2EZ6A

Crystal structure of aquifex aeolicus rnase iii (d44n) complexed with product of double-stranded rna processing
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
218
structure length
218
Chain Sequence
MLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGNALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords 28-MER
publication title Structural Insight into the Mechanism of Double-Stranded RNA Processing by Ribonuclease III.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 80
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2005-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 2ez6A01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ez6A02
1XMQE 4LF8E 4B3RE 1RC7A 4LF6E 5IWAE 1JFZA 1N32E 1STUA 2UXDE 4JI2E 4M30A 2LUPB 2JVAA 2L2KB 4DR5E 4OOGC 1DI2A 1WHQA 2LJHA 4JI7E 3ADJA 2UU9E 4DR2E 2L3JA 5LMUE 1X48A 2NUFA 4WYQB 1RQ0A 2NA2A 3RV1A 1YYOA 4B3ME 1J26A 4DV6E 4LF7E 2MDRA 2RSMA 3ADGA 1XMOE 2A11A 1YYWA 1T4OA 1IBLE 4JI3E 4DKKA 1ZBTA 2NUGA 3RV0A 4X8WA 3C4TA 4B3SE 4LF5E 2DIXA 4DV2E 2UXCE 4DUYE 2QVWA 4NXME 2FFLA 1YZ9A 2JY9A 5CFFE 4LFAE 4DR1E 1UILA 3ADLA 4X64E 4LFCE 2VQFE 2LBSB 2L2NA 2LUQA 2LTRA 2YT4A 1FKAE 1T4LB 2RS7A 4X62E 1YYKA 2L3CA 4AQYE 1N34E 3P1XA 4DV5E 5BR8E 4JI4E 4JI0E 2UUAE 4X66E 1UHZA 1EKZA 1HNXE 4JI6E 3OTOE 2UXBE 4DR3E 2UUBE 4M2ZA 1I4SA 4B3TE 1RC5A 1IBME 4LF9E 4DV4E 4LFBE 4GKJE 4DR4E 2CPNA 4DUZE 3O2RA 3T1YE 1J5EE 4WFTA 1HR0E 1XNQE 1HNZE 3C4BA 4YY3E 5LMNE 4DV1E 2N3GA 1PKPA 3VYXA 1X47A 2DB2A 4JI5E 1O0WA 3N3WA 3O2RB 2DMYA 3VYYA 2UUCE 4NXNE 2RS6A 1FJGE 4DV3E 2RTXA 1QU6A 3LLHA 1N36E 4X65E 4DR6E 4JYAE 2ZM6E 2F4VE 3HTXA 4JI1E 2NUEA 2IHR1 1GQEA 2L33A 2B7TA 4JI8E 4OUNA 2B7VA 1U61A 1WHNA 1X49A 2N3HA 4K0KE 1N33E 1IBKE 4JV5E 2B3TB 1T4NA 3T1HE 2L2MA 1XNRE 4LF4E 2KHXA 2VQEE 4OX9E 2EZ6A 4DV7E 3ADIA 2E5LE 4KHPE 4DR7E 2LRSA 1HNWE 3J7Yp 2GSLA 4DV0E 2EB1A 1I94E 4GKKE 2HHHE 4YHHE 2LTSA
chains in the Genus database with same CATH superfamily
