3C4BA

Structure of rnaseiiib and dsrna binding domains of mouse dicer
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
263
structure length
244
Chain Sequence
DAEKTLNHLISGFETFEKKINYRFKNKAYLLQAFTHASYHYNTITDYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVKFQLEKNEEDIEVPKAMGDIFESLAGAIYMDSGMSLEVVWQVYYPMMQPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Endoribonuclease Dicer
publication title Structural and biochemical insights into the dicing mechanism of mouse Dicer: A conserved lysine is critical for dsRNA cleavage.
pubmed doi rcsb
source organism Mus musculus
total genus 80
structure length 244
sequence length 263
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2008-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 3c4bA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3c4bA02
1YYWA 4DV6E 4LF7E 2LRSA 2ZM6E 3T1HE 4LF9E 2L3CA 4OX9E 2E5LE 4DV7E 1T4LB 4B3ME 4WFTA 3RV0A 4DR1E 4M30A 2CPNA 2N3GA 2L2MA 2RS6A 3C4TA 1HNXE 4DV1E 1X47A 4DR3E 1XNRE 4K0KE 1U61A 4M2ZA 2DMYA 4B3RE 4JI2E 4JI1E 2B3TB 3VYYA 1X49A 2UU9E 2GSLA 5LMNE 2LUPB 2JY9A 1STUA 3VYXA 4B3TE 4YY3E 2RTXA 1WHQA 4X8WA 2L33A 4DV2E 4X65E 4DKKA 2UUAE 1RC7A 2B7TA 3ADLA 2LTSA 4YHHE 1I4SA 4JI3E 4NXNE 2RS7A 4DR4E 2IHR1 5IWAE 4OUNA 2EZ6A 5LMUE 4KHPE 4LF4E 3N3WA 2NA2A 1EKZA 4LF5E 3O2RA 4LFCE 2L2NA 2MDRA 5CFFE 2LUQA 4JI6E 1X48A 1N33E 4NXME 1UILA 2L2KB 4LF8E 2UXCE 1FJGE 4DR5E 4JI5E 1N34E 4WYQB 2L3JA 4LF6E 3OTOE 4LFAE 4B3SE 1GQEA 4JI0E 2NUEA 1UHZA 2LJHA 3LLHA 4X66E 1O0WA 4JI7E 1HNZE 2UUCE 1XNQE 4LFBE 3C4BA 2UUBE 4JI8E 1DI2A 2EB1A 2KHXA 4JV5E 4X64E 2RSMA 4DR2E 4DV4E 1J26A 2VQFE 2FFLA 3RV1A 3ADIA 1XMQE 2N3HA 1I94E 4DUYE 3O2RB 4DUZE 2LBSB 1PKPA 2B7VA 4DV0E 4X62E 3ADJA 4JI4E 4DR6E 2VQEE 3J7Yp 4JYAE 3HTXA 2LTRA 3T1YE 2HHHE 2A11A 1QU6A 1HNWE 4DR7E 2NUGA 2DIXA 3ADGA 1J5EE 2DB2A 2QVWA 1YYOA 1IBME 1RC5A 2YT4A 1HR0E 1T4OA 3P1XA 4AQYE 4OOGC 1N36E 1YZ9A 2F4VE 1RQ0A 1IBLE 2UXDE 2JVAA 4DV5E 1N32E 1FKAE 4GKJE 1YYKA 1ZBTA 1IBKE 4GKKE 5BR8E 2NUFA 4DV3E 1XMOE 2UXBE 1T4NA 1WHNA 1JFZA
chains in the Genus database with same CATH superfamily
