3C4TA

Structure of rnaseiiib and dsrna binding domains of mouse dicer
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
260
structure length
241
Chain Sequence
DAEKTLNHLISGFETFEKKINYRFKNKAYLLQAFTHASYHYNTITDYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVKFQLEKNEEDIEVPKAMGDIFESLAGAIYMDSGMSLEVVWQVYYPMMQPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endoribonuclease Dicer
publication title Structural and biochemical insights into the dicing mechanism of mouse Dicer: A conserved lysine is critical for dsRNA cleavage.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 73
structure length 241
sequence length 260
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 3c4tA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3c4tA02
2LTSA 4AQYE 2UU9E 2RTXA 4DV1E 2VQFE 2B7TA 3HTXA 3C4TA 4B3ME 2L2MA 2NA2A 2UUAE 2YT4A 5LMNE 4JI1E 4LF7E 2MDRA 4JI7E 1YYWA 1ZBTA 2LUPB 1FKAE 2VQEE 4M30A 1T4LB 1J5EE 2LJHA 2EZ6A 1YYKA 4GKKE 1O0WA 4JI6E 3J7Yp 2RS6A 4K0KE 2LRSA 2CPNA 1XNRE 3O2RB 3ADGA 4DR1E 4DV5E 2HHHE 4DV6E 1XMOE 2L3CA 4X8WA 3RV0A 4JI8E 3ADJA 2ZM6E 1RQ0A 3O2RA 3T1YE 4LF9E 1QU6A 2UXDE 1N32E 1U61A 3P1XA 1DI2A 1WHQA 4OUNA 4JI4E 3ADIA 4LFBE 1EKZA 1XNQE 1STUA 1HNWE 2N3GA 4LFCE 4DUYE 4DKKA 2UUBE 1X49A 1YYOA 1J26A 4DR3E 1HNXE 1T4NA 1UHZA 2E5LE 2NUGA 1N33E 3VYXA 2IHR1 4JI3E 1IBLE 1N36E 2RS7A 4DV0E 4DV7E 3T1HE 4OX9E 3ADLA 2L2KB 1PKPA 4DR4E 5IWAE 3VYYA 1X48A 2B3TB 2L2NA 2F4VE 4DR2E 4X64E 5BR8E 1RC7A 2LTRA 4DUZE 4JV5E 2DMYA 1HNZE 4WFTA 2B7VA 1UILA 1HR0E 4NXME 1FJGE 5CFFE 4YHHE 2QVWA 4WYQB 2JVAA 4KHPE 4NXNE 2KHXA 4X66E 1GQEA 4LF4E 2JY9A 1N34E 4LF6E 2DIXA 2RSMA 4YY3E 2LBSB 2UUCE 2UXBE 2UXCE 4JI5E 4GKJE 4B3RE 3LLHA 1T4OA 5LMUE 1RC5A 4JI2E 2GSLA 4X65E 2N3HA 4B3SE 4DR7E 2A11A 4JYAE 2FFLA 4M2ZA 1YZ9A 1IBKE 1XMQE 4LFAE 4LF5E 2DB2A 4JI0E 4DR6E 4B3TE 2NUEA 1JFZA 3OTOE 2NUFA 4X62E 1IBME 4DV4E 4DR5E 2EB1A 4OOGC 1I4SA 3RV1A 1WHNA 2LUQA 4DV3E 2L3JA 3C4BA 4DV2E 1I94E 4LF8E 1X47A 2L33A 3N3WA
chains in the Genus database with same CATH superfamily