4F2JC 4FK5C 4B3RE 4LF6E 2LO3A 2VRDA 2JVAA 2L2KB 4WPYA 2F8BA 5A69A 4LU9A 2LJHA 2RSIA 2YTFA 2EPMX 1RQ0A 4B3ME 4LF7E 2K7IA 4BC9A 2MDRA 1YYWA 1T4OA 2EPUA 1JK2A 2A25A 2YRMA 4DUYE 4R2AA 4NXME 2B9DA 2EN4A 1KJKA 2WZOA 2MC5A 4R2RA 4X64E 4BHCA 2VQFE 2LBSB 2LUQA 2YT4A 2LTRA 2G7HA 2JYAA 4AQYE 4LTYA 1YPNA 1RMDA 1YUIA 3VK6A 4JI4E 3BGHA 2CTDA 4ZYEA 4JI0E 1X6EA 2UUAE 1UHZA 4JI6E 2EMIA 4B3TE 5A6BD 4LF9E 3LMLA 2YTJA 4GKJE 3OMLA 2EPCA 5AE1A 1QNTA 1PKPA 5A6AA 3VYXA 1X47A 3J7AG 2EWLA 2DB2A 4JI5E 1O0WA 2DMYA 3IWBA 5KL6A 2YU8A 2YPNA 2RS6A 4NXNE 1FJGE 1A1FA 3C6MA 4DR6E 1N36E 3HTXA 4BCAA 4P7DA 2L6MA 4JI8E 4OUNA 2B7VA 2EN6A 1U61A 1X49A 4TUIA 2N3HA 4K0KE 4O24A 1A1LA 4JV5E 2ODRC 2YTDA 1GTKA 1XNRE 2VQEE 4OX9E 2EMKA 2EQ3A 2EZ6A 2YTOA 2V8QB 4IJDA 2YRHA 4WSGA 4F54A 2LRSA 1WRJA 4F9BB 2EB1A 2EP3A 2VE7C 1RC7A 2JWOA 3DF6A 5IWAE 4R8OA 1ZAAC 1N32E 2DSYA 2LUPB 2EN2A 5KL3A 2EL4A 4R2CA 2LE2A 2J7JA 3ADJA 4F6MA 4DR2E 3AUZA 3VHTB 3HXLA 3EPLA 1DQ3A 2EPAA 2GHFA 5F3WA 2JPAA 1XMOE 3J80C 3THOB 4DKKA 1ZBTA 2V83A 4O4KA 4B3SE 4DV2E 2UXCE 3THNA 2FFLA 1YZ9A 2JY9A 3ADLA 2R1FA 4WSPA 1A1IA 1N3GA 2L2NA 4P78A 1YYKA 2NABA 3P1XA 2EL5A 1NEIA 5LLQA 5TSEA 1JK1A 2EPLX 2YWQA 1ZTDA 4X66E 2LV2A 2EMCA 1EKZA 5KL4A 3JU0A 3C6KA 2UUBE 1PJQA 2FV4B 2YTPA 1F2IG 2EM5A 1IBME 3J81C 2EPXA 2EM6A 1UBDC 4DR4E 2EJ4A 2CPNA 2EM2A 3TQMA 3FIGA 4GEQB 2EM4A 3O2RA 2EL6A 2EMYA 2K4VA 2JOXA 4HEIA 4BBYA 4ZYHA 1BB8A 4WFTA 5AC4A 1HR0E 1XNQE 5LMNE 2N3GA 2KONA 2YRKA 5AASA 2BBGA 2EM8A 3LLHA 4JYAE 2EMZA 2NUEA 1GQEA 4BS9A 2B7TA 4WXCA 2GLIA 5LL6R 5AC5A 2EM7A 3BBGA 1EH7A 1A1KA 4L8NA 2WBUA 1T4NA 2EOJA 2L2MA 1ZBQA 2EOQA 1KYQA 3EPKA 4R2EA 2LT7A 4R2QA 2BB8A 2FTXB 2D9HA 5IXMB 2E5LE 5A6JA 2EPNA 2EMFA 2V85A 2EN1A 2DLKA 2ELZA 2ODRD 4GKKE 2RPCA 1IQSA 2HHHE 4YHHE 2I9IA 4LF8E 2GPIA 1T38A 1JFZA 4MLVA 1T39A 2UXDE 1TN9A 4JI2E 4M30A 2KOUA 4R2DA 2HJJA 1WXRA 4IS1C 1DI2A 1PJTA 1SR9A 1WHQA 1Z1BA 2Q8UA 4JI7E 1A1GA 2HGHA 2UU9E 2YTIA 5KL2A 4WX9A 2DMIA 5LMUE 4M0VA 2NUFA 2EMBA 2M7QA 1J26A 4Q28A 2RSMA 3ADGA 2NUGA 3BF2A 1EH6A 4X8WA 4O43A 2I13A 1L4SA 4N4RB 2QVWA 5CFFE 5AE3A 4LFAE 2HC5A 3M99B 1AAYA 4R03A 4X9JA 2RS7A 3BIDA 4F6NA 4X62E 2ENCA 1X6HA 3IWDA 4J8ZA 4TUGA 2PRTA 5AE2A 5BR8E 1GZ6A 1X5WA 1EH8A 5DNYA 2EE8A 1HNXE 2L8TA 1TF6A 2ADRA 3KWRA 2MDGA 3OTOE 2YSPA 2YSOA 4WXDA 1BBOA 1I4SA 1RC5A 2EORA 2YZTA 4DV4E 4R2PA 2YTNA 1YSAC 1ZU1A 3EQ1A 3KZYA 1G2FC 2V86A 2V87A 2EOYA 3T1YE 4KZSA 4BC7A 1J5EE 2EPOA 1HNZE 3MHHC 3N3WA 3HQ1A 1YUJA 2R76A 2EMGA 1DGCA 2RTXA 1QU6A 2LMZA 4NZVA 4ZYDA 2JP9A 2F4VE 3HPSA 2IHR1 2L92A 2L33A 2EMLA 1MGTA 2RQLA 2YTEA 4I8OA 1WHNA 2EPZA 1BBGA 