2EZ6A

Crystal structure of aquifex aeolicus rnase iii (d44n) complexed with product of double-stranded rna processing
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
218
structure length
218
Chain Sequence
MLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGNALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight into the Mechanism of Double-Stranded RNA Processing by Ribonuclease III.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
molecule keywords 28-MER
total genus 80
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2005-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 2ez6A01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ez6A02
4DV5E 1XMOE 1XNQE 1UILA 3ADIA 4JI6E 1RQ0A 1UHZA 4JI0E 2LUPB 3ADGA 4LF5E 1RC7A 1T4NA 1XMQE 3RV1A 1QU6A 2NUFA 1DI2A 4DV3E 5CFFE 4LF8E 4JI8E 3T1HE 5BR8E 4X64E 4DR1E 1N32E 4K0KE 1HR0E 4JYAE 2GSLA 2NUEA 3LLHA 3HTXA 4DV7E 2JVAA 4DR7E 4DV1E 2EB1A 4DV0E 2LBSB 2LUQA 4DKKA 1IBKE 4KHPE 1ZBTA 1HNZE 4JI4E 2VQEE 2RSMA 4JI3E 2NUGA 4GKJE 1FJGE 1O0WA 2A11A 4X66E 2LJHA 4JV5E 2L2NA 2UUAE 4WFTA 2L33A 1J5EE 5LMNE 3C4TA 1YYWA 3O2RA 2B7VA 2N3GA 2YT4A 4LF9E 1X47A 3C4BA 4YHHE 1T4OA 3OTOE 2UUCE 4NXNE 1HNXE 4B3SE 2L3CA 1JFZA 4M2ZA 3ADLA 2L2MA 4DR4E 2N3HA 3VYXA 4LFAE 4NXME 4DUZE 1PKPA 4AQYE 3ADJA 2E5LE 4JI2E 4LF7E 2MDRA 5LMUE 2B3TB 4LF4E 2F4VE 2DIXA 4JI7E 1WHQA 1RC5A 3O2RB 2HHHE 3P1XA 4YY3E 2UU9E 2EZ6A 2B7TA 4DR6E 4WYQB 4JI1E 4JI5E 4X65E 2RS6A 1GQEA 2DMYA 2UXBE 2UXDE 5IWAE 2UXCE 3N3WA 4X8WA 4DV2E 2L2KB 2LTRA 4DR5E 2CPNA 1FKAE 4LFCE 1X48A 2RTXA 2LTSA 4DV4E 1YZ9A 1IBME 4GKKE 4DR3E 4B3ME 2UUBE 1N33E 2LRSA 3J7Yp 4B3TE 4DV6E 1N34E 4B3RE 1X49A 4DR2E 1WHNA 4LF6E 2FFLA 1T4LB 1J26A 3RV0A 1HNWE 1YYOA 2DB2A 2L3JA 2QVWA 3VYYA 4X62E 1U61A 1STUA 1N36E 1I94E 1I4SA 3T1YE 4OX9E 4LFBE 4OOGC 2JY9A 1IBLE 2RS7A 2VQFE 2NA2A 4OUNA 1XNRE 2IHR1 1EKZA 4DUYE 2KHXA 2ZM6E 1YYKA 4M30A
chains in the Genus database with same CATH superfamily
