3C4TA

Structure of rnaseiiib and dsrna binding domains of mouse dicer
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
260
structure length
241
Chain Sequence
DAEKTLNHLISGFETFEKKINYRFKNKAYLLQAFTHASYHYNTITDYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVKFQLEKNEEDIEVPKAMGDIFESLAGAIYMDSGMSLEVVWQVYYPMMQPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Endoribonuclease Dicer
publication title Structural and biochemical insights into the dicing mechanism of mouse Dicer: A conserved lysine is critical for dsRNA cleavage.
pubmed doi rcsb
source organism Mus musculus
total genus 73
structure length 241
sequence length 260
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 3c4tA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3c4tA02
2LTSA 4M2ZA 3C4BA 3VYYA 1N36E 2NUEA 2UXDE 2F4VE 1IBME 1UILA 2JVAA 2DMYA 2UXCE 4X8WA 2DB2A 3HTXA 4LFBE 4X64E 2NUFA 1UHZA 4AQYE 2L2MA 4JI6E 4DUYE 2L2KB 3ADJA 2N3HA 5CFFE 1RC5A 4JV5E 1T4NA 4DUZE 3P1XA 4WYQB 1XMOE 2LUQA 2RTXA 3T1HE 3VYXA 3ADLA 4B3RE 1XNQE 1YYWA 1GQEA 1RQ0A 1X48A 1YZ9A 2UU9E 4LF5E 1J26A 3ADIA 1X47A 2NUGA 4JI7E 4DR5E 1X49A 1ZBTA 4JYAE 2B7VA 2HHHE 4JI0E 3RV0A 2UXBE 2UUCE 2B7TA 4DV7E 4JI2E 2JY9A 4DR3E 4LFAE 2E5LE 3J7Yp 4DV5E 1JFZA 4M30A 1T4OA 4DR2E 4JI5E 4K0KE 4NXNE 2VQEE 1I4SA 4LF4E 1HR0E 2L2NA 1HNZE 4B3ME 1I94E 4DV0E 4OOGC 2B3TB 1WHQA 1YYKA 2A11A 5LMUE 2MDRA 2LUPB 2LTRA 2GSLA 2L3CA 1HNWE 3RV1A 1XMQE 4LF7E 4JI8E 4X62E 1O0WA 1T4LB 2L33A 2RSMA 2LBSB 4OX9E 2QVWA 2ZM6E 4DR6E 3O2RA 3LLHA 4DR7E 1N33E 1J5EE 3OTOE 1RC7A 4DR4E 2EZ6A 1XNRE 4DKKA 1HNXE 4LF9E 1DI2A 2L3JA 5BR8E 1IBKE 4GKJE 1EKZA 2NA2A 1QU6A 2KHXA 4B3TE 1N32E 4OUNA 3T1YE 2DIXA 4DV1E 4JI1E 4DV3E 4DV2E 1U61A 4LFCE 4WFTA 1FJGE 2VQFE 4DV4E 4YHHE 5IWAE 4JI3E 4LF8E 3O2RB 5LMNE 2YT4A 2IHR1 4NXME 2CPNA 2UUBE 4LF6E 2FFLA 1IBLE 3C4TA 4YY3E 1N34E 2RS6A 3N3WA 2RS7A 4JI4E 4GKKE 4B3SE 4KHPE 2UUAE 2LRSA 1FKAE 4X66E 4DV6E 1YYOA 1WHNA 3ADGA 4X65E 2LJHA 1STUA 2EB1A 1PKPA 4DR1E 2N3GA
chains in the Genus database with same CATH superfamily