1X6FA 2LJUA 1N33E 2JOBA 1PJSA 3H09A 1P47A 2EOIA 2WBTA 5T6JA 4BMJA 1YFHA 1G2DC 1A1JA 3ADIA 2FGGA 2EMHA 2EQ1A 3F6HA 1HNWE 3J7Yp 2E1MA 2EOXA 5A2QC 4BHBA 4DV0E 1I94E 2EOFA 2H36X 2LTSA 1XMQE 2M9AA 3EPHA 1WJPA 5IT9C 2EPRA 2EN3A 3ZOQB 1STUA 5A6BA 2WCC3 1B69A 2EMAA 4R2SA 4DR5E 4OOGC 3EPJA 2E72A 2L3JA 1X48A 3KZZA 4WYQB 2NA2A 3RV1A 1YYOA 4F9CB 4DV6E 3IWCA 2MKDA 1PDAA 3F6GA 3MSWA 1A1HA 2MKNA 4HTGA 2A11A 1IBLE 3L00A 4JI3E 3RV0A 3C4TA 2LCEA 2DIXA 2LVHA 4LF5E 1AH5A 4DMIA 2CT1A 4DR1E 1UILA 4LFCE 2EM3A 1FKAE 3MHSC 2EOOA 1T4LB 4M9VC 2L3CA 1N34E 1IQOA 1SFEA 3JAMC 2JR1A 4DV5E 4RH8A 2EOEA 2EMXA 1IMUA 2V89A 4ZYGA 2EN8A 2V88A 2M1SA 2UXBE 4DR3E 4M2ZA 2EMWA 3JTZA 2EM9A 3RMPA 2EN7A 2EQ0A 4LFBE 2YTQA 2ELYA 2M4IA 2VF1A 1MEYC 2EPPA 4DUZE 1X3CA 3ECRA 4Q35B 3AV0A 3C4BA 4YY3E 4DV1E 2ENAA 2EOZA 4GZNC 2DGCA 3VYYA 3O2RB 4L5NC 2JXPA 2UUCE 1TF3A 2EOMA 4DV3E 4X65E 2ZM6E 5IV8B 3DJWA 3UK3C 2YTGA 5FLXC 4JI1E 1UN6B 1LLMC 5ADZA 5KL5A 2YU5A 2CSHA 3QG5C 2DRPA 2DLQA 1ZR9A 1IBKE 2EM0A 2B3TB 3T1HE 5A6KA 4RHBB 4O5GA 4KWYA 4LF4E 3HPZA 4NHRA 4F9AB 2KHXA 2MC6A 2EOSA 2EPKX 5KL7A 4DV7E 2ENHA 4KHPE 4DR7E 2WBSA 1NCSA 2N8XA 2GSLA 2EOHA 4MLQA 3K6QA
chains in the Genus database with same CATH topology
1XMQE 4LF8E 2VE7C 4B3RE 1RC7A 2JWOA 4LF6E 3DF6A 5IWAE 4R8OA 5IT9C 1JFZA 1N32E 3ZOQB 1STUA 2UXDE 4JI2E 4M30A 2DSYA 2KOUA 2LUPB 2JVAA 2L2KB 4WPYA 1WXRA 4DR5E 4OOGC 2F8BA 1SR9A 1WHQA 2LJHA 4LU9A 1DI2A 4JI7E 2LE2A 3ADJA 2UU9E 4DR2E 2L3JA 5LMUE 1X48A 3AUZA 4M0VA 2NUFA 4WYQB 3HXLA 2M7QA 1RQ0A 2NA2A 1DQ3A 3RV1A 1YYOA 4F9CB 4B3ME 1J26A 4DV6E 4Q28A 3IWCA 4LF7E 4BC9A 2MDRA 3F6GA 3MSWA 5F3WA 2RSMA 3ADGA 1XMOE 2A11A 1YYWA 3J80C 1T4OA 1IBLE 4JI3E 4DKKA 1ZBTA 2NUGA 3RV0A 4X8WA 3C4TA 2V83A 4B3SE 4LF5E 2DIXA 4DV2E 2UXCE 4DUYE 2QVWA 4DMIA 2B9DA 4NXME 2FFLA 1YZ9A 2WZOA 2JY9A 5CFFE 2MC5A 5AE3A 4LFAE 4DR1E 1UILA 3ADLA 4X64E 4LFCE 4WSPA 4R03A 2VQFE 2LBSB 2L2NA 2LUQA 2LTRA 2YT4A 4P78A 1FKAE 2G7HA 1T4LB 2RS7A 4X62E 1YYKA 2L3CA 4AQYE 1N34E 3JAMC 4LTYA 2JR1A 3P1XA 3IWDA 4J8ZA 3VK6A 4TUGA 5AE2A 4DV5E 5BR8E 4JI4E 1GZ6A 2V89A 4JI0E 2UUAE 4X66E 1UHZA 5DNYA 1EKZA 1HNXE 2L8TA 3KWRA 4JI6E 3OTOE 2V88A 2M1SA 3JU0A 2UXBE 4DR3E 2UUBE 2FV4B 4M2ZA 1I4SA 4B3TE 3JTZA 1RC5A 1IBME 4LF9E 2YZTA 3LMLA 4DV4E 3J81C 3RMPA 4LFBE 4GKJE 2M4IA 