3C4BA

Structure of rnaseiiib and dsrna binding domains of mouse dicer
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
263
structure length
244
Chain Sequence
b'DAEKTLNHLISGFETFEKKINYRFKNKAYLLQAFTHASYHYNTITDYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVKFQLEKNEEDIEVPKAMGDIFESLAGAIYMDSGMSLEVVWQVYYPMMQPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endoribonuclease Dicer
publication title Structural and biochemical insights into the dicing mechanism of mouse Dicer: A conserved lysine is critical for dsRNA cleavage.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 80
structure length 244
sequence length 263
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2008-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 3c4bA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3c4bA02
4B3TE 2EB1A 2N3GA 4DV4E 4LFCE 1FJGE 4B3RE 1N36E 2LTSA 3T1YE 2MDRA 3O2RB 1YYKA 4DR4E 2FFLA 1T4LB 2B7VA 1HR0E 1GQEA 4AQYE 1J5EE 2LJHA 2DMYA 4WFTA 1WHNA 1XNRE 4X66E 2LTRA 3P1XA 3ADJA 3RV1A 2L2NA 4JI1E 4DV6E 4LF9E 1XNQE 3LLHA 2VQFE 1STUA 1HNXE 5BR8E 1YZ9A 4LF5E 3ADGA 4DV5E 4JI4E 2LUQA 4DV1E 2L3JA 4LFBE 4DV2E 1HNZE 5LMNE 2RSMA 2RS7A 1EKZA 4DR1E 1DI2A 4DV7E 4JI3E 1O0WA 2YT4A 2UUBE 2UUAE 1IBLE 3VYYA 2GSLA 3HTXA 4DR6E 1X48A 4YY3E 4DV3E 1RC5A 5CFFE 1RC7A 1IBKE 2VQEE 1N33E 4X62E 4JI6E 4OOGC 1T4OA 2E5LE 4JI0E 2L33A 4X8WA 1HNWE 3C4BA 2UUCE 2LUPB 4B3ME 4DR3E 3T1HE 2DB2A 2B3TB 1QU6A 4KHPE 1J26A 2CPNA 2KHXA 4DUYE 3N3WA 1RQ0A 5LMUE 1I94E 2LBSB 2HHHE 2IHR1 4JYAE 1T4NA 4JV5E 2ZM6E 2EZ6A 4M2ZA 4B3SE 1I4SA 2RTXA 4DR2E 1WHQA 3VYXA 3OTOE 4NXNE 4NXME 4GKKE 2NUFA 4WYQB 4JI5E 1ZBTA 4OUNA 2B7TA 2JVAA 4JI2E 2L2KB 2UU9E 2QVWA 4LFAE 4LF8E 4DR7E 3O2RA 2F4VE 1JFZA 4DUZE 2L3CA 1X49A 4LF4E 1YYWA 4JI7E 3C4TA 4X65E 4YHHE 2L2MA 2UXBE 4K0KE 3RV0A 3ADIA 4M30A 2LRSA 1UHZA 2NA2A 1N34E 4OX9E 2UXCE 4LF7E 4LF6E 2UXDE 4JI8E 4X64E 3J7Yp 4DKKA 1N32E 3ADLA 2RS6A 5IWAE 2A11A 1UILA 1PKPA 2JY9A 1FKAE 1YYOA 2N3HA 1XMOE 2NUGA 1X47A 4DV0E 1U61A 2DIXA 4GKJE 1IBME 4DR5E 2NUEA 1XMQE
chains in the Genus database with same CATH superfamily