2LTSA 2ODRC 2LT7A 3C4BA 2YTGA 5KL4A 1YUJA 3BF2A 3EPLA 1L4SA 3VYYA 1BBOA 2HGHA 2F4VE 3C6KA 1UILA 2L8TA 3ECRA 3H09A 1G2FC 2JR1A 1UHZA 4WXCA 3UK3C 2WBTA 4JI6E 4DUYE 2V8QB 1RC5A 2LO3A 2EN3A 3KZZA 4DUZE 4Q28A 1XMOE 2LUQA 2EMGA 3VYXA 4B3RE 2V89A 2D9HA 1RQ0A 2NUGA 1F2IG 2E1MA 2YWQA 1SR9A 2UUCE 1IQSA 4LFAE 4MLQA 2R1FA 5ADZA 2M4IA 4DV5E 1JFZA 4M30A 4DR2E 4NHRA 4NXNE 4TUGA 4DV0E 2YTQA 2YSOA 2A11A 2GHFA 2EPCA 2LTRA 1A1GA 1YUIA 2DRPA 4O5GA 3KZYA 5A2QC 2L3CA 1HNWE 2E72A 4LF7E 3RMPA 1ZAAC 2EM0A 4O43A 2LBSB 4OX9E 1UN6B 2MDGA 2N8XA 2L6MA 3O2RA 4WSPA 5A6KA 4R2DA 2MC5A 4KWYA 3OTOE 4DR4E 2BBGA 4DKKA 1DI2A 5A6JA 5BR8E 4GKJE 5A69A 2DLKA 5AC5A 2A25A 2KHXA 2I13A 4P78A 2EN7A 3HPSA 4B3TE 1N32E 4DV1E 3C6MA 4DV2E 5IXMB 4DV4E 4ZYEA 5AC4A 1MGTA 4JI3E 4LF8E 2ADRA 1B69A 3KWRA 2V85A 2YT4A 2EN8A 4BCAA 2YTPA 2CPNA 2FFLA 4R2CA 1IBLE 2YTJA 5A6AA 2NABA 2RS6A 3TQMA 2WCC3 4FK5C 1EH6A 2ELYA 4ZYHA 2ENHA 4KHPE 3EPJA 4X66E 2ODRD 5KL2A 3ADGA 2ENCA 4M2ZA 4ZYDA 2WBUA 1N36E 2WBSA 2UXCE 4X8WA 2EL5A 2DB2A 4X64E 2NUFA 2EPOA 3ADJA 1YFHA 2EQ0A 1RMDA 2EQ3A 2JPAA 3P1XA 5A6BD 1X5WA 1ZTDA 2EM4A 1ZU1A 2EOJA 2EMIA 3ADLA 2BB8A 4LF5E 1YZ9A 3EPHA 3ADIA 1X47A 1J26A 1GZ6A 1GTKA 1PJSA 2B7VA 4WSGA 4NZVA 4R2QA 2EPRA 2B7TA 4DV7E 4JI2E 2JY9A 3MHHC 3IWCA 1T4OA 4K0KE 1WXRA 1A1HA 1EH7A 2VQEE 4LF4E 1HNZE 4ZYGA 4B3ME 2EOOA 2B3TB 1WHQA 1YYKA 2EQ1A 2YRKA 2V87A 1SFEA 1DGCA 2EN4A 2GSLA 4DMIA 2YPNA 4WXDA 3ZOQB 1KJKA 2VRDA 1O0WA 1T4LB 1JK1A 1JK2A 4R2AA 2QVWA 2V86A 2J7JA 2ZM6E 1LLMC 2ENAA 5F3WA 1IMUA 1T38A 1RC7A 4R2PA 2EZ6A 2DLQA 2EMYA 4LF9E 2L3JA 2EORA 1IBKE 4MLVA 3AUZA 2ELZA 4F9AB 1AAYA 1EKZA 4J8ZA 2EMAA 4O24A 1QU6A 2YTOA 2EOXA 4GEQB 3THOB 4OUNA 2EM9A 3IWDA 3JU0A 2GPIA 3HPZA 4WFTA 2LMZA 4YHHE 5IWAE 2CSHA 4L8NA 4R2SA 5LMNE 4HEIA 2KONA 3VHTB 2EM2A 1WRJA 3K6QA 4N4RB 2YU8A 3THNA 2UUBE 1PJQA 2L92A 4LF6E 1N34E 1TN9A 4O4KA 2CTDA 2EM5A 3N3WA 2RS7A 4BC9A 4B3SE 1AH5A 1EH8A 2LRSA 2YZTA 1QNTA 1FKAE 4DV6E 4F6NA 2EPKX 1TF6A 5KL3A 3VK6A 4OOGC 2EM3A 1G2DC 4GKKE 2N3GA 2FGGA 2EMBA 5AE1A 3JAMC 2YTNA 2EE8A 2EPUA 2UXDE 1IBME 2JVAA 2EPLX 1TF3A 2EMCA 2HC5A 2LVHA 1A1JA 4BHBA 2L2MA 2HJJA 2L2KB 1PJTA 5CFFE 2V83A 4TUIA 1T4NA 2LJUA 2JWOA 2EL4A 4I8OA 2RTXA 2LV2A 4L5NC 1A1FA 2EOHA 1GQEA 2RSIA 3J7AG 1A1IA 1ZBQA 3DJWA 4DR5E 1X49A 1ZBTA 4F54A 4JI0E 3RV0A 4GZNC 3JTZA 2E5LE 3J7Yp 4BBYA 4RH8A 4BS9A 1T39A 4JI5E 2I9IA 3EQ1A 4IJDA 2L2NA 2EM7A 1I94E 1YPNA 4Q35B 3F6HA 5LMUE 5T6JA 2MDRA 4HTGA 2LUPB 2EL6A 2YRHA 1PKPA 2DSYA 2JYAA 1XMQE 4R03A 4F6MA 5LL6R 4X62E 2RSMA 2R76A 2EPMX 2RQLA 