4DV5E 2EPCA 2YTGA 1SFEA 2EMWA 2YPNA 4JI0E 4IS1C 3EPKA 3JAMC 2EM7A 2EOHA 1RC7A 4I8OA 5KL7A 2WCC3 2NUFA 4BC9A 4DV3E 3BGHA 3THOB 5DNYA 3T1HE 4X64E 4K0KE 4WSGA 2NUEA 2EMLA 2G7HA 3MSWA 2V85A 2ENAA 4DV1E 2EN2A 2M4IA 4KHPE 4BBYA 1HNZE 3BBGA 5KL5A 2VQEE 1EH6A 5AE1A 4R2CA 2Q8UA 3HPZA 4JV5E 1SR9A 4BCAA 4WFTA 2FTXB 2YU8A 2H36X 3C4TA 2B7VA 2EM6A 1WXRA 2EOEA 1G2DC 1X47A 3C4BA 1JK2A 2V83A 4NXNE 2ENHA 2YTQA 4B3SE 2EM4A 3KZZA 3QG5C 3JTZA 2VRDA 1JFZA 5IV8B 4DR4E 2N3HA 2M9AA 3HXLA 5A6BA 2GPIA 2YTDA 4TUGA 3J80C 2R1FA 4DUZE 2CSHA 1PJSA 4JI2E 2JPAA 4LF7E 2EOFA 2F4VE 4ZYDA 4F2JC 1A1LA 4WX9A 1RC5A 3P1XA 4GZNC 4HTGA 4FK5C 5TSEA 2DLKA 1YPNA 4R2AA 1GQEA 2DMYA 3C6MA 4O43A 2UXBE 2WBTA 3N3WA 4GEQB 5LL6R 1FKAE 2RTXA 4R2RA 4DV4E 1PJQA 2EM0A 1N33E 5AASA 4R2EA 3J7Yp 2MDGA 4B3TE 1KJKA 1A1HA 2FFLA 1T4LB 2EPAA 3RV0A 5A2QC 2B9DA 2L6MA 3DF6A 2QVWA 3BF2A 3VYYA 1U61A 2EPMX 4KWYA 4OX9E 2V87A 2EMXA 3MHHC 2RS7A 2JWOA 2YRKA 2EJ4A 2IHR1 3IWBA 2ODRD 2ZM6E 1YYKA 3VYXA 1GTKA 5FLXC 2EN4A 1MEYC 4L5NC 3ADGA 1AAYA 4BHBA 2DSYA 2YTNA 1T4NA 1AH5A 2EMCA 1XMQE 2EPPA 4R2SA 3RV1A 3RMPA 2V89A 5KL3A 2YSOA 2EQ1A 5AC4A 4X9JA 2EPOA 2EM2A 2GSLA 2RQLA 4DR7E 3C6KA 1IBKE 4WXDA 2RSMA 4GKJE 4DMIA 1LLMC 1L4SA 5IT9C 2YWQA 4MLVA 2YTFA 3O2RA 3VK6A 4J8ZA 2NABA 4LF9E 2EMAA 2EPRA 1YUJA 2MKDA 3OTOE 2LE2A 4IJDA 3UK3C 2LVHA 1MGTA 3F6GA 2L3CA 4BS9A 2EMBA 5KL2A 2L2MA 4AQYE 2MKNA 2MDRA 3ECRA 4RHBB 4WSPA 4LF4E 2EPXA 2D9HA 4F9BB 2A25A 2EMKA 3O2RB 2HC5A 2EM3A 4F9CB 1X6FA 3M99B 5AE2A 1EH8A 2EZ6A 2EPNA 1TF6A 4JI1E 2DMIA 5LLQA 2I13A 2UXDE 1X3CA 2ELZA 4X8WA 2L2KB 2LTRA 2CPNA 1ZBQA 4WPYA 1YZ9A 4BMJA 1IBME 4B3ME 2EMIA 2LRSA 5A6AA 4HEIA 4O24A 4LTYA 2EMFA 2EP3A 2E1MA 2EQ0A 2L92A 4LF6E 5A6KA 2LT7A 2DB2A 2EM9A 4F9AB 1STUA 5AE3A 4OOGC 2YU5A 1ZU1A 2EOSA 2JY9A 1IBLE 2F8BA 2EMZA 2M1SA 2NA2A 1XNRE 4Q35B 2JP9A 2EM8A 1WJPA 2EN6A 2JXPA 4DUYE 2FGGA 4P7DA 1XNQE 1XMOE 5ADZA 1UILA 3ADIA 4JI6E 2EOMA 1T39A 1UHZA 2LUPB 3HQ1A 5A6BD 1QU6A 1DI2A 2YTEA 3DJWA 5CFFE 4LF8E 4R03A 3LMLA 1NCSA 5BR8E 1N32E 4R2DA 1YUIA 1HR0E 4JYAE 2EL6A 2LJUA 5KL6A 5IXMB 3LLHA 3HTXA 