2EZ6A

Crystal structure of aquifex aeolicus rnase iii (d44n) complexed with product of double-stranded rna processing
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
218
structure length
218
Chain Sequence
MLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGNALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight into the Mechanism of Double-Stranded RNA Processing by Ribonuclease III.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
molecule keywords 28-MER
total genus 80
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2005-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 2ez6A01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ez6A02
4X64E 4JYAE 2L2KB 4DR1E 1JFZA 4AQYE 4B3ME 1RC5A 2DIXA 2UU9E 4JI0E 1WHNA 2YT4A 2QVWA 1I4SA 1RQ0A 5IWAE 1X47A 3T1HE 2RS7A 2EZ6A 1PKPA 1X48A 2LUPB 4DR5E 3T1YE 4K0KE 2DMYA 1IBKE 2UUCE 1XNQE 5CFFE 3OTOE 1U61A 1YYWA 2IHR1 4DV6E 4DV2E 2L2MA 4DR6E 2EB1A 1J26A 1HNXE 4X66E 4WFTA 4JI5E 4DV1E 4LF8E 3C4TA 2UUBE 3LLHA 2UXDE 2KHXA 1STUA 4DUYE 1YYKA 2E5LE 4KHPE 1UILA 4DKKA 4OX9E 3RV1A 4X62E 3HTXA 4JI2E 3O2RB 2B3TB 2L2NA 1UHZA 1EKZA 3ADLA 4DR3E 2FFLA 1J5EE 2NUGA 4GKKE 2VQFE 4M2ZA 3J7Yp 3ADJA 4JI4E 4NXNE 4X65E 4LFBE 2UXBE 1N36E 2RTXA 1FKAE 4LF4E 2UXCE 3O2RA 3C4BA 2NUFA 4LFCE 4LF5E 4DR7E 1N32E 1X49A 2B7VA 1T4NA 4YHHE 3ADIA 2L33A 2VQEE 4DV4E 1HR0E 3ADGA 2LJHA 2JY9A 4LFAE 4DR4E 2NA2A 4JI6E 2DB2A 1YYOA 4X8WA 4DV5E 1QU6A 4DV7E 1YZ9A 2LBSB 4LF6E 4WYQB 1O0WA 2LTSA 3VYYA 1N34E 1IBLE 4B3SE 4JV5E 1RC7A 2NUEA 1I94E 1T4OA 1DI2A 4OOGC 4M30A 2GSLA 4LF9E 5LMNE 2B7TA 1XNRE 1WHQA 1XMOE 2JVAA 3N3WA 1FJGE 4JI8E 4JI7E 4LF7E 4DUZE 2N3GA 2CPNA 1XMQE 4B3TE 2F4VE 4JI1E 4OUNA 3RV0A 2LTRA 3P1XA 2ZM6E 2L3JA 1GQEA 4DV3E 1HNWE 1T4LB 5BR8E 2UUAE 2MDRA 2RSMA 4DR2E 1IBME 4NXME 3VYXA 1N33E 4B3RE 1ZBTA 2HHHE 2RS6A 4DV0E 4JI3E 2LRSA 2LUQA 2N3HA 2L3CA 5LMUE 2A11A 1HNZE 4GKJE 4YY3E
chains in the Genus database with same CATH superfamily