2VF1A 3OMLA 4DR4E 2CPNA 3FIGA 4GEQB 4DUZE 3O2RA 2K4VA 2V86A 2V87A 2JOXA 4BBYA 5AE1A 4KZSA 4BC7A 3T1YE 1J5EE 4WFTA 1HR0E 1XNQE 3AV0A 3C4BA 4YY3E 5LMNE 4DV1E 2N3GA 1HNZE 1PKPA 3VYXA 2KONA 1X47A 3J7AG 2EWLA 2DB2A 4JI5E 1O0WA 3N3WA 3O2RB 2DMYA 3IWBA 4L5NC 3HQ1A 5AASA 3VYYA 2UUCE 4NXNE 2RS6A 1FJGE 4DV3E 2RTXA 1QU6A 2LMZA 3LLHA 1N36E 4X65E 4DR6E 4JYAE 2ZM6E 3DJWA 2F4VE 3HPSA 5FLXC 2NUEA 2IHR1 4JI1E 3HTXA 1GQEA 2L92A 4BCAA 2L33A 4BS9A 4P7DA 2B7TA 5ADZA 2L6MA 4JI8E 4OUNA 2B7VA 4I8OA 5LL6R 1U61A 1WHNA 1X49A 2N3HA 4TUIA 4K0KE 1N33E 2JOBA 4L8NA 1IBKE 4JV5E 2B3TB 1T4NA 3H09A 2ODRC 3T1HE 2L2MA 1ZBQA 1XNRE 5T6JA 4LF4E 3HPZA 2HHHE 4F9AB 2KHXA 2MC6A 4BMJA 2VQEE 4OX9E 2FTXB 2EZ6A 4DV7E 3ADIA 2FGGA 2V8QB 2E5LE 4KHPE 4DR7E 2V85A 3F6HA 2LRSA 4F54A 1HNWE 3J7Yp 2E1MA 2GSLA 4F9BB 2ODRD 5A2QC 4DV0E 2EB1A 1I94E 4GKKE 3K6QA 4YHHE 2H36X 2LTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ E;  4LF8 E;  4B3R E;  1RC7 A;  4LF6 E;  5IWA E;  1JFZ A;  1N32 E;  1STU A;  2UXD E;  4JI2 E;  4M30 A;  2LUP B;  2JVA A;  2L2K B;  4DR5 E;  4OOG C;  1DI2 A;  1WHQ A;  2LJH A;  4JI7 E;  3ADJ A;  2UU9 E;  4DR2 E;  2L3J A;  5LMU E;  1X48 A;  2NUF A;  4WYQ B;  1RQ0 A;  2NA2 A;  3RV1 A;  1YYO A;  4B3M E;  1J26 A;  4DV6 E;  4LF7 E;  2MDR A;  2RSM A;  3ADG A;  1XMO E;  2A11 A;  1YYW A;  1T4O A;  1IBL E;  4JI3 E;  4DKK A;  1ZBT A;  2NUG A;  3RV0 A;  4X8W A;  3C4T A;  4B3S E;  4LF5 E;  2DIX A;  4DV2 E;  2UXC E;  4DUY E;  2QVW A;  4NXM E;  2FFL A;  1YZ9 A;  2JY9 A;  5CFF E;  4LFA E;  4DR1 E;  1UIL A;  3ADL A;  4X64 E;  4LFC E;  2VQF E;  2LBS B;  2L2N A;  2LUQ A;  2LTR A;  2YT4 A;  1FKA E;  1T4L B;  2RS7 A;  4X62 E;  1YYK A;  2L3C A;  4AQY E;  1N34 E;  3P1X A;  4DV5 E;  5BR8 E;  4JI4 E;  4JI0 E;  2UUA E;  4X66 E;  1UHZ A;  1EKZ A;  1HNX E;  4JI6 E;  3OTO E;  2UXB E;  4DR3 E;  2UUB E;  4M2Z A;  1I4S A;  4B3T E;  1RC5 A;  1IBM E;  4LF9 E;  4DV4 E;  4LFB E;  4GKJ E;  4DR4 E;  2CPN A;  4DUZ E;  3O2R A;  3T1Y E;  1J5E E;  4WFT A;  1HR0 E;  1XNQ E;  1HNZ E;  3C4B A;  4YY3 E;  5LMN E;  4DV1 E;  2N3G A;  1PKP A;  3VYX A;  1X47 A;  2DB2 A;  4JI5 E;  1O0W A;  3N3W A;  3O2R B;  2DMY A;  3VYY A;  2UUC E;  4NXN E;  2RS6 A;  1FJG E;  4DV3 E;  2RTX A;  1QU6 A;  3LLH A;  1N36 E;  4X65 E;  4DR6 E;  4JYA