2EMLA 2EMXA 2JP9A 2JXPA 4WPYA 3M99B 4DR6E 2YTDA 4R2RA 4DR7E 1N33E 5AE3A 1J5EE 2YRMA 3IWBA 4BC7A 1PDAA 2EOZA 4WX9A 4F9CB 3FIGA 1YSAC 1NCSA 1A1KA 5AE2A 2EJ4A 1IQOA 5IV8B 3F6GA 2Q8UA 2WZOA 5KL5A 1ZR9A 4M0VA 1MEYC 5DNYA 4DV3E 4LFCE 2MKDA 3HQ1A 2EOSA 2VQFE 2YU5A 3J80C 3MHSC 3HXLA 2VE7C 2EPAA 2IHR1 4NXME 1DQ3A 2CT1A 3C4TA 1NEIA 3AV0A 1BBGA 4X9JA 4LTYA 2UUAE 2EMFA 2EPPA 2EPZA 2EMHA 4RHBB 2LJHA 2EOYA 1STUA 2EOIA 4DR1E 4R2EA 2EMWA 5LLQA 3MSWA 2EOEA 2MC6A 1UBDC 2NUEA 3QG5C 3BIDA 3LMLA 2DMYA 1X6HA 2K4VA 3HTXA 2EOFA 4LFBE 1X6EA 3EPKA 4AQYE 2PRTA 2N3HA 2EN6A 4JV5E 2EPXA 2DGCA 4WYQB 3T1HE 1XNQE 1YYWA 1X48A 2UU9E 2GLIA 4F9BB 2YSPA 4JI7E 4JYAE 2HHHE 2EOMA 2UXBE 2EPNA 5TSEA 4DR3E 4LU9A 1KYQA 2EP3A 2EMZA 2EM6A 1P47A 2M7QA 2H36X 1I4SA 1HR0E 5AASA 3OMLA 2DMIA 2EWLA 2EMKA 3BBGA 3J81C 2FTXB 3RV1A 4BHCA 2B9DA 3BGHA 4JI8E 4P7DA 2YTEA 2L33A 2YTFA 1BB8A 1X6FA 2YTIA 3LLHA 4R8OA 1XNRE 1HNXE 4IS1C 3L00A 2EOQA 2NA2A 2RPCA 5KL7A 2F8BA 2MKNA 2EN2A 3T1YE 2DIXA 4JI1E 1WJPA 1U61A 1A1LA 2KOUA 1FJGE 2M1SA 2JOBA 3O2RB 2LE2A 4BMJA 5FLXC 1Z1BA 2VF1A 2JOXA 5KL6A 2M9AA 5IT9C 4M9VC 1X3CA 4YY3E 2EM8A 4JI4E 3DF6A 4KZSA 2K7IA 4F2JC 1N3GA 1YYOA 1WHNA 2G7HA 5A6BA 4X65E 2V88A 2EN1A 2LCEA 2EB1A 2FV4B
chains in the Genus database with same CATH topology
2LTSA 2ODRC 4M2ZA 2FGGA 3C4BA 5AE1A 3JAMC 3MSWA 2MC6A 3VYYA 1N36E 2NUEA 2UXDE 2F4VE 1IBME 1UILA 2JVAA 2L8TA 3LMLA 2DMYA 3H09A 2JR1A 2UXCE 4X8WA 2K4VA 2DB2A 3HTXA 4LFBE 4X64E 2NUFA 1UHZA 4AQYE 2L2MA 4JI6E 4DUYE 2L2KB 3ADJA 2V8QB 2N3HA 5CFFE 1RC5A 2V83A 4TUIA 4JV5E 1T4NA 2JWOA 3P1XA 4Q28A 4WYQB 4DUZE 1XMOE 4I8OA 2LUQA 2RTXA 3T1HE 3VYXA 3ADLA 4L5NC 1XNQE 1YYWA 2V89A 4B3RE 1GQEA 1RQ0A 1X48A 1YZ9A 2UU9E 4F9BB 4LF5E 3ADIA 1X47A 2NUGA 1GZ6A 1ZBQA 3DJWA 4JI7E 4DR5E 2E1MA 1X49A 1ZBTA 4F54A 4JYAE 2B7VA 2HHHE 4JI0E 3RV0A 1SR9A 2UXBE 2UUCE 2B7TA 4DV7E 4JI2E 2JY9A 4DR3E 3JTZA 1J26A 4LFAE 4LU9A 5ADZA 2E5LE 3IWCA 4BBYA 2M4IA 3J7Yp 4DV5E 1JFZA 4M30A 1T4OA 4BS9A 4DR2E 2M7QA 2H36X 1WXRA 2VQEE 4JI5E 4NXNE 1I4SA 4K0KE 4LF4E 4TUGA 1HR0E 2L2NA 5AASA 1HNZE 3OMLA 4B3ME 1I94E 4DV0E 4OOGC 3F6HA 2B3TB 1WHQA 1YYKA 2A11A 5T6JA 2MDRA 5LMUE 2LUPB 2LTRA 2V87A 2EWLA 3J81C 1PKPA 2DSYA 2GSLA 4DMIA 5A2QC 2L3CA 1HNWE 2FTXB 3RV1A 2B9DA 4R03A 1XMQE 4JI8E 3ZOQB 3RMPA 5LL6R 4X62E 1O0WA 