3C4BA

Structure of rnaseiiib and dsrna binding domains of mouse dicer
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
263
structure length
244
Chain Sequence
DAEKTLNHLISGFETFEKKINYRFKNKAYLLQAFTHASYHYNTITDYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVKFQLEKNEEDIEVPKAMGDIFESLAGAIYMDSGMSLEVVWQVYYPMMQPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and biochemical insights into the dicing mechanism of mouse Dicer: A conserved lysine is critical for dsRNA cleavage.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Endoribonuclease Dicer
total genus 80
structure length 244
sequence length 263
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2008-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 3c4bA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3c4bA02
4LF5E 1X48A 4DV2E 3RV0A 1DI2A 2KHXA 1J26A 1HR0E 2UXBE 1RC5A 4GKJE 4JI1E 4YY3E 4JI7E 4K0KE 3J7Yp 3T1YE 2UXDE 3T1HE 2L2NA 2LUQA 1FJGE 4KHPE 2JVAA 4OOGC 4DV6E 2UXCE 2RS6A 4YHHE 1WHQA 2CPNA 3O2RB 4WFTA 3ADLA 4M2ZA 3ADJA 2ZM6E 1ZBTA 1XMOE 4JI2E 2UUBE 1UHZA 4LF4E 1STUA 1EKZA 4LF7E 1QU6A 4JV5E 5LMNE 4DR5E 5LMUE 1XMQE 4X66E 1JFZA 2QVWA 1HNZE 4LFCE 2L33A 4LFAE 4B3ME 1T4NA 4JI5E 4DR1E 4JI0E 4DV1E 4LF8E 3ADIA 2L2MA 1IBKE 1X47A 2L3CA 4WYQB 2L2KB 4DR3E 4GKKE 3O2RA 5IWAE 4LF6E 4DV4E 2E5LE 4LFBE 2DB2A 1N36E 4B3RE 1RQ0A 4DR6E 2YT4A 2RTXA 2FFLA 4DKKA 4DR2E 2LBSB 1T4LB 1I94E 2RSMA 4DV5E 1UILA 1RC7A 2NUEA 2B7TA 4DV7E 4B3SE 3HTXA 2F4VE 2VQFE 1YYWA 3C4TA 2JY9A 2GSLA 4NXNE 2IHR1 1YYKA 2NUGA 1XNQE 4OUNA 2EB1A 2DIXA 2B3TB 1IBME 2MDRA 3LLHA 1N33E 5BR8E 4DR7E 4X8WA 4X64E 4LF9E 1YYOA 3RV1A 4JI8E 2N3GA 2DMYA 2HHHE 1PKPA 1I4SA 2A11A 2UUCE 2NA2A 2LUPB 1HNWE 2LTSA 3VYYA 4X65E 2VQEE 4JYAE 2LRSA 2LTRA 1J5EE 4JI6E 4OX9E 4DV0E 4DUYE 4JI4E 4NXME 2UUAE 1HNXE 1GQEA 4DUZE 3OTOE 2B7VA 1FKAE 2RS7A 1N32E 2LJHA 4DR4E 1N34E 3ADGA 2UU9E 1IBLE 2NUFA 3N3WA 3P1XA 4X62E 4AQYE 3C4BA 1XNRE 1X49A 4B3TE 2N3HA 2L3JA 2EZ6A 1T4OA 1YZ9A 4DV3E 4M30A 1O0WA 1U61A 3VYXA 4JI3E 1WHNA 5CFFE
chains in the Genus database with same CATH superfamily