4TUGA 4LFCE 2V8QB 2EMFA 3T1YE 5AASA 3O2RB 1B69A 4F2JC 1YYKA 1DQ3A 5A6JA 1IMUA 4O43A 2VRDA 4WSPA 1T4LB 1A1HA 2EORA 2YTGA 2EPAA 2YU5A 2MDGA 3RMPA 3MSWA 2V86A 4WFTA 4R2QA 2LTRA 4R2DA 3ADJA 1MEYC 1XNQE 5F3WA 1WRJA 3LLHA 3C6MA 5KL4A 1HNXE 4LF5E 2JXPA 4LFBE 1F2IG 2FGGA 4DV2E 2YTNA 4HEIA 4DR1E 2EWLA 4DMIA 4BMJA 1LLMC 2GSLA 3HTXA 1X48A 2EN1A 2EMXA 3MHHC 1RC5A 5CFFE 4R03A 3VHTB 2WBSA 2JOBA 4OOGC 2YTFA 4JI0E 5AE3A 3C4BA 2EM6A 4M0VA 5A69A 2M4IA 2LUPB 4BC9A 2EPPA 2EL6A 1QU6A 4F9AB 1J26A 5DNYA 2RQLA 4ZYDA 2LBSB 2HHHE 2YTOA 1PDAA 2ZM6E 3H09A 3J7AG 3VYXA 3OTOE 3OMLA 2EJ4A 4WYQB 2ENHA 4BHBA 4WX9A 2GLIA 4OUNA 1MGTA 2L2KB 1RMDA 4KZSA 1BBOA 3O2RA 4F9CB 2L3CA 2WBUA 1YFHA 3HXLA 2MKDA 5KL7A 1X49A 4LF4E 3HPSA 5LLQA 5AC5A 1A1FA 2BBGA 2JYAA 4M30A 4OX9E 2UXDE 4J8ZA 1N3GA 3J7Yp 2EOFA 2WBTA 1N32E 5A2QC 2JP9A 4R2CA 4N4RB 1YYOA 2EN2A 1XMOE 2NUGA 2EPKX 1A1LA 2EN4A 1PJQA 5FLXC 2J7JA 2EN8A 1WJPA 4F6MA 2A25A 2N3GA 1FJGE 2MC5A 3F6GA 4B3RE 1N36E 2LCEA 2R1FA 3J81C 1EH7A 3JU0A 4F6NA 2EOOA 2YSPA 2DMIA 1HR0E 2EOIA 4AQYE 2EL5A 3IWBA 1Z1BA 3P1XA 4O24A 1T39A 4JI1E 4DV6E 2EMYA 2VQFE 4R2PA 1SFEA 5BR8E 1YZ9A 3DF6A 5T6JA 3ADGA 2YRKA 4JI4E 5AC4A 2I9IA 5LMNE 4O5GA 1SR9A 2EL4A 2HJJA 2K7IA 4ZYHA 3BBGA 4DV7E 2YT4A 4IJDA 5AE2A 4DR6E 2EM0A 4DV3E 1UBDC 1IBKE 3KZYA 4GZNC 4P7DA 1N33E 3KWRA 2ODRD 4X62E 5KL2A 4X8WA 2YWQA 4B3ME 2DB2A 2B3TB 4KHPE 2EPCA 1X6FA 2VF1A 2EQ0A 2CPNA 2EM2A 2RSIA 4P78A 2KHXA 2YTQA 3N3WA 2GPIA 5LMUE 1I94E 4F54A 2IHR1 1ZR9A 1T4NA 3BGHA 4JYAE 1IQSA 2EZ6A 4WXCA 1X3CA 2G7HA 2YRMA 1EH8A 4GKKE 4R2EA 2ENCA 4L5NC 2EMAA 2HGHA 4JI5E 1ZBTA 1DGCA 4LFAE 2UU9E 4DR7E 4NZVA 2KOUA 1ZTDA 4DUZE 1A1IA 4R2SA 2GHFA 4JI7E 3C4TA 4YHHE 2LV2A 2V89A 2I13A 3ADIA 2UXCE 1UHZA 2NA2A 4LF6E 2WZOA 2K4VA 2L92A 4M9VC 2YRHA 1YPNA 3ADLA 2A11A 2JR1A 1PKPA 4IS1C 2N3HA 1QNTA 1BB8A 2EMLA 4TUIA 2YSOA 4ZYEA 2EPOA 1X47A 3F6HA 2V87A 2EM4A 2EM5A 2JWOA 1NEIA 2JPAA 2KONA 2EQ1A 2EB1A 2LO3A 2FFLA 2EOZA 4BS9A 2B7VA 1GQEA 1T38A 2DMYA 2EOJA 1WHNA 1XNRE 4MLVA 4X66E 1G2FC 1TN9A 4LF9E 4LU9A 1X6EA 2EP3A 1STUA 2RPCA 3THOB 4BC7A 5A6BA 4RH8A 2DLKA 4DV5E 2M9AA 2N8XA 2LUQA 2EMZA 2EM9A 2L3JA 3EPHA 1X5WA 2YTDA 2H36X 1KJKA 2RSMA 2RS7A 5KL3A 3EPJA 1DI2A 2EMBA 2YZTA 3M99B 4JI3E 1O0WA 5AE1A 1IBLE 3DJWA 1PJTA 5A6BD 4KWYA 4WPYA 2EMGA 1RC7A 2YU8A 1YUJA 2EN3A 1AH5A 4JI6E 1EH6A 3JAMC 4RHBB 2NABA 1ZU1A 3IWCA 3T1HE 2E1MA 2EOXA 1UN6B 2EMWA 2LVHA 1YUIA 2DRPA 2LE2A 4MLQA 1PJSA 5IXMB 2ADRA 2ELZA 4M2ZA 2RTXA 1WHQA 4NXNE 2CSHA 2EMIA 2EPRA 