4WXDA 1YUIA 1ZR9A 2EPZA 1G2FC 1GZ6A 2EOIA 2YRHA 2YWQA 2ODRD 3DF6A 3HTXA 2EN3A 2EPUA 5IT9C 4JI1E 1YFHA 2MDRA 1YYWA 5KL2A 4IJDA 2KONA 2EZ6A 1P47A 1O0WA 4Q35B 3J7Yp 2RQLA 2RS6A 3KZYA 1XNRE 4WSPA 2EMBA 4DV5E 2EOJA 3KWRA 2EMZA 4X8WA 3HXLA 3ADJA 2N8XA 1RQ0A 1UBDC 4X9JA 2EPRA 2WCC3 3T1YE 2EP3A 2EMGA 3P1XA 1JK1A 4LFBE 3IWDA 1PDAA 2MKNA 2WZOA 4DR3E 2RPCA 4ZYEA 3HQ1A 1F2IG 3VYXA 2IHR1 2EM6A 3UK3C 2EMIA 4P78A 3T1HE 3ADLA 2EJ4A 2LV2A 3J81C 1PKPA 2FV4B 3KZZA 2B3TB 5A6BD 4DR2E 2EPOA 5A2QC 4DUZE 2ELYA 1HNZE 2EMFA 1UILA 1N3GA 5CFFE 4YHHE 4WYQB 2GHFA 2EPPA 4R2SA 2EM4A 2KHXA 2EM5A 2JY9A 4GZNC 2D9HA 2DIXA 2EQ3A 2UUCE 2EOEA 2UXBE 1A1KA 2YTQA 3LLHA 1PJTA 3H09A 2V85A 2GSLA 2YTPA 5TSEA 4X65E 4MLQA 4B3SE 4DR7E 4L8NA 2FFLA 2EN7A 4O5GA 2YTDA 3BGHA 3M99B 1IBKE 4LFAE 1KJKA 4GEQB 4DR6E 2ENHA 2MKDA 4WSGA 2YSOA 1JFZA 2I9IA 4DV4E 4DR5E 2EB1A 4ZYDA 1TN9A 3RV1A 2LUQA 2CT1A 2VF1A 4ZYHA 4WX9A 4DV2E 4DV3E 1EH7A 1YPNA 2YTFA 1I94E 3TQMA 4LF8E 2EQ0A 2EOFA 3VK6A 2M4IA 3C6KA 5KL3A 1ZTDA 4WXCA 4B3ME 2L2MA 4BS9A 2LCEA 1X3CA 2YSPA 1UN6B 2ENAA 4R2QA 4LF7E 2H36X 4HEIA 2JPAA 1FKAE 2VQEE 4M30A 1T4LB 5LL6R 2EOSA 2ELZA 1X6HA 2EORA 2EMKA 4K0KE 3O2RB 2EPKX 2L3CA 1YUJA 4JI8E 3O2RA 4BHCA 2MC5A 5IXMB 2YRKA 1QU6A 5AE1A 1A1FA 2JP9A 4JI4E 3ADIA 2EOXA 2EOMA 2EN4A 1Z1BA 1HNWE 4O43A 2GPIA 3AUZA 4DUYE 4N4RB 2M9AA 1YYOA 2PRTA 1HNXE 2EPMX 1PJQA 3EPKA 3JAMC 1BB8A 1IQSA 2FGGA 2RS7A 4DV7E 2EE8A 2CSHA 2VE7C 4F6NA 2YTEA 2EOHA 3JU0A 4R2EA 2EMHA 3IWCA 2L2NA 3HPSA 2DRPA 4JV5E 2EL4A 1BBOA 1AAYA 1HR0E 2ENCA 2DLKA 1WJPA 5AC5A 4KHPE 2GLIA 2EOYA 2DSYA 3HPZA 2EN8A 1WRJA 4LF4E 4L5NC 3L00A 4LF6E 2J7JA 4BHBA 2EL5A 2UXCE 2RSIA 4JI5E 3F6GA 4B3RE 1T4OA 5LMUE 3ZOQB 4KZSA 2ODRC 2YTOA 2A11A 2EN6A 2EMAA 4M9VC 1A1JA 3ECRA 2EOOA 2MC6A 1AH5A 2L6MA 3EPHA 3EPJA 4IS1C 5A6BA 2JXPA 2V88A 2NUEA 5KL4A 2NUFA 1SR9A 4X62E 1ZAAC 2LVHA 1IBME 2EQ1A 4OOGC 1I4SA 4I8OA 2A25A 2L33A 3N3WA 2EM2A 2LTSA 5T6JA 4DV1E 4MLVA 2B7TA 4BCAA 4R03A 1G2DC 2NA2A 2YT4A 5LMNE 3MHSC 5A6AA 2KOUA 2YTIA 2YTNA 1J5EE 4GKKE 4Q28A 5AC4A 4JI6E 2HJJA 2M1SA 2CPNA 1DGCA 2HHHE 1ZBQA 2V87A 1XMOE 3THOB 1QNTA 2ZM6E 4LF9E 1A1HA 4R2CA 4F9AB 1DI2A 4OUNA 1X5WA 1XNQE 1STUA 2L92A 3K6QA 2DLQA 2EL6A 2N3GA 4LFCE 2EM9A 2LT7A 4DKKA 1J26A 4BC7A 2JWOA 3LMLA 2E5LE 1UHZA 1EH8A 1EH6A 1NEIA 4F9CB 1TF6A 2EPLX 2ADRA 4JI3E 1IBLE 2EMCA 1N36E 4DV0E 3BF2A 1NCSA 2EPNA 4DR4E 4BC9A 3VYYA 2K7IA 4X64E 3IWBA 2YTGA 4ZYGA 2LTRA 1TF3A 4F54A 4NZVA 4J8ZA 3OMLA 4WFTA 2B7VA 2MDGA 2DGCA 4NXME 5A6KA 2M7QA 2R76A 2JVAA 2EM7A 4NXNE 5AE2A 4X66E 1GQEA 