5A69A 2ENCA 3K6QA 1RMDA 2GHFA 2EM9A 2UXBE 1YPNA 2EM3A 3T1HE 4BBYA 4J8ZA 2L2NA 3AV0A 3VHTB 2UXCE 4TUIA 3O2RB 3C6MA 2BBGA 2JWOA 3ADJA 2EOOA 3IWBA 1IQSA 4JI2E 2V8QB 2EE8A 2WBSA 2EN3A 2RQLA 1T38A 1EKZA 4LF7E 5LMNE 1DQ3A 3THNA 3HQ1A 3ADIA 4NZVA 4BHCA 3IWDA 2L3CA 2L2KB 4DR3E 2EOYA 3O2RA 2D9HA 3DJWA 5AE1A 4R2DA 2EWLA 2EQ1A 1N36E 3EPLA 2FFLA 2EN4A 3IWCA 2PRTA 2NUEA 4B3SE 3HTXA 5A2QC 3C4TA 4P7DA 2A25A 2JY9A 2LT7A 5IV8B 1Z1BA 2NUGA 3QG5C 2EPOA 4RHBB 4F9BB 2EL4A 4F9CB 2DIXA 3KZZA 2H36X 2EMBA 4WSGA 2K4VA 2NA2A 2YTGA 1HNWE 2LTSA 2DLKA 3VYYA 2LRSA 3KWRA 2B9DA 1J5EE 4OX9E 2V86A 2EPZA 2YRKA 2EPUA 2I13A 2FGGA 3MHSC 2EPAA 3MSWA 1JK2A 5AC4A 2EM5A 4X9JA 4Q35B 4DR4E 1TN9A 2M1SA 2EOMA 1N3GA 2JPAA 2EM0A 3P1XA 5IXMB 3C4BA 2N3HA 1ZR9A 4O4KA 4BMJA 4M30A 4MLVA 1O0WA 3OMLA 1SR9A 2EPMX 5AASA 3M99B 5ADZA 2V87A 2EMZA 3BGHA 3EPKA 1DI2A 2LVHA 1HR0E 2E1MA 4R03A 1RC5A 2WCC3 5A6AA 2EJ4A 2DLQA 4DMIA 2EOJA 2MKDA 3J7Yp 2EMKA 2UXDE 4R2SA 1F2IG 1PJTA 3JTZA 4KHPE 1ZAAC 2JVAA 4F2JC 5KL6A 1T39A 1ZBQA 1X6FA 2CPNA 4GEQB 4WFTA 4IS1C 1A1LA 3UK3C 4M2ZA 2ZM6E 1XMOE 4FK5C 1KYQA 4Q28A 1G2FC 1UHZA 2EOZA 4LF4E 4F6MA 4L5NC 3VK6A 1TF6A 1L4SA 4JV5E 1XMQE 2QVWA 2EMLA 2EOHA 5AE2A 2L33A 3ECRA 4LFAE 3EQ1A 4LF8E 2EMAA 4R2CA 4WYQB 2M9AA 4BCAA 2WBTA 2K7IA 3C6KA 5KL3A 2EQ0A 2YT4A 2RTXA 4DR2E 2LBSB 2EPKX 1PDAA 2LJUA 2YU5A 1UILA 2B7TA 1X5WA 3TQMA 2MC5A 5FLXC 3THOB 2IHR1 1UBDC 4R2PA 2V89A 1X6HA 1QNTA 2F8BA 4HEIA 4BS9A 1XNQE 5AC5A 2EB1A 2YTQA 4O5GA 4X8WA 2FTXB 3RV1A 1YFHA 4TUGA 2CSHA 2ENHA 5TSEA 1A1FA 1I4SA 2UUCE 3HXLA 3J7AG 2V85A 4JYAE 4JI6E 1AH5A 2RPCA 4NHRA 5KL4A 3BBGA 4R8OA 4BC9A 2EN1A 4DUZE 1WXRA 3ZOQB 2B7VA 1FKAE 2Q8UA 2EPCA 2RS7A 2YTNA 1NCSA 1EH8A 2EPRA 2HC5A 2LJHA 4F6NA 2YWQA 2G7HA 1IBLE 5KL7A 3N3WA 4WXCA 2WZOA 1A1KA 4HTGA 4R2AA 4ZYGA 3J80C 1T4OA 2EMXA 2YPNA 1U61A 2ELYA 2YTFA 1EH6A 3HPSA 2EPXA 1ZU1A 3VYXA 2ODRC 1X48A 4LF5E 3RV0A 3RMPA 2M4IA 2ELZA 1J26A 2YSOA 4JI1E 1WJPA 3DF6A 4YY3E 4K0KE 3T1YE 3BF2A 2GPIA 4GZNC 2EN6A 4OOGC 1TF3A 4IJDA 1G2DC 2RS6A 4R2RA 4YHHE 2EN2A 2YTEA 2DGCA 2HGHA 4ZYEA 2YTPA 4BHBA 1DGCA 2MDGA 2MKNA 1ZBTA 2EOSA 3LMLA 5KL5A 1STUA 2EM6A 2LO3A 4KWYA 5LMUE 2MC6A 1JFZA 1HNZE 2ADRA 5A6BA 1MEYC 4L8NA 1X3CA 2L92A 4JI5E 4DR1E 4DV1E 4LU9A 1IMUA 2EMFA 2VRDA 1IBKE 1X47A 4LF6E 4ZYHA 2R1FA 3L00A 2EPPA 2FV4B 2EOFA 4LFBE 2YTJA 2DB2A 2LV2A 3EPJA 1RQ0A 2EM7A 4B3RE 4DR6E 2JOBA 5A6JA 1WRJA 5KL2A 1I94E 1LLMC 1UN6B 3EPHA 1RC7A 1X6EA 2DSYA 4DV7E 2F4VE 1A1HA 2EM4A 4P78A 5DNYA 2JOXA 1GZ6A 1SFEA 2BB8A 2YSPA 