2EN6A 5IV8B 2WCC3 4JI2E 4LF8E 2JVAA 5ADZA 2QVWA 4R8OA 2EM8A 3L00A 2CT1A 2EN7A 3BF2A 1YYWA 2F8BA 2YTPA 2EPLX 1JK1A 2LRSA 3JTZA 4LF7E 3EQ1A 2B9DA 2Q8UA 2YTJA 4JI8E 2BB8A 1NCSA 2M7QA 4X64E 4FK5C 2RS6A 2ODRC 2EOYA 2JY9A 2YTIA 3UK3C 2L6MA 4Q35B 2DSYA 5IT9C 4DR5E 2NUEA 2EOQA 1GTKA 4B3TE 4WXDA 4DV4E 3THNA 4HTGA 2LTSA 2MDRA 5LL6R 1YSAC 2LT7A 2ENAA 4DR4E 2EMKA 4BCAA 1KYQA 2M1SA 5A6KA 1J5EE 2LJHA 1G2DC 1BBGA 2ELYA 2EMCA 2YTEA 2EPUA 3RV1A 2L2NA 3MHSC 4LTYA 3ECRA 2EOEA 3TQMA 2DLQA 4R2AA 2EPNA 4WSGA 2EM3A 4DV1E 2MC6A 3AUZA 3HPZA 1HNZE 3EPLA 5TSEA 2HC5A 3LMLA 1EKZA 3ZOQB 3K6QA 2UUBE 2EOSA 2UUAE 3VYYA 4YY3E 2JOXA 2EE8A 1TF3A 3KZZA 2VQEE 4ZYGA 1X6HA 2VE7C 1L4SA 2R76A 5KL5A 1T4OA 2E5LE 3C6KA 2L33A 1HNWE 2E72A 2YPNA 2UUCE 2V85A 4DR3E 2FTXB 1JK2A 3EPKA 4DUYE 4O4KA 1RQ0A 1A1KA 4JV5E 4B3SE 1I4SA 4DR2E 4NXME 4L8NA 2DGCA 5KL6A 2NUFA 1GZ6A 2V88A 1AAYA 2EPMX 2LMZA 2B7TA 2D9HA 1P47A 2F4VE 1JFZA 3HQ1A 1ZAAC 2V83A 2EQ3A 4X65E 2PRTA 4Q28A 2L2MA 2EMHA 1A1JA 4K0KE 2UXBE 3AV0A 1TF6A 3RV0A 3VK6A 4NHRA 2MKNA 2EOHA 1N34E 4F9BB 4GEQB 4I8OA 2CTDA 1ZBQA 3J80C 1A1GA 4BBYA 4DKKA 3BIDA 5IWAE 4R2RA 1UILA 4BHCA 1FKAE 4X9JA 2EOMA 2LJUA 3QG5C 2FV4B 1WXRA 5A6AA 2EPZA 4DV0E 1U61A 2DIXA 4GKJE 2EPXA 2L8TA 1IBME 3IWDA 1IQOA 3FIGA 1XMQE 2EM7A
chains in the Genus database with same CATH topology
4TUGA 4B3TE 2EB1A 2N3GA 4DV4E 2V8QB 4LFCE 2MC5A 3F6GA 1FJGE 4B3RE 1N36E 2LTSA 3T1YE 2MDRA 3O2RB 5AASA 5LL6R 3J81C 1YYKA 1DQ3A 4DR4E 2FFLA 3JU0A 4BCAA 4BS9A 4WSPA 1T4LB 2B7VA 1HR0E 2M1SA 1GQEA 4AQYE 1J5EE 3IWBA 3RMPA 3MSWA 2LJHA 2DMYA 2V86A 4WFTA 1WHNA 1XNRE 4X66E 2LTRA 3P1XA 3ADJA 3RV1A 2L2NA 4LTYA 4JI1E 4DV6E 4LF9E 1XNQE 5F3WA 4LU9A 3LLHA 2VQFE 1STUA 1HNXE 5BR8E 1YZ9A 3DF6A 5T6JA 4BC7A 3ADGA 4LF5E 4DV5E 4JI4E 2LUQA 4DV1E 2L3JA 4LFBE 2MC6A 2FGGA 3AUZA 4DV2E 3HPZA 1HNZE 5LMNE 2H36X 1SR9A 2RSMA 2RS7A 3LMLA 1EKZA 3ZOQB 3K6QA 4DR1E 2YZTA 1DI2A 4DV7E 2EWLA 4JI3E 1O0WA 2YT4A 4BMJA 4DMIA 5AE1A 1IBLE 2UUBE 2UUAE 3DJWA 3VYYA 2GSLA 5AE2A 3HTXA 1X48A 4DR6E 4YY3E 4DV3E 4WPYA 1RC5A 2JOXA 1RC7A 5CFFE 1IBKE 4R03A 2VQEE 2JOBA 4P7DA 1N33E 3KWRA 2VE7C 2ODRD 4X62E 4JI6E 3JAMC 4OOGC 1T4OA 2E5LE 4JI0E 2L33A 5AE3A 4X8WA 1HNWE 3C4BA 4M0VA 2UUCE 2M4IA 2V85A 3IWCA 2LUPB 4BC9A 4DR3E 2FTXB 4B3ME 3T1HE 2DB2A 2B3TB 1QU6A 2E1MA 4F9AB 4KHPE 1J26A 