2EM5A 2JOXA 2DLKA 2QVWA 1RQ0A 2EQ3A 1ZU1A 4BMJA 4J8ZA 4X9JA 2DMYA 1T39A 1U61A 4DR6E 2EOMA 4GZNC 3EPKA 2J7JA 2DRPA 4LF8E 2EOJA 4BC7A 4RH8A 2EORA 2ODRD 2L92A 3LLHA 2JWOA 1IQSA 4DUYE 1YYKA 3EPJA 2E5LE 2MKNA 1UILA 2YTOA 2H36X 4F9AB 2B3TB 2L2NA 3ADLA 2DLQA 4O5GA 2EPUA 4GKKE 4BHCA 4M2ZA 3J7Yp 3BIDA 3MHHC 2V87A 2EOIA 2V89A 4ZYDA 5AE2A 3BGHA 3LMLA 4LTYA 1X3CA 4LFCE 2EOFA 5A6BD 2B7VA 2EMIA 3J7AG 2L33A 4KWYA 3HPZA 4F9CB 4DR4E 4NZVA 4JI6E 1QNTA 1YYOA 2DB2A 2EMCA 4X8WA 3UK3C 4DV7E 1NEIA 2JOBA 2CT1A 4IJDA 4ZYHA 4LF6E 1MEYC 1YUIA 1KYQA 2EJ4A 2LV2A 1O0WA 5A6AA 2LTSA 4JV5E 2NUEA 3HQ1A 2LVHA 5DNYA 2EE8A 4BHBA 4OOGC 2CSHA 5AE3A 2YPNA 1YPNA 2EPXA 1GZ6A 2YTNA 5F3WA 2EQ0A 5A2QC 4LF7E 2EOXA 4B3TE 2RSIA 4OUNA 3RV0A 1X5WA 2Q8UA 2ZM6E 2L3JA 1UBDC 4M9VC 3EPHA 5BR8E 4R2SA 1F2IG 2FV4B 4R03A 4Q28A 3THOB 3L00A 1WXRA 1WRJA 1L4SA 2RS6A 4DMIA 2EOSA 2L3CA 1YFHA 1JK1A 4YY3E 1A1HA 4X64E 2YTDA 4JYAE 1JFZA 1RC5A 1WHNA 2YT4A 4P78A 5AC5A 4F54A 2EMFA 1Z1BA 2EOHA 2EZ6A 2F8BA 3AV0A 3BBGA 2G7HA 2K7IA 5AC4A 2EQ1A 2LUPB 2B9DA 3TQMA 1ZR9A 5A6KA 4K0KE 2EMAA 2V86A 2VF1A 4P7DA 5FLXC 5CFFE 2EPOA 2L2MA 2EB1A 4JI5E 2EPRA 4WXCA 4R2QA 3C4TA 4MLVA 2ENCA 4BBYA 1PJSA 1STUA 2EM7A 4O4KA 2YRMA 1AAYA 2EM3A 4JI2E 1A1GA 2EOQA 1UHZA 2EL6A 2EOOA 1B69A 2GHFA 2FFLA 1J5EE 2NUGA 2VQFE 2EMGA 4HEIA 3EPLA 3FIGA 3IWBA 4F2JC 1A1KA 1N36E 1FKAE 5KL6A 2EPMX 2UXCE 2EPAA 3C4BA 2NUFA 3M99B 5A69A 2EM2A 1T38A 2HJJA 3KWRA 2LO3A 3JTZA 3ADIA 1T4NA 2V85A 4DV4E 1BB8A 2M4IA 1A1FA 2DMIA 1N3GA 4F9BB 2YWQA 3H09A 4TUIA 4DV5E 2V8QB 2JYAA 2EMZA 3MSWA 2YU5A 2WZOA 1I94E 1SFEA 4Q35B 1SR9A 4M30A 1GTKA 2ENAA 2WCC3 2ELZA 1WHQA 2MKDA 3N3WA 1LLMC 4JI8E 4JI7E 5A6BA 2CPNA 1XMQE 4NHRA 4F6NA 2JXPA 5IXMB 3C6MA 2EP3A 2YSPA 2EPKX 2I13A 2EN1A 4DR2E 3K6QA 1WJPA 2YTPA 3VHTB 2M9AA 4DV0E 2EM8A 3RMPA 2JP9A 2ENHA 2LRSA 2LUQA 5LMUE 2A11A 1HNZE 3IWDA 5ADZA 5TSEA 2EM0A 4AQYE 2DIXA 1ZTDA 2D9HA 2EM6A 3KZZA 2I9IA 1X47A 3JU0A 1DGCA 1PKPA 1X48A 2RPCA 4DR5E 3DJWA 1P47A 2PRTA 1IBKE 2UUCE 5KL2A 1XNQE 3OTOE 1YYWA 4DV2E 4R2DA 4X66E 4WFTA 4DV1E 5A6JA 2EWLA 2UUBE 2UXDE 3IWCA 2EMXA 2WBSA 2LCEA 2R1FA 1BBGA 4KHPE 2GPIA 2EMHA 4DKKA 1TF6A 3RV1A 4X62E 2YTIA 2LT7A 1JK2A 2YRHA 2EM9A 1EKZA 2EN6A 4DR3E 3HPSA 5KL3A 2EMBA 1DQ3A 4HTGA 2MC5A 4WPYA 2YTEA 2KOUA 4X65E 4N4RB 5AE1A 1YSAC 4LFBE 2UXBE 2RTXA 2EMWA 4GEQB 2V88A 1G2FC 2A25A 4DR7E 1N32E 3F6HA 2M1SA 4ZYGA 4YHHE 4R2AA 2VQEE 1HR0E 4LU9A 3ADGA 5LL6R 3QG5C 2JY9A 2YTFA 2NA2A 2VE7C 3C6KA 5IV8B 2N8XA 1TF3A 2L8TA 2LBSB 2EPZA 5KL7A 2R76A 3F6GA 2EN8A 2EPNA 2VRDA 2WBUA 1T4OA 1DI2A 1EH6A 1A1JA 1A1LA 2GSLA 2YSOA 4LF9E 4FK5C 