4O43A 2R76A 2EN7A 2MDRA 3LLHA 2EOIA 2E72A 4LF9E 2CTDA 4O24A 2N3GA 4JI8E 2EP3A 2DMYA 2A11A 2RSIA 2HJJA 4MLQA 2LUPB 4X65E 4DV0E 1JK1A 1HNXE 1GQEA 2EORA 2VF1A 3BIDA 4BC7A 1YSAC 1BBOA 4RH8A 4WX9A 1N34E 2EMWA 2EQ3A 4R2QA 5A6KA 3ADGA 1BB8A 1XNRE 1X49A 2I9IA 4B3TE 1AAYA 1YZ9A 4WSPA 3JAMC 5LLQA 4DV3E 1B69A 1WHNA 2YRMA 2ENAA 4DV2E 2KHXA 2EMCA 2LMZA 2YRHA 2EMYA 3JU0A 4LTYA 4GKJE 5IT9C 2YZTA 2EMHA 4JI7E 3AUZA 2DRPA 2JYAA 2LUQA 1FJGE 1GTKA 1PJSA 3H09A 4DV6E 2M7QA 1WHQA 2EOQA 2KONA 1MGTA 3ADLA 5AE3A 2EL6A 4WPYA 2EN8A 2UUBE 2V83A 2J7JA 1YUIA 1KJKA 3MHHC 1A1JA 1QU6A 2EM8A 4DR5E 2YTDA 4X66E 1IQOA 1PJQA 1A1GA 4B3ME 1T4NA 4JI0E 5LL6R 2L2MA 4F9AB 4GKKE 5IWAE 4DV4E 2EL5A 2LCEA 5A6BD 2E5LE 2EPLX 2V88A 4I8OA 2JR1A 1A1IA 4DKKA 2LE2A 1T4LB 2RSMA 4DV5E 4KZSA 3KZYA 3FIGA 2YTIA 2JP9A 2VQFE 1YYWA 4F54A 2GSLA 4NXNE 1YYKA 4N4RB 3F6HA 5T6JA 5F3WA 2EPNA 2DMIA 4OUNA 2EM2A 1IBME 1N33E 1BBGA 2B3TB 5BR8E 4DR7E 2EOXA 4ZYDA 2N8XA 4X64E 4M9VC 1YYOA 2L8TA 2EOEA 1P47A 2HHHE 1PKPA 2EMGA 2VQEE 2LTRA 2VE7C 4R2EA 4DUYE 4JI4E 4NXME 2UUAE 3J81C 2WBUA 3OTOE 4WXDA 4M0VA 2GLIA 2CT1A 1ZTDA 3F6GA 3HPZA 1YUJA 2KOUA 2JXPA 1EH7A 2EMIA 1N32E 2L6MA 2UU9E 2YU8A 2NUFA 1NEIA 4X62E 4AQYE 2NABA 2EZ6A 2L3JA 2YTOA 2ODRD 4JI3E 4LFCE 5CFFE
chains in the Genus database with same CATH topology
2ODRC 1X48A 4LF5E 5AASA 4DV2E 5ADZA 3RV0A 3RMPA 2V87A 2M4IA 3K6QA 1DI2A 2KHXA 2LMZA 1J26A 3JU0A 4LTYA 1HR0E 2E1MA 4R03A 1RC5A 4GKJE 2UXBE 4JI1E 3DF6A 4YY3E 5IT9C 2YZTA 4DMIA 4JI7E 4K0KE 3J7Yp 3AUZA 3T1YE 2UXDE 3T1HE 4BBYA 4J8ZA 2L2NA 2LUQA 1FJGE 3JTZA 4KHPE 3AV0A 2JVAA 4OOGC 3HPSA 3H09A 4DV6E 2UXCE 2RS6A 1ZBQA 4YHHE 4TUIA 3ADIA 2M7QA 1WHQA 2CPNA 3O2RB 2KONA 4GEQB 4WFTA 3ADLA 5AE3A 2JWOA 4M2ZA 3ADJA 4WPYA 3IWBA 2ZM6E 1ZBTA 1XMOE 4JI2E 3LMLA 2V8QB 2UUBE 2V83A 4Q28A 1UHZA 4LF4E 1STUA 1EKZA 4L5NC 3VK6A 4LF7E 1QU6A 4JV5E 5LMNE 1DQ3A 4DR5E 5LMUE 1XMQE 2MC6A 4X66E 1JFZA 2QVWA 1HNZE 5AE2A 4LFCE 2L33A 3HQ1A 4L8NA 4LFAE 2L92A 1T4NA 4B3ME 4JI5E 4DR1E 4JI0E 4DV1E 4LU9A 5LL6R 4LF8E 3IWDA 2L2MA 4F9AB 1X47A 2L3CA 4BCAA 4WYQB 2L2KB 4DR3E 1IBKE 4GKKE 3O2RA 5IWAE 4LF6E 4DV4E 3DJWA 5AE1A 2EWLA 2E5LE 4I8OA 2FV4B 2V88A 4LFBE 2JR1A 2DB2A 1N36E 4B3RE 1RQ0A 4DR6E 2YT4A 2JOBA 2RTXA 2FFLA 4DKKA 4DR2E 2LBSB 2LE2A 1T4LB 1I94E 2RSMA 4DV5E 3IWCA 1UILA 1RC7A 