3C4BA

Structure of rnaseiiib and dsrna binding domains of mouse dicer
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
263
structure length
244
Chain Sequence
DAEKTLNHLISGFETFEKKINYRFKNKAYLLQAFTHASYHYNTITDYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVKFQLEKNEEDIEVPKAMGDIFESLAGAIYMDSGMSLEVVWQVYYPMMQPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endoribonuclease Dicer
publication title Structural and biochemical insights into the dicing mechanism of mouse Dicer: A conserved lysine is critical for dsRNA cleavage.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 80
structure length 244
sequence length 263
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2008-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 3c4bA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3c4bA02
4B3RE 2L2KB 4WFTA 4LFCE 2IHR1 2EZ6A 4X64E 4X65E 4JI1E 4LF9E 3T1HE 4DV0E 2MDRA 3HTXA 2RTXA 4M30A 2DMYA 1N36E 1J5EE 3ADLA 2L33A 4JI4E 4DR7E 3OTOE 2UUAE 2ZM6E 4DV2E 4DV3E 1RQ0A 4LF6E 3ADJA 4YY3E 4DV5E 1IBME 1RC5A 2QVWA 1UHZA 2NUGA 3O2RA 1GQEA 4OUNA 1HNWE 1U61A 2UUCE 4KHPE 2L3JA 1QU6A 2RSMA 1IBKE 3N3WA 2F4VE 2LTRA 4X66E 4GKKE 1WHQA 4K0KE 4B3ME 1DI2A 2CPNA 4LFBE 1T4NA 1UILA 2L3CA 2N3GA 2VQEE 2LUQA 2HHHE 1ZBTA 1XMOE 1T4LB 1XNRE 4DUYE 2DIXA 3RV0A 1IBLE 4LF4E 1JFZA 2GSLA 4X8WA 2LUPB 2UXDE 1EKZA 4DR2E 4JI5E 2NUEA 3VYXA 2UXBE 2LBSB 1XNQE 4DR6E 2VQFE 4DR1E 1N34E 1YYWA 4DV1E 2DB2A 4DR5E 4B3SE 1X48A 2NA2A 1PKPA 2A11A 4JYAE 1HNZE 1FKAE 2UU9E 4GKJE 4M2ZA 4X62E 2B7TA 4DKKA 2KHXA 4JV5E 4OX9E 4JI8E 1HR0E 2E5LE 2LJHA 1I4SA 2NUFA 2EB1A 4NXNE 4AQYE 5LMNE 1YYKA 3T1YE 4NXME 1N33E 3J7Yp 2LTSA 4JI2E 1X49A 4DV7E 4DR4E 1X47A 2YT4A 1N32E 1O0WA 3C4BA 3ADGA 1T4OA 4LFAE 3P1XA 2B7VA 1WHNA 4DV6E 4DV4E 3LLHA 4JI7E 4JI6E 3ADIA 4DUZE 1I94E 1STUA 4WYQB 1HNXE 5BR8E 5CFFE 1XMQE 2UUBE 2RS6A 2L2MA 4B3TE 3O2RB 4LF5E 4LF7E 3C4TA 2L2NA 4LF8E 2JVAA 1RC7A 5IWAE 1FJGE 3RV1A 4JI0E 2JY9A 4OOGC 1J26A 1YZ9A 4YHHE 2LRSA 2RS7A 3VYYA 5LMUE 2UXCE 4DR3E 2B3TB 2FFLA 4JI3E 1YYOA 2N3HA
chains in the Genus database with same CATH superfamily