2VF1A 2CPNA 4P78A 2KHXA 4DUYE 5DNYA 2LE2A 3N3WA 1RQ0A 5LMUE 1I94E 4F54A 2LBSB 2IHR1 2HHHE 1T4NA 4OX9E 4JYAE 4JV5E 2ZM6E 2EZ6A 4M2ZA 2G7HA 3H09A 4B3SE 1I4SA 2RTXA 4DR2E 1WHQA 3J7AG 3VYXA 3OTOE 4NXNE 3OMLA 4NXME 4L8NA 4GKKE 2NUFA 4WYQB 4L5NC 1GZ6A 4JI5E 2V88A 1ZBTA 2LMZA 4OUNA 2B7TA 2JVAA 4JI2E 2L2KB 4KZSA 2QVWA 5ADZA 2UU9E 4LFAE 4DR7E 3O2RA 2KOUA 2F4VE 1JFZA 4DUZE 3HQ1A 4R8OA 4F9CB 2L3CA 3HXLA 2V83A 1X49A 4LF4E 1YYWA 3HPSA 4JI7E 3C4TA 4X65E 2F8BA 2L2MA 4Q28A 4YHHE 4K0KE 2UXBE 3AV0A 2V89A 3RV0A 3VK6A 3ADIA 4M30A 2LRSA 1UHZA 2NA2A 3JTZA 4F9BB 1N34E 4GEQB 4I8OA 4LF7E 4LF6E 2WZOA 2K4VA 2L92A 2UXDE 2B9DA 4J8ZA 1ZBQA 4JI8E 3J80C 4X64E 4LF8E 2M7QA 4BBYA 4DKKA 3J7Yp 1N32E 3ADLA 2RS6A 2ODRC 5IWAE 2A11A 1UILA 1PKPA 2JR1A 2JY9A 5A2QC 1FKAE 2L6MA 1YYOA 2N3HA 2FV4B 4TUIA 1WXRA 2NUGA 1XMOE 1X47A 4DV0E 1U61A 2DIXA 3F6HA 4GKJE 2V87A 2L8TA 2DSYA 5FLXC 5IT9C 1IBME 3IWDA 2JWOA 3FIGA 4DR5E 2UXCE 2NUEA 2KONA 1XMQE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T E;  2EB1 A;  2N3G A;  4DV4 E;  4LFC E;  1FJG E;  4B3R E;  1N36 E;  2LTS A;  3T1Y E;  2MDR A;  3O2R B;  1YYK A;  4DR4 E;  2FFL A;  1T4L B;  2B7V A;  1HR0 E;  1GQE A;  4AQY E;  1J5E E;  2LJH A;  2DMY A;  4WFT A;  1WHN A;  1XNR E;  4X66 E;  2LTR A;  3P1X A;  3ADJ A;  3RV1 A;  2L2N A;  4JI1 E;  4DV6 E;  4LF9 E;  1XNQ E;  3LLH A;  2VQF E;  1STU A;  1HNX E;  5BR8 E;  1YZ9 A;  4LF5 E;  3ADG A;  4DV5 E;  4JI4 E;  2LUQ A;  4DV1 E;  2L3J A;  4LFB E;  4DV2 E;  1HNZ E;  5LMN E;  2RSM A;  2RS7 A;  1EKZ A;  4DR1 E;  1DI2 A;  4DV7 E;  4JI3 E;  1O0W A;  2YT4 A;  2UUB E;  2UUA E;  1IBL E;  3VYY A;  2GSL A;  3HTX A;  4DR6 E;  1X48 A;  4YY3 E;  4DV3 E;  1RC5 A;  5CFF E;  1RC7 A;  1IBK E;  2VQE E;  1N33 E;  4X62 E;  4JI6 E;  4OOG C;  1T4O A;  2E5L E;  4JI0 E;  2L33 A;  4X8W A;  1HNW E;  3C4B A;  2UUC E;  2LUP B;  4B3M E;  4DR3 E;  3T1H E;  2DB2 A;  2B3T B;  1QU6 A;  4KHP E;  1J26 A;  2CPN A;  2KHX A;  4DUY E;  3N3W A;  1RQ0 A;  5LMU E;  1I94 E;  2LBS B;  2HHH E;  2IHR 1;  4JYA E;  1T4N A;  4JV5 E;  2ZM6 E;  2EZ6 A;  4M2Z A;  4B3S E;  1I4S A;  2RTX A;  4DR2 E;  1WHQ A;  3VYX A;  3OTO E;  4NXN E;  4NXM E;  4GKK E;  2NUF A;  4WYQ B;  4JI5 E;  1ZBT A;  4OUN A;  2B7T A;  2JVA A;  4JI2 E;  2L2K B;  2UU9 E;  2QVW A;  4LFA E;  4LF8 E;  