1MGTA 1N34E 5AE3A 2EN2A 2JOXA 4YY3E 2EMXA 2YU5A 4NHRA 2E1MA 2LBSB 2Q8UA 4GKJE 2WBTA 2B9DA 2EMLA 4JI2E 5ADZA 3BBGA 3MHHC 1X6EA 2N3HA 4M2ZA 1YZ9A 2EOZA 4P7DA 1A1IA 2EM3A 4KWYA 5F3WA 1T38A 2F8BA 2DB2A 2HC5A 2I13A 4R2PA 4B3TE 1T39A 2V89A 2G7HA 4R8OA 1WHNA 3AV0A 2L3JA 2BBGA 1WXRA 4AQYE 2EOQA 2UU9E 4O24A 2RTXA 2VQFE 3EQ1A 4BBYA 1YSAC 2EPAA 4FK5C 3C4TA 2JYAA 2EPCA 3BIDA 2UUAE 2EM0A 2EM8A 1IQOA 4LU9A 2YTJA 4JI7E 4F6MA 1ZBTA 1PJSA 2LUPB 1A1LA 2LJHA 4RH8A 2WBUA 1YYKA 1RMDA 2HGHA 2LRSA 3ADGA 2R1FA 4DR1E 4DV6E 2EMWA 4F9BB 3QG5C 3RV0A 1SFEA 2YPNA 5KL7A 2UXDE 1N32E 4R2RA 1U61A 5KL5A 5A69A 1WHQA 2NABA 1B69A 1EKZA 2LJUA 2VRDA 5AASA 2UUBE 1X49A 3JTZA 2BB8A 2JOBA 4TUIA 1T4NA 4RHBB 2JR1A 5IV8B 2NUGA 2FTXB 1N33E 3FIGA 2V86A 3J80C 2YZTA 2CTDA 1L4SA 1JK2A 3VHTB 1IMUA 4OX9E 4WPYA 1DQ3A 2L2KB 1KYQA 5IWAE 1LLMC 2F4VE 1X48A 2DMIA 4BMJA 5BR8E 1RC7A 5KL6A 2LO3A 2DMYA 4TUGA 1GTKA 2V8QB 1FJGE 2LMZA 4DMIA 2QVWA 5FLXC 5LLQA 3C6MA 5DNYA 3MSWA 2WBSA 3F6HA 2RSMA 2LE2A 2YU8A 4LTYA 1RC5A 3DJWA 4M0VA 4JYAE 4R2DA 2YRMA 1XMQE 4LF5E 2EPXA 4F2JC 1X6FA 3EPLA 3RMPA 4R2AA 2L8TA 4JI0E 2EWLA 1BBGA 4O4KA 2E72A 4HTGA 2V83A 3OTOE 2EMYA 5A6JA 3J7AG 1A1GA 2EN1A 3C4BA 1X47A 1MEYC 2K4VA 1ZU1A 3THNA
chains in the Genus database with same CATH topology
1WXRA 5T6JA 2LTSA 4AQYE 2UU9E 2RTXA 4DV1E 2VQFE 4BBYA 4BCAA 1GZ6A 2B7TA 3DF6A 3HTXA 2ODRD 3C4TA 4B3ME 4R03A 2L2MA 2NA2A 4BS9A 2UUAE 2YT4A 5LMNE 4LU9A 5IT9C 4JI1E 4LF7E 2H36X 2MDRA 4JI7E 1YYWA 1ZBTA 2LUPB 1FKAE 2VQEE 2KOUA 4M30A 1T4LB 2KONA 5LL6R 1J5EE 2LJHA 2EZ6A 1YYKA 4GKKE 4Q28A 1O0WA 4JI6E 3J7Yp 2RS6A 4K0KE 2LRSA 2M1SA 2CPNA 1XNRE 3O2RB 4WSPA 3ADGA 4DR1E 4DV5E 2HHHE 1ZBQA 4DV6E 2V87A 1XMOE 3KWRA 4X8WA 4F9BB 3RV0A 4JI8E 2L3CA 3HXLA 3ADJA 2ZM6E 1RQ0A 3O2RA 2MC5A 3T1YE 4LF9E 1QU6A 2UXDE 1N32E 5AE1A 1U61A 3P1XA 4F9AB 1DI2A 1WHQA 4OUNA 4JI4E 3ADIA 4LFBE 3IWDA 1EKZA 1XNQE 1STUA 2L92A 3K6QA 1HNWE 2N3GA 5AASA 4LFCE 3AUZA 4DKKA 4DUYE 1X49A 2WZOA 2UUBE 3JTZA 1YYOA 1J26A 4DR3E 1HNXE 2JOBA 4BC7A 4TUIA 2JWOA 3LMLA 1T4NA 1UHZA 2JR1A 2E5LE 2NUGA 2FTXB 3HQ1A 1N33E 4F9CB 3JAMC 3VYXA 3FIGA 2IHR1 4JI3E 2V86A 3J80C 1IBLE 2YZTA 2FGGA 2RS7A 4DV0E 4DV7E 1N36E 4P78A 3T1HE 4OX9E 4WPYA 1DQ3A 3ADLA 2VE7C 2L2KB 3J81C 1PKPA 2FV4B 4DR4E 3JU0A 5IWAE 4BC9A 3VYYA 1X48A 2B3TB 2L2NA 