4LFCE 4WFTA 1QNTA 4X65E 2YRMA 3M99B 3T1HE 3EQ1A 2EN1A 2RTXA 2DMYA 2D9HA 3IWDA 3OTOE 4DV2E 4DV3E 4R2QA 2HC5A 1TF6A 2V8QB 4BS9A 3EPKA 2WZOA 2NUGA 2EL6A 2E1MA 5A6JA 2EWLA 2LO3A 3THNA 2EM8A 3DJWA 4KHPE 4RH8A 2R76A 1X5WA 2EPOA 2L3JA 2F4VE 2ENAA 2LTRA 4X66E 1YUJA 3KZYA 4K0KE 2CPNA 2EPCA 4WPYA 2JP9A 3F6HA 1KYQA 2EPZA 5AE3A 2LUQA 3RMPA 2EM5A 1ZBTA 2KOUA 2EM2A 1XNRE 4DUYE 2DIXA 1JFZA 2MC6A 3FIGA 2ELYA 3IWCA 1UBDC 2JOXA 4KZSA 1T39A 2JXPA 4O24A 4P78A 5IT9C 2LBSB 1XNQE 4F9CB 1N34E 2EMBA 2FV4B 4R2SA 2VF1A 1RMDA 1N3GA 2WBSA 5LL6R 4GZNC 2A11A 2EE8A 2NABA 1PJSA 5KL5A 4L5NC 4GKJE 1DQ3A 4M2ZA 2EPAA 4DKKA 4F9BB 2J7JA 5IXMB 2MKNA 4JV5E 1HR0E 2CT1A 2LT7A 4R2EA 2EB1A 2A25A 2EMAA 4ZYEA 3C6KA 4DV7E 2EQ3A 4O43A 1X3CA 3MHSC 2CSHA 2GLIA 3P1XA 2KONA 3VHTB 4MLVA 2EJ4A 3C6MA 4JI6E 4L8NA 4X9JA 1HNXE 4WYQB 2LE2A 1KJKA 2R1FA 5CFFE 1L4SA 1F2IG 3MHHC 1XMQE 4BCAA 2EPRA 2YSOA 2RS6A 2L2MA 2MKDA 2EMGA 2BB8A 2EMIA 4I8OA 1RC7A 2FGGA 2EPLX 2JY9A 4YHHE 3ZOQB 2LMZA 3IWBA 2YTFA 1Z1BA 2N3HA 5LLQA 2B9DA 2IHR1 1X6FA 2EM6A 2YTJA 4TUIA 2ELZA 2EL4A 3HTXA 1N36E 3ADLA 2L33A 4JI4E 2VE7C 5A6AA 3L00A 4IS1C 2ODRC 4LF6E 3ADJA 4YY3E 2EMLA 1IBME 1RC5A 2GPIA 2V85A 2CTDA 2QVWA 1UHZA 2JOBA 2YSPA 2WCC3 4F6MA 3KWRA 3O2RA 4HEIA 1GQEA 2EMCA 2K4VA 1U61A 2UUCE 1PJTA 1SFEA 2M1SA 1IBKE 5KL6A 2EOMA 2YTOA 2EOZA 2EPMX 2EM9A 2EORA 2GHFA 3HPZA 5AE2A 4J8ZA 1T4NA 4F6NA 2VQEE 3UK3C 1XMOE 4DMIA 4WSGA 2N8XA 4BHCA 4R03A 2GSLA 1ZR9A 4X8WA 2LUPB 4WXDA 4R2PA 2EMYA 2UXDE 5F3WA 2DLQA 4JI5E 3MSWA 2YU5A 2NUEA 3VYXA 1TF3A 2UXBE 5A6BD 2VQFE 1YYWA 1A1FA 1LLMC 1A1GA 2NA2A 4F9AB 2L6MA 1WJPA 2YTGA 3HPSA 1ZBQA 5KL7A 1YUIA 2H36X 2KHXA 3HQ1A 4OX9E 2V87A 2LJHA 1I4SA 5T6JA 1YYKA 2YRHA 3BIDA 4RHBB 4R2AA 3QG5C 1EH7A 4DR4E 1N32E 1O0WA 4P7DA 3J7AG 2B7VA 1PDAA 2M4IA 4DV6E 2EOJA 1T38A 3AUZA 4NHRA 4DUZE 4TUGA 4R2RA 2UUBE 3HXLA 4B3TE 2ADRA 4LF5E 4O4KA 2RQLA 2EN8A 2JVAA 5IWAE 4OOGC 2EMXA 2LCEA 2LRSA 2RS7A 4WSPA 1ZU1A 2UXCE 2B3TB 2EOOA 2EL5A 3H09A 2L2KB 2EZ6A 4LU9A 2EPKX 5A69A 2LV2A 4FK5C 2YTEA 2ODRD 5KL3A 2EM3A 5AC5A 4DR7E 2UUAE 2ZM6E 4N4RB 1RQ0A 5KL4A 4DV5E 2EN3A 5IV8B 5AC4A 1ZAAC 1X6HA 2YU8A 2EP3A 2EOYA 2DSYA 4OUNA 2PRTA 1A1LA 3EPLA 1NCSA 2V83A 4B3ME 2EOSA 2V86A 4NZVA 2L3CA 2YPNA 2N3GA 4BMJA 4WX9A 2HHHE 1T4LB 2K7IA 3RV0A 1ZTDA 4MLQA 4LF4E 1UN6B 2HJJA 2YTQA 4GEQB 4ZYDA 2EMZA 1EKZA 2YWQA 1JK1A 2DMIA 3JTZA 4DR6E 4DR1E 4DV1E 2DB2A 5ADZA 4IJDA 4ZYGA 2EOFA 3BBGA 2EOXA 3EPJA 1IQSA 1X6EA 1HNZE 2DLKA 1FKAE 2UU9E 2B7TA 2YTPA 1B69A 1A1IA 