4KZSA 2NUEA 2B7TA 2DSYA 3FIGA 4DV7E 4B3SE 3HTXA 2F4VE 2VQFE 1YYWA 2MC5A 4F54A 5FLXC 3C4TA 5A2QC 4P7DA 2JY9A 2GSLA 4NXNE 2IHR1 4P78A 1YYKA 2V89A 2NUGA 3F6HA 5T6JA 2F8BA 2JOXA 5DNYA 5F3WA 1GZ6A 4F9BB 4BS9A 1XNQE 4OUNA 4F9CB 2EB1A 2DIXA 2B3TB 1IBME 2MDRA 3LLHA 1N33E 5BR8E 4DR7E 4X8WA 2FTXB 4X64E 2H36X 1YYOA 4LF9E 3RV1A 2L8TA 2N3GA 4JI8E 4TUGA 2DMYA 2HHHE 1PKPA 1I4SA 2A11A 2UUCE 2K4VA 2NA2A 2LUPB 3HXLA 2LTSA 3VYYA 2V85A 4X65E 2VQEE 3J7AG 1HNWE 4JYAE 2LRSA 2LTRA 2B9DA 2VE7C 3KWRA 4DV0E 1J5EE 4DUYE 4JI6E 4OX9E 2V86A 4JI4E 4NXME 2UUAE 1HNXE 4R8OA 1GQEA 4BC9A 3J81C 1WXRA 4DUZE 3OTOE 2FGGA 4M0VA 3ZOQB 2B7VA 3MSWA 3F6GA 3HPZA 1FKAE 2KOUA 2RS7A 2VF1A 4BC7A 1N32E 2LJHA 4DR4E 1N34E 2M1SA 2L6MA 3VYXA 3ADGA 2UU9E 2G7HA 1IBLE 2NUFA 3N3WA 3P1XA 2WZOA 4X62E 4AQYE 3C4BA 1XNRE 1X49A 4B3TE 2N3HA 2L3JA 2EZ6A 1T4OA 1YZ9A 4WSPA 4BMJA 3JAMC 4M30A 3J80C 1O0WA 1U61A 2ODRD 4DV3E 3OMLA 1SR9A 4JI3E 1WHNA 5CFFE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 E;  1X48 A;  4DV2 E;  3RV0 A;  1DI2 A;  2KHX A;  1J26 A;  1HR0 E;  2UXB E;  1RC5 A;  4GKJ E;  4JI1 E;  4YY3 E;  4JI7 E;  4K0K E;  3J7Y p;  3T1Y E;  2UXD E;  3T1H E;  2L2N A;  2LUQ A;  1FJG E;  4KHP E;  2JVA A;  4OOG C;  4DV6 E;  2UXC E;  2RS6 A;  4YHH E;  1WHQ A;  2CPN A;  3O2R B;  4WFT A;  3ADL A;  4M2Z A;  3ADJ A;  2ZM6 E;  1ZBT A;  1XMO E;  4JI2 E;  2UUB E;  1UHZ A;  4LF4 E;  1STU A;  1EKZ A;  4LF7 E;  1QU6 A;  4JV5 E;  5LMN E;  4DR5 E;  5LMU E;  1XMQ E;  4X66 E;  1JFZ A;  2QVW A;  1HNZ E;  4LFC E;  2L33 A;  4LFA E;  4B3M E;  1T4N A;  4JI5 E;  4DR1 E;  4JI0 E;  4DV1 E;  4LF8 E;  3ADI A;  2L2M A;  1IBK E;  1X47 A;  2L3C A;  4WYQ B;  2L2K B;  4DR3 E;  4GKK E;  3O2R A;  5IWA E;  4LF6 E;  4DV4 E;  2E5L E;  4LFB E;  2DB2 A;  1N36 E;  4B3R E;  1RQ0 A;  4DR6 E;  2YT4 A;  2RTX A;  2FFL A;  4DKK A;  4DR2 E;  2LBS B;  1T4L B;  1I94 E;  2RSM A;  4DV5 E;  1UIL A;  1RC7 A;  2NUE A;  2B7T A;  4DV7 E;  4B3S E;  3HTX A;  2F4V E;  2VQF E;  1YYW A;  3C4T A;  2JY9 A;  2GSL A;  4NXN E;  2IHR 1;  1YYK A;  2NUG A;  1XNQ E;  4OUN A;  2EB1 A;  2DIX A;  2B3T B;  1IBM E;  2MDR A;  3LLH A;  1N33 E;  5BR8 E;  4DR7 E;  4X8W A;  4X64 E;  4LF9 E;  1YYO A;  3RV1 A;  4JI8 E;  2N3G A;  2DMY A;  2HHH E;  1PKP A;  1I4S A;  2A11 A;  2UUC E;  2NA2 A;  2LUP