4O24A 5A6AA 4DV6E 2LRSA 2L3CA 2JP9A 4OX9E 1PJTA 4Q35B 2JOBA 4B3ME 2CT1A 3RV0A 4DR1E 4R2AA 5KL6A 2N3GA 1EH6A 1HNXE 1UN6B 1TN9A 3VHTB 2Q8UA 1A1LA 5ADZA 4WSPA 1YUIA 5AE3A 3AV0A 1WXRA 2DMYA 4LU9A 4B3RE 2HGHA 3BBGA 3H09A 2FV4B 3VYYA 4WPYA 2GSLA 4BHCA 2EM0A 2EOSA 4TUIA 4B3TE 2HC5A 2L33A 4X65E 3KWRA 5AE1A 5KL4A 4LTYA 2YPNA 3F6HA 2EM3A 1RC7A 2JWOA 1YFHA 2EMYA 4BC7A 2E1MA 4JI3E 4NXNE 2RS7A 4DR4E 2IHR1 2EZ6A 2YTJA 5LMUE 2EL4A 1BB8A 3QG5C 2EQ0A 4L5NC 1N33E 4BHBA 4LF8E 2EN3A 1SR9A 1GTKA 2GPIA 3C6MA 2EWLA 1N34E 1T39A 1UBDC 1KJKA 4LF6E 2YU5A 2ELYA 2EM2A 3THOB 2LV2A 1RMDA 4LFBE 2EMCA 2UUBE 4O43A 2EB1A 2KHXA 2YTDA 1EH7A 1X6EA 4DUYE 2BBGA 3ADJA 2LTRA 2YWQA 2HHHE 5IT9C 1L4SA 2EMIA 4DR7E 5A6JA 2NUGA 2EMWA 1J5EE 2H36X 4M0VA 1YYOA 1X3CA 1IBME 4FK5C 1HR0E 5KL7A 5KL5A 3P1XA 3UK3C 3KZYA 1PDAA 1YSAC 3HPSA 2YTIA 4ZYEA 1TF6A 2J7JA 2ENHA 2JVAA 1YUJA 2KOUA 1IMUA 2WBSA 2EQ3A 1YYKA 3DJWA 2EPNA 1AH5A 2YTGA 3K6QA 4R2DA 4IS1C 2NUFA 4DV3E 2EOQA 3BF2A 1T4NA 1SFEA 4O4KA 2DRPA 3DF6A 1F2IG 1BBOA 2DSYA 5KL3A 4WX9A 4I8OA 2ZM6E 4LF9E 4J8ZA 2E5LE 4Q28A 2EM6A 2CPNA 3THNA 2L2MA 4R2PA 3KZZA 4IJDA 2DGCA 4R03A 4DV1E 2MC5A 2M4IA 4L8NA 4JI1E 2FGGA 1A1HA 1GZ6A 2LVHA 1A1JA 2UU9E 3EQ1A 2BB8A 2EN8A 3JAMC 2L92A 2EOEA 2DLKA 3JU0A 5A6KA 2LTSA 4R8OA 2V88A 4OUNA 1X6HA 2YTEA 2EPUA 4KHPE 1NCSA 3N3WA 2NABA 2YSPA 3F6GA 2EPOA 4LF4E 1BBGA 1B69A 2MDRA 4JI6E 2LUQA 2V89A 4NXME 1UILA 2RPCA 2YTFA 5AE2A 3J80C 5A69A 2E72A 5F3WA 2LE2A 1X5WA 2L3JA 3C6KA 1GQEA 2EMFA 3IWBA 1PJSA 1A1GA 3EPHA 4R2QA 2EPCA 2UUCE 1XNQE 3OMLA 1DI2A 4JI8E 4JV5E 2DLQA 4X64E 4HEIA 2EMHA 4DV4E 3RV1A 2V85A 1KYQA 2LCEA 2N3HA 2EPMX 5AC5A 1I94E 3VK6A 4MLQA 2EOJA 4JYAE 3IWDA 2RQLA 3T1YE 2ODRD 2A11A 2V87A 4R2RA 2DB2A 1WRJA 2QVWA 3J81C 2MKNA 2YT4A 2YTNA 1T4OA 1TF3A 4N4RB 1DQ3A 1YZ9A 1N3GA 3JTZA 1ZTDA 2EOIA 2EOOA 4DV5E 1N32E 2GLIA 2JR1A 4GKJE 4RHBB 1ZBTA 2EPLX 1IBKE 2CTDA 1XMOE 3RMPA 2UXBE 1P47A 1X6FA 2N8XA 2EMLA 5T6JA 2M1SA 4BC9A 4LF7E 2YTQA 5KL2A 3ZOQB 2CSHA 4DV7E 2ODRC 1T4LB 1QNTA 2MC6A 2EL5A 2EOXA 4DR3E 4NHRA 4HTGA 4O5GA 4F6NA 1U61A 4F54A 2ADRA 1T38A 2EOFA 4GEQB 5LMNE 2JY9A 1STUA 2ENCA 3VYXA 1IQOA 4X8WA 2PRTA 4DV2E 3MHHC 2DMIA 2L6MA 4DKKA 3HXLA 2EOHA 5A6BD 3IWCA 2KONA 2B7TA 4YHHE 1I4SA 4ZYHA 2GHFA 4BMJA 2EMAA 2EMGA 3LMLA 2JXPA 2NA2A 4WSGA 1EKZA 4LF5E 2EOYA 4TUGA 5LLQA 3O2RA 2V86A 1X48A 2EN7A 2L2KB 2EPAA 2JPAA 4DR5E 4JI5E 2YRHA 2F8BA 1MGTA 2EPKX 3L00A 1EH8A 1UHZA 4WXDA 3MHSC 5FLXC 2WCC3 4X66E 1O0WA 4P7DA 1HNZE 2EMBA 4X9JA 3C4BA 