3IWCA 4DR2E 2F4VE 4X64E 3IWBA 3HPSA 4BMJA 5BR8E 5A2QC 1RC7A 2LTRA 4F54A 4DUZE 4JV5E 2DMYA 1HNZE 4J8ZA 3OMLA 4WFTA 2B7VA 4TUGA 1UILA 1HR0E 2V8QB 4NXME 1FJGE 2LMZA 5CFFE 4YHHE 2M7QA 4DMIA 2QVWA 4WYQB 5FLXC 2JVAA 4KHPE 5DNYA 4NXNE 2DSYA 2KHXA 3MSWA 3HPZA 5AE2A 4X66E 1GQEA 4LF4E 2JY9A 1N34E 5AE3A 4L5NC 3F6HA 2JOXA 4LF6E 2DIXA 2RSMA 4YY3E 2E1MA 2LBSB 2UUCE 2LE2A 2UXBE 2UXCE 4JI5E 4GKJE 3F6GA 4B3RE 4LTYA 2B9DA 3LLHA 1T4OA 3H09A 5LMUE 1RC5A 2V85A 4JI2E 5ADZA 2GSLA 3ZOQB 4X65E 3DJWA 4KZSA 2N3HA 2ODRC 4B3SE 4DR7E 4M0VA 2A11A 4L8NA 2FFLA 4JYAE 4M2ZA 1YZ9A 1IBKE 4P7DA 1XMQE 2MC6A 4LFAE 2L6MA 4LF5E 3RMPA 5F3WA 2F8BA 2DB2A 4GEQB 2L8TA 4JI0E 4DR6E 2V88A 4B3TE 2EWLA 2NUEA 2V89A 1JFZA 2V83A 3OTOE 2NUFA 1SR9A 4X62E 2G7HA 4R8OA 1IBME 4DV4E 4DR5E 2EB1A 4OOGC 3J7AG 1I4SA 4I8OA 3RV1A 1WHNA 3AV0A 2LUQA 2VF1A 2L3JA 3C4BA 4DV2E 4DV3E 1I94E 1X47A 2L33A 4LF8E 3N3WA 2K4VA 3VK6A 2M4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LTS A;  4AQY E;  2UU9 E;  2RTX A;  4DV1 E;  2VQF E;  2B7T A;  3HTX A;  3C4T A;  4B3M E;  2L2M A;  2NA2 A;  2UUA E;  2YT4 A;  5LMN E;  4JI1 E;  4LF7 E;  2MDR A;  4JI7 E;  1YYW A;  1ZBT A;  2LUP B;  1FKA E;  2VQE E;  4M30 A;  1T4L B;  1J5E E;  2LJH A;  2EZ6 A;  1YYK A;  4GKK E;  1O0W A;  4JI6 E;  3J7Y p;  2RS6 A;  4K0K E;  2LRS A;  2CPN A;  1XNR E;  3O2R B;  3ADG A;  4DR1 E;  4DV5 E;  2HHH E;  4DV6 E;  1XMO E;  2L3C A;  4X8W A;  3RV0 A;  4JI8 E;  3ADJ A;  2ZM6 E;  1RQ0 A;  3O2R A;  3T1Y E;  4LF9 E;  1QU6 A;  2UXD E;  1N32 E;  1U61 A;  3P1X A;  1DI2 A;  1WHQ A;  4OUN A;  4JI4 E;  3ADI A;  4LFB E;  1EKZ A;  1XNQ E;  1STU A;  1HNW E;  2N3G A;  4LFC E;  4DUY E;  4DKK A;  2UUB E;  1X49 A;  1YYO A;  1J26 A;  4DR3 E;  1HNX E;  1T4N A;  1UHZ A;  2E5L E;  2NUG A;  1N33 E;  3VYX A;  2IHR 1;  4JI3 E;  1IBL E;  1N36 E;  2RS7 A;  4DV0 E;  4DV7 E;  3T1H E;  4OX9 E;  3ADL A;  2L2K B;  1PKP A;  4DR4 E;  5IWA E;  3VYY A;  1X48 A;  2B3T B;  2L2N A;  2F4V E;  4DR2 E;  4X64 E;  5BR8 E;  1RC7 A;  2LTR A;  4DUZ E;  4JV5 E;  2DMY A;  1HNZ E;  4WFT A;  2B7V A;  1UIL A;  1HR0 E;  4NXM E;  1FJG E;  5CFF E;  4YHH E;  2QVW A;  4WYQ B;  2JVA A;  4KHP E;  4NXN E;  2KHX A;  4X66 E;  1GQE A;  4LF4 E;  2JY9 A;  1N34 E;  4LF6 E;  2DIX A;  2RSM A;  4YY3 E;  2LBS B;  2UUC E;  2UXB