B;  1HNW E;  2LTS A;  3VYY A;  4X65 E;  2VQE E;  4JYA E;  2LRS A;  2LTR A;  1J5E E;  4JI6 E;  4OX9 E;  4DV0 E;  4DUY E;  4JI4 E;  4NXM E;  2UUA E;  1HNX E;  1GQE A;  4DUZ E;  3OTO E;  2B7V A;  1FKA E;  2RS7 A;  1N32 E;  2LJH A;  4DR4 E;  1N34 E;  3ADG A;  2UU9 E;  1IBL E;  2NUF A;  3N3W A;  3P1X A;  4X62 E;  4AQY E;  3C4B A;  1XNR E;  1X49 A;  4B3T E;  2N3H A;  2L3J A;  2EZ6 A;  1T4O A;  1YZ9 A;  4DV3 E;  4M30 A;  1O0W A;  1U61 A;  3VYX A;  4JI3 E;  1WHN A;  5CFF E; 
#chains in the Genus database with same CATH topology
 5A69 A;  2ENC A;  3K6Q A;  1RMD A;  2GHF A;  2EM9 A;  2UXB E;  1YPN A;  2EM3 A;  3T1H E;  4BBY A;  4J8Z A;  2L2N A;  3AV0 A;  3VHT B;  2UXC E;  4TUI A;  3O2R B;  3C6M A;  2BBG A;  2JWO A;  3ADJ A;  2EOO A;  3IWB A;  1IQS A;  4JI2 E;  2V8Q B;  2EE8 A;  2WBS A;  2EN3 A;  2RQL A;  1T38 A;  1EKZ A;  4LF7 E;  5LMN E;  1DQ3 A;  3THN A;  3HQ1 A;  3ADI A;  4NZV A;  4BHC A;  3IWD A;  2L3C A;  2L2K B;  4DR3 E;  2EOY A;  3O2R A;  2D9H A;  3DJW A;  5AE1 A;  4R2D A;  2EWL A;  2EQ1 A;  1N36 E;  3EPL A;  2FFL A;  2EN4 A;  3IWC A;  2PRT A;  2NUE A;  4B3S E;  3HTX A;  5A2Q C;  3C4T A;  4P7D A;  2A25 A;  2JY9 A;  2LT7 A;  5IV8 B;  1Z1B A;  2NUG A;  3QG5 C;  2EPO A;  4RHB B;  4F9B B;  2EL4 A;  4F9C B;  2DIX A;  3KZZ A;  2H36 X;  2EMB A;  4WSG A;  2K4V A;  2NA2 A;  2YTG A;  1HNW E;  2LTS A;  2DLK A;  3VYY A;  2LRS A;  3KWR A;  2B9D A;  1J5E E;  4OX9 E;  2V86 A;  2EPZ A;  2YRK A;  2EPU A;  2I13 A;  2FGG A;  3MHS C;  2EPA A;  3MSW A;  1JK2 A;  5AC4 A;  2EM5 A;  4X9J A;  4Q35 B;  4DR4 E;  1TN9 A;  2M1S A;  2EOM A;  1N3G A;  2JPA A;  2EM0 A;  3P1X A;  5IXM B;  3C4B A;  2N3H A;  1ZR9 A;  4O4K A;  4BMJ A;  4M30 A;  4MLV A;  1O0W A;  3OML A;  1SR9 A;  2EPM X;  5AAS A;  3M99 B;  5ADZ A;  2V87 A;  2EMZ A;  3BGH A;  3EPK A;  1DI2 A;  2LVH A;  1HR0 E;  2E1M A;  4R03 A;  1RC5 A;  2WCC 3;  5A6A A;  2EJ4 A;  2DLQ A;  4DMI A;  2EOJ A;  2MKD A;  3J7Y p;  2EMK A;  2UXD E;  4R2S A;  1F2I G;  1PJT A;  3JTZ A;  4KHP E;  1ZAA C;  2JVA A;  4F2J C;  5KL6 A;  1T39 A;  1ZBQ A;  1X6F A;  2CPN A;  4GEQ B;  4WFT A;  4IS1 C;  1A1L A;  3UK3 C;  4M2Z A;  2ZM6 E;  1XMO E;  4FK5 C;  1KYQ A;  4Q28 A;  1G2F C;  1UHZ A;  2EOZ A;  4LF4 E;  4F6M A;  4L5N C;  3VK6 A;  1TF6 A;  1L4S A;  4JV5 