1Z1BA 2YRMA 2EPZA 5IV8B 2RSMA 2WBTA 4DR2E 3M99B 2HJJA 2FFLA 2VQFE 4DUZE 2B7VA 4KZSA 4DR6E 2VQEE 3J7Yp 5A6BA 2EPXA 1A1IA 2YSOA 3ADGA 2YU8A 2EM9A 1ZR9A 1RC5A 2VE7C 5AC4A 2EPRA 2EL6A 5DNYA 4ZYDA 2EORA 2FTXB 2EM8A 1LLMC 2F4VE 1YPNA 2MKDA 1IBLE 2EM7A 2MDGA 2EMXA 2EM5A 1FKAE 2EPPA 1IQSA 5LL6R 2V83A 4BBYA 4GKKE 4M9VC 4F6MA 4F9CB 1JFZA 1YYWA 2A25A 1WJPA 2L8TA 2EQ1A 3T1HE 1ZU1A 2M9AA 2RSIA 1ZAAC 2M7QA 4WFTA 4WXCA 4R2CA 2B9DA 4M30A 4KWYA 3AUZA 2RS6A 3C4TA 2EE8A 1X47A 2I9IA 1XNRE 4K0KE 4M2ZA 2R76A 4JI2E 4GZNC 3EPJA 2B3TB 1X49A 2VRDA 2LUPB 4MLVA 4YY3E 2RTXA 2LJUA 1WHQA 2LO3A 5IXMB 5TSEA 3FIGA 2UUAE 1G2DC 5AASA 3EPLA 3ADLA 1ZBQA 2JYAA 2EMZA 5IWAE 3TQMA 4RH8A 1G2FC 3BGHA 1JK2A 4F2JC 4F9AB 4LFCE 2L2NA 4P78A 5CFFE 2YTPA 4F9BB 3J7AG 2YZTA 2G7HA 4NZVA 2UXCE 1MEYC 1FJGE 4WYQB 3BIDA 3OTOE 4LFAE 4B3SE 2R1FA 4JI0E 3HPZA 2NUEA 2K7IA 2LJHA 4R2EA 3LLHA 4JI7E 2LT7A 2EM4A 1J26A 3ADIA 1XMQE 2EOZA 1AAYA 2EN1A 1NEIA 3O2RB 2LBSB 2EN6A 1PKPA 2VF1A 2WBUA 4X62E 4DV0E 3MSWA 4JI4E 4BS9A 3HTXA 4BCAA 1QU6A 2D9HA 2EN2A 2WZOA 1PJQA 3HQ1A 3EPKA 1HNWE 2DIXA 5A2QC 2JOXA 2EMKA 2ENAA 4ZYGA 2EOMA 2EJ4A 2I13A 2LMZA 4AQYE 4OOGC 2YRKA 1N36E 2ELZA 1RQ0A 1JK1A 2UXDE 2EP3A 2V8QB 2K4VA 4R2SA 1A1FA 2EN4A 1DGCA 2YTOA 5BR8E 4DMIA 1A1KA 1WHNA 3ECRA
chains in the Genus database with same CATH topology
1YYWA 3DF6A 5T6JA 2DSYA 2M1SA 4DV6E 4BC9A 4LF7E 2L8TA 2LRSA 4I8OA 2ZM6E 3ZOQB 3T1HE 4LF9E 4J8ZA 2L3CA 4OX9E 2E5LE 4Q28A 4DV7E 2ODRC 1T4LB 2JOBA 4B3ME 2M7QA 4WFTA 3RV0A 2MC6A 2B9DA 4M30A 2CPNA 4DR1E 2N3GA 2L2MA 3AUZA 2RS6A 3C4TA 1HNXE 4R03A 4DV1E 1X47A 4DR3E 2MC5A 5ADZA 1XNRE 4K0KE 1U61A 2M4IA 4WSPA 4M2ZA 5AE3A 3AV0A 1WXRA 2DMYA 4L8NA 4LU9A 4JI2E 4F54A 2FGGA 4JI1E 4B3RE 1GZ6A 3H09A 2B3TB 2FV4B 3VYYA 1X49A 4GEQB 4WPYA 2UU9E 2GSLA 5LMNE 2LUPB 2JY9A 1STUA 3VYXA 4TUIA 4B3TE 4YY3E 2RTXA 1WHQA 4X8WA 2L33A 4DV2E 4X65E 4F9CB 2L6MA 3KWRA 4DKKA 5AE1A 3FIGA 3HXLA 3JAMC 2UUAE 4LTYA 3F6HA 2L92A 1RC7A 2JWOA 3IWCA 2KONA 3JU0A 2B7TA 5AASA 4BC7A 3ADLA 1ZBQA 2LTSA 2E1MA 1I4SA 4YHHE 4JI3E 4BMJA 4R8OA 4NXNE 2RS7A 2V88A 2IHR1 5IWAE 4DR4E 4OUNA 2EZ6A 3LMLA 5LMUE 4KHPE 4LF4E 3N3WA 2NA2A 3F6GA 1EKZA 4LF5E 4TUGA 4F9AB 3O2RA 2V86A 2L2NA 4L5NC 4LFCE 4P78A 2MDRA 5CFFE 2LUQA 2V89A 1X48A 4F9BB 4JI6E 1UILA 2L2KB 2YZTA 4NXME 2G7HA 3J7AG 1N33E 