2E5LE 2EOHA 2VRDA 5KL2A 2NUFA 3BGHA 3JAMC 4NXNE 2M9AA 4NXME 2EMWA 5LMNE 3T1YE 1N33E 2EN4A 1IQOA 3ADGA 5TSEA 1T4OA 2EM7A 4LFAE 4Q28A 2DGCA 2HGHA 4DV4E 4M9VC 1GZ6A 2MC5A 3ADIA 1MEYC 2I9IA 4LF7E 2L2NA 3AV0A 1G2DC 1FJGE 2LVHA 4JI0E 2EM0A 3THOB 1MGTA 3VYYA 3ECRA 1WXRA 4DR3E 2FFLA 1AAYA 2EOIA 1YFHA 4R2DA 2DRPA 4JI3E 4WXCA 4B3RE 4X64E 4JI1E 4LF9E 2EN7A 1G2FC 2YZTA 3TQMA 4DV0E 1NEIA 2MDRA 2V88A 2L92A 5AASA 4M30A 1J5EE 3J80C 4ZYHA 3K6QA 2EMFA 1YSAC 2I13A 5A2QC 4LTYA 2JYAA 2M7QA 1IMUA 2RPCA 1HNWE 1BB8A 1QU6A 2RSMA 3N3WA 3EPHA 2E72A 2EM4A 2YTIA 3KZZA 1A1KA 1A1HA 4GKKE 2WBTA 1WHQA 2MDGA 1DI2A 4HTGA 4LFBE 5DNYA 1EH6A 1UILA 2EOQA 4M0VA 2ENCA 2WBUA 2BBGA 2EMKA 2EN2A 2EQ0A 2YRKA 2EN6A 1IBLE 4R8OA 4BC9A 1SR9A 3BF2A 5FLXC 4Q35B 3LMLA 2F8BA 2RSIA 2JWOA 1PJQA 4DR2E 2JR1A 2YTDA 4R2CA 4BC7A 2Q8UA 4O5GA 1AH5A 1BBGA 1EH8A 4DR5E 4BHBA 4B3SE 1X48A 2EPPA 1PKPA 2V89A 4JYAE 3OMLA 2EOEA 1BBOA 4X62E 2LJUA 5A6KA 5AE1A 4JI8E 2L8TA 4F2JC 5A6BA 2G7HA 1TN9A 4AQYE 3J7Yp 2LTSA 3F6GA 2EPUA 4JI2E 1X49A 1X47A 2EPXA 2YT4A 1JK2A 3C4BA 2EMHA 4F54A 1WHNA 4BBYA 3LLHA 4JI7E 3DF6A 1I94E 1STUA 3J81C 1DGCA 5BR8E 1WRJA 1P47A 1A1JA 2EQ1A 2ENHA 4KWYA 2EPNA 3O2RB 3VK6A 2FTXB 3C4TA 4LF8E 3RV1A 1J26A 3JU0A 1YZ9A 2YTNA 1GTKA 1YPNA 5LMUE 2JPAA 1YYOA
chains in the Genus database with same CATH topology
3H09A 4B3RE 2B9DA 2L2KB 4WFTA 4LFCE 2IHR1 2EZ6A 4X64E 4X65E 4JI1E 4LF9E 4LU9A 2YZTA 3T1HE 4DV0E 2MDRA 2V88A 4TUIA 2ODRD 2L92A 5AASA 3HTXA 2RTXA 4M30A 2DMYA 1N36E 1J5EE 3J80C 3ADLA 2L33A 4JI4E 4DR7E 3IWDA 2VE7C 3K6QA 3OTOE 2UUAE 2ZM6E 4DV2E 4DV3E 1RQ0A 2ODRC 4LF6E 3ADJA 4YY3E 4DV5E 1IBME 1RC5A 5A2QC 2V8QB 2V85A 4BS9A 4LTYA 2QVWA 1UHZA 2JOBA 2WZOA 2NUGA 3KWRA 3O2RA 2M7QA 2E1MA 1GQEA 2EWLA 2K4VA 2DSYA 4OUNA 1HNWE 1U61A 2UUCE 3DJWA 4KHPE 2L3JA 2M1SA 1QU6A 2RSMA 1IBKE 3N3WA 2F4VE 2LTRA 4X66E 4GKKE 1WHQA 4K0KE 4B3ME 2V83A 2CPNA 4WPYA 1DI2A 3HPZA 4LFBE 5AE2A 3F6HA 4J8ZA 1T4NA 1UILA 2V86A 5DNYA 2L3CA 2N3GA 4M0VA 4BMJA 2VQEE 5AE3A 2LUQA 3RMPA 2HHHE 1ZBTA 2KOUA 1XMOE 1T4LB 1XNRE 4DUYE 4DMIA 2DIXA 3RV0A 1IBLE 4LF4E 4R8OA 1JFZA 1SR9A 2MC6A 2GSLA 4R03A 3FIGA 4X8WA 3IWCA 4BC9A 2LUPB 2JOXA 4GEQB 4KZSA 5FLXC 5F3WA 2F8BA 3LMLA 4DR2E 2JWOA 3MSWA 4P78A 2NUEA 5IT9C 4JI5E 2JR1A 2LBSB 4BC7A 3VYXA 1XNQE 3JTZA 4DR6E 4F9CB 2VQFE 4DR1E 1HNXE 