2JVAA 2DLQA 2EB1A 4DV0E 3AV0A 2LUQA 4DKKA 3IWCA 1ZBTA 4O5GA 2EMGA 2R76A 1A1FA 2NUGA 1FJGE 2A11A 4X66E 3AUZA 2EPUA 4TUIA 2L2NA 2RPCA 2UUAE 2ENCA 2EOYA 2WZOA 1F2IG 1WRJA 3IWDA 2YTJA 1T4OA 3L00A 2UUCE 3EPHA 1G2FC 3FIGA 1HNXE 2V86A 3MHSC 2GLIA 2EE8A 4L8NA 2ADRA 4M0VA 1IMUA 5T6JA 3J7AG 5F3WA 2EOIA 1PKPA 1N3GA 4F6NA 2I9IA 2MC6A 5LMUE 2JOBA 2B3TB 2EPZA 4Q28A 2DIXA 4JI7E 2HHHE 2WBSA 2LO3A 2UU9E 2BBGA 2V88A 2B7TA 4WYQB 4BHCA 4F6MA 4JI5E 1ZR9A 3HPSA 2WBUA 1BBOA 2HGHA 2UXCE 2EMYA 2EQ3A 4NHRA 4F54A 1GZ6A 4DV2E 3KZYA 1YFHA 2EPKX 1X48A 2LTSA 4GKKE 1ZAAC 2UUBE 4DV6E 2LV2A 1N34E 4B3RE 1DQ3A 2PRTA 4DR2E 2V8QB 1HNWE 1YYOA 4LU9A 2L3JA 1N36E 1I94E 1I4SA 3T1YE 4LFBE 3OMLA 2EN1A 2N8XA 2M7QA 2EMHA 4O4KA 2L8TA 4OUNA 2LMZA 2EOQA 2EM5A 4ZYHA 2EORA 1RMDA 1IQSA 2RSIA 2K7IA 1RQ0A 2ELYA 2EOZA 2EOXA 1NEIA 4LF5E 1A1GA 1X5WA 3H09A 1UBDC 2EOJA 1ZTDA 2YTIA 4JI8E 4R2PA 4R2QA 4DR1E 1BB8A 4MLQA 4DV7E 3EQ1A 1BBGA 2LBSB 2GHFA 2KOUA 2VF1A 4R8OA 4JI4E 2ODRC 4JI3E 1O0WA 4KZSA 2YRHA 3F6HA 2LJHA 3EPLA 4BC7A 4M9VC 1TF3A 2L33A 3BIDA 5KL4A 5LMNE 1J5EE 1YYWA 1YSAC 2N3GA 2DGCA 1KYQA 2YT4A 1B69A 3EPJA 2EN3A 2CTDA 4YHHE 2EWLA 2KONA 1A1IA 1P47A 2EN7A 3K6QA 2EOOA 1DGCA 3ZOQB 4M2ZA 3ADLA 3TQMA 2VE7C 4NZVA 1PDAA 4LFAE 1JK1A 2MC5A 4NXME 2YTOA 3ADJA 2EL4A 2YSPA 2E5LE 3VHTB 3J81C 1WHQA 4ZYEA 2CT1A 2EN8A 2JR1A 4YY3E 4DR6E 5AC5A 1QNTA 4WXCA 4X65E 1A1KA 1PJTA 2RS6A 2J7JA 2E72A 5IWAE 1A1JA 1UN6B 1T38A 4RH8A 2HJJA 3JU0A 4DR5E 2YRMA 4N4RB 3THNA 4LFCE 4DR3E 2JOXA 1TN9A 1EH7A 1X49A 1WHNA 1J26A 1Z1BA 5A6JA 5A69A 2LCEA 4X62E 2FV4B 2DRPA 1X6HA 2EPLX 1IQOA 1X6EA 2BB8A 2K4VA 2JYAA 2VQFE 4ZYGA 1EKZA 2KHXA 2EL5A 3KWRA 2YZTA 4M30A 4P78A 2YTPA
chains in the Genus database with same CATH topology