1T4LB 4P7DA 2L33A 2RSMA 2LBSB 4OX9E 2QVWA 2V86A 4WPYA 2ZM6E 2L6MA 4DR6E 3O2RA 4WSPA 3LLHA 4DR7E 1N33E 4R8OA 2MC5A 5AE3A 1J5EE 5F3WA 3IWBA 3OTOE 1RC7A 4BC7A 4DR4E 2EZ6A 1XNRE 4DKKA 1HNXE 4LF9E 4F9CB 2L3JA 5BR8E 3FIGA 1IBKE 1DI2A 4GKJE 3AUZA 4F9AB 1EKZA 4J8ZA 2NA2A 5AE2A 1QU6A 2KHXA 2WZOA 3F6GA 4P78A 4M0VA 2F8BA 3HPSA 4B3TE 4GEQB 1N32E 4OUNA 3T1YE 2DIXA 3IWDA 4DV1E 4JI1E 5DNYA 4DV3E 4DV2E 1U61A 3JU0A 4LFCE 2KOUA 3HPZA 3HQ1A 4WFTA 1FJGE 2VQFE 4DV4E 2LMZA 4YHHE 5IWAE 2M1SA 3J80C 2JOBA 3HXLA 4JI3E 4LF8E 3O2RB 4L8NA 2LE2A 4BMJA 5LMNE 5FLXC 2KONA 2V85A 2YT4A 2VF1A 3K6QA 2JOXA 3KWRA 2VE7C 4BCAA 2IHR1 4NXME 2CPNA 1DQ3A 2UUBE 2L92A 2FFLA 5IT9C 1IBLE 3C4TA 4YY3E 4LF6E 1N34E 2RS6A 3AV0A 3N3WA 2RS7A 3DF6A 4JI4E 4GKKE 4BC9A 4KZSA 4B3SE 4LF7E 4KHPE 4LTYA 2UUAE 2LRSA 2YZTA 1FKAE 4X66E 4DV6E 3J7AG 1YYOA 1WHNA 2G7HA 2ODRD 3ADGA 4X65E 2V88A 3VK6A 2LJHA 1STUA 2EB1A 2FV4B 4DR1E 2N3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LTS A;  4M2Z A;  3C4B A;  3VYY A;  1N36 E;  2NUE A;  2UXD E;  2F4V E;  1IBM E;  1UIL A;  2JVA A;  2DMY A;  2UXC E;  4X8W A;  2DB2 A;  3HTX A;  4LFB E;  4X64 E;  2NUF A;  1UHZ A;  4AQY E;  2L2M A;  4JI6 E;  4DUY E;  2L2K B;  3ADJ A;  2N3H A;  5CFF E;  1RC5 A;  4JV5 E;  1T4N A;  4DUZ E;  3P1X A;  4WYQ B;  1XMO E;  2LUQ A;  2RTX A;  3T1H E;  3VYX A;  3ADL A;  4B3R E;  1XNQ E;  1YYW A;  1GQE A;  1RQ0 A;  1X48 A;  1YZ9 A;  2UU9 E;  4LF5 E;  1J26 A;  3ADI A;  1X47 A;  2NUG A;  4JI7 E;  4DR5 E;  1X49 A;  1ZBT A;  4JYA E;  2B7V A;  2HHH E;  4JI0 E;  3RV0 A;  2UXB E;  2UUC E;  2B7T A;  4DV7 E;  4JI2 E;  2JY9 A;  4DR3 E;  4LFA E;  2E5L E;  3J7Y p;  4DV5 E;  1JFZ A;  4M30 A;  1T4O A;  4DR2 E;  4JI5 E;  4K0K E;  4NXN E;  2VQE E;  1I4S A;  4LF4 E;  1HR0 E;  2L2N A;  1HNZ E;  4B3M E;  1I94 E;  4DV0 E;  4OOG C;  2B3T B;  1WHQ A;  1YYK A;  2A11 A;  5LMU E;  2MDR A;  2LUP B;  2LTR A;  2GSL A;  2L3C A;  1HNW E;  3RV1 A;  1XMQ E;  4LF7 E;  4JI8 E;  4X62 E;  1O0W A;  1T4L B;  2L33 A;  2RSM A;  2LBS B;  4OX9 E;  2QVW A;  2ZM6 E;  4DR6 E;  3O2R A;  3LLH A;  4DR7 E;  1N33 E;  1J5E E;  3OTO E;  1RC7 A;  4DR4 E;  2EZ6 A;  1XNR E;  4DKK A;  1HNX E;  4LF9 E;  1DI2 A;  2L3J A;  5BR8 E;  1IBK E;  4GKJ E;  1EKZ A;  2NA2 A;  1QU6 A;  2KHX A;  4B3T E;  1N32 E;  4OUN A;  