1N34E 1YYWA 2FV4B 2UXDE 4DV1E 2DB2A 5ADZA 4DR5E 4B3SE 2VF1A 1X48A 2NA2A 1PKPA 4F9AB 5LL6R 2L6MA 2A11A 2V89A 4JYAE 3OMLA 1HNZE 1FKAE 4L5NC 3HPSA 1DQ3A 4M2ZA 1ZBQA 2UU9E 4GKJE 4X62E 2B7TA 2UXBE 4DKKA 4F9BB 5AE1A 2H36X 2KHXA 3HQ1A 4JV5E 4OX9E 4JI8E 2L8TA 1HR0E 2V87A 2E5LE 2LJHA 1I4SA 2NUFA 2EB1A 2G7HA 5T6JA 3JAMC 4NXNE 1EKZA 4AQYE 5LMNE 1YYKA 3T1YE 4NXME 1N33E 3J7Yp 2LTSA 3F6GA 4JI6E 4JI2E 1X49A 4DV7E 4DR4E 1X47A 2YT4A 1N32E 1O0WA 3C4BA 3ADGA 4P7DA 1T4OA 4F54A 4LFAE 3P1XA 3J7AG 2B7VA 2KONA 4Q28A 1WHNA 2M4IA 4BBYA 4DV6E 4DV4E 3LLHA 1GZ6A 2MC5A 3AUZA 3DF6A 4L8NA 1STUA 4WYQB 2LE2A 4JI7E 5BR8E 3J81C 4DUZE 5CFFE 4TUGA 1I94E 1XMQE 2UUBE 4BCAA 2RS6A 2L2MA 3HXLA 4B3TE 3O2RB 4LF5E 3VK6A 2FTXB 4LF7E 3C4TA 2L2NA 3AV0A 4I8OA 4LF8E 2JVAA 1RC7A 5IWAE 1FJGE 3RV1A 2FGGA 2JY9A 4OOGC 3JU0A 1YZ9A 4YHHE 4JI0E 3ADIA 1J26A 3ZOQB 2LRSA 2RS7A 3VYYA 4WSPA 5LMUE 1WXRA 2UXCE 4DR3E 2B3TB 2FFLA 2LMZA 4JI3E 3IWBA 1YYOA 2N3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R E;  2L2K B;  4WFT A;  4LFC E;  2IHR 1;  2EZ6 A;  4X64 E;  4X65 E;  4JI1 E;  4LF9 E;  3T1H E;  4DV0 E;  2MDR A;  3HTX A;  2RTX A;  4M30 A;  2DMY A;  1N36 E;  1J5E E;  3ADL A;  2L33 A;  4JI4 E;  4DR7 E;  3OTO E;  2UUA E;  2ZM6 E;  4DV2 E;  4DV3 E;  1RQ0 A;  4LF6 E;  3ADJ A;  4YY3 E;  4DV5 E;  1IBM E;  1RC5 A;  2QVW A;  1UHZ A;  2NUG A;  3O2R A;  1GQE A;  4OUN A;  1HNW E;  1U61 A;  2UUC E;  4KHP E;  2L3J A;  1QU6 A;  2RSM A;  1IBK E;  3N3W A;  2F4V E;  2LTR A;  4X66 E;  4GKK E;  1WHQ A;  4K0K E;  4B3M E;  1DI2 A;  2CPN A;  4LFB E;  1T4N A;  1UIL A;  2L3C A;  2N3G A;  2VQE E;  2LUQ A;  2HHH E;  1ZBT A;  1XMO E;  1T4L B;  1XNR E;  4DUY E;  2DIX A;  3RV0 A;  1IBL E;  4LF4 E;  1JFZ A;  2GSL A;  4X8W A;  2LUP B;  2UXD E;  1EKZ A;  4DR2 E;  4JI5 E;  2NUE A;  3VYX A;  2UXB E;  2LBS B;  1XNQ E;  4DR6 E;  2VQF E;  4DR1 E;  1N34 E;  1YYW A;  4DV1 E;  2DB2 A;  4DR5 E;  4B3S E;  1X48 A;  2NA2 A;  1PKP A;  2A11 A;  4JYA E;  1HNZ E;  1FKA E;  2UU9 E;  4GKJ E;  4M2Z A;  4X62 E;  2B7T A;  4DKK A;  2KHX A;  4JV5 E;  4OX9 E;  4JI8 E;  1HR0 E;  2E5L E;  2LJH A;  1I4S A;  2NUF A;  2EB1 A;  4NXN E;  4AQY E;  5LMN E;  1YYK A;  3T1Y E;  4NXM E;  1N33 E;  3J7Y p;  2LTS A;  4JI2 E;  1X49 A;  4DV7 E;  4DR4 E;  1X47 A;  2YT4 A;  1N32 E;  