2ELYA 4TUGA 1XMOE 2DGCA 1XNRE 2JVAA 4L5NC 3MHSC 1FJGE 3BF2A 4DUZE 1ZBQA 1UN6B 2MC6A 4JI1E 2EMYA 3P1XA 4R2EA 1ZAAC 1GQEA 2M7QA 4DV3E 1HNWE 2GLIA 2K4VA 1BBOA 2YTQA 3AUZA 1MGTA 2UUAE 2MDRA 3THNA 2RSMA 4NXME 1IBME 3VYXA 3OMLA 2E72A 2HHHE 4WSGA 3JAMC 4M0VA 4ZYEA 2N3HA 3EQ1A 5KL4A 1TN9A 3J81C 2L2KB 4DR1E 4B3ME 2UU9E 2MDGA 2EN2A 4JI0E 1PJTA 1I4SA 5IWAE 2EMLA 4O43A 3T1HE 1RMDA 2RS7A 2DSYA 1X6HA 1PDAA 4WSPA 4WXDA 3T1YE 2YTJA 1G2DC 3VK6A 5T6JA 4L8NA 2IHR1 4DV6E 1J26A 1HNXE 2EN3A 1KJKA 2BB8A 2NABA 2LMZA 2E1MA 2EPLX 2KHXA 2ODRC 2EL4A 2EM4A 4BS9A 2EOEA 2YTGA 4F6MA 2JPAA 4OX9E 3HTXA 3HXLA 3O2RB 1PJQA 1IQOA 2V83A 2EPCA 2EMKA 3ADJA 2YRKA 4JI4E 2YZTA 4NXNE 1EH7A 3KZYA 4WX9A 2CTDA 4LF4E 1YUJA 2L6MA 3O2RA 2EOZA 2EN4A 4BCAA 4LF5E 1X49A 4BC9A 2EN7A 1EH8A 1A1IA 4R2PA 5IT9C 2FGGA 2EOYA 2LJHA 2YU8A 1IMUA 4LFAE 4IS1C 1AH5A 1QU6A 1YZ9A 2FTXB 4R2CA 5AASA 4WYQB 2HC5A 3VYYA 4B3SE 1N34E 1IBLE 1RC7A 4RHBB 2EPPA 2BBGA 4KZSA 5LMNE 2B7TA 4R8OA 4R2RA 5KL5A 1X6EA 2JR1A 2N3GA 2F4VE 3DF6A 2LTRA 4O24A 1X6FA 2LE2A 5LLQA 2HGHA 1T4LB 1NCSA 4MLQA 2LJUA 2EL5A 2RQLA 1N33E 2KONA 3ZOQB 1ZBTA 3ECRA 4B3RE 2WBTA 3J80C 2ADRA 4JI3E 4I8OA 4GKJE
chains in the Genus database with same CATH topology
4X64E 4JYAE 3J81C 2L2KB 4DR1E 1JFZA 4AQYE 4B3ME 1RC5A 2DIXA 2UU9E 4JI0E 1WHNA 2JOXA 2YT4A 4P78A 4F54A 2QVWA 1I4SA 1RQ0A 5IWAE 1X47A 3JU0A 3T1HE 2RS7A 2EZ6A 2DSYA 2F8BA 1PKPA 3AV0A 4J8ZA 2G7HA 4BMJA 1X48A 2LUPB 2B9DA 4WSPA 4DR5E 3T1YE 4K0KE 2DMYA 3DJWA 3VK6A 1IBKE 2V86A 2UUCE 2VF1A 5T6JA 4P7DA 5FLXC 1XNQE 5CFFE 3OTOE 4L8NA 1U61A 1YYWA 2IHR1 4DV6E 4DV2E 2L2MA 4DR6E 2EB1A 1J26A 1HNXE 4X66E 4WFTA 4JI5E 2LMZA 4DV1E 2E1MA 3ADIA 4LF8E 4BC7A 2EWLA 3C4TA 2UUBE 2ODRD 2L92A 3LLHA 2UXDE 2KHXA 2JWOA 2ODRC 3IWCA 4BBYA 1STUA 4BS9A 4DUYE 1YYKA 2E5LE 4KHPE 1UILA 4DKKA 4OX9E 3RV1A 4X62E 3HTXA 4JI2E 3HXLA 2H36X 3O2RB 2B3TB 2L2NA 1UHZA 4F9AB 3J7AG 1EKZA 3ADLA 4DR3E 2FFLA 1J5EE 2NUGA 4GKKE 2VQFE 3HPSA 4M2ZA 2V83A 3J7Yp 1DQ3A 3ADJA 2MC5A 4JI4E 2V87A 2YZTA 4NXNE 3FIGA 3IWBA 4WPYA 2KOUA 4X65E 2V89A 5AE1A 4LFBE 2UXBE 1N36E 2RTXA 1FKAE 4LF4E 5AE2A 2UXCE 3LMLA 2L6MA 3O2RA 4LTYA 4GEQB 3C4BA 2V88A 2NUFA 4BCAA 4LFCE 4LF5E 4DR7E 3KWRA 3F6HA 1N32E 1X49A 2B7VA 1T4NA 2M1SA 2V85A 3JTZA 4BC9A 2L33A 4YHHE 2M4IA 3HPZA 2VQEE 4DV4E 4F9CB 