E;  1XMQ E;  2QVW A;  2EML A;  2EOH A;  5AE2 A;  2L33 A;  3ECR A;  4LFA E;  3EQ1 A;  4LF8 E;  2EMA A;  4R2C A;  4WYQ B;  2M9A A;  4BCA A;  2WBT A;  2K7I A;  3C6K A;  5KL3 A;  2EQ0 A;  2YT4 A;  2RTX A;  4DR2 E;  2LBS B;  2EPK X;  1PDA A;  2LJU A;  2YU5 A;  1UIL A;  2B7T A;  1X5W A;  3TQM A;  2MC5 A;  5FLX C;  3THO B;  2IHR 1;  1UBD C;  4R2P A;  2V89 A;  1X6H A;  1QNT A;  2F8B A;  4HEI A;  4BS9 A;  1XNQ E;  5AC5 A;  2EB1 A;  2YTQ A;  4O5G A;  4X8W A;  2FTX B;  3RV1 A;  1YFH A;  4TUG A;  2CSH A;  2ENH A;  5TSE A;  1A1F A;  1I4S A;  2UUC E;  3HXL A;  3J7A G;  2V85 A;  4JYA E;  4JI6 E;  1AH5 A;  2RPC A;  4NHR A;  5KL4 A;  3BBG A;  4R8O A;  4BC9 A;  2EN1 A;  4DUZ E;  1WXR A;  3ZOQ B;  2B7V A;  1FKA E;  2Q8U A;  2EPC A;  2RS7 A;  2YTN A;  1NCS A;  1EH8 A;  2EPR A;  2HC5 A;  2LJH A;  4F6N A;  2YWQ A;  2G7H A;  1IBL E;  5KL7 A;  3N3W A;  4WXC A;  2WZO A;  1A1K A;  4HTG A;  4R2A A;  4ZYG A;  3J80 C;  1T4O A;  2EMX A;  2YPN A;  1U61 A;  2ELY A;  2YTF A;  1EH6 A;  3HPS A;  2EPX A;  1ZU1 A;  3VYX A;  2ODR C;  1X48 A;  4LF5 E;  3RV0 A;  3RMP A;  2M4I A;  2ELZ A;  1J26 A;  2YSO A;  4JI1 E;  1WJP A;  3DF6 A;  4YY3 E;  4K0K E;  3T1Y E;  3BF2 A;  2GPI A;  4GZN C;  2EN6 A;  4OOG C;  1TF3 A;  4IJD A;  1G2D C;  2RS6 A;  4R2R A;  4YHH E;  2EN2 A;  2YTE A;  2DGC A;  2HGH A;  4ZYE A;  2YTP A;  4BHB A;  1DGC A;  2MDG A;  2MKN A;  1ZBT A;  2EOS A;  3LML A;  5KL5 A;  1STU A;  2EM6 A;  2LO3 A;  4KWY A;  5LMU E;  2MC6 A;  1JFZ A;  1HNZ E;  2ADR A;  5A6B A;  1MEY C;  4L8N A;  1X3C A;  2L92 A;  4JI5 E;  4DR1 E;  4DV1 E;  4LU9 A;  1IMU A;  2EMF A;  2VRD A;  1IBK E;  1X47 A;  4LF6 E;  4ZYH A;  2R1F A;  3L00 A;  2EPP A;  2FV4 B;  2EOF A;  4LFB E;  2YTJ A;  2DB2 A;  2LV2 A;  3EPJ A;  1RQ0 A;  2EM7 A;  4B3R E;  4DR6 E;  2JOB A;  5A6J A;  1WRJ A;  5KL2 A;  1I94 E;  1LLM C;  1UN6 B;  3EPH A;  1RC7 A;  1X6E A;  2DSY A;  4DV7 E;  2F4V E;  1A1H A;  2EM4 A;  4P78 A;  5DNY A;  2JOX A;  1GZ6 A;  1SFE A;  2BB8 A;  2YSP A;  4O43 A;  2R76 A;  2EN7 A;  2MDR A;  3LLH A;  2EOI A;  2E72 A;  4LF9 E;  2CTD A;  4O24 A;  2N3G A;  4JI8 E;  2EP3 A;  2DMY A;  2A11 A;  2RSI A;  2HJJ A;  4MLQ A;  2LUP B;  4X65 E;  4DV0 E;  1JK1 A;  1HNX E;  1GQE A;  2EOR A;  2VF1 A;  3BID A;  4BC7 A;  1YSA C;  1BBO A;  4RH8 