5FLXC 4DV5E 1XMOE 1XNQE 5ADZA 1UILA 3ADIA 4JI6E 4L5NC 1RQ0A 1UHZA 4JI0E 2LUPB 3ADGA 4LF5E 3HQ1A 2DSYA 3JAMC 1RC7A 1T4NA 4I8OA 3H09A 1XMQE 3RV1A 1QU6A 2NUFA 3RMPA 4BC9A 2V89A 4DV3E 1DI2A 3DJWA 5CFFE 4LF8E 4R03A 3LMLA 4JI8E 5DNYA 5BR8E 4X64E 3T1HE 4DR1E 1N32E 4K0KE 1HR0E 4JYAE 2GSLA 2NUEA 2G7HA 3LLHA 3HTXA 3MSWA 4DV7E 2JVAA 2V85A 4DR7E 4DV1E 2EB1A 4DV0E 3AV0A 2LBSB 2LUQA 4DKKA 2KOUA 2M4IA 3IWCA 4BBYA 1ZBTA 2VF1A 4R8OA 1IBKE 1HNZE 4JI4E 2VQEE 2ODRC 2RSMA 4JI3E 2NUGA 5AE1A 4GKJE 1FJGE 1O0WA 4KZSA 2A11A 4DMIA 4KHPE 4X66E 3AUZA 3F6HA 3HPZA 4TUIA 2LJHA 4JV5E 2L2NA 1SR9A 4BCAA 2UUAE 5IT9C 4WFTA 4BC7A 2FTXB 2WZOA 2L33A 1J5EE 2H36X 5LMNE 3C4TA 1YYWA 3O2RA 2B7VA 2N3GA 2YT4A 4J8ZA 3VK6A 1WXRA 4LF9E 3IWDA 1X47A 3C4BA 4YHHE 1T4OA 3OTOE 2EWLA 2LE2A 2UUCE 2KONA 2V83A 4NXNE 3FIGA 3K6QA 2V86A 1HNXE 3F6GA 4B3SE 2L3CA 4BS9A 3JTZA 3ZOQB 1JFZA 4M2ZA 4L8NA 4M0VA 2L2MA 3ADLA 4DR4E 2N3HA 3HXLA 2VE7C 5T6JA 3J7AG 3VYXA 5F3WA 4TUGA 4LFAE 2MC5A 3J80C 4NXME 4DUZE 1PKPA 4AQYE 3ADJA 2E5LE 4JI2E 4LF7E 2MC6A 2MDRA 5LMUE 2JOBA 2B3TB 4WSPA 4LF4E 2F4VE 4F9BB 3J81C 4Q28A 2DIXA 4JI7E 1WHQA 1RC5A 3O2RB 2HHHE 4F9CB 2JR1A 3P1XA 5AE2A 4YY3E 2UU9E 2EZ6A 2V88A 2B7TA 4DR6E 4WYQB 4JI1E 4JI5E 4X65E 2RS6A 1GQEA 2DMYA 3HPSA 2UXBE 2UXDE 5IWAE 2UXCE 3N3WA 4GEQB 1GZ6A 4X8WA 2LTRA 3JU0A 4F54A 2L2KB 4DV2E 4DR5E 2CPNA 5LL6R 1FKAE 4LFCE 1X48A 2RTXA 1ZBQA 2LTSA 4WPYA 1YZ9A 4BMJA 4DV4E 1IBME 4DR3E 4GKKE 2JOXA 4B3ME 2UUBE 1N33E 2LRSA 5AASA 3J7Yp 4B3TE 4LTYA 4DV6E 1N34E 4B3RE 1X49A 1DQ3A 4DR2E 1WHNA 2E1MA 2L92A 2FFLA 2V8QB 1T4LB 4LF6E 1J26A 3RV0A 5A2QC 2B9DA 1YYOA 1HNWE 4LU9A 2L6MA 2DB2A 3DF6A 2QVWA 2L3JA 4X62E 3VYYA 4F9AB 1U61A 1STUA 1N36E 2FV4B 1I4SA 3T1YE 2V87A 1I94E 5AE3A 4OX9E 3OMLA 4OOGC 4LFBE 2JY9A 1IBLE 2F8BA 2RS7A 2K4VA 2M7QA 2JWOA 2M1SA 2NA2A 2VQFE 2L8TA 4OUNA 2LMZA 1XNRE 2IHR1 3IWBA 4DUYE 1EKZA 2FGGA 2KHXA 2ODRD 3KWRA 2YZTA 1YYKA 2ZM6E 4M30A 4P78A 4P7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 E;  1XMO E;  1XNQ E;  1UIL A;  3ADI A;  4JI6 E;  1RQ0 A;  1UHZ A;  4JI0 E;  2LUP B;  3ADG A;  4LF5 E;  1RC7 A;  1T4N A;  1XMQ E;  3RV1 A;  1QU6 A;  2NUF A;  1DI2 A;  4DV3 E;  5CFF E;  4LF8 E;  4JI8 E;  3T1H E;  5BR8 E;  4X64 E;  4DR1 E;  1N32 E;  4K0K E;  1HR0 E;  4JYA E;  2GSL A;  2NUE A;  3LLH A;  3HTX A;  4DV7 E;  2JVA