E;  2UXC E;  4JI5 E;  4GKJ E;  4B3R E;  3LLH A;  1T4O A;  5LMU E;  1RC5 A;  4JI2 E;  2GSL A;  4X65 E;  2N3H A;  4B3S E;  4DR7 E;  2A11 A;  4JYA E;  2FFL A;  4M2Z A;  1YZ9 A;  1IBK E;  1XMQ E;  4LFA E;  4LF5 E;  2DB2 A;  4JI0 E;  4DR6 E;  4B3T E;  2NUE A;  1JFZ A;  3OTO E;  2NUF A;  4X62 E;  1IBM E;  4DV4 E;  4DR5 E;  2EB1 A;  4OOG C;  1I4S A;  3RV1 A;  1WHN A;  2LUQ A;  4DV3 E;  2L3J A;  3C4B A;  4DV2 E;  1I94 E;  4LF8 E;  1X47 A;  2L33 A;  3N3W A; 
#chains in the Genus database with same CATH topology
 4WXD A;  1YUI A;  1ZR9 A;  2EPZ A;  1G2F C;  1GZ6 A;  2EOI A;  2YRH A;  2YWQ A;  2ODR D;  3DF6 A;  3HTX A;  2EN3 A;  2EPU A;  5IT9 C;  4JI1 E;  1YFH A;  2MDR A;  1YYW A;  5KL2 A;  4IJD A;  2KON A;  2EZ6 A;  1P47 A;  1O0W A;  4Q35 B;  3J7Y p;  2RQL A;  2RS6 A;  3KZY A;  1XNR E;  4WSP A;  2EMB A;  4DV5 E;  2EOJ A;  3KWR A;  2EMZ A;  4X8W A;  3HXL A;  3ADJ A;  2N8X A;  1RQ0 A;  1UBD C;  4X9J A;  2EPR A;  2WCC 3;  3T1Y E;  2EP3 A;  2EMG A;  3P1X A;  1JK1 A;  4LFB E;  3IWD A;  1PDA A;  2MKN A;  2WZO A;  4DR3 E;  2RPC A;  4ZYE A;  3HQ1 A;  1F2I G;  3VYX A;  2IHR 1;  2EM6 A;  3UK3 C;  2EMI A;  4P78 A;  3T1H E;  3ADL A;  2EJ4 A;  2LV2 A;  3J81 C;  1PKP A;  2FV4 B;  3KZZ A;  2B3T B;  5A6B D;  4DR2 E;  2EPO A;  5A2Q C;  4DUZ E;  2ELY A;  1HNZ E;  2EMF A;  1UIL A;  1N3G A;  5CFF E;  4YHH E;  4WYQ B;  2GHF A;  2EPP A;  4R2S A;  2EM4 A;  2KHX A;  2EM5 A;  2JY9 A;  4GZN C;  2D9H A;  2DIX A;  2EQ3 A;  2UUC E;  2EOE A;  2UXB E;  1A1K A;  2YTQ A;  3LLH A;  1PJT A;  3H09 A;  2V85 A;  2GSL A;  2YTP A;  5TSE A;  4X65 E;  4MLQ A;  4B3S E;  4DR7 E;  4L8N A;  2FFL A;  2EN7 A;  4O5G A;  2YTD A;  3BGH A;  3M99 B;  1IBK E;  4LFA E;  1KJK A;  4GEQ B;  4DR6 E;  2ENH A;  2MKD A;  4WSG A;  2YSO A;  1JFZ A;  2I9I A;  4DV4 E;  4DR5 E;  2EB1 A;  4ZYD A;  1TN9 A;  3RV1 A;  2LUQ A;  2CT1 A;  2VF1 A;  4ZYH A;  4WX9 A;  4DV2 E;  4DV3 E;  1EH7 A;  1YPN A;  2YTF A;  1I94 E;  3TQM A;  4LF8 E;  2EQ0 A;  2EOF A;  3VK6 A;  2M4I A;  3C6K A;  5KL3 A;  1ZTD A;  4WXC A;  4B3M E;  2L2M A;  4BS9 A;  2LCE A;  1X3C A;  2YSP A;  1UN6 B;  2ENA A;  4R2Q A;  4LF7 E;  2H36 X;  4HEI A;  2JPA A;  1FKA E;  2VQE E;  4M30 A;  1T4L B;  5LL6 R;  2EOS A;  2ELZ A;  1X6H A;  2EOR A;  2EMK A;  4K0K E;  3O2R B;  