1O0W A;  3C4B A;  3ADG A;  1T4O A;  4LFA E;  3P1X A;  2B7V A;  1WHN A;  4DV6 E;  4DV4 E;  3LLH A;  4JI7 E;  4JI6 E;  3ADI A;  4DUZ E;  1I94 E;  1STU A;  4WYQ B;  1HNX E;  5BR8 E;  5CFF E;  1XMQ E;  2UUB E;  2RS6 A;  2L2M A;  4B3T E;  3O2R B;  4LF5 E;  4LF7 E;  3C4T A;  2L2N A;  4LF8 E;  2JVA A;  1RC7 A;  5IWA E;  1FJG E;  3RV1 A;  4JI0 E;  2JY9 A;  4OOG C;  1J26 A;  1YZ9 A;  4YHH E;  2LRS A;  2RS7 A;  3VYY A;  5LMU E;  2UXC E;  4DR3 E;  2B3T B;  2FFL A;  4JI3 E;  1YYO A;  2N3H A; 
#chains in the Genus database with same CATH topology
 4LFC E;  4WFT A;  1QNT A;  4X65 E;  2YRM A;  3M99 B;  3T1H E;  3EQ1 A;  2EN1 A;  2RTX A;  2DMY A;  2D9H A;  3IWD A;  3OTO E;  4DV2 E;  4DV3 E;  4R2Q A;  2HC5 A;  1TF6 A;  2V8Q B;  4BS9 A;  3EPK A;  2WZO A;  2NUG A;  2EL6 A;  2E1M A;  5A6J A;  2EWL A;  2LO3 A;  3THN A;  2EM8 A;  3DJW A;  4KHP E;  4RH8 A;  2R76 A;  1X5W A;  2EPO A;  2L3J A;  2F4V E;  2ENA A;  2LTR A;  4X66 E;  1YUJ A;  3KZY A;  4K0K E;  2CPN A;  2EPC A;  4WPY A;  2JP9 A;  3F6H A;  1KYQ A;  2EPZ A;  5AE3 A;  2LUQ A;  3RMP A;  2EM5 A;  1ZBT A;  2KOU A;  2EM2 A;  1XNR E;  4DUY E;  2DIX A;  1JFZ A;  2MC6 A;  3FIG A;  2ELY A;  3IWC A;  1UBD C;  2JOX A;  4KZS A;  1T39 A;  2JXP A;  4O24 A;  4P78 A;  5IT9 C;  2LBS B;  1XNQ E;  4F9C B;  1N34 E;  2EMB A;  2FV4 B;  4R2S A;  2VF1 A;  1RMD A;  1N3G A;  2WBS A;  5LL6 R;  4GZN C;  2A11 A;  2EE8 A;  2NAB A;  1PJS A;  5KL5 A;  4L5N C;  4GKJ E;  1DQ3 A;  4M2Z A;  2EPA A;  4DKK A;  4F9B B;  2J7J A;  5IXM B;  2MKN A;  4JV5 E;  1HR0 E;  2CT1 A;  2LT7 A;  4R2E A;  2EB1 A;  2A25 A;  2EMA A;  4ZYE A;  3C6K A;  4DV7 E;  2EQ3 A;  4O43 A;  1X3C A;  3MHS C;  2CSH A;  2GLI A;  3P1X A;  2KON A;  3VHT B;  4MLV A;  2EJ4 A;  3C6M A;  4JI6 E;  4L8N A;  4X9J A;  1HNX E;  4WYQ B;  2LE2 A;  1KJK A;  2R1F A;  5CFF E;  1L4S A;  1F2I G;  3MHH C;  1XMQ E;  4BCA A;  2EPR A;  2YSO A;  2RS6 A;  2L2M A;  2MKD A;  2EMG A;  2BB8 A;  2EMI A;  4I8O A;  1RC7 A;  2FGG A;  2EPL X;  2JY9 A;  4YHH E;  3ZOQ B;  2LMZ A;  3IWB A;  2YTF A;  1Z1B A;  2N3H A;  5LLQ A;  2B9D A;  2IHR 1;  1X6F A;  2EM6 A;  2YTJ A;  4TUI A;  2ELZ A;  2EL4 A;  3HTX A;  1N36 E;  3ADL A;  2L33 A;  4JI4 E;  2VE7 C;  5A6A A;  3L00 A;  4IS1 C;  2ODR C;  4LF6 E;  3ADJ A;  4YY3 E;  2EML A;  1IBM