4DR7 E;  3O2R A;  2F4V E;  1JFZ A;  4DUZ E;  2L3C A;  1X49 A;  4LF4 E;  1YYW A;  4JI7 E;  3C4T A;  4X65 E;  4YHH E;  2L2M A;  2UXB E;  4K0K E;  3RV0 A;  3ADI A;  4M30 A;  2LRS A;  1UHZ A;  2NA2 A;  1N34 E;  4OX9 E;  2UXC E;  4LF7 E;  4LF6 E;  2UXD E;  4JI8 E;  4X64 E;  3J7Y p;  4DKK A;  1N32 E;  3ADL A;  2RS6 A;  5IWA E;  2A11 A;  1UIL A;  1PKP A;  2JY9 A;  1FKA E;  1YYO A;  2N3H A;  1XMO E;  2NUG A;  1X47 A;  4DV0 E;  1U61 A;  2DIX A;  4GKJ E;  1IBM E;  4DR5 E;  2NUE A;  1XMQ E; 
#chains in the Genus database with same CATH topology
 4TUG A;  4LFC E;  2V8Q B;  2EMF A;  3T1Y E;  5AAS A;  3O2R B;  1B69 A;  4F2J C;  1YYK A;  1DQ3 A;  5A6J A;  1IMU A;  4O43 A;  2VRD A;  4WSP A;  1T4L B;  1A1H A;  2EOR A;  2YTG A;  2EPA A;  2YU5 A;  2MDG A;  3RMP A;  3MSW A;  2V86 A;  4WFT A;  4R2Q A;  2LTR A;  4R2D A;  3ADJ A;  1MEY C;  1XNQ E;  5F3W A;  1WRJ A;  3LLH A;  3C6M A;  5KL4 A;  1HNX E;  4LF5 E;  2JXP A;  4LFB E;  1F2I G;  2FGG A;  4DV2 E;  2YTN A;  4HEI A;  4DR1 E;  2EWL A;  4DMI A;  4BMJ A;  1LLM C;  2GSL A;  3HTX A;  1X48 A;  2EN1 A;  2EMX A;  3MHH C;  1RC5 A;  5CFF E;  4R03 A;  3VHT B;  2WBS A;  2JOB A;  4OOG C;  2YTF A;  4JI0 E;  5AE3 A;  3C4B A;  2EM6 A;  4M0V A;  5A69 A;  2M4I A;  2LUP B;  4BC9 A;  2EPP A;  2EL6 A;  1QU6 A;  4F9A B;  1J26 A;  5DNY A;  2RQL A;  4ZYD A;  2LBS B;  2HHH E;  2YTO A;  1PDA A;  2ZM6 E;  3H09 A;  3J7A G;  3VYX A;  3OTO E;  3OML A;  2EJ4 A;  4WYQ B;  2ENH A;  4BHB A;  4WX9 A;  2GLI A;  4OUN A;  1MGT A;  2L2K B;  1RMD A;  4KZS A;  1BBO A;  3O2R A;  4F9C B;  2L3C A;  2WBU A;  1YFH A;  3HXL A;  2MKD A;  5KL7 A;  1X49 A;  4LF4 E;  3HPS A;  5LLQ A;  5AC5 A;  1A1F A;  2BBG A;  2JYA A;  4M30 A;  4OX9 E;  2UXD E;  4J8Z A;  1N3G A;  3J7Y p;  2EOF A;  2WBT A;  1N32 E;  5A2Q C;  2JP9 A;  4R2C A;  4N4R B;  1YYO A;  2EN2 A;  1XMO E;  2NUG A;  2EPK X;  1A1L A;  2EN4 A;  1PJQ A;  5FLX C;  2J7J A;  2EN8 A;  1WJP A;  4F6M A;  2A25 A;  2N3G A;  1FJG E;  2MC5 A;  3F6G A;  4B3R E;  1N36 E;  2LCE A;  2R1F A;  3J81 C;  1EH7 A;  3JU0 A;  4F6N A;  2EOO A;  2YSP A;  2DMI A;  1HR0 E;  2EOI A;  4AQY E;  2EL5 A;  3IWB A;  1Z1B A;  3P1X A;  4O24 A;  1T39 A;  4JI1 E;  4DV6 E;  2EMY A;  2VQF E;  4R2P A;  1SFE A;  5BR8 E;  1YZ9 A;  3DF6 A;  5T6J A;  3ADG A;  2YRK