3T1Y E;  2DIX A;  4DV1 E;  4JI1 E;  4DV3 E;  4DV2 E;  1U61 A;  4LFC E;  4WFT A;  1FJG E;  2VQF E;  4DV4 E;  4YHH E;  5IWA E;  4JI3 E;  4LF8 E;  3O2R B;  5LMN E;  2YT4 A;  2IHR 1;  4NXM E;  2CPN A;  2UUB E;  4LF6 E;  2FFL A;  1IBL E;  3C4T A;  4YY3 E;  1N34 E;  2RS6 A;  3N3W A;  2RS7 A;  4JI4 E;  4GKK E;  4B3S E;  4KHP E;  2UUA E;  2LRS A;  1FKA E;  4X66 E;  4DV6 E;  1YYO A;  1WHN A;  3ADG A;  4X65 E;  2LJH A;  1STU A;  2EB1 A;  1PKP A;  4DR1 E;  2N3G A; 
#chains in the Genus database with same CATH topology
 2LTS A;  2ODR C;  2LT7 A;  3C4B A;  2YTG A;  5KL4 A;  1YUJ A;  3BF2 A;  3EPL A;  1L4S A;  3VYY A;  1BBO A;  2HGH A;  2F4V E;  3C6K A;  1UIL A;  2L8T A;  3ECR A;  3H09 A;  1G2F C;  2JR1 A;  1UHZ A;  4WXC A;  3UK3 C;  2WBT A;  4JI6 E;  4DUY E;  2V8Q B;  1RC5 A;  2LO3 A;  2EN3 A;  3KZZ A;  4DUZ E;  4Q28 A;  1XMO E;  2LUQ A;  2EMG A;  3VYX A;  4B3R E;  2V89 A;  2D9H A;  1RQ0 A;  2NUG A;  1F2I G;  2E1M A;  2YWQ A;  1SR9 A;  2UUC E;  1IQS A;  4LFA E;  4MLQ A;  2R1F A;  5ADZ A;  2M4I A;  4DV5 E;  1JFZ A;  4M30 A;  4DR2 E;  4NHR A;  4NXN E;  4TUG A;  4DV0 E;  2YTQ A;  2YSO A;  2A11 A;  2GHF A;  2EPC A;  2LTR A;  1A1G A;  1YUI A;  2DRP A;  4O5G A;  3KZY A;  5A2Q C;  2L3C A;  1HNW E;  2E72 A;  4LF7 E;  3RMP A;  1ZAA C;  2EM0 A;  4O43 A;  2LBS B;  4OX9 E;  1UN6 B;  2MDG A;  2N8X A;  2L6M A;  3O2R A;  4WSP A;  5A6K A;  4R2D A;  2MC5 A;  4KWY A;  3OTO E;  4DR4 E;  2BBG A;  4DKK A;  1DI2 A;  5A6J A;  5BR8 E;  4GKJ E;  5A69 A;  2DLK A;  5AC5 A;  2A25 A;  2KHX A;  2I13 A;  4P78 A;  2EN7 A;  3HPS A;  4B3T E;  1N32 E;  4DV1 E;  3C6M A;  4DV2 E;  5IXM B;  4DV4 E;  4ZYE A;  5AC4 A;  1MGT A;  4JI3 E;  4LF8 E;  2ADR A;  1B69 A;  3KWR A;  2V85 A;  2YT4 A;  2EN8 A;  4BCA A;  2YTP A;  2CPN A;  2FFL A;  4R2C A;  1IBL E;  2YTJ A;  5A6A A;  2NAB A;  2RS6 A;  3TQM A;  2WCC 3;  4FK5 C;  1EH6 A;  2ELY A;  4ZYH A;  2ENH A;  4KHP E;  3EPJ A;  4X66 E;  2ODR D;  5KL2 A;  3ADG A;  2ENC A;  4M2Z A;  4ZYD A;  2WBU A;  1N36 E;  2WBS A;  2UXC E;  4X8W A;  2EL5 A;  2DB2 A;  4X64 E;  2NUF A;  2EPO A;  3ADJ A;  1YFH A;  2EQ0 A;  1RMD A;  2EQ3 A;  2JPA A;  3P1X A;  5A6B D;  1X5W A;  1ZTD A;  2EM4 A;  1ZU1 A;  2EOJ A;  2EMI A;  3ADL A;  2BB8 A;  4LF5 E;  1YZ9 A;  3EPH A;  3ADI A;  1X47 