5IT9C 2FGGA 4LU9A 1HR0E 4F9BB 3ADGA 5LL6R 2LJHA 2JY9A 4LFAE 4DR4E 2NA2A 2VE7C 4JI6E 3H09A 4TUIA 2DB2A 1YYOA 4X8WA 4DV5E 2V8QB 1QU6A 4DV7E 2JOBA 1YZ9A 2L8TA 2FTXB 2LBSB 5AASA 4LF6E 4WYQB 3MSWA 1O0WA 2WZOA 2LTSA 3F6GA 3VYYA 1N34E 1IBLE 4B3SE 4JV5E 1RC7A 2NUEA 1I94E 1T4OA 3HQ1A 1DI2A 1SR9A 5DNYA 4OOGC 4M30A 4KZSA 2GSLA 5AE3A 5LMNE 4LF9E 2B7TA 4TUGA 1GZ6A 1WHQA 4R8OA 1XMOE 2JVAA 4L5NC 1XNRE 3N3WA 4GKJE 5F3WA 1FJGE 4JI8E 5A2QC 4JI7E 4LF7E 4DUZE 2JR1A 1ZBQA 2CPNA 2N3GA 1XMQE 2MC6A 4B3TE 2F4VE 4JI1E 4OUNA 3RV0A 2LTRA 3DF6A 3P1XA 2ZM6E 2L3JA 2LE2A 1GQEA 2M7QA 4DV3E 1HNWE 2K4VA 1T4LB 5BR8E 3AUZA 2UUAE 2MDRA 2FV4B 2RSMA 4DR2E 4R03A 4Q28A 1IBME 3K6QA 4NXME 1WXRA 3OMLA 3VYXA 1N33E 2KONA 3ZOQB 1ZBTA 2HHHE 4B3RE 2RS6A 3JAMC 3J80C 4DMIA 4M0VA 4DV0E 2LRSA 2LUQA 3RMPA 2N3HA 2L3CA 4JI3E 5LMUE 2A11A 4I8OA 1HNZE 3IWDA 4YY3E 5ADZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 E;  4JYA E;  2L2K B;  4DR1 E;  1JFZ A;  4AQY E;  4B3M E;  1RC5 A;  2DIX A;  2UU9 E;  4JI0 E;  1WHN A;  2YT4 A;  2QVW A;  1I4S A;  1RQ0 A;  5IWA E;  1X47 A;  3T1H E;  2RS7 A;  2EZ6 A;  1PKP A;  1X48 A;  2LUP B;  4DR5 E;  3T1Y E;  4K0K E;  2DMY A;  1IBK E;  2UUC E;  1XNQ E;  5CFF E;  3OTO E;  1U61 A;  1YYW A;  2IHR 1;  4DV6 E;  4DV2 E;  2L2M A;  4DR6 E;  2EB1 A;  1J26 A;  1HNX E;  4X66 E;  4WFT A;  4JI5 E;  4DV1 E;  4LF8 E;  3C4T A;  2UUB E;  3LLH A;  2UXD E;  2KHX A;  1STU A;  4DUY E;  1YYK A;  2E5L E;  4KHP E;  1UIL A;  4DKK A;  4OX9 E;  3RV1 A;  4X62 E;  3HTX A;  4JI2 E;  3O2R B;  2B3T B;  2L2N A;  1UHZ A;  1EKZ A;  3ADL A;  4DR3 E;  2FFL A;  1J5E E;  2NUG A;  4GKK E;  2VQF E;  4M2Z A;  3J7Y p;  3ADJ A;  4JI4 E;  4NXN E;  4X65 E;  4LFB E;  2UXB E;  1N36 E;  2RTX A;  1FKA E;  4LF4 E;  2UXC E;  3O2R A;  3C4B A;  2NUF A;  4LFC E;  4LF5 E;  4DR7 E;  1N32 E;  1X49 A;  2B7V A;  1T4N A;  4YHH E;  3ADI A;  2L33 A;  2VQE E;  4DV4 E;  1HR0 E;  3ADG A;  2LJH A;  2JY9 A;  4LFA E;  4DR4 E;  2NA2 A;  4JI6 E;  2DB2 A;  1YYO A;  4X8W A;  4DV5 E;  1QU6 A;  4DV7 E;  1YZ9 A;  2LBS B;  4LF6 E;  4WYQ B;  1O0W A;  2LTS A;  3VYY A;  1N34 E;  1IBL E;  4B3S E;  4JV5 E;  1RC7 A;  2NUE A;  1I94 E;  1T4O A;  1DI2 A;  4OOG C;  4M30 A;  2GSL A;  4LF9 E;  5LMN E;  2B7T A;  1XNR E;  1WHQ A;  1XMO E;  2JVA A;  