E;  1RC5 A;  2GPI A;  2V85 A;  2CTD A;  2QVW A;  1UHZ A;  2JOB A;  2YSP A;  2WCC 3;  4F6M A;  3KWR A;  3O2R A;  4HEI A;  1GQE A;  2EMC A;  2K4V A;  1U61 A;  2UUC E;  1PJT A;  1SFE A;  2M1S A;  1IBK E;  5KL6 A;  2EOM A;  2YTO A;  2EOZ A;  2EPM X;  2EM9 A;  2EOR A;  2GHF A;  3HPZ A;  5AE2 A;  4J8Z A;  1T4N A;  4F6N A;  2VQE E;  3UK3 C;  1XMO E;  4DMI A;  4WSG A;  2N8X A;  4BHC A;  4R03 A;  2GSL A;  1ZR9 A;  4X8W A;  2LUP B;  4WXD A;  4R2P A;  2EMY A;  2UXD E;  5F3W A;  2DLQ A;  4JI5 E;  3MSW A;  2YU5 A;  2NUE A;  3VYX A;  1TF3 A;  2UXB E;  5A6B D;  2VQF E;  1YYW A;  1A1F A;  1LLM C;  1A1G A;  2NA2 A;  4F9A B;  2L6M A;  1WJP A;  2YTG A;  3HPS A;  1ZBQ A;  5KL7 A;  1YUI A;  2H36 X;  2KHX A;  3HQ1 A;  4OX9 E;  2V87 A;  2LJH A;  1I4S A;  5T6J A;  1YYK A;  2YRH A;  3BID A;  4RHB B;  4R2A A;  3QG5 C;  1EH7 A;  4DR4 E;  1N32 E;  1O0W A;  4P7D A;  3J7A G;  2B7V A;  1PDA A;  2M4I A;  4DV6 E;  2EOJ A;  1T38 A;  3AUZ A;  4NHR A;  4DUZ E;  4TUG A;  4R2R A;  2UUB E;  3HXL A;  4B3T E;  2ADR A;  4LF5 E;  4O4K A;  2RQL A;  2EN8 A;  2JVA A;  5IWA E;  4OOG C;  2EMX A;  2LCE A;  2LRS A;  2RS7 A;  4WSP A;  1ZU1 A;  2UXC E;  2B3T B;  2EOO A;  2EL5 A;  3H09 A;  2L2K B;  2EZ6 A;  4LU9 A;  2EPK X;  5A69 A;  2LV2 A;  4FK5 C;  2YTE A;  2ODR D;  5KL3 A;  2EM3 A;  5AC5 A;  4DR7 E;  2UUA E;  2ZM6 E;  4N4R B;  1RQ0 A;  5KL4 A;  4DV5 E;  2EN3 A;  5IV8 B;  5AC4 A;  1ZAA C;  1X6H A;  2YU8 A;  2EP3 A;  2EOY A;  2DSY A;  4OUN A;  2PRT A;  1A1L A;  3EPL A;  1NCS A;  2V83 A;  4B3M E;  2EOS A;  2V86 A;  4NZV A;  2L3C A;  2YPN A;  2N3G A;  4BMJ A;  4WX9 A;  2HHH E;  1T4L B;  2K7I A;  3RV0 A;  1ZTD A;  4MLQ A;  4LF4 E;  1UN6 B;  2HJJ A;  2YTQ A;  4GEQ B;  4ZYD A;  2EMZ A;  1EKZ A;  2YWQ A;  1JK1 A;  2DMI A;  3JTZ A;  4DR6 E;  4DR1 E;  4DV1 E;  2DB2 A;  5ADZ A;  4IJD A;  4ZYG A;  2EOF A;  3BBG A;  2EOX A;  3EPJ A;  1IQS A;  1X6E A;  1HNZ E;  2DLK A;  1FKA E;  2UU9 E;  2B7T A;  2YTP A;  1B69 A;  1A1I A;  2E5L E;  2EOH A;  2VRD A;  5KL2 A;  2NUF A;  3BGH A;  3JAM C;  4NXN E;  2M9A A;  4NXM E;  2EMW A;  5LMN E;  3T1Y E;  1N33 E;  2EN4 A;  1IQO A;  3ADG A;  5TSE A;  1T4O A;  2EM7 A;  4LFA E;  4Q28 A;  2DGC A;  2HGH A;  4DV4 E;  4M9V C;  1GZ6 A;  2MC5 A;  3ADI A;  1MEY C;  2I9I A;  4LF7 E;  2L2N A;  