A;  1J26 A;  1GZ6 A;  1GTK A;  1PJS A;  2B7V A;  4WSG A;  4NZV A;  4R2Q A;  2EPR A;  2B7T A;  4DV7 E;  4JI2 E;  2JY9 A;  3MHH C;  3IWC A;  1T4O A;  4K0K E;  1WXR A;  1A1H A;  1EH7 A;  2VQE E;  4LF4 E;  1HNZ E;  4ZYG A;  4B3M E;  2EOO A;  2B3T B;  1WHQ A;  1YYK A;  2EQ1 A;  2YRK A;  2V87 A;  1SFE A;  1DGC A;  2EN4 A;  2GSL A;  4DMI A;  2YPN A;  4WXD A;  3ZOQ B;  1KJK A;  2VRD A;  1O0W A;  1T4L B;  1JK1 A;  1JK2 A;  4R2A A;  2QVW A;  2V86 A;  2J7J A;  2ZM6 E;  1LLM C;  2ENA A;  5F3W A;  1IMU A;  1T38 A;  1RC7 A;  4R2P A;  2EZ6 A;  2DLQ A;  2EMY A;  4LF9 E;  2L3J A;  2EOR A;  1IBK E;  4MLV A;  3AUZ A;  2ELZ A;  4F9A B;  1AAY A;  1EKZ A;  4J8Z A;  2EMA A;  4O24 A;  1QU6 A;  2YTO A;  2EOX A;  4GEQ B;  3THO B;  4OUN A;  2EM9 A;  3IWD A;  3JU0 A;  2GPI A;  3HPZ A;  4WFT A;  2LMZ A;  4YHH E;  5IWA E;  2CSH A;  4L8N A;  4R2S A;  5LMN E;  4HEI A;  2KON A;  3VHT B;  2EM2 A;  1WRJ A;  3K6Q A;  4N4R B;  2YU8 A;  3THN A;  2UUB E;  1PJQ A;  2L92 A;  4LF6 E;  1N34 E;  1TN9 A;  4O4K A;  2CTD A;  2EM5 A;  3N3W A;  2RS7 A;  4BC9 A;  4B3S E;  1AH5 A;  1EH8 A;  2LRS A;  2YZT A;  1QNT A;  1FKA E;  4DV6 E;  4F6N A;  2EPK X;  1TF6 A;  5KL3 A;  3VK6 A;  4OOG C;  2EM3 A;  1G2D C;  4GKK E;  2N3G A;  2FGG A;  2EMB A;  5AE1 A;  3JAM C;  2YTN A;  2EE8 A;  2EPU A;  2UXD E;  1IBM E;  2JVA A;  2EPL X;  1TF3 A;  2EMC A;  2HC5 A;  2LVH A;  1A1J A;  4BHB A;  2L2M A;  2HJJ A;  2L2K B;  1PJT A;  5CFF E;  2V83 A;  4TUI A;  1T4N A;  2LJU A;  2JWO A;  2EL4 A;  4I8O A;  2RTX A;  2LV2 A;  4L5N C;  1A1F A;  2EOH A;  1GQE A;  2RSI A;  3J7A G;  1A1I A;  1ZBQ A;  3DJW A;  4DR5 E;  1X49 A;  1ZBT A;  4F54 A;  4JI0 E;  3RV0 A;  4GZN C;  3JTZ A;  2E5L E;  3J7Y p;  4BBY A;  4RH8 A;  4BS9 A;  1T39 A;  4JI5 E;  2I9I A;  3EQ1 A;  4IJD A;  2L2N A;  2EM7 A;  1I94 E;  1YPN A;  4Q35 B;  3F6H A;  5LMU E;  5T6J A;  2MDR A;  4HTG A;  2LUP B;  2EL6 A;  2YRH A;  1PKP A;  2DSY A;  2JYA A;  1XMQ E;  4R03 A;  4F6M A;  5LL6 R;  4X62 E;  2RSM A;  2R76 A;  2EPM X;  2RQL A;  2EML A;  2EMX A;  2JP9 A;  2JXP A;  4WPY A;  3M99 B;  4DR6 E;  2YTD A;  4R2R A;  4DR7 E;  1N33 E;  5AE3 A;  1J5E E;  2YRM A;  3IWB A;  4BC7 A;  1PDA A;  2EOZ A;  4WX9 A;  4F9C B;  3FIG A;  1YSA C;  1NCS A;  1A1K A;  5AE2 A;  2EJ4 A;  1IQO A;  5IV8 