A;  4JI4 E;  5AC4 A;  2I9I A;  5LMN E;  4O5G A;  1SR9 A;  2EL4 A;  2HJJ A;  2K7I A;  4ZYH A;  3BBG A;  4DV7 E;  2YT4 A;  4IJD A;  5AE2 A;  4DR6 E;  2EM0 A;  4DV3 E;  1UBD C;  1IBK E;  3KZY A;  4GZN C;  4P7D A;  1N33 E;  3KWR A;  2ODR D;  4X62 E;  5KL2 A;  4X8W A;  2YWQ A;  4B3M E;  2DB2 A;  2B3T B;  4KHP E;  2EPC A;  1X6F A;  2VF1 A;  2EQ0 A;  2CPN A;  2EM2 A;  2RSI A;  4P78 A;  2KHX A;  2YTQ A;  3N3W A;  2GPI A;  5LMU E;  1I94 E;  4F54 A;  2IHR 1;  1ZR9 A;  1T4N A;  3BGH A;  4JYA E;  1IQS A;  2EZ6 A;  4WXC A;  1X3C A;  2G7H A;  2YRM A;  1EH8 A;  4GKK E;  4R2E A;  2ENC A;  4L5N C;  2EMA A;  2HGH A;  4JI5 E;  1ZBT A;  1DGC A;  4LFA E;  2UU9 E;  4DR7 E;  4NZV A;  2KOU A;  1ZTD A;  4DUZ E;  1A1I A;  4R2S A;  2GHF A;  4JI7 E;  3C4T A;  4YHH E;  2LV2 A;  2V89 A;  2I13 A;  3ADI A;  2UXC E;  1UHZ A;  2NA2 A;  4LF6 E;  2WZO A;  2K4V A;  2L92 A;  4M9V C;  2YRH A;  1YPN A;  3ADL A;  2A11 A;  2JR1 A;  1PKP A;  4IS1 C;  2N3H A;  1QNT A;  1BB8 A;  2EML A;  4TUI A;  2YSO A;  4ZYE A;  2EPO A;  1X47 A;  3F6H A;  2V87 A;  2EM4 A;  2EM5 A;  2JWO A;  1NEI A;  2JPA A;  2KON A;  2EQ1 A;  2EB1 A;  2LO3 A;  2FFL A;  2EOZ A;  4BS9 A;  2B7V A;  1GQE A;  1T38 A;  2DMY A;  2EOJ A;  1WHN A;  1XNR E;  4MLV A;  4X66 E;  1G2F C;  1TN9 A;  4LF9 E;  4LU9 A;  1X6E A;  2EP3 A;  1STU A;  2RPC A;  3THO B;  4BC7 A;  5A6B A;  4RH8 A;  2DLK A;  4DV5 E;  2M9A A;  2N8X A;  2LUQ A;  2EMZ A;  2EM9 A;  2L3J A;  3EPH A;  1X5W A;  2YTD A;  2H36 X;  1KJK A;  2RSM A;  2RS7 A;  5KL3 A;  3EPJ A;  1DI2 A;  2EMB A;  2YZT A;  3M99 B;  4JI3 E;  1O0W A;  5AE1 A;  1IBL E;  3DJW A;  1PJT A;  5A6B D;  4KWY A;  4WPY A;  2EMG A;  1RC7 A;  2YU8 A;  1YUJ A;  2EN3 A;  1AH5 A;  4JI6 E;  1EH6 A;  3JAM C;  4RHB B;  2NAB A;  1ZU1 A;  3IWC A;  3T1H E;  2E1M A;  2EOX A;  1UN6 B;  2EMW A;  2LVH A;  1YUI A;  2DRP A;  2LE2 A;  4MLQ A;  1PJS A;  5IXM B;  2ADR A;  2ELZ A;  4M2Z A;  2RTX A;  1WHQ A;  4NXN E;  2CSH A;  2EMI A;  2EPR A;  2EN6 A;  5IV8 B;  2WCC 3;  4JI2 E;  4LF8 E;  2JVA A;  5ADZ A;  2QVW A;  4R8O A;  2EM8 A;  3L00 A;  2CT1 A;  2EN7 A;  3BF2 A;  1YYW A;  2F8B A;  2YTP A;  2EPL X;  1JK1 A;  2LRS A;  3JTZ A;  4LF7 E;  3EQ1 A;  2B9D A;  2Q8U A;  2YTJ A;  4JI8 E;  2BB8 A;  1NCS A;  2M7Q A;  4X64 E;  4FK5 C;  2RS6 A;  