4LF8E 1SR9A 5AE2A 3J80C 2UXCE 1FJGE 4DR5E 4JI5E 2EWLA 5F3WA 1N34E 2LE2A 4WYQB 2L3JA 4LF6E 3OTOE 2F8BA 4LFAE 4B3SE 1GQEA 3IWBA 4JI0E 3HPZA 2NUEA 1UHZA 2LJHA 3LLHA 5FLXC 4X66E 1O0WA 4P7DA 4JI7E 1HNZE 2UUCE 3OMLA 1XNQE 3C4BA 4LFBE 2UUBE 4JI8E 1DI2A 2EB1A 2KHXA 4JV5E 4X64E 2RSMA 4DR2E 4DV4E 1J26A 2VQFE 2FFLA 3RV1A 2V85A 3ADIA 1XMQE 2N3HA 1I94E 3VK6A 3O2RB 4DUYE 4DUZE 2LBSB 1PKPA 2B7VA 2VF1A 4KZSA 4X62E 3MSWA 4DV0E 3ADJA 4JI4E 4BS9A 2VQEE 3IWDA 3J7Yp 3HTXA 2LTRA 3T1YE 2HHHE 4DR6E 2ODRD 4BCAA 2A11A 5IT9C 1QU6A 2WZOA 3HQ1A 1HNWE 2V87A 4DR7E 2NUGA 2DIXA 3ADGA 2H36X 1J5EE 5A2QC 2DB2A 2JOXA 4M0VA 2QVWA 1YYOA 3J81C 1IBME 1RC5A 2YT4A 2VE7C 1HR0E 1T4OA 2LMZA 3P1XA 4AQYE 5DNYA 4OOGC 1N36E 2FTXB 3HPSA 1DQ3A 1YZ9A 2F4VE 3JTZA 1RQ0A 4JYAE 1IBLE 2UXDE 2JVAA 2V8QB 4DV5E 1N32E 2K4VA 2KOUA 1FKAE 2JR1A 4GKJE 1YYKA 1ZBTA 3DJWA 5LL6R 2V83A 1IBKE 4BBYA 4GKKE 3K6QA 5BR8E 2NUFA 4DV3E 4DMIA 3RMPA 1XMOE 2UXBE 1T4NA 1WHNA 1JFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYW A;  4DV6 E;  4LF7 E;  2LRS A;  2ZM6 E;  3T1H E;  4LF9 E;  2L3C A;  4OX9 E;  2E5L E;  4DV7 E;  1T4L B;  4B3M E;  4WFT A;  3RV0 A;  4DR1 E;  4M30 A;  2CPN A;  2N3G A;  2L2M A;  2RS6 A;  3C4T A;  1HNX E;  4DV1 E;  1X47 A;  4DR3 E;  1XNR E;  4K0K E;  1U61 A;  4M2Z A;  2DMY A;  4B3R E;  4JI2 E;  4JI1 E;  2B3T B;  3VYY A;  1X49 A;  2UU9 E;  2GSL A;  5LMN E;  2LUP B;  2JY9 A;  1STU A;  3VYX A;  4B3T E;  4YY3 E;  2RTX A;  1WHQ A;  4X8W A;  2L33 A;  4DV2 E;  4X65 E;  4DKK A;  2UUA E;  1RC7 A;  2B7T A;  3ADL A;  2LTS A;  4YHH E;  1I4S A;  4JI3 E;  4NXN E;  2RS7 A;  4DR4 E;  2IHR 1;  5IWA E;  4OUN A;  2EZ6 A;  5LMU E;  4KHP E;  4LF4 E;  3N3W A;  2NA2 A;  1EKZ A;  4LF5 E;  3O2R A;  4LFC E;  2L2N A;  2MDR A;  5CFF E;  2LUQ A;  4JI6 E;  1X48 A;  1N33 E;  4NXM E;  1UIL A;  2L2K B;  4LF8 E;  2UXC E;  1FJG E;  4DR5 E;  4JI5 E;  1N34 E;  4WYQ B;  2L3J A;  4LF6 E;  3OTO E;  4LFA E;  4B3S E;  1GQE A;  4JI0 E;  2NUE A;  1UHZ A;  2LJH A;  3LLH A;  4X66 E;  1O0W A;  4JI7 E;  1HNZ E;  2UUC E;  1XNQ E;  4LFB E;  3C4B A;  2UUB E;  4JI8 E;  1DI2 A;  2EB1 A;  2KHX A;  4JV5 E;  4X64 E;  2RSM A;  4DR2 E;  4DV4 E;  1J26 A;  2VQF E;  2FFL A;  3RV1 A;  3ADI A;  1XMQ E;  2N3H A;  1I94 E;  4DUY E;  3O2R B;  4DUZ E;  2LBS B;  1PKP A;  2B7V A;  