3AV0 A;  1G2D C;  1FJG E;  2LVH A;  4JI0 E;  2EM0 A;  3THO B;  1MGT A;  3VYY A;  3ECR A;  1WXR A;  4DR3 E;  2FFL A;  1AAY A;  2EOI A;  1YFH A;  4R2D A;  2DRP A;  4JI3 E;  4WXC A;  4B3R E;  4X64 E;  4JI1 E;  4LF9 E;  2EN7 A;  1G2F C;  2YZT A;  3TQM A;  4DV0 E;  1NEI A;  2MDR A;  2V88 A;  2L92 A;  5AAS A;  4M30 A;  1J5E E;  3J80 C;  4ZYH A;  3K6Q A;  2EMF A;  1YSA C;  2I13 A;  5A2Q C;  4LTY A;  2JYA A;  2M7Q A;  1IMU A;  2RPC A;  1HNW E;  1BB8 A;  1QU6 A;  2RSM A;  3N3W A;  3EPH A;  2E72 A;  2EM4 A;  2YTI A;  3KZZ A;  1A1K A;  1A1H A;  4GKK E;  2WBT A;  1WHQ A;  2MDG A;  1DI2 A;  4HTG A;  4LFB E;  5DNY A;  1EH6 A;  1UIL A;  2EOQ A;  4M0V A;  2ENC A;  2WBU A;  2BBG A;  2EMK A;  2EN2 A;  2EQ0 A;  2YRK A;  2EN6 A;  1IBL E;  4R8O A;  4BC9 A;  1SR9 A;  3BF2 A;  5FLX C;  4Q35 B;  3LML A;  2F8B A;  2RSI A;  2JWO A;  1PJQ A;  4DR2 E;  2JR1 A;  2YTD A;  4R2C A;  4BC7 A;  2Q8U A;  4O5G A;  1AH5 A;  1BBG A;  1EH8 A;  4DR5 E;  4BHB A;  4B3S E;  1X48 A;  2EPP A;  1PKP A;  2V89 A;  4JYA E;  3OML A;  2EOE A;  1BBO A;  4X62 E;  2LJU A;  5A6K A;  5AE1 A;  4JI8 E;  2L8T A;  4F2J C;  5A6B A;  2G7H A;  1TN9 A;  4AQY E;  3J7Y p;  2LTS A;  3F6G A;  2EPU A;  4JI2 E;  1X49 A;  1X47 A;  2EPX A;  2YT4 A;  1JK2 A;  3C4B A;  2EMH A;  4F54 A;  1WHN A;  4BBY A;  3LLH A;  4JI7 E;  3DF6 A;  1I94 E;  1STU A;  3J81 C;  1DGC A;  5BR8 E;  1WRJ A;  1P47 A;  1A1J A;  2EQ1 A;  2ENH A;  4KWY A;  2EPN A;  3O2R B;  3VK6 A;  2FTX B;  3C4T A;  4LF8 E;  3RV1 A;  1J26 A;  3JU0 A;  1YZ9 A;  2YTN A;  1GTK A;  1YPN A;  5LMU E;  2JPA A;  1YYO A; 
#chains in the Genus database with same CATH homology
 3H09 A;  4B3R E;  2B9D A;  2L2K B;  4WFT A;  4LFC E;  2IHR 1;  2EZ6 A;  4X64 E;  4X65 E;  4JI1 E;  4LF9 E;  4LU9 A;  2YZT A;  3T1H E;  4DV0 E;  2MDR A;  2V88 A;  4TUI A;  2ODR D;  2L92 A;  5AAS A;  3HTX A;  2RTX A;  4M30 A;  2DMY A;  1N36 E;  1J5E E;  3J80 C;  3ADL A;  2L33 A;  4JI4 E;  4DR7 E;  3IWD A;  2VE7 C;  3K6Q A;  3OTO E;  2UUA E;  2ZM6 E;  4DV2 E;  4DV3 E;  1RQ0 A;  2ODR C;  4LF6 E;  3ADJ A;  4YY3 E;  4DV5 E;  1IBM E;  1RC5 A;  5A2Q C;  2V8Q B;  2V85 A;  4BS9 A;  4LTY A;  2QVW A;  1UHZ A;  2JOB A;  2WZO A;  2NUG A;  3KWR A;  3O2R A;  2M7Q A;  2E1M A;  1GQE A;  2EWL A;  2K4V A;  2DSY A;  4OUN A;  