2ODR C;  2EOY A;  2JY9 A;  2YTI A;  3UK3 C;  2L6M A;  4Q35 B;  2DSY A;  5IT9 C;  4DR5 E;  2NUE A;  2EOQ A;  1GTK A;  4B3T E;  4WXD A;  4DV4 E;  3THN A;  4HTG A;  2LTS A;  2MDR A;  5LL6 R;  1YSA C;  2LT7 A;  2ENA A;  4DR4 E;  2EMK A;  4BCA A;  1KYQ A;  2M1S A;  5A6K A;  1J5E E;  2LJH A;  1G2D C;  1BBG A;  2ELY A;  2EMC A;  2YTE A;  2EPU A;  3RV1 A;  2L2N A;  3MHS C;  4LTY A;  3ECR A;  2EOE A;  3TQM A;  2DLQ A;  4R2A A;  2EPN A;  4WSG A;  2EM3 A;  4DV1 E;  2MC6 A;  3AUZ A;  3HPZ A;  1HNZ E;  3EPL A;  5TSE A;  2HC5 A;  3LML A;  1EKZ A;  3ZOQ B;  3K6Q A;  2UUB E;  2EOS A;  2UUA E;  3VYY A;  4YY3 E;  2JOX A;  2EE8 A;  1TF3 A;  3KZZ A;  2VQE E;  4ZYG A;  1X6H A;  2VE7 C;  1L4S A;  2R76 A;  5KL5 A;  1T4O A;  2E5L E;  3C6K A;  2L33 A;  1HNW E;  2E72 A;  2YPN A;  2UUC E;  2V85 A;  4DR3 E;  2FTX B;  1JK2 A;  3EPK A;  4DUY E;  4O4K A;  1RQ0 A;  1A1K A;  4JV5 E;  4B3S E;  1I4S A;  4DR2 E;  4NXM E;  4L8N A;  2DGC A;  5KL6 A;  2NUF A;  1GZ6 A;  2V88 A;  1AAY A;  2EPM X;  2LMZ A;  2B7T A;  2D9H A;  1P47 A;  2F4V E;  1JFZ A;  3HQ1 A;  1ZAA C;  2V83 A;  2EQ3 A;  4X65 E;  2PRT A;  4Q28 A;  2L2M A;  2EMH A;  1A1J A;  4K0K E;  2UXB E;  3AV0 A;  1TF6 A;  3RV0 A;  3VK6 A;  4NHR A;  2MKN A;  2EOH A;  1N34 E;  4F9B B;  4GEQ B;  4I8O A;  2CTD A;  1ZBQ A;  3J80 C;  1A1G A;  4BBY A;  4DKK A;  3BID A;  5IWA E;  4R2R A;  1UIL A;  4BHC A;  1FKA E;  4X9J A;  2EOM A;  2LJU A;  3QG5 C;  2FV4 B;  1WXR A;  5A6A A;  2EPZ A;  4DV0 E;  1U61 A;  2DIX A;  4GKJ E;  2EPX A;  2L8T A;  1IBM E;  3IWD A;  1IQO A;  3FIG A;  1XMQ E;  2EM7 A; 
#chains in the Genus database with same CATH homology
 4TUG A;  4B3T E;  2EB1 A;  2N3G A;  4DV4 E;  2V8Q B;  4LFC E;  2MC5 A;  3F6G A;  1FJG E;  4B3R E;  1N36 E;  2LTS A;  3T1Y E;  2MDR A;  3O2R B;  5AAS A;  5LL6 R;  3J81 C;  1YYK A;  1DQ3 A;  4DR4 E;  2FFL A;  3JU0 A;  4BCA A;  4BS9 A;  4WSP A;  1T4L B;  2B7V A;  1HR0 E;  2M1S A;  1GQE A;  4AQY E;  1J5E E;  3IWB A;  3RMP A;  3MSW A;  2LJH A;  2DMY A;  2V86 A;  4WFT A;  1WHN A;  1XNR E;  4X66 E;  2LTR A;  3P1X A;  3ADJ A;  3RV1 A;  2L2N A;  4LTY A;  4JI1 E;  4DV6 E;  4LF9 E;  1XNQ E;  5F3W A;  4LU9 A;  3LLH A;  2VQF E;  1STU A;  1HNX E;  5BR8 E;  1YZ9 A;  3DF6 A;  5T6J A;  4BC7 A;  3ADG A;  4LF5 E;  4DV5 E;  