4DV0 E;  4X62 E;  3ADJ A;  4JI4 E;  4DR6 E;  2VQE E;  3J7Y p;  4JYA E;  3HTX A;  2LTR A;  3T1Y E;  2HHH E;  2A11 A;  1QU6 A;  1HNW E;  4DR7 E;  2NUG A;  2DIX A;  3ADG A;  1J5E E;  2DB2 A;  2QVW A;  1YYO A;  1IBM E;  1RC5 A;  2YT4 A;  1HR0 E;  1T4O A;  3P1X A;  4AQY E;  4OOG C;  1N36 E;  1YZ9 A;  2F4V E;  1RQ0 A;  1IBL E;  2UXD E;  2JVA A;  4DV5 E;  1N32 E;  1FKA E;  4GKJ E;  1YYK A;  1ZBT A;  1IBK E;  4GKK E;  5BR8 E;  2NUF A;  4DV3 E;  1XMO E;  2UXB E;  1T4N A;  1WHN A;  1JFZ A; 
#chains in the Genus database with same CATH topology
 4O24 A;  5A6A A;  4DV6 E;  2LRS A;  2L3C A;  2JP9 A;  4OX9 E;  1PJT A;  4Q35 B;  2JOB A;  4B3M E;  2CT1 A;  3RV0 A;  4DR1 E;  4R2A A;  5KL6 A;  2N3G A;  1EH6 A;  1HNX E;  1UN6 B;  1TN9 A;  3VHT B;  2Q8U A;  1A1L A;  5ADZ A;  4WSP A;  1YUI A;  5AE3 A;  3AV0 A;  1WXR A;  2DMY A;  4LU9 A;  4B3R E;  2HGH A;  3BBG A;  3H09 A;  2FV4 B;  3VYY A;  4WPY A;  2GSL A;  4BHC A;  2EM0 A;  2EOS A;  4TUI A;  4B3T E;  2HC5 A;  2L33 A;  4X65 E;  3KWR A;  5AE1 A;  5KL4 A;  4LTY A;  2YPN A;  3F6H A;  2EM3 A;  1RC7 A;  2JWO A;  1YFH A;  2EMY A;  4BC7 A;  2E1M A;  4JI3 E;  4NXN E;  2RS7 A;  4DR4 E;  2IHR 1;  2EZ6 A;  2YTJ A;  5LMU E;  2EL4 A;  1BB8 A;  3QG5 C;  2EQ0 A;  4L5N C;  1N33 E;  4BHB A;  4LF8 E;  2EN3 A;  1SR9 A;  1GTK A;  2GPI A;  3C6M A;  2EWL A;  1N34 E;  1T39 A;  1UBD C;  1KJK A;  4LF6 E;  2YU5 A;  2ELY A;  2EM2 A;  3THO B;  2LV2 A;  1RMD A;  4LFB E;  2EMC A;  2UUB E;  4O43 A;  2EB1 A;  2KHX A;  2YTD A;  1EH7 A;  1X6E A;  4DUY E;  2BBG A;  3ADJ A;  2LTR A;  2YWQ A;  2HHH E;  5IT9 C;  1L4S A;  2EMI A;  4DR7 E;  5A6J A;  2NUG A;  2EMW A;  1J5E E;  2H36 X;  4M0V A;  1YYO A;  1X3C A;  1IBM E;  4FK5 C;  1HR0 E;  5KL7 A;  5KL5 A;  3P1X A;  3UK3 C;  3KZY A;  1PDA A;  1YSA C;  3HPS A;  2YTI A;  4ZYE A;  1TF6 A;  2J7J A;  2ENH A;  2JVA A;  1YUJ A;  2KOU A;  1IMU A;  2WBS A;  2EQ3 A;  1YYK A;  3DJW A;  2EPN A;  1AH5 A;  2YTG A;  3K6Q A;  4R2D A;  4IS1 C;  2NUF A;  4DV3 E;  2EOQ A;  3BF2 A;  1T4N A;  1SFE A;  4O4K A;  2DRP A;  3DF6 A;  1F2I G;  1BBO A;  2DSY A;  5KL3 A;  4WX9 A;  4I8O A;  2ZM6 E;  4LF9 E;  4J8Z A;  2E5L E;  4Q28 A;  2EM6 A;  2CPN A;  3THN A;  2L2M A;  4R2P A;  3KZZ A;  4IJD A;  2DGC A;  4R03 A;  4DV1 E;  2MC5 A;  2M4I A;  4L8N