3N3W A;  1FJG E;  4JI8 E;  4JI7 E;  4LF7 E;  4DUZ E;  2N3G A;  2CPN A;  1XMQ E;  4B3T E;  2F4V E;  4JI1 E;  4OUN A;  3RV0 A;  2LTR A;  3P1X A;  2ZM6 E;  2L3J A;  1GQE A;  4DV3 E;  1HNW E;  1T4L B;  5BR8 E;  2UUA E;  2MDR A;  2RSM A;  4DR2 E;  1IBM E;  4NXM E;  3VYX A;  1N33 E;  4B3R E;  1ZBT A;  2HHH E;  2RS6 A;  4DV0 E;  4JI3 E;  2LRS A;  2LUQ A;  2N3H A;  2L3C A;  5LMU E;  2A11 A;  1HNZ E;  4GKJ E;  4YY3 E; 
#chains in the Genus database with same CATH topology
 2EM5 A;  2JOX A;  2DLK A;  2QVW A;  1RQ0 A;  2EQ3 A;  1ZU1 A;  4BMJ A;  4J8Z A;  4X9J A;  2DMY A;  1T39 A;  1U61 A;  4DR6 E;  2EOM A;  4GZN C;  3EPK A;  2J7J A;  2DRP A;  4LF8 E;  2EOJ A;  4BC7 A;  4RH8 A;  2EOR A;  2ODR D;  2L92 A;  3LLH A;  2JWO A;  1IQS A;  4DUY E;  1YYK A;  3EPJ A;  2E5L E;  2MKN A;  1UIL A;  2YTO A;  2H36 X;  4F9A B;  2B3T B;  2L2N A;  3ADL A;  2DLQ A;  4O5G A;  2EPU A;  4GKK E;  4BHC A;  4M2Z A;  3J7Y p;  3BID A;  3MHH C;  2V87 A;  2EOI A;  2V89 A;  4ZYD A;  5AE2 A;  3BGH A;  3LML A;  4LTY A;  1X3C A;  4LFC E;  2EOF A;  5A6B D;  2B7V A;  2EMI A;  3J7A G;  2L33 A;  4KWY A;  3HPZ A;  4F9C B;  4DR4 E;  4NZV A;  4JI6 E;  1QNT A;  1YYO A;  2DB2 A;  2EMC A;  4X8W A;  3UK3 C;  4DV7 E;  1NEI A;  2JOB A;  2CT1 A;  4IJD A;  4ZYH A;  4LF6 E;  1MEY C;  1YUI A;  1KYQ A;  2EJ4 A;  2LV2 A;  1O0W A;  5A6A A;  2LTS A;  4JV5 E;  2NUE A;  3HQ1 A;  2LVH A;  5DNY A;  2EE8 A;  4BHB A;  4OOG C;  2CSH A;  5AE3 A;  2YPN A;  1YPN A;  2EPX A;  1GZ6 A;  2YTN A;  5F3W A;  2EQ0 A;  5A2Q C;  4LF7 E;  2EOX A;  4B3T E;  2RSI A;  4OUN A;  3RV0 A;  1X5W A;  2Q8U A;  2ZM6 E;  2L3J A;  1UBD C;  4M9V C;  3EPH A;  5BR8 E;  4R2S A;  1F2I G;  2FV4 B;  4R03 A;  4Q28 A;  3THO B;  3L00 A;  1WXR A;  1WRJ A;  1L4S A;  2RS6 A;  4DMI A;  2EOS A;  2L3C A;  1YFH A;  1JK1 A;  4YY3 E;  1A1H A;  4X64 E;  2YTD A;  4JYA E;  1JFZ A;  1RC5 A;  1WHN A;  2YT4 A;  4P78 A;  5AC5 A;  4F54 A;  2EMF A;  1Z1B A;  2EOH A;  2EZ6 A;  2F8B A;  3AV0 A;  3BBG A;  2G7H A;  2K7I A;  5AC4 A;  2EQ1 A;  2LUP B;  2B9D A;  3TQM A;  1ZR9 A;  5A6K A;  4K0K E;  2EMA A;  2V86 A;  2VF1 A;  4P7D A;  5FLX C;  5CFF E;  2EPO A;  2L2M A;  2EB1 A;  4JI5 E;  2EPR A;  4WXC A;  4R2Q A;  3C4T A;  4MLV A;  2ENC A;  4BBY A;  1PJS A;  1STU A;  