A;  4DR7 E;  4DV1 E;  2EB1 A;  4DV0 E;  2LBS B;  2LUQ A;  4DKK A;  1IBK E;  4KHP E;  1ZBT A;  1HNZ E;  4JI4 E;  2VQE E;  2RSM A;  4JI3 E;  2NUG A;  4GKJ E;  1FJG E;  1O0W A;  2A11 A;  4X66 E;  2LJH A;  4JV5 E;  2L2N A;  2UUA E;  4WFT A;  2L33 A;  1J5E E;  5LMN E;  3C4T A;  1YYW A;  3O2R A;  2B7V A;  2N3G A;  2YT4 A;  4LF9 E;  1X47 A;  3C4B A;  4YHH E;  1T4O A;  3OTO E;  2UUC E;  4NXN E;  1HNX E;  4B3S E;  2L3C A;  1JFZ A;  4M2Z A;  3ADL A;  2L2M A;  4DR4 E;  2N3H A;  3VYX A;  4LFA E;  4NXM E;  4DUZ E;  1PKP A;  4AQY E;  3ADJ A;  2E5L E;  4JI2 E;  4LF7 E;  2MDR A;  5LMU E;  2B3T B;  4LF4 E;  2F4V E;  2DIX A;  4JI7 E;  1WHQ A;  1RC5 A;  3O2R B;  2HHH E;  3P1X A;  4YY3 E;  2UU9 E;  2EZ6 A;  2B7T A;  4DR6 E;  4WYQ B;  4JI1 E;  4JI5 E;  4X65 E;  2RS6 A;  1GQE A;  2DMY A;  2UXB E;  2UXD E;  5IWA E;  2UXC E;  3N3W A;  4X8W A;  4DV2 E;  2L2K B;  2LTR A;  4DR5 E;  2CPN A;  1FKA E;  4LFC E;  1X48 A;  2RTX A;  2LTS A;  4DV4 E;  1YZ9 A;  1IBM E;  4GKK E;  4DR3 E;  4B3M E;  2UUB E;  1N33 E;  2LRS A;  3J7Y p;  4B3T E;  4DV6 E;  1N34 E;  4B3R E;  1X49 A;  4DR2 E;  1WHN A;  4LF6 E;  2FFL A;  1T4L B;  1J26 A;  3RV0 A;  1HNW E;  1YYO A;  2DB2 A;  2L3J A;  2QVW A;  3VYY A;  4X62 E;  1U61 A;  1STU A;  1N36 E;  1I94 E;  1I4S A;  3T1Y E;  4OX9 E;  4LFB E;  4OOG C;  2JY9 A;  1IBL E;  2RS7 A;  2VQF E;  2NA2 A;  4OUN A;  1XNR E;  2IHR 1;  1EKZ A;  4DUY E;  2KHX A;  2ZM6 E;  1YYK A;  4M30 A; 
#chains in the Genus database with same CATH topology
 4DV5 E;  2EPC A;  2YTG A;  1SFE A;  2EMW A;  2YPN A;  4JI0 E;  4IS1 C;  3EPK A;  3JAM C;  2EM7 A;  2EOH A;  1RC7 A;  4I8O A;  5KL7 A;  2WCC 3;  2NUF A;  4BC9 A;  4DV3 E;  3BGH A;  3THO B;  5DNY A;  3T1H E;  4X64 E;  4K0K E;  4WSG A;  2NUE A;  2EML A;  2G7H A;  3MSW A;  2V85 A;  2ENA A;  4DV1 E;  2EN2 A;  2M4I A;  4KHP E;  4BBY A;  1HNZ E;  3BBG A;  5KL5 A;  2VQE E;  1EH6 A;  5AE1 A;  4R2C A;  2Q8U A;  3HPZ A;  4JV5 E;  1SR9 A;  4BCA A;  4WFT A;  2FTX B;  2YU8 A;  2H36 X;  3C4T A;  