB E;  2G7H A;  4P7D A;  4LF6 E;  3OTO E;  4F9A B;  2LBS B;  2VF1 A;  3HXL A;  4OOG C;  1I4S A;  3RV1 A;  4I8O A;  4X62 E;  4LFA E;  2DB2 A;  4BS9 A;  1RC5 A;  4R8O A;  2V86 A;  1RC7 A;  5BR8 E;  2UUC E;  2MC6 A;  4Q28 A;  3JTZ A;  4R03 A;  4M30 A;  3J80 C;  4AQY E;  2L6M A;  2L8T A;  3AUZ A;  4DV4 E;  3N3W A;  3MSW A;  4LF8 E;  1X49 A;  2CPN A;  4L5N C;  4DV0 E;  1YYW A;  2JY9 A;  4B3S E;  4WYQ B;  2L92 A;  4LF7 E;  2UXD E;  2EWL A;  2V85 A;  4GEQ B;  4L8N A;  1ZBQ A;  4LF4 E;  2JVA A;  1IBM E;  2RTX A;  1YYK A;  3AV0 A;  4DV5 E;  2LTS A;  4JI0 E;  2EZ6 A;  4P78 A;  2F8B A;  2L2K B;  4DV1 E;  2LUP B;  3C4B A;  1N36 E;  1U61 A;  1GZ6 A;  3LLH A;  2ZM6 E;  1FJG E;  3ADJ A;  3KWR A;  3VYY A;  1XMQ E;  2UXC E;  1N34 E;  1N32 E;  3RV0 A;  1IBK E;  4F9B B;  3OML A;  3RMP A;  2QVW A;  1I94 E;  2L3J A;  4B3M E;  5ADZ A;  3F6G A;  4JV5 E;  4M0V A;  1UHZ A;  2NUG A;  2JOX A;  3ADL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...