E;  2ZM6 E;  2F4V E;  3HTX A;  4JI1 E;  2NUE A;  2IHR 1;  1GQE A;  2L33 A;  2B7T A;  4JI8 E;  4OUN A;  2B7V A;  1U61 A;  1WHN A;  1X49 A;  2N3H A;  4K0K E;  1N33 E;  1IBK E;  4JV5 E;  2B3T B;  1T4N A;  3T1H E;  2L2M A;  1XNR E;  4LF4 E;  2KHX A;  2VQE E;  4OX9 E;  2EZ6 A;  4DV7 E;  3ADI A;  2E5L E;  4KHP E;  4DR7 E;  2LRS A;  1HNW E;  3J7Y p;  2GSL A;  4DV0 E;  2EB1 A;  1I94 E;  4GKK E;  2HHH E;  4YHH E;  2LTS A; 
#chains in the Genus database with same CATH topology
 4F2J C;  4FK5 C;  4B3R E;  4LF6 E;  2LO3 A;  2VRD A;  2JVA A;  2L2K B;  4WPY A;  2F8B A;  5A69 A;  4LU9 A;  2LJH A;  2RSI A;  2YTF A;  2EPM X;  1RQ0 A;  4B3M E;  4LF7 E;  2K7I A;  4BC9 A;  2MDR A;  1YYW A;  1T4O A;  2EPU A;  1JK2 A;  2A25 A;  2YRM A;  4DUY E;  4R2A A;  4NXM E;  2B9D A;  2EN4 A;  1KJK A;  2WZO A;  2MC5 A;  4R2R A;  4X64 E;  4BHC A;  2VQF E;  2LBS B;  2LUQ A;  2YT4 A;  2LTR A;  2G7H A;  2JYA A;  4AQY E;  4LTY A;  1YPN A;  1RMD A;  1YUI A;  3VK6 A;  4JI4 E;  3BGH A;  2CTD A;  4ZYE A;  4JI0 E;  1X6E A;  2UUA E;  1UHZ A;  4JI6 E;  2EMI A;  4B3T E;  5A6B D;  4LF9 E;  3LML A;  2YTJ A;  4GKJ E;  3OML A;  2EPC A;  5AE1 A;  1QNT A;  1PKP A;  5A6A A;  3VYX A;  1X47 A;  3J7A G;  2EWL A;  2DB2 A;  4JI5 E;  1O0W A;  2DMY A;  3IWB A;  5KL6 A;  2YU8 A;  2YPN A;  2RS6 A;  4NXN E;  1FJG E;  1A1F A;  3C6M A;  4DR6 E;  1N36 E;  3HTX A;  4BCA A;  4P7D A;  2L6M A;  4JI8 E;  4OUN A;  2B7V A;  2EN6 A;  1U61 A;  1X49 A;  4TUI A;  2N3H A;  4K0K E;  4O24 A;  1A1L A;  4JV5 E;  2ODR C;  2YTD A;  1GTK A;  1XNR E;  2VQE E;  4OX9 E;  2EMK A;  2EQ3 A;  2EZ6 A;  2YTO A;  2V8Q B;  4IJD A;  2YRH A;  4WSG A;  4F54 A;  2LRS A;  1WRJ A;  4F9B B;  2EB1 A;  2EP3 A;  2VE7 C;  1RC7 A;  2JWO A;  3DF6 A;  5IWA E;  4R8O A;  1ZAA C;  1N32 E;  2DSY A;  2LUP B;  2EN2 A;  5KL3 A;  2EL4 A;  4R2C A;  2LE2 A;  2J7J A;  3ADJ A;  4F6M A;  4DR2 E;  3AUZ A;  3VHT B;  3HXL A;  3EPL A;  1DQ3 A;  2EPA A;  2GHF A;  5F3W A;  2JPA A;  1XMO E;  3J80 C;  3THO B;  4DKK A;  1ZBT A;  2V83 A;  4O4K A;  4B3S E;  4DV2 E;  2UXC E;  3THN A;  2FFL A;  1YZ9 A;  2JY9 A;  3ADL A;  2R1F A;  4WSP A;  1A1I A;  1N3G A;  2L2N A;  4P78 A;  1YYK A;  2NAB A;  3P1X A;  2EL5 A;  1NEI A;  5LLQ A;  5TSE A;  1JK1 A;  2EPL X;  2YWQ A;  1ZTD A;  