A;  4JI1 E;  2FGG A;  1A1H A;  1GZ6 A;  2LVH A;  1A1J A;  2UU9 E;  3EQ1 A;  2BB8 A;  2EN8 A;  3JAM C;  2L92 A;  2EOE A;  2DLK A;  3JU0 A;  5A6K A;  2LTS A;  4R8O A;  2V88 A;  4OUN A;  1X6H A;  2YTE A;  2EPU A;  4KHP E;  1NCS A;  3N3W A;  2NAB A;  2YSP A;  3F6G A;  2EPO A;  4LF4 E;  1BBG A;  1B69 A;  2MDR A;  4JI6 E;  2LUQ A;  2V89 A;  4NXM E;  1UIL A;  2RPC A;  2YTF A;  5AE2 A;  3J80 C;  5A69 A;  2E72 A;  5F3W A;  2LE2 A;  1X5W A;  2L3J A;  3C6K A;  1GQE A;  2EMF A;  3IWB A;  1PJS A;  1A1G A;  3EPH A;  4R2Q A;  2EPC A;  2UUC E;  1XNQ E;  3OML A;  1DI2 A;  4JI8 E;  4JV5 E;  2DLQ A;  4X64 E;  4HEI A;  2EMH A;  4DV4 E;  3RV1 A;  2V85 A;  1KYQ A;  2LCE A;  2N3H A;  2EPM X;  5AC5 A;  1I94 E;  3VK6 A;  4MLQ A;  2EOJ A;  4JYA E;  3IWD A;  2RQL A;  3T1Y E;  2ODR D;  2A11 A;  2V87 A;  4R2R A;  2DB2 A;  1WRJ A;  2QVW A;  3J81 C;  2MKN A;  2YT4 A;  2YTN A;  1T4O A;  1TF3 A;  4N4R B;  1DQ3 A;  1YZ9 A;  1N3G A;  3JTZ A;  1ZTD A;  2EOI A;  2EOO A;  4DV5 E;  1N32 E;  2GLI A;  2JR1 A;  4GKJ E;  4RHB B;  1ZBT A;  2EPL X;  1IBK E;  2CTD A;  1XMO E;  3RMP A;  2UXB E;  1P47 A;  1X6F A;  2N8X A;  2EML A;  5T6J A;  2M1S A;  4BC9 A;  4LF7 E;  2YTQ A;  5KL2 A;  3ZOQ B;  2CSH A;  4DV7 E;  2ODR C;  1T4L B;  1QNT A;  2MC6 A;  2EL5 A;  2EOX A;  4DR3 E;  4NHR A;  4HTG A;  4O5G A;  4F6N A;  1U61 A;  4F54 A;  2ADR A;  1T38 A;  2EOF A;  4GEQ B;  5LMN E;  2JY9 A;  1STU A;  2ENC A;  3VYX A;  1IQO A;  4X8W A;  2PRT A;  4DV2 E;  3MHH C;  2DMI A;  2L6M A;  4DKK A;  3HXL A;  2EOH A;  5A6B D;  3IWC A;  2KON A;  2B7T A;  4YHH E;  1I4S A;  4ZYH A;  2GHF A;  4BMJ A;  2EMA A;  2EMG A;  3LML A;  2JXP A;  2NA2 A;  4WSG A;  1EKZ A;  4LF5 E;  2EOY A;  4TUG A;  5LLQ A;  3O2R A;  2V86 A;  1X48 A;  2EN7 A;  2L2K B;  2EPA A;  2JPA A;  4DR5 E;  4JI5 E;  2YRH A;  2F8B A;  1MGT A;  2EPK X;  3L00 A;  1EH8 A;  1UHZ A;  4WXD A;  3MHS C;  5FLX C;  2WCC 3;  4X66 E;  1O0W A;  4P7D A;  1HNZ E;  2EMB A;  4X9J A;  3C4B A;  1Z1B A;  2YRM A;  2EPZ A;  5IV8 B;  2RSM A;  2WBT A;  4DR2 E;  3M99 B;  2HJJ A;  2FFL A;  2VQF E;  4DUZ E;  2B7V A;  4KZS A;  4DR6 E;  2VQE E;  3J7Y p;  5A6B A;  2EPX A;  1A1I A;  2YSO A;  3ADG A;  2YU8 A;  2EM9 A;  1ZR9 A;  1RC5 A;  2VE7 C;  5AC4 A;  2EPR A;  2EL6 A;  5DNY A;  4ZYD A;  2EOR