2GSLA

X-ray crystal structure of protein fn1578 from fusobacterium nucleatum. northeast structural genomics consortium target nr1.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
126
structure length
124
Chain Sequence
b'DFSKDIRDYSGLELAFLGDAIWELEIRKYYLQFGYNIPTLNKYVKAKVNAKYQSLIYKKIINDLDEEFKVIGKRAKNIKTFPRSCTVMEYKEATALEAIIGAMYLLKKEEEIKKIINIVIKGEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal Structure of the Hypothetical Protein (FN1578) from Fusobacterium nucleatum, NESG Target NR1
rcsb
source organism Fusobacterium nucleatum subsp. nucleatum
molecule tags Structural genomics, unknown function
total genus 42
structure length 124
sequence length 126
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 2gslA00
4M30A 4M2ZA 1RC5A 2EZ6A 1YYWA 2NUFA 3C4BA 2NUGA 2EB1A 2A11A 1YYKA 1RC7A 1YYOA 1YZ9A 3C4TA 2FFLA 3O2RB 3N3WA 2NUEA 1O0WA 3RV0A 2GSLA 1U61A 3O2RA 4OUNA 1JFZA 1I4SA 3RV1A 4OOGC 2QVWA
chains in the Genus database with same CATH superfamily
4M30A 4M2ZA 1RC5A 2EZ6A 1YYWA 2NUFA 3C4BA 2NUGA 2EB1A 2A11A 1YYKA 1RC7A 1YYOA 1YZ9A 3C4TA 2FFLA 3O2RB 3N3WA 2NUEA 1O0WA 3RV0A 2GSLA 1U61A 1ZTDA 3O2RA 4OUNA 1JFZA 1I4SA 3RV1A 4OOGC 2QVWA
chains in the Genus database with same CATH topology
4M30A 4M2ZA 1RC5A 2EZ6A 1YYWA 2NUFA 3C4BA 2NUGA 2EB1A 2A11A 1YYKA 1RC7A 1YYOA 1YZ9A 3C4TA 2FFLA 3O2RB 3N3WA 2NUEA 1O0WA 3RV0A 2GSLA 1U61A 3O2RA 4OUNA 1JFZA 1I4SA 3RV1A 4OOGC 2QVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M30 A;  4M2Z A;  1RC5 A;  2EZ6 A;  1YYW A;  2NUF A;  3C4B A;  2NUG A;  2EB1 A;  2A11 A;  1YYK A;  1RC7 A;  1YYO A;  1YZ9 A;  3C4T A;  2FFL A;  3O2R B;  3N3W A;  2NUE A;  1O0W A;  3RV0 A;  2GSL A;  1U61 A;  3O2R A;  4OUN A;  1JFZ A;  1I4S A;  3RV1 A;  4OOG C;  2QVW A; 
#chains in the Genus database with same CATH topology
 4M30 A;  4M2Z A;  1RC5 A;  2EZ6 A;  1YYW A;  2NUF A;  3C4B A;  2NUG A;  2EB1 A;  2A11 A;  1YYK A;  1RC7 A;  1YYO A;  1YZ9 A;  3C4T A;  2FFL A;  3O2R B;  3N3W A;  2NUE A;  1O0W A;  3RV0 A;  2GSL A;  1U61 A;  1ZTD A;  3O2R A;  4OUN A;  1JFZ A;  1I4S A;  3RV1 A;  4OOG C;  2QVW A; 
#chains in the Genus database with same CATH homology
 4M30 A;  4M2Z A;  1RC5 A;  2EZ6 A;  1YYW A;  2NUF A;  3C4B A;  2NUG A;  2EB1 A;  2A11 A;  1YYK A;  1RC7 A;  1YYO A;  1YZ9 A;  3C4T A;  2FFL A;  3O2R B;  3N3W A;  2NUE A;  1O0W A;  3RV0 A;  2GSL A;  1U61 A;  3O2R A;  4OUN A;  1JFZ A;  1I4S A;  3RV1 A;  4OOG C;  2QVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...