4X66 E;  2LV2 A;  2EMC A;  1EKZ A;  5KL4 A;  3JU0 A;  3C6K A;  2UUB E;  1PJQ A;  2FV4 B;  2YTP A;  1F2I G;  2EM5 A;  1IBM E;  3J81 C;  2EPX A;  2EM6 A;  1UBD C;  4DR4 E;  2EJ4 A;  2CPN A;  2EM2 A;  3TQM A;  3FIG A;  4GEQ B;  2EM4 A;  3O2R A;  2EL6 A;  2EMY A;  2K4V A;  2JOX A;  4HEI A;  4BBY A;  4ZYH A;  1BB8 A;  4WFT A;  5AC4 A;  1HR0 E;  1XNQ E;  5LMN E;  2N3G A;  2KON A;  2YRK A;  5AAS A;  2BBG A;  2EM8 A;  3LLH A;  4JYA E;  2EMZ A;  2NUE A;  1GQE A;  4BS9 A;  2B7T A;  4WXC A;  2GLI A;  5LL6 R;  5AC5 A;  2EM7 A;  3BBG A;  1EH7 A;  1A1K A;  4L8N A;  2WBU A;  1T4N A;  2EOJ A;  2L2M A;  1ZBQ A;  2EOQ A;  1KYQ A;  3EPK A;  4R2E A;  2LT7 A;  4R2Q A;  2BB8 A;  2FTX B;  2D9H A;  5IXM B;  2E5L E;  5A6J A;  2EPN A;  2EMF A;  2V85 A;  2EN1 A;  2DLK A;  2ELZ A;  2ODR D;  4GKK E;  2RPC A;  1IQS A;  2HHH E;  4YHH E;  2I9I A;  4LF8 E;  2GPI A;  1T38 A;  1JFZ A;  4MLV A;  1T39 A;  2UXD E;  1TN9 A;  4JI2 E;  4M30 A;  2KOU A;  4R2D A;  2HJJ A;  1WXR A;  4IS1 C;  1DI2 A;  1PJT A;  1SR9 A;  1WHQ A;  1Z1B A;  2Q8U A;  4JI7 E;  1A1G A;  2HGH A;  2UU9 E;  2YTI A;  5KL2 A;  4WX9 A;  2DMI A;  5LMU E;  4M0V A;  2NUF A;  2EMB A;  2M7Q A;  1J26 A;  4Q28 A;  2RSM A;  3ADG A;  2NUG A;  3BF2 A;  1EH6 A;  4X8W A;  4O43 A;  2I13 A;  1L4S A;  4N4R B;  2QVW A;  5CFF E;  5AE3 A;  4LFA E;  2HC5 A;  3M99 B;  1AAY A;  4R03 A;  4X9J A;  2RS7 A;  3BID A;  4F6N A;  4X62 E;  2ENC A;  1X6H A;  3IWD A;  4J8Z A;  4TUG A;  2PRT A;  5AE2 A;  5BR8 E;  1GZ6 A;  1X5W A;  1EH8 A;  5DNY A;  2EE8 A;  1HNX E;  2L8T A;  1TF6 A;  2ADR A;  3KWR A;  2MDG A;  3OTO E;  2YSP A;  2YSO A;  4WXD A;  1BBO A;  1I4S A;  1RC5 A;  2EOR A;  2YZT A;  4DV4 E;  4R2P A;  2YTN A;  1YSA C;  1ZU1 A;  3EQ1 A;  3KZY A;  1G2F C;  2V86 A;  2V87 A;  2EOY A;  3T1Y E;  4KZS A;  4BC7 A;  1J5E E;  2EPO A;  1HNZ E;  3MHH C;  3N3W A;  3HQ1 A;  1YUJ A;  2R76 A;  2EMG A;  1DGC A;  2RTX A;  1QU6 A;  2LMZ A;  4NZV A;  4ZYD A;  2JP9 A;  2F4V E;  3HPS A;  2IHR 1;  2L92 A;  2L33 A;  2EML A;  1MGT A;  2RQL A;  2YTE A;  4I8O A;  1WHN A;  2EPZ A;  1BBG A;  1X6F A;  2LJU A;  1N33 E;  2JOB A;  1PJS A;  3H09 A;  1P47 A;  2EOI A;  2WBT A;  5T6J A;  4BMJ A;  1YFH A;  1G2D C;  1A1J A;  3ADI A;  2FGG A;  2EMH A;  2EQ1 A;  3F6H A;  1HNW