2EPK X;  2L3C A;  1YUJ A;  4JI8 E;  3O2R A;  4BHC A;  2MC5 A;  5IXM B;  2YRK A;  1QU6 A;  5AE1 A;  1A1F A;  2JP9 A;  4JI4 E;  3ADI A;  2EOX A;  2EOM A;  2EN4 A;  1Z1B A;  1HNW E;  4O43 A;  2GPI A;  3AUZ A;  4DUY E;  4N4R B;  2M9A A;  1YYO A;  2PRT A;  1HNX E;  2EPM X;  1PJQ A;  3EPK A;  3JAM C;  1BB8 A;  1IQS A;  2FGG A;  2RS7 A;  4DV7 E;  2EE8 A;  2CSH A;  2VE7 C;  4F6N A;  2YTE A;  2EOH A;  3JU0 A;  4R2E A;  2EMH A;  3IWC A;  2L2N A;  3HPS A;  2DRP A;  4JV5 E;  2EL4 A;  1BBO A;  1AAY A;  1HR0 E;  2ENC A;  2DLK A;  1WJP A;  5AC5 A;  4KHP E;  2GLI A;  2EOY A;  2DSY A;  3HPZ A;  2EN8 A;  1WRJ A;  4LF4 E;  4L5N C;  3L00 A;  4LF6 E;  2J7J A;  4BHB A;  2EL5 A;  2UXC E;  2RSI A;  4JI5 E;  3F6G A;  4B3R E;  1T4O A;  5LMU E;  3ZOQ B;  4KZS A;  2ODR C;  2YTO A;  2A11 A;  2EN6 A;  2EMA A;  4M9V C;  1A1J A;  3ECR A;  2EOO A;  2MC6 A;  1AH5 A;  2L6M A;  3EPH A;  3EPJ A;  4IS1 C;  5A6B A;  2JXP A;  2V88 A;  2NUE A;  5KL4 A;  2NUF A;  1SR9 A;  4X62 E;  1ZAA C;  2LVH A;  1IBM E;  2EQ1 A;  4OOG C;  1I4S A;  4I8O A;  2A25 A;  2L33 A;  3N3W A;  2EM2 A;  2LTS A;  5T6J A;  4DV1 E;  4MLV A;  2B7T A;  4BCA A;  4R03 A;  1G2D C;  2NA2 A;  2YT4 A;  5LMN E;  3MHS C;  5A6A A;  2KOU A;  2YTI A;  2YTN A;  1J5E E;  4GKK E;  4Q28 A;  5AC4 A;  4JI6 E;  2HJJ A;  2M1S A;  2CPN A;  1DGC A;  2HHH E;  1ZBQ A;  2V87 A;  1XMO E;  3THO B;  1QNT A;  2ZM6 E;  4LF9 E;  1A1H A;  4R2C A;  4F9A B;  1DI2 A;  4OUN A;  1X5W A;  1XNQ E;  1STU A;  2L92 A;  3K6Q A;  2DLQ A;  2EL6 A;  2N3G A;  4LFC E;  2EM9 A;  2LT7 A;  4DKK A;  1J26 A;  4BC7 A;  2JWO A;  3LML A;  2E5L E;  1UHZ A;  1EH8 A;  1EH6 A;  1NEI A;  4F9C B;  1TF6 A;  2EPL X;  2ADR A;  4JI3 E;  1IBL E;  2EMC A;  1N36 E;  4DV0 E;  3BF2 A;  1NCS A;  2EPN A;  4DR4 E;  4BC9 A;  3VYY A;  2K7I A;  4X64 E;  3IWB A;  2YTG A;  4ZYG A;  2LTR A;  1TF3 A;  4F54 A;  4NZV A;  4J8Z A;  3OML A;  4WFT A;  2B7V A;  2MDG A;  2DGC A;  4NXM E;  5A6K A;  2M7Q A;  2R76 A;  2JVA A;  2EM7 A;  4NXN E;  5AE2 A;  4X66 E;  1GQE A;  1MGT A;  1N34 E;  5AE3 A;  2EN2 A;  2JOX A;  4YY3 E;  2EMX A;  2YU5 A;  4NHR A;  2E1M A;  2LBS B;  2Q8U A;  4GKJ E;  2WBT A;  2B9D A;  2EML A;  4JI2 E;  5ADZ A;  3BBG A;  3MHH C;  1X6E A;  2N3H A;  4M2Z A;  1YZ9 A;  2EOZ A;  4P7D A;  1A1I