1HNW E;  1U61 A;  2UUC E;  3DJW A;  4KHP E;  2L3J A;  2M1S A;  1QU6 A;  2RSM A;  1IBK E;  3N3W A;  2F4V E;  2LTR A;  4X66 E;  4GKK E;  1WHQ A;  4K0K E;  4B3M E;  2V83 A;  2CPN A;  4WPY A;  1DI2 A;  3HPZ A;  4LFB E;  5AE2 A;  3F6H A;  4J8Z A;  1T4N A;  1UIL A;  2V86 A;  5DNY A;  2L3C A;  2N3G A;  4M0V A;  4BMJ A;  2VQE E;  5AE3 A;  2LUQ A;  3RMP A;  2HHH E;  1ZBT A;  2KOU A;  1XMO E;  1T4L B;  1XNR E;  4DUY E;  4DMI A;  2DIX A;  3RV0 A;  1IBL E;  4LF4 E;  4R8O A;  1JFZ A;  1SR9 A;  2MC6 A;  2GSL A;  4R03 A;  3FIG A;  4X8W A;  3IWC A;  4BC9 A;  2LUP B;  2JOX A;  4GEQ B;  4KZS A;  5FLX C;  5F3W A;  2F8B A;  3LML A;  4DR2 E;  2JWO A;  3MSW A;  4P78 A;  2NUE A;  5IT9 C;  4JI5 E;  2JR1 A;  2LBS B;  4BC7 A;  3VYX A;  1XNQ E;  3JTZ A;  4DR6 E;  4F9C B;  2VQF E;  4DR1 E;  1HNX E;  1N34 E;  1YYW A;  2FV4 B;  2UXD E;  4DV1 E;  2DB2 A;  5ADZ A;  4DR5 E;  4B3S E;  2VF1 A;  1X48 A;  2NA2 A;  1PKP A;  4F9A B;  5LL6 R;  2L6M A;  2A11 A;  2V89 A;  4JYA E;  3OML A;  1HNZ E;  1FKA E;  4L5N C;  3HPS A;  1DQ3 A;  4M2Z A;  1ZBQ A;  2UU9 E;  4GKJ E;  4X62 E;  2B7T A;  2UXB E;  4DKK A;  4F9B B;  5AE1 A;  2H36 X;  2KHX A;  3HQ1 A;  4JV5 E;  4OX9 E;  4JI8 E;  2L8T A;  1HR0 E;  2V87 A;  2E5L E;  2LJH A;  1I4S A;  2NUF A;  2EB1 A;  2G7H A;  5T6J A;  3JAM C;  4NXN E;  1EKZ A;  4AQY E;  5LMN E;  1YYK A;  3T1Y E;  4NXM E;  1N33 E;  3J7Y p;  2LTS A;  3F6G A;  4JI6 E;  4JI2 E;  1X49 A;  4DV7 E;  4DR4 E;  1X47 A;  2YT4 A;  1N32 E;  1O0W A;  3C4B A;  3ADG A;  4P7D A;  1T4O A;  4F54 A;  4LFA E;  3P1X A;  3J7A G;  2B7V A;  2KON A;  4Q28 A;  1WHN A;  2M4I A;  4BBY A;  4DV6 E;  4DV4 E;  3LLH A;  1GZ6 A;  2MC5 A;  3AUZ A;  3DF6 A;  4L8N A;  1STU A;  4WYQ B;  2LE2 A;  4JI7 E;  5BR8 E;  3J81 C;  4DUZ E;  5CFF E;  4TUG A;  1I94 E;  1XMQ E;  2UUB E;  4BCA A;  2RS6 A;  2L2M A;  3HXL A;  4B3T E;  3O2R B;  4LF5 E;  3VK6 A;  2FTX B;  4LF7 E;  3C4T A;  2L2N A;  3AV0 A;  4I8O A;  4LF8 E;  2JVA A;  1RC7 A;  5IWA E;  1FJG E;  3RV1 A;  2FGG A;  2JY9 A;  4OOG C;  3JU0 A;  1YZ9 A;  4YHH E;  4JI0 E;  3ADI A;  1J26 A;  3ZOQ B;  2LRS A;  2RS7 A;  3VYY A;  4WSP A;  5LMU E;  1WXR A;  2UXC E;  4DR3 E;  2B3T B;  2FFL A;  2LMZ A;  4JI3 E;  3IWB A;  1YYO A;  2N3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...