B;  3F6G A;  2Q8U A;  2WZO A;  5KL5 A;  1ZR9 A;  4M0V A;  1MEY C;  5DNY A;  4DV3 E;  4LFC E;  2MKD A;  3HQ1 A;  2EOS A;  2VQF E;  2YU5 A;  3J80 C;  3MHS C;  3HXL A;  2VE7 C;  2EPA A;  2IHR 1;  4NXM E;  1DQ3 A;  2CT1 A;  3C4T A;  1NEI A;  3AV0 A;  1BBG A;  4X9J A;  4LTY A;  2UUA E;  2EMF A;  2EPP A;  2EPZ A;  2EMH A;  4RHB B;  2LJH A;  2EOY A;  1STU A;  2EOI A;  4DR1 E;  4R2E A;  2EMW A;  5LLQ A;  3MSW A;  2EOE A;  2MC6 A;  1UBD C;  2NUE A;  3QG5 C;  3BID A;  3LML A;  2DMY A;  1X6H A;  2K4V A;  3HTX A;  2EOF A;  4LFB E;  1X6E A;  3EPK A;  4AQY E;  2PRT A;  2N3H A;  2EN6 A;  4JV5 E;  2EPX A;  2DGC A;  4WYQ B;  3T1H E;  1XNQ E;  1YYW A;  1X48 A;  2UU9 E;  2GLI A;  4F9B B;  2YSP A;  4JI7 E;  4JYA E;  2HHH E;  2EOM A;  2UXB E;  2EPN A;  5TSE A;  4DR3 E;  4LU9 A;  1KYQ A;  2EP3 A;  2EMZ A;  2EM6 A;  1P47 A;  2M7Q A;  2H36 X;  1I4S A;  1HR0 E;  5AAS A;  3OML A;  2DMI A;  2EWL A;  2EMK A;  3BBG A;  3J81 C;  2FTX B;  3RV1 A;  4BHC A;  2B9D A;  3BGH A;  4JI8 E;  4P7D A;  2YTE A;  2L33 A;  2YTF A;  1BB8 A;  1X6F A;  2YTI A;  3LLH A;  4R8O A;  1XNR E;  1HNX E;  4IS1 C;  3L00 A;  2EOQ A;  2NA2 A;  2RPC A;  5KL7 A;  2F8B A;  2MKN A;  2EN2 A;  3T1Y E;  2DIX A;  4JI1 E;  1WJP A;  1U61 A;  1A1L A;  2KOU A;  1FJG E;  2M1S A;  2JOB A;  3O2R B;  2LE2 A;  4BMJ A;  5FLX C;  1Z1B A;  2VF1 A;  2JOX A;  5KL6 A;  2M9A A;  5IT9 C;  4M9V C;  1X3C A;  4YY3 E;  2EM8 A;  4JI4 E;  3DF6 A;  4KZS A;  2K7I A;  4F2J C;  1N3G A;  1YYO A;  1WHN A;  2G7H A;  5A6B A;  4X65 E;  2V88 A;  2EN1 A;  2LCE A;  2EB1 A;  2FV4 B; 
#chains in the Genus database with same CATH homology
 2LTS A;  2ODR C;  4M2Z A;  2FGG A;  3C4B A;  5AE1 A;  3JAM C;  3MSW A;  2MC6 A;  3VYY A;  1N36 E;  2NUE A;  2UXD E;  2F4V E;  1IBM E;  1UIL A;  2JVA A;  2L8T A;  3LML A;  2DMY A;  3H09 A;  2JR1 A;  2UXC E;  4X8W A;  2K4V A;  2DB2 A;  3HTX A;  4LFB E;  4X64 E;  2NUF A;  1UHZ A;  4AQY E;  2L2M A;  4JI6 E;  4DUY E;  2L2K B;  3ADJ A;  2V8Q B;  2N3H A;  5CFF E;  1RC5 A;  2V83 A;  4TUI A;  4JV5 E;  1T4N A;  2JWO A;  3P1X A;  4Q28 A;  4WYQ B;  4DUZ E;  1XMO E;  4I8O A;  2LUQ A;  2RTX A;  3T1H E;  3VYX A;  3ADL A;  4L5N C;  1XNQ E;  1YYW A;  2V89 A;  4B3R E;  1GQE A;  1RQ0 A;  1X48 A;  1YZ9 A;  2UU9 E;  4F9B B;  4LF5 E;  