A;  2EM3 A;  4KWY A;  5F3W A;  1T38 A;  2F8B A;  2DB2 A;  2HC5 A;  2I13 A;  4R2P A;  4B3T E;  1T39 A;  2V89 A;  2G7H A;  4R8O A;  1WHN A;  3AV0 A;  2L3J A;  2BBG A;  1WXR A;  4AQY E;  2EOQ A;  2UU9 E;  4O24 A;  2RTX A;  2VQF E;  3EQ1 A;  4BBY A;  1YSA C;  2EPA A;  4FK5 C;  3C4T A;  2JYA A;  2EPC A;  3BID A;  2UUA E;  2EM0 A;  2EM8 A;  1IQO A;  4LU9 A;  2YTJ A;  4JI7 E;  4F6M A;  1ZBT A;  1PJS A;  2LUP B;  1A1L A;  2LJH A;  4RH8 A;  2WBU A;  1YYK A;  1RMD A;  2HGH A;  2LRS A;  3ADG A;  2R1F A;  4DR1 E;  4DV6 E;  2EMW A;  4F9B B;  3QG5 C;  3RV0 A;  1SFE A;  2YPN A;  5KL7 A;  2UXD E;  1N32 E;  4R2R A;  1U61 A;  5KL5 A;  5A69 A;  1WHQ A;  2NAB A;  1B69 A;  1EKZ A;  2LJU A;  2VRD A;  5AAS A;  2UUB E;  1X49 A;  3JTZ A;  2BB8 A;  2JOB A;  4TUI A;  1T4N A;  4RHB B;  2JR1 A;  5IV8 B;  2NUG A;  2FTX B;  1N33 E;  3FIG A;  2V86 A;  3J80 C;  2YZT A;  2CTD A;  1L4S A;  1JK2 A;  3VHT B;  1IMU A;  4OX9 E;  4WPY A;  1DQ3 A;  2L2K B;  1KYQ A;  5IWA E;  1LLM C;  2F4V E;  1X48 A;  2DMI A;  4BMJ A;  5BR8 E;  1RC7 A;  5KL6 A;  2LO3 A;  2DMY A;  4TUG A;  1GTK A;  2V8Q B;  1FJG E;  2LMZ A;  4DMI A;  2QVW A;  5FLX C;  5LLQ A;  3C6M A;  5DNY A;  3MSW A;  2WBS A;  3F6H A;  2RSM A;  2LE2 A;  2YU8 A;  4LTY A;  1RC5 A;  3DJW A;  4M0V A;  4JYA E;  4R2D A;  2YRM A;  1XMQ E;  4LF5 E;  2EPX A;  4F2J C;  1X6F A;  3EPL A;  3RMP A;  4R2A A;  2L8T A;  4JI0 E;  2EWL A;  1BBG A;  4O4K A;  2E72 A;  4HTG A;  2V83 A;  3OTO E;  2EMY A;  5A6J A;  3J7A G;  1A1G A;  2EN1 A;  3C4B A;  1X47 A;  1MEY C;  2K4V A;  1ZU1 A;  3THN A; 
#chains in the Genus database with same CATH homology
 1WXR A;  5T6J A;  2LTS A;  4AQY E;  2UU9 E;  2RTX A;  4DV1 E;  2VQF E;  4BBY A;  4BCA A;  1GZ6 A;  2B7T A;  3DF6 A;  3HTX A;  2ODR D;  3C4T A;  4B3M E;  4R03 A;  2L2M A;  2NA2 A;  4BS9 A;  2UUA E;  2YT4 A;  5LMN E;  4LU9 A;  5IT9 C;  4JI1 E;  4LF7 E;  2H36 X;  2MDR A;  4JI7 E;  1YYW A;  1ZBT A;  2LUP B;  1FKA E;  2VQE E;  2KOU A;  4M30 A;  1T4L B;  2KON A;  5LL6 R;  1J5E E;  2LJH A;  2EZ6 A;  1YYK A;  4GKK E;  4Q28 A;  1O0W A;  4JI6 E;  3J7Y p;  2RS6 A;  4K0K E;  2LRS A;  2M1S A;  2CPN A;  1XNR E;  3O2R B;  4WSP A;  3ADG A;  4DR1 E;  4DV5 E;  2HHH E;  1ZBQ A;  4DV6 E;  2V87 A;  1XMO E;  3KWR A;  4X8W A;  4F9B B;  