A;  4WX9 A;  1N34 E;  2EMW A;  2EQ3 A;  4R2Q A;  5A6K A;  3ADG A;  1BB8 A;  1XNR E;  1X49 A;  2I9I A;  4B3T E;  1AAY A;  1YZ9 A;  4WSP A;  3JAM C;  5LLQ A;  4DV3 E;  1B69 A;  1WHN A;  2YRM A;  2ENA A;  4DV2 E;  2KHX A;  2EMC A;  2LMZ A;  2YRH A;  2EMY A;  3JU0 A;  4LTY A;  4GKJ E;  5IT9 C;  2YZT A;  2EMH A;  4JI7 E;  3AUZ A;  2DRP A;  2JYA A;  2LUQ A;  1FJG E;  1GTK A;  1PJS A;  3H09 A;  4DV6 E;  2M7Q A;  1WHQ A;  2EOQ A;  2KON A;  1MGT A;  3ADL A;  5AE3 A;  2EL6 A;  4WPY A;  2EN8 A;  2UUB E;  2V83 A;  2J7J A;  1YUI A;  1KJK A;  3MHH C;  1A1J A;  1QU6 A;  2EM8 A;  4DR5 E;  2YTD A;  4X66 E;  1IQO A;  1PJQ A;  1A1G A;  4B3M E;  1T4N A;  4JI0 E;  5LL6 R;  2L2M A;  4F9A B;  4GKK E;  5IWA E;  4DV4 E;  2EL5 A;  2LCE A;  5A6B D;  2E5L E;  2EPL X;  2V88 A;  4I8O A;  2JR1 A;  1A1I A;  4DKK A;  2LE2 A;  1T4L B;  2RSM A;  4DV5 E;  4KZS A;  3KZY A;  3FIG A;  2YTI A;  2JP9 A;  2VQF E;  1YYW A;  4F54 A;  2GSL A;  4NXN E;  1YYK A;  4N4R B;  3F6H A;  5T6J A;  5F3W A;  2EPN A;  2DMI A;  4OUN A;  2EM2 A;  1IBM E;  1N33 E;  1BBG A;  2B3T B;  5BR8 E;  4DR7 E;  2EOX A;  4ZYD A;  2N8X A;  4X64 E;  4M9V C;  1YYO A;  2L8T A;  2EOE A;  1P47 A;  2HHH E;  1PKP A;  2EMG A;  2VQE E;  2LTR A;  2VE7 C;  4R2E A;  4DUY E;  4JI4 E;  4NXM E;  2UUA E;  3J81 C;  2WBU A;  3OTO E;  4WXD A;  4M0V A;  2GLI A;  2CT1 A;  1ZTD A;  3F6G A;  3HPZ A;  1YUJ A;  2KOU A;  2JXP A;  1EH7 A;  2EMI A;  1N32 E;  2L6M A;  2UU9 E;  2YU8 A;  2NUF A;  1NEI A;  4X62 E;  4AQY E;  2NAB A;  2EZ6 A;  2L3J A;  2YTO A;  2ODR D;  4JI3 E;  4LFC E;  5CFF E; 
#chains in the Genus database with same CATH homology
 2ODR C;  1X48 A;  4LF5 E;  5AAS A;  4DV2 E;  5ADZ A;  3RV0 A;  3RMP A;  2V87 A;  2M4I A;  3K6Q A;  1DI2 A;  2KHX A;  2LMZ A;  1J26 A;  3JU0 A;  4LTY A;  1HR0 E;  2E1M A;  4R03 A;  1RC5 A;  4GKJ E;  2UXB E;  4JI1 E;  3DF6 A;  4YY3 E;  5IT9 C;  2YZT A;  4DMI A;  4JI7 E;  4K0K E;  3J7Y p;  3AUZ A;  3T1Y E;  2UXD E;  3T1H E;  4BBY A;  4J8Z A;  2L2N A;  2LUQ A;  1FJG E;  3JTZ A;  4KHP E;  3AV0 A;  2JVA A;  4OOG C;  3HPS A;  3H09 A;  4DV6 E;  2UXC E;  2RS6 A;  1ZBQ A;  4YHH E;  4TUI A;  3ADI A;  2M7Q A;  1WHQ A;  2CPN A;  3O2R B;  2KON A;  4GEQ B;  4WFT A;  3ADL A;  5AE3 A;  2JWO A;  4M2Z A;  3ADJ A;  4WPY A;  3IWB