E;  3J7Y p;  2E1M A;  2EOX A;  5A2Q C;  4BHB A;  4DV0 E;  1I94 E;  2EOF A;  2H36 X;  2LTS A;  1XMQ E;  2M9A A;  3EPH A;  1WJP A;  5IT9 C;  2EPR A;  2EN3 A;  3ZOQ B;  1STU A;  5A6B A;  2WCC 3;  1B69 A;  2EMA A;  4R2S A;  4DR5 E;  4OOG C;  3EPJ A;  2E72 A;  2L3J A;  1X48 A;  3KZZ A;  4WYQ B;  2NA2 A;  3RV1 A;  1YYO A;  4F9C B;  4DV6 E;  3IWC A;  2MKD A;  1PDA A;  3F6G A;  3MSW A;  1A1H A;  2MKN A;  4HTG A;  2A11 A;  1IBL E;  3L00 A;  4JI3 E;  3RV0 A;  3C4T A;  2LCE A;  2DIX A;  2LVH A;  4LF5 E;  1AH5 A;  4DMI A;  2CT1 A;  4DR1 E;  1UIL A;  4LFC E;  2EM3 A;  1FKA E;  3MHS C;  2EOO A;  1T4L B;  4M9V C;  2L3C A;  1N34 E;  1IQO A;  1SFE A;  3JAM C;  2JR1 A;  4DV5 E;  4RH8 A;  2EOE A;  2EMX A;  1IMU A;  2V89 A;  4ZYG A;  2EN8 A;  2V88 A;  2M1S A;  2UXB E;  4DR3 E;  4M2Z A;  2EMW A;  3JTZ A;  2EM9 A;  3RMP A;  2EN7 A;  2EQ0 A;  4LFB E;  2YTQ A;  2ELY A;  2M4I A;  2VF1 A;  1MEY C;  2EPP A;  4DUZ E;  1X3C A;  3ECR A;  4Q35 B;  3AV0 A;  3C4B A;  4YY3 E;  4DV1 E;  2ENA A;  2EOZ A;  4GZN C;  2DGC A;  3VYY A;  3O2R B;  4L5N C;  2JXP A;  2UUC E;  1TF3 A;  2EOM A;  4DV3 E;  4X65 E;  2ZM6 E;  5IV8 B;  3DJW A;  3UK3 C;  2YTG A;  5FLX C;  4JI1 E;  1UN6 B;  1LLM C;  5ADZ A;  5KL5 A;  2YU5 A;  2CSH A;  3QG5 C;  2DRP A;  2DLQ A;  1ZR9 A;  1IBK E;  2EM0 A;  2B3T B;  3T1H E;  5A6K A;  4RHB B;  4O5G A;  4KWY A;  4LF4 E;  3HPZ A;  4NHR A;  4F9A B;  2KHX A;  2MC6 A;  2EOS A;  2EPK X;  5KL7 A;  4DV7 E;  2ENH A;  4KHP E;  4DR7 E;  2WBS A;  1NCS A;  2N8X A;  2GSL A;  2EOH A;  4MLQ A;  3K6Q A; 
#chains in the Genus database with same CATH homology
 1XMQ E;  4LF8 E;  2VE7 C;  4B3R E;  1RC7 A;  2JWO A;  4LF6 E;  3DF6 A;  5IWA E;  4R8O A;  5IT9 C;  1JFZ A;  1N32 E;  3ZOQ B;  1STU A;  2UXD E;  4JI2 E;  4M30 A;  2DSY A;  2KOU A;  2LUP B;  2JVA A;  2L2K B;  4WPY A;  1WXR A;  4DR5 E;  4OOG C;  2F8B A;  1SR9 A;  1WHQ A;  2LJH A;  4LU9 A;  1DI2 A;  4JI7 E;  2LE2 A;  3ADJ A;  2UU9 E;  4DR2 E;  2L3J A;  5LMU E;  1X48 A;  3AUZ A;  4M0V A;  2NUF A;  4WYQ B;  3HXL A;  2M7Q A;  1RQ0 A;  2NA2 A;  1DQ3 A;  3RV1 A;  1YYO A;  4F9C B;  4B3M E;  1J26 A;  4DV6 E;  4Q28 A;  3IWC A;  4LF7 E;  4BC9 A;  2MDR A;  3F6G A;  3MSW A;  5F3W A;  2RSM A;  3ADG A;  1XMO E;  2A11 A;  1YYW A;  3J80 C;  