2EM7 A;  4O4K A;  2YRM A;  1AAY A;  2EM3 A;  4JI2 E;  1A1G A;  2EOQ A;  1UHZ A;  2EL6 A;  2EOO A;  1B69 A;  2GHF A;  2FFL A;  1J5E E;  2NUG A;  2VQF E;  2EMG A;  4HEI A;  3EPL A;  3FIG A;  3IWB A;  4F2J C;  1A1K A;  1N36 E;  1FKA E;  5KL6 A;  2EPM X;  2UXC E;  2EPA A;  3C4B A;  2NUF A;  3M99 B;  5A69 A;  2EM2 A;  1T38 A;  2HJJ A;  3KWR A;  2LO3 A;  3JTZ A;  3ADI A;  1T4N A;  2V85 A;  4DV4 E;  1BB8 A;  2M4I A;  1A1F A;  2DMI A;  1N3G A;  4F9B B;  2YWQ A;  3H09 A;  4TUI A;  4DV5 E;  2V8Q B;  2JYA A;  2EMZ A;  3MSW A;  2YU5 A;  2WZO A;  1I94 E;  1SFE A;  4Q35 B;  1SR9 A;  4M30 A;  1GTK A;  2ENA A;  2WCC 3;  2ELZ A;  1WHQ A;  2MKD A;  3N3W A;  1LLM C;  4JI8 E;  4JI7 E;  5A6B A;  2CPN A;  1XMQ E;  4NHR A;  4F6N A;  2JXP A;  5IXM B;  3C6M A;  2EP3 A;  2YSP A;  2EPK X;  2I13 A;  2EN1 A;  4DR2 E;  3K6Q A;  1WJP A;  2YTP A;  3VHT B;  2M9A A;  4DV0 E;  2EM8 A;  3RMP A;  2JP9 A;  2ENH A;  2LRS A;  2LUQ A;  5LMU E;  2A11 A;  1HNZ E;  3IWD A;  5ADZ A;  5TSE A;  2EM0 A;  4AQY E;  2DIX A;  1ZTD A;  2D9H A;  2EM6 A;  3KZZ A;  2I9I A;  1X47 A;  3JU0 A;  1DGC A;  1PKP A;  1X48 A;  2RPC A;  4DR5 E;  3DJW A;  1P47 A;  2PRT A;  1IBK E;  2UUC E;  5KL2 A;  1XNQ E;  3OTO E;  1YYW A;  4DV2 E;  4R2D A;  4X66 E;  4WFT A;  4DV1 E;  5A6J A;  2EWL A;  2UUB E;  2UXD E;  3IWC A;  2EMX A;  2WBS A;  2LCE A;  2R1F A;  1BBG A;  4KHP E;  2GPI A;  2EMH A;  4DKK A;  1TF6 A;  3RV1 A;  4X62 E;  2YTI A;  2LT7 A;  1JK2 A;  2YRH A;  2EM9 A;  1EKZ A;  2EN6 A;  4DR3 E;  3HPS A;  5KL3 A;  2EMB A;  1DQ3 A;  4HTG A;  2MC5 A;  4WPY A;  2YTE A;  2KOU A;  4X65 E;  4N4R B;  5AE1 A;  1YSA C;  4LFB E;  2UXB E;  2RTX A;  2EMW A;  4GEQ B;  2V88 A;  1G2F C;  2A25 A;  4DR7 E;  1N32 E;  3F6H A;  2M1S A;  4ZYG A;  4YHH E;  4R2A A;  2VQE E;  1HR0 E;  4LU9 A;  3ADG A;  5LL6 R;  3QG5 C;  2JY9 A;  2YTF A;  2NA2 A;  2VE7 C;  3C6K A;  5IV8 B;  2N8X A;  1TF3 A;  2L8T A;  2LBS B;  2EPZ A;  5KL7 A;  2R76 A;  3F6G A;  2EN8 A;  2EPN A;  2VRD A;  2WBU A;  1T4O A;  1DI2 A;  1EH6 A;  1A1J A;  1A1L A;  2GSL A;  2YSO A;  4LF9 E;  4FK5 C;  2ELY A;  4TUG A;  1XMO E;  2DGC A;  1XNR E;  2JVA A;  4L5N C;  3MHS C;  1FJG E;  3BF2 A;  4DUZ E;  1ZBQ A;  1UN6 B;  2MC6 A;  4JI1 E;  2EMY A;  3P1X A;  4R2E A;  1ZAA C;  1GQE