A;  2ZM6 E;  1ZBT A;  1XMO E;  4JI2 E;  3LML A;  2V8Q B;  2UUB E;  2V83 A;  4Q28 A;  1UHZ A;  4LF4 E;  1STU A;  1EKZ A;  4L5N C;  3VK6 A;  4LF7 E;  1QU6 A;  4JV5 E;  5LMN E;  1DQ3 A;  4DR5 E;  5LMU E;  1XMQ E;  2MC6 A;  4X66 E;  1JFZ A;  2QVW A;  1HNZ E;  5AE2 A;  4LFC E;  2L33 A;  3HQ1 A;  4L8N A;  4LFA E;  2L92 A;  1T4N A;  4B3M E;  4JI5 E;  4DR1 E;  4JI0 E;  4DV1 E;  4LU9 A;  5LL6 R;  4LF8 E;  3IWD A;  2L2M A;  4F9A B;  1X47 A;  2L3C A;  4BCA A;  4WYQ B;  2L2K B;  4DR3 E;  1IBK E;  4GKK E;  3O2R A;  5IWA E;  4LF6 E;  4DV4 E;  3DJW A;  5AE1 A;  2EWL A;  2E5L E;  4I8O A;  2FV4 B;  2V88 A;  4LFB E;  2JR1 A;  2DB2 A;  1N36 E;  4B3R E;  1RQ0 A;  4DR6 E;  2YT4 A;  2JOB A;  2RTX A;  2FFL A;  4DKK A;  4DR2 E;  2LBS B;  2LE2 A;  1T4L B;  1I94 E;  2RSM A;  4DV5 E;  3IWC A;  1UIL A;  1RC7 A;  4KZS A;  2NUE A;  2B7T A;  2DSY A;  3FIG A;  4DV7 E;  4B3S E;  3HTX A;  2F4V E;  2VQF E;  1YYW A;  2MC5 A;  4F54 A;  5FLX C;  3C4T A;  5A2Q C;  4P7D A;  2JY9 A;  2GSL A;  4NXN E;  2IHR 1;  4P78 A;  1YYK A;  2V89 A;  2NUG A;  3F6H A;  5T6J A;  2F8B A;  2JOX A;  5DNY A;  5F3W A;  1GZ6 A;  4F9B B;  4BS9 A;  1XNQ E;  4OUN A;  4F9C B;  2EB1 A;  2DIX A;  2B3T B;  1IBM E;  2MDR A;  3LLH A;  1N33 E;  5BR8 E;  4DR7 E;  4X8W A;  2FTX B;  4X64 E;  2H36 X;  1YYO A;  4LF9 E;  3RV1 A;  2L8T A;  2N3G A;  4JI8 E;  4TUG A;  2DMY A;  2HHH E;  1PKP A;  1I4S A;  2A11 A;  2UUC E;  2K4V A;  2NA2 A;  2LUP B;  3HXL A;  2LTS A;  3VYY A;  2V85 A;  4X65 E;  2VQE E;  3J7A G;  1HNW E;  4JYA E;  2LRS A;  2LTR A;  2B9D A;  2VE7 C;  3KWR A;  4DV0 E;  1J5E E;  4DUY E;  4JI6 E;  4OX9 E;  2V86 A;  4JI4 E;  4NXM E;  2UUA E;  1HNX E;  4R8O A;  1GQE A;  4BC9 A;  3J81 C;  1WXR A;  4DUZ E;  3OTO E;  2FGG A;  4M0V A;  3ZOQ B;  2B7V A;  3MSW A;  3F6G A;  3HPZ A;  1FKA E;  2KOU A;  2RS7 A;  2VF1 A;  4BC7 A;  1N32 E;  2LJH A;  4DR4 E;  1N34 E;  2M1S A;  2L6M A;  3VYX A;  3ADG A;  2UU9 E;  2G7H A;  1IBL E;  2NUF A;  3N3W A;  3P1X A;  2WZO A;  4X62 E;  4AQY E;  3C4B A;  1XNR E;  1X49 A;  4B3T E;  2N3H A;  2L3J A;  2EZ6 A;  1T4O A;  1YZ9 A;  4WSP A;  4BMJ A;  3JAM C;  4M30 A;  3J80 C;  1O0W A;  1U61 A;  2ODR D;  4DV3 E;  3OML A;  1SR9 A;  4JI3 E;  1WHN A;  5CFF E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...