A;  2FTX B;  2EM8 A;  1LLM C;  2F4V E;  1YPN A;  2MKD A;  1IBL E;  2EM7 A;  2MDG A;  2EMX A;  2EM5 A;  1FKA E;  2EPP A;  1IQS A;  5LL6 R;  2V83 A;  4BBY A;  4GKK E;  4M9V C;  4F6M A;  4F9C B;  1JFZ A;  1YYW A;  2A25 A;  1WJP A;  2L8T A;  2EQ1 A;  3T1H E;  1ZU1 A;  2M9A A;  2RSI A;  1ZAA C;  2M7Q A;  4WFT A;  4WXC A;  4R2C A;  2B9D A;  4M30 A;  4KWY A;  3AUZ A;  2RS6 A;  3C4T A;  2EE8 A;  1X47 A;  2I9I A;  1XNR E;  4K0K E;  4M2Z A;  2R76 A;  4JI2 E;  4GZN C;  3EPJ A;  2B3T B;  1X49 A;  2VRD A;  2LUP B;  4MLV A;  4YY3 E;  2RTX A;  2LJU A;  1WHQ A;  2LO3 A;  5IXM B;  5TSE A;  3FIG A;  2UUA E;  1G2D C;  5AAS A;  3EPL A;  3ADL A;  1ZBQ A;  2JYA A;  2EMZ A;  5IWA E;  3TQM A;  4RH8 A;  1G2F C;  3BGH A;  1JK2 A;  4F2J C;  4F9A B;  4LFC E;  2L2N A;  4P78 A;  5CFF E;  2YTP A;  4F9B B;  3J7A G;  2YZT A;  2G7H A;  4NZV A;  2UXC E;  1MEY C;  1FJG E;  4WYQ B;  3BID A;  3OTO E;  4LFA E;  4B3S E;  2R1F A;  4JI0 E;  3HPZ A;  2NUE A;  2K7I A;  2LJH A;  4R2E A;  3LLH A;  4JI7 E;  2LT7 A;  2EM4 A;  1J26 A;  3ADI A;  1XMQ E;  2EOZ A;  1AAY A;  2EN1 A;  1NEI A;  3O2R B;  2LBS B;  2EN6 A;  1PKP A;  2VF1 A;  2WBU A;  4X62 E;  4DV0 E;  3MSW A;  4JI4 E;  4BS9 A;  3HTX A;  4BCA A;  1QU6 A;  2D9H A;  2EN2 A;  2WZO A;  1PJQ A;  3HQ1 A;  3EPK A;  1HNW E;  2DIX A;  5A2Q C;  2JOX A;  2EMK A;  2ENA A;  4ZYG A;  2EOM A;  2EJ4 A;  2I13 A;  2LMZ A;  4AQY E;  4OOG C;  2YRK A;  1N36 E;  2ELZ A;  1RQ0 A;  1JK1 A;  2UXD E;  2EP3 A;  2V8Q B;  2K4V A;  4R2S A;  1A1F A;  2EN4 A;  1DGC A;  2YTO A;  5BR8 E;  4DMI A;  1A1K A;  1WHN A;  3ECR A; 
#chains in the Genus database with same CATH homology
 1YYW A;  3DF6 A;  5T6J A;  2DSY A;  2M1S A;  4DV6 E;  4BC9 A;  4LF7 E;  2L8T A;  2LRS A;  4I8O A;  2ZM6 E;  3ZOQ B;  3T1H E;  4LF9 E;  4J8Z A;  2L3C A;  4OX9 E;  2E5L E;  4Q28 A;  4DV7 E;  2ODR C;  1T4L B;  2JOB A;  4B3M E;  2M7Q A;  4WFT A;  3RV0 A;  2MC6 A;  2B9D A;  4M30 A;  2CPN A;  4DR1 E;  2N3G A;  2L2M A;  3AUZ A;  2RS6 A;  3C4T A;  1HNX E;  4R03 A;  4DV1 E;  1X47 A;  4DR3 E;  2MC5 A;  5ADZ A;  1XNR E;  4K0K E;  1U61 A;  2M4I A;  4WSP A;  4M2Z A;  5AE3 A;  3AV0 A;  1WXR A;  2DMY A;  4L8N A;  4LU9 A;  4JI2 E;  4F54 A;  2FGG A;  4JI1 E;  4B3R E;  1GZ6 A;  3H09 A;  2B3T B;  2FV4 B;  3VYY A;  1X49 A;  