3RV0 A;  4JI8 E;  2L3C A;  3HXL A;  3ADJ A;  2ZM6 E;  1RQ0 A;  3O2R A;  2MC5 A;  3T1Y E;  4LF9 E;  1QU6 A;  2UXD E;  1N32 E;  5AE1 A;  1U61 A;  3P1X A;  4F9A B;  1DI2 A;  1WHQ A;  4OUN A;  4JI4 E;  3ADI A;  4LFB E;  3IWD A;  1EKZ A;  1XNQ E;  1STU A;  2L92 A;  3K6Q A;  1HNW E;  2N3G A;  5AAS A;  4LFC E;  3AUZ A;  4DKK A;  4DUY E;  1X49 A;  2WZO A;  2UUB E;  3JTZ A;  1YYO A;  1J26 A;  4DR3 E;  1HNX E;  2JOB A;  4BC7 A;  4TUI A;  2JWO A;  3LML A;  1T4N A;  1UHZ A;  2JR1 A;  2E5L E;  2NUG A;  2FTX B;  3HQ1 A;  1N33 E;  4F9C B;  3JAM C;  3VYX A;  3FIG A;  2IHR 1;  4JI3 E;  2V86 A;  3J80 C;  1IBL E;  2YZT A;  2FGG A;  2RS7 A;  4DV0 E;  4DV7 E;  1N36 E;  4P78 A;  3T1H E;  4OX9 E;  4WPY A;  1DQ3 A;  3ADL A;  2VE7 C;  2L2K B;  3J81 C;  1PKP A;  2FV4 B;  4DR4 E;  3JU0 A;  5IWA E;  4BC9 A;  3VYY A;  1X48 A;  2B3T B;  2L2N A;  3IWC A;  4DR2 E;  2F4V E;  4X64 E;  3IWB A;  3HPS A;  4BMJ A;  5BR8 E;  5A2Q C;  1RC7 A;  2LTR A;  4F54 A;  4DUZ E;  4JV5 E;  2DMY A;  1HNZ E;  4J8Z A;  3OML A;  4WFT A;  2B7V A;  4TUG A;  1UIL A;  1HR0 E;  2V8Q B;  4NXM E;  1FJG E;  2LMZ A;  5CFF E;  4YHH E;  2M7Q A;  4DMI A;  2QVW A;  4WYQ B;  5FLX C;  2JVA A;  4KHP E;  5DNY A;  4NXN E;  2DSY A;  2KHX A;  3MSW A;  3HPZ A;  5AE2 A;  4X66 E;  1GQE A;  4LF4 E;  2JY9 A;  1N34 E;  5AE3 A;  4L5N C;  3F6H A;  2JOX A;  4LF6 E;  2DIX A;  2RSM A;  4YY3 E;  2E1M A;  2LBS B;  2UUC E;  2LE2 A;  2UXB E;  2UXC E;  4JI5 E;  4GKJ E;  3F6G A;  4B3R E;  4LTY A;  2B9D A;  3LLH A;  1T4O A;  3H09 A;  5LMU E;  1RC5 A;  2V85 A;  4JI2 E;  5ADZ A;  2GSL A;  3ZOQ B;  4X65 E;  3DJW A;  4KZS A;  2N3H A;  2ODR C;  4B3S E;  4DR7 E;  4M0V A;  2A11 A;  4L8N A;  2FFL A;  4JYA E;  4M2Z A;  1YZ9 A;  1IBK E;  4P7D A;  1XMQ E;  2MC6 A;  4LFA E;  2L6M A;  4LF5 E;  3RMP A;  5F3W A;  2F8B A;  2DB2 A;  4GEQ B;  2L8T A;  4JI0 E;  4DR6 E;  2V88 A;  4B3T E;  2EWL A;  2NUE A;  2V89 A;  1JFZ A;  2V83 A;  3OTO E;  2NUF A;  1SR9 A;  4X62 E;  2G7H A;  4R8O A;  1IBM E;  4DV4 E;  4DR5 E;  2EB1 A;  4OOG C;  3J7A G;  1I4S A;  4I8O A;  3RV1 A;  1WHN A;  3AV0 A;  2LUQ A;  2VF1 A;  2L3J A;  3C4B A;  4DV2 E;  4DV3 E;  1I94 E;  1X47 A;  2L33 A;  4LF8 E;  3N3W A;  2K4V A;  3VK6 A;  2M4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...