2B7V A;  2EM6 A;  1WXR A;  2EOE A;  1G2D C;  1X47 A;  3C4B A;  1JK2 A;  2V83 A;  4NXN E;  2ENH A;  2YTQ A;  4B3S E;  2EM4 A;  3KZZ A;  3QG5 C;  3JTZ A;  2VRD A;  1JFZ A;  5IV8 B;  4DR4 E;  2N3H A;  2M9A A;  3HXL A;  5A6B A;  2GPI A;  2YTD A;  4TUG A;  3J80 C;  2R1F A;  4DUZ E;  2CSH A;  1PJS A;  4JI2 E;  2JPA A;  4LF7 E;  2EOF A;  2F4V E;  4ZYD A;  4F2J C;  1A1L A;  4WX9 A;  1RC5 A;  3P1X A;  4GZN C;  4HTG A;  4FK5 C;  5TSE A;  2DLK A;  1YPN A;  4R2A A;  1GQE A;  2DMY A;  3C6M A;  4O43 A;  2UXB E;  2WBT A;  3N3W A;  4GEQ B;  5LL6 R;  1FKA E;  2RTX A;  4R2R A;  4DV4 E;  1PJQ A;  2EM0 A;  1N33 E;  5AAS A;  4R2E A;  3J7Y p;  2MDG A;  4B3T E;  1KJK A;  1A1H A;  2FFL A;  1T4L B;  2EPA A;  3RV0 A;  5A2Q C;  2B9D A;  2L6M A;  3DF6 A;  2QVW A;  3BF2 A;  3VYY A;  1U61 A;  2EPM X;  4KWY A;  4OX9 E;  2V87 A;  2EMX A;  3MHH C;  2RS7 A;  2JWO A;  2YRK A;  2EJ4 A;  2IHR 1;  3IWB A;  2ODR D;  2ZM6 E;  1YYK A;  3VYX A;  1GTK A;  5FLX C;  2EN4 A;  1MEY C;  4L5N C;  3ADG A;  1AAY A;  4BHB A;  2DSY A;  2YTN A;  1T4N A;  1AH5 A;  2EMC A;  1XMQ E;  2EPP A;  4R2S A;  3RV1 A;  3RMP A;  2V89 A;  5KL3 A;  2YSO A;  2EQ1 A;  5AC4 A;  4X9J A;  2EPO A;  2EM2 A;  2GSL A;  2RQL A;  4DR7 E;  3C6K A;  1IBK E;  4WXD A;  2RSM A;  4GKJ E;  4DMI A;  1LLM C;  1L4S A;  5IT9 C;  2YWQ A;  4MLV A;  2YTF A;  3O2R A;  3VK6 A;  4J8Z A;  2NAB A;  4LF9 E;  2EMA A;  2EPR A;  1YUJ A;  2MKD A;  3OTO E;  2LE2 A;  4IJD A;  3UK3 C;  2LVH A;  1MGT A;  3F6G A;  2L3C A;  4BS9 A;  2EMB A;  5KL2 A;  2L2M A;  4AQY E;  2MKN A;  2MDR A;  3ECR A;  4RHB B;  4WSP A;  4LF4 E;  2EPX A;  2D9H A;  4F9B B;  2A25 A;  2EMK A;  3O2R B;  2HC5 A;  2EM3 A;  4F9C B;  1X6F A;  3M99 B;  5AE2 A;  1EH8 A;  2EZ6 A;  2EPN A;  1TF6 A;  4JI1 E;  2DMI A;  5LLQ A;  2I13 A;  2UXD E;  1X3C A;  2ELZ A;  4X8W A;  2L2K B;  2LTR A;  2CPN A;  1ZBQ A;  4WPY A;  1YZ9 A;  4BMJ A;  1IBM E;  4B3M E;  2EMI A;  2LRS A;  5A6A A;  4HEI A;  4O24 A;  4LTY A;  2EMF A;  2EP3 A;  2E1M A;  2EQ0 A;  2L92 