4GEQ B;  4WPY A;  2UU9 E;  2GSL A;  5LMN E;  2LUP B;  2JY9 A;  1STU A;  3VYX A;  4TUI A;  4B3T E;  4YY3 E;  2RTX A;  1WHQ A;  4X8W A;  2L33 A;  4DV2 E;  4X65 E;  4F9C B;  2L6M A;  3KWR A;  4DKK A;  5AE1 A;  3FIG A;  3HXL A;  3JAM C;  2UUA E;  4LTY A;  3F6H A;  2L92 A;  1RC7 A;  2JWO A;  3IWC A;  2KON A;  3JU0 A;  2B7T A;  5AAS A;  4BC7 A;  3ADL A;  1ZBQ A;  2LTS A;  2E1M A;  1I4S A;  4YHH E;  4JI3 E;  4BMJ A;  4R8O A;  4NXN E;  2RS7 A;  2V88 A;  2IHR 1;  5IWA E;  4DR4 E;  4OUN A;  2EZ6 A;  3LML A;  5LMU E;  4KHP E;  4LF4 E;  3N3W A;  2NA2 A;  3F6G A;  1EKZ A;  4LF5 E;  4TUG A;  4F9A B;  3O2R A;  2V86 A;  2L2N A;  4L5N C;  4LFC E;  4P78 A;  2MDR A;  5CFF E;  2LUQ A;  2V89 A;  1X48 A;  4F9B B;  4JI6 E;  1UIL A;  2L2K B;  2YZT A;  4NXM E;  2G7H A;  3J7A G;  1N33 E;  4LF8 E;  1SR9 A;  5AE2 A;  3J80 C;  2UXC E;  1FJG E;  4DR5 E;  4JI5 E;  2EWL A;  5F3W A;  1N34 E;  2LE2 A;  4WYQ B;  2L3J A;  4LF6 E;  3OTO E;  2F8B A;  4LFA E;  4B3S E;  1GQE A;  3IWB A;  4JI0 E;  3HPZ A;  2NUE A;  1UHZ A;  2LJH A;  3LLH A;  5FLX C;  4X66 E;  1O0W A;  4P7D A;  4JI7 E;  1HNZ E;  2UUC E;  3OML A;  1XNQ E;  3C4B A;  4LFB E;  2UUB E;  4JI8 E;  1DI2 A;  2EB1 A;  2KHX A;  4JV5 E;  4X64 E;  2RSM A;  4DR2 E;  4DV4 E;  1J26 A;  2VQF E;  2FFL A;  3RV1 A;  2V85 A;  3ADI A;  1XMQ E;  2N3H A;  1I94 E;  3VK6 A;  3O2R B;  4DUY E;  4DUZ E;  2LBS B;  1PKP A;  2B7V A;  2VF1 A;  4KZS A;  4X62 E;  3MSW A;  4DV0 E;  3ADJ A;  4JI4 E;  4BS9 A;  2VQE E;  3IWD A;  3J7Y p;  3HTX A;  2LTR A;  3T1Y E;  2HHH E;  4DR6 E;  2ODR D;  4BCA A;  2A11 A;  5IT9 C;  1QU6 A;  2WZO A;  3HQ1 A;  1HNW E;  2V87 A;  4DR7 E;  2NUG A;  2DIX A;  3ADG A;  2H36 X;  1J5E E;  5A2Q C;  2DB2 A;  2JOX A;  4M0V A;  2QVW A;  1YYO A;  3J81 C;  1IBM E;  1RC5 A;  2YT4 A;  2VE7 C;  1HR0 E;  1T4O A;  2LMZ A;  3P1X A;  4AQY E;  5DNY A;  4OOG C;  1N36 E;  2FTX B;  3HPS A;  1DQ3 A;  1YZ9 A;  2F4V E;  3JTZ A;  1RQ0 A;  4JYA E;  1IBL E;  2UXD E;  2JVA A;  2V8Q B;  4DV5 E;  1N32 E;  2K4V A;  2KOU A;  1FKA E;  2JR1 A;  4GKJ E;  1YYK A;  1ZBT A;  3DJW A;  5LL6 R;  2V83 A;  1IBK E;  4BBY A;  4GKK E;  3K6Q A;  5BR8 E;  2NUF A;  4DV3 E;  4DMI A;  3RMP A;  1XMO E;  2UXB E;  1T4N A;  1WHN A;  1JFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...