A;  2M7Q A;  4DV3 E;  1HNW E;  2GLI A;  2K4V A;  1BBO A;  2YTQ A;  3AUZ A;  1MGT A;  2UUA E;  2MDR A;  3THN A;  2RSM A;  4NXM E;  1IBM E;  3VYX A;  3OML A;  2E72 A;  2HHH E;  4WSG A;  3JAM C;  4M0V A;  4ZYE A;  2N3H A;  3EQ1 A;  5KL4 A;  1TN9 A;  3J81 C;  2L2K B;  4DR1 E;  4B3M E;  2UU9 E;  2MDG A;  2EN2 A;  4JI0 E;  1PJT A;  1I4S A;  5IWA E;  2EML A;  4O43 A;  3T1H E;  1RMD A;  2RS7 A;  2DSY A;  1X6H A;  1PDA A;  4WSP A;  4WXD A;  3T1Y E;  2YTJ A;  1G2D C;  3VK6 A;  5T6J A;  4L8N A;  2IHR 1;  4DV6 E;  1J26 A;  1HNX E;  2EN3 A;  1KJK A;  2BB8 A;  2NAB A;  2LMZ A;  2E1M A;  2EPL X;  2KHX A;  2ODR C;  2EL4 A;  2EM4 A;  4BS9 A;  2EOE A;  2YTG A;  4F6M A;  2JPA A;  4OX9 E;  3HTX A;  3HXL A;  3O2R B;  1PJQ A;  1IQO A;  2V83 A;  2EPC A;  2EMK A;  3ADJ A;  2YRK A;  4JI4 E;  2YZT A;  4NXN E;  1EH7 A;  3KZY A;  4WX9 A;  2CTD A;  4LF4 E;  1YUJ A;  2L6M A;  3O2R A;  2EOZ A;  2EN4 A;  4BCA A;  4LF5 E;  1X49 A;  4BC9 A;  2EN7 A;  1EH8 A;  1A1I A;  4R2P A;  5IT9 C;  2FGG A;  2EOY A;  2LJH A;  2YU8 A;  1IMU A;  4LFA E;  4IS1 C;  1AH5 A;  1QU6 A;  1YZ9 A;  2FTX B;  4R2C A;  5AAS A;  4WYQ B;  2HC5 A;  3VYY A;  4B3S E;  1N34 E;  1IBL E;  1RC7 A;  4RHB B;  2EPP A;  2BBG A;  4KZS A;  5LMN E;  2B7T A;  4R8O A;  4R2R A;  5KL5 A;  1X6E A;  2JR1 A;  2N3G A;  2F4V E;  3DF6 A;  2LTR A;  4O24 A;  1X6F A;  2LE2 A;  5LLQ A;  2HGH A;  1T4L B;  1NCS A;  4MLQ A;  2LJU A;  2EL5 A;  2RQL A;  1N33 E;  2KON A;  3ZOQ B;  1ZBT A;  3ECR A;  4B3R E;  2WBT A;  3J80 C;  2ADR A;  4JI3 E;  4I8O A;  4GKJ E; 
#chains in the Genus database with same CATH homology
 4X64 E;  4JYA E;  3J81 C;  2L2K B;  4DR1 E;  1JFZ A;  4AQY E;  4B3M E;  1RC5 A;  2DIX A;  2UU9 E;  4JI0 E;  1WHN A;  2JOX A;  2YT4 A;  4P78 A;  4F54 A;  2QVW A;  1I4S A;  1RQ0 A;  5IWA E;  1X47 A;  3JU0 A;  3T1H E;  2RS7 A;  2EZ6 A;  2DSY A;  2F8B A;  1PKP A;  3AV0 A;  4J8Z A;  2G7H A;  4BMJ A;  1X48 A;  2LUP B;  2B9D A;  4WSP A;  4DR5 E;  3T1Y E;  4K0K E;  2DMY A;  3DJW A;  3VK6 A;  1IBK E;  2V86 A;  2UUC E;  2VF1 A;  5T6J A;  4P7D A;  5FLX C;  1XNQ E;  5CFF E;  3OTO E;  4L8N A;  1U61 A;  1YYW A;  2IHR 1;  4DV6 E;  4DV2 E;  2L2M A;  4DR6 E;  2EB1 A;  1J26 A;  1HNX E;  4X66 E;  4WFT A;  4JI5 E;  2LMZ A;  4DV1 E;  2E1M A;  