4JI4 E;  2LUQ A;  4DV1 E;  2L3J A;  4LFB E;  2MC6 A;  2FGG A;  3AUZ A;  4DV2 E;  3HPZ A;  1HNZ E;  5LMN E;  2H36 X;  1SR9 A;  2RSM A;  2RS7 A;  3LML A;  1EKZ A;  3ZOQ B;  3K6Q A;  4DR1 E;  2YZT A;  1DI2 A;  4DV7 E;  2EWL A;  4JI3 E;  1O0W A;  2YT4 A;  4BMJ A;  4DMI A;  5AE1 A;  1IBL E;  2UUB E;  2UUA E;  3DJW A;  3VYY A;  2GSL A;  5AE2 A;  3HTX A;  1X48 A;  4DR6 E;  4YY3 E;  4DV3 E;  4WPY A;  1RC5 A;  2JOX A;  1RC7 A;  5CFF E;  1IBK E;  4R03 A;  2VQE E;  2JOB A;  4P7D A;  1N33 E;  3KWR A;  2VE7 C;  2ODR D;  4X62 E;  4JI6 E;  3JAM C;  4OOG C;  1T4O A;  2E5L E;  4JI0 E;  2L33 A;  5AE3 A;  4X8W A;  1HNW E;  3C4B A;  4M0V A;  2UUC E;  2M4I A;  2V85 A;  3IWC A;  2LUP B;  4BC9 A;  4DR3 E;  2FTX B;  4B3M E;  3T1H E;  2DB2 A;  2B3T B;  1QU6 A;  2E1M A;  4F9A B;  4KHP E;  1J26 A;  2VF1 A;  2CPN A;  4P78 A;  2KHX A;  4DUY E;  5DNY A;  2LE2 A;  3N3W A;  1RQ0 A;  5LMU E;  1I94 E;  4F54 A;  2LBS B;  2IHR 1;  2HHH E;  1T4N A;  4OX9 E;  4JYA E;  4JV5 E;  2ZM6 E;  2EZ6 A;  4M2Z A;  2G7H A;  3H09 A;  4B3S E;  1I4S A;  2RTX A;  4DR2 E;  1WHQ A;  3J7A G;  3VYX A;  3OTO E;  4NXN E;  3OML A;  4NXM E;  4L8N A;  4GKK E;  2NUF A;  4WYQ B;  4L5N C;  1GZ6 A;  4JI5 E;  2V88 A;  1ZBT A;  2LMZ A;  4OUN A;  2B7T A;  2JVA A;  4JI2 E;  2L2K B;  4KZS A;  2QVW A;  5ADZ A;  2UU9 E;  4LFA E;  4DR7 E;  3O2R A;  2KOU A;  2F4V E;  1JFZ A;  4DUZ E;  3HQ1 A;  4R8O A;  4F9C B;  2L3C A;  3HXL A;  2V83 A;  1X49 A;  4LF4 E;  1YYW A;  3HPS A;  4JI7 E;  3C4T A;  4X65 E;  2F8B A;  2L2M A;  4Q28 A;  4YHH E;  4K0K E;  2UXB E;  3AV0 A;  2V89 A;  3RV0 A;  3VK6 A;  3ADI A;  4M30 A;  2LRS A;  1UHZ A;  2NA2 A;  3JTZ A;  4F9B B;  1N34 E;  4GEQ B;  4I8O A;  4LF7 E;  4LF6 E;  2WZO A;  2K4V A;  2L92 A;  2UXD E;  2B9D A;  4J8Z A;  1ZBQ A;  4JI8 E;  3J80 C;  4X64 E;  4LF8 E;  2M7Q A;  4BBY A;  4DKK A;  3J7Y p;  1N32 E;  3ADL A;  2RS6 A;  2ODR C;  5IWA E;  2A11 A;  1UIL A;  1PKP A;  2JR1 A;  2JY9 A;  5A2Q C;  1FKA E;  2L6M A;  1YYO A;  2N3H A;  2FV4 B;  4TUI A;  1WXR A;  2NUG A;  1XMO E;  1X47 A;  4DV0 E;  1U61 A;  2DIX A;  3F6H A;  4GKJ E;  2V87 A;  2L8T A;  2DSY A;  5FLX C;  5IT9 C;  1IBM E;  3IWD A;  2JWO A;  3FIG A;  4DR5 E;  2UXC E;  2NUE A;  2KON A;  1XMQ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...