1T4O A;  1IBL E;  4JI3 E;  4DKK A;  1ZBT A;  2NUG A;  3RV0 A;  4X8W A;  3C4T A;  2V83 A;  4B3S E;  4LF5 E;  2DIX A;  4DV2 E;  2UXC E;  4DUY E;  2QVW A;  4DMI A;  2B9D A;  4NXM E;  2FFL A;  1YZ9 A;  2WZO A;  2JY9 A;  5CFF E;  2MC5 A;  5AE3 A;  4LFA E;  4DR1 E;  1UIL A;  3ADL A;  4X64 E;  4LFC E;  4WSP A;  4R03 A;  2VQF E;  2LBS B;  2L2N A;  2LUQ A;  2LTR A;  2YT4 A;  4P78 A;  1FKA E;  2G7H A;  1T4L B;  2RS7 A;  4X62 E;  1YYK A;  2L3C A;  4AQY E;  1N34 E;  3JAM C;  4LTY A;  2JR1 A;  3P1X A;  3IWD A;  4J8Z A;  3VK6 A;  4TUG A;  5AE2 A;  4DV5 E;  5BR8 E;  4JI4 E;  1GZ6 A;  2V89 A;  4JI0 E;  2UUA E;  4X66 E;  1UHZ A;  5DNY A;  1EKZ A;  1HNX E;  2L8T A;  3KWR A;  4JI6 E;  3OTO E;  2V88 A;  2M1S A;  3JU0 A;  2UXB E;  4DR3 E;  2UUB E;  2FV4 B;  4M2Z A;  1I4S A;  4B3T E;  3JTZ A;  1RC5 A;  1IBM E;  4LF9 E;  2YZT A;  3LML A;  4DV4 E;  3J81 C;  3RMP A;  4LFB E;  4GKJ E;  2M4I A;  2VF1 A;  3OML A;  4DR4 E;  2CPN A;  3FIG A;  4GEQ B;  4DUZ E;  3O2R A;  2K4V A;  2V86 A;  2V87 A;  2JOX A;  4BBY A;  5AE1 A;  4KZS A;  4BC7 A;  3T1Y E;  1J5E E;  4WFT A;  1HR0 E;  1XNQ E;  3AV0 A;  3C4B A;  4YY3 E;  5LMN E;  4DV1 E;  2N3G A;  1HNZ E;  1PKP A;  3VYX A;  2KON A;  1X47 A;  3J7A G;  2EWL A;  2DB2 A;  4JI5 E;  1O0W A;  3N3W A;  3O2R B;  2DMY A;  3IWB A;  4L5N C;  3HQ1 A;  5AAS A;  3VYY A;  2UUC E;  4NXN E;  2RS6 A;  1FJG E;  4DV3 E;  2RTX A;  1QU6 A;  2LMZ A;  3LLH A;  1N36 E;  4X65 E;  4DR6 E;  4JYA E;  2ZM6 E;  3DJW A;  2F4V E;  3HPS A;  5FLX C;  2NUE A;  2IHR 1;  4JI1 E;  3HTX A;  1GQE A;  2L92 A;  4BCA A;  2L33 A;  4BS9 A;  4P7D A;  2B7T A;  5ADZ A;  2L6M A;  4JI8 E;  4OUN A;  2B7V A;  4I8O A;  5LL6 R;  1U61 A;  1WHN A;  1X49 A;  2N3H A;  4TUI A;  4K0K E;  1N33 E;  2JOB A;  4L8N A;  1IBK E;  4JV5 E;  2B3T B;  1T4N A;  3H09 A;  2ODR C;  3T1H E;  2L2M A;  1ZBQ A;  1XNR E;  5T6J A;  4LF4 E;  3HPZ A;  2HHH E;  4F9A B;  2KHX A;  2MC6 A;  4BMJ A;  2VQE E;  4OX9 E;  2FTX B;  2EZ6 A;  4DV7 E;  3ADI A;  2FGG A;  2V8Q B;  2E5L E;  4KHP E;  4DR7 E;  2V85 A;  3F6H A;  2LRS A;  4F54 A;  1HNW E;  3J7Y p;  2E1M A;  2GSL A;  4F9B B;  2ODR D;  5A2Q C;  4DV0 E;  2EB1 A;  1I94 E;  4GKK E;  3K6Q A;  4YHH E;  2H36 X;  2LTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...