3ADI A;  4LF8 E;  4BC7 A;  2EWL A;  3C4T A;  2UUB E;  2ODR D;  2L92 A;  3LLH A;  2UXD E;  2KHX A;  2JWO A;  2ODR C;  3IWC A;  4BBY A;  1STU A;  4BS9 A;  4DUY E;  1YYK A;  2E5L E;  4KHP E;  1UIL A;  4DKK A;  4OX9 E;  3RV1 A;  4X62 E;  3HTX A;  4JI2 E;  3HXL A;  2H36 X;  3O2R B;  2B3T B;  2L2N A;  1UHZ A;  4F9A B;  3J7A G;  1EKZ A;  3ADL A;  4DR3 E;  2FFL A;  1J5E E;  2NUG A;  4GKK E;  2VQF E;  3HPS A;  4M2Z A;  2V83 A;  3J7Y p;  1DQ3 A;  3ADJ A;  2MC5 A;  4JI4 E;  2V87 A;  2YZT A;  4NXN E;  3FIG A;  3IWB A;  4WPY A;  2KOU A;  4X65 E;  2V89 A;  5AE1 A;  4LFB E;  2UXB E;  1N36 E;  2RTX A;  1FKA E;  4LF4 E;  5AE2 A;  2UXC E;  3LML A;  2L6M A;  3O2R A;  4LTY A;  4GEQ B;  3C4B A;  2V88 A;  2NUF A;  4BCA A;  4LFC E;  4LF5 E;  4DR7 E;  3KWR A;  3F6H A;  1N32 E;  1X49 A;  2B7V A;  1T4N A;  2M1S A;  2V85 A;  3JTZ A;  4BC9 A;  2L33 A;  4YHH E;  2M4I A;  3HPZ A;  2VQE E;  4DV4 E;  4F9C B;  5IT9 C;  2FGG A;  4LU9 A;  1HR0 E;  4F9B B;  3ADG A;  5LL6 R;  2LJH A;  2JY9 A;  4LFA E;  4DR4 E;  2NA2 A;  2VE7 C;  4JI6 E;  3H09 A;  4TUI A;  2DB2 A;  1YYO A;  4X8W A;  4DV5 E;  2V8Q B;  1QU6 A;  4DV7 E;  2JOB A;  1YZ9 A;  2L8T A;  2FTX B;  2LBS B;  5AAS A;  4LF6 E;  4WYQ B;  3MSW A;  1O0W A;  2WZO A;  2LTS A;  3F6G A;  3VYY A;  1N34 E;  1IBL E;  4B3S E;  4JV5 E;  1RC7 A;  2NUE A;  1I94 E;  1T4O A;  3HQ1 A;  1DI2 A;  1SR9 A;  5DNY A;  4OOG C;  4M30 A;  4KZS A;  2GSL A;  5AE3 A;  5LMN E;  4LF9 E;  2B7T A;  4TUG A;  1GZ6 A;  1WHQ A;  4R8O A;  1XMO E;  2JVA A;  4L5N C;  1XNR E;  3N3W A;  4GKJ E;  5F3W A;  1FJG E;  4JI8 E;  5A2Q C;  4JI7 E;  4LF7 E;  4DUZ E;  2JR1 A;  1ZBQ A;  2CPN A;  2N3G A;  1XMQ E;  2MC6 A;  4B3T E;  2F4V E;  4JI1 E;  4OUN A;  3RV0 A;  2LTR A;  3DF6 A;  3P1X A;  2ZM6 E;  2L3J A;  2LE2 A;  1GQE A;  2M7Q A;  4DV3 E;  1HNW E;  2K4V A;  1T4L B;  5BR8 E;  3AUZ A;  2UUA E;  2MDR A;  2FV4 B;  2RSM A;  4DR2 E;  4R03 A;  4Q28 A;  1IBM E;  3K6Q A;  4NXM E;  1WXR A;  3OML A;  3VYX A;  1N33 E;  2KON A;  3ZOQ B;  1ZBT A;  2HHH E;  4B3R E;  2RS6 A;  3JAM C;  3J80 C;  4DMI A;  4M0V A;  4DV0 E;  2LRS A;  2LUQ A;  3RMP A;  2N3H A;  2L3C A;  4JI3 E;  5LMU E;  2A11 A;  4I8O A;  1HNZ E;  3IWD A;  4YY3 E;  5ADZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...