3ADI A;  1X47 A;  2NUG A;  1GZ6 A;  1ZBQ A;  3DJW A;  4JI7 E;  4DR5 E;  2E1M A;  1X49 A;  1ZBT A;  4F54 A;  4JYA E;  2B7V A;  2HHH E;  4JI0 E;  3RV0 A;  1SR9 A;  2UXB E;  2UUC E;  2B7T A;  4DV7 E;  4JI2 E;  2JY9 A;  4DR3 E;  3JTZ A;  1J26 A;  4LFA E;  4LU9 A;  5ADZ A;  2E5L E;  3IWC A;  4BBY A;  2M4I A;  3J7Y p;  4DV5 E;  1JFZ A;  4M30 A;  1T4O A;  4BS9 A;  4DR2 E;  2M7Q A;  2H36 X;  1WXR A;  2VQE E;  4JI5 E;  4NXN E;  1I4S A;  4K0K E;  4LF4 E;  4TUG A;  1HR0 E;  2L2N A;  5AAS A;  1HNZ E;  3OML A;  4B3M E;  1I94 E;  4DV0 E;  4OOG C;  3F6H A;  2B3T B;  1WHQ A;  1YYK A;  2A11 A;  5T6J A;  2MDR A;  5LMU E;  2LUP B;  2LTR A;  2V87 A;  2EWL A;  3J81 C;  1PKP A;  2DSY A;  2GSL A;  4DMI A;  5A2Q C;  2L3C A;  1HNW E;  2FTX B;  3RV1 A;  2B9D A;  4R03 A;  1XMQ E;  4JI8 E;  3ZOQ B;  3RMP A;  5LL6 R;  4X62 E;  1O0W A;  1T4L B;  4P7D A;  2L33 A;  2RSM A;  2LBS B;  4OX9 E;  2QVW A;  2V86 A;  4WPY A;  2ZM6 E;  2L6M A;  4DR6 E;  3O2R A;  4WSP A;  3LLH A;  4DR7 E;  1N33 E;  4R8O A;  2MC5 A;  5AE3 A;  1J5E E;  5F3W A;  3IWB A;  3OTO E;  1RC7 A;  4BC7 A;  4DR4 E;  2EZ6 A;  1XNR E;  4DKK A;  1HNX E;  4LF9 E;  4F9C B;  2L3J A;  5BR8 E;  3FIG A;  1IBK E;  1DI2 A;  4GKJ E;  3AUZ A;  4F9A B;  1EKZ A;  4J8Z A;  2NA2 A;  5AE2 A;  1QU6 A;  2KHX A;  2WZO A;  3F6G A;  4P78 A;  4M0V A;  2F8B A;  3HPS A;  4B3T E;  4GEQ B;  1N32 E;  4OUN A;  3T1Y E;  2DIX A;  3IWD A;  4DV1 E;  4JI1 E;  5DNY A;  4DV3 E;  4DV2 E;  1U61 A;  3JU0 A;  4LFC E;  2KOU A;  3HPZ A;  3HQ1 A;  4WFT A;  1FJG E;  2VQF E;  4DV4 E;  2LMZ A;  4YHH E;  5IWA E;  2M1S A;  3J80 C;  2JOB A;  3HXL A;  4JI3 E;  4LF8 E;  3O2R B;  4L8N A;  2LE2 A;  4BMJ A;  5LMN E;  5FLX C;  2KON A;  2V85 A;  2YT4 A;  2VF1 A;  3K6Q A;  2JOX A;  3KWR A;  2VE7 C;  4BCA A;  2IHR 1;  4NXM E;  2CPN A;  1DQ3 A;  2UUB E;  2L92 A;  2FFL A;  5IT9 C;  1IBL E;  3C4T A;  4YY3 E;  4LF6 E;  1N34 E;  2RS6 A;  3AV0 A;  3N3W A;  2RS7 A;  3DF6 A;  4JI4 E;  4GKK E;  4BC9 A;  4KZS A;  4B3S E;  4LF7 E;  4KHP E;  4LTY A;  2UUA E;  2LRS A;  2YZT A;  1FKA E;  4X66 E;  4DV6 E;  3J7A G;  1YYO A;  1WHN A;  2G7H A;  2ODR D;  3ADG A;  4X65 E;  2V88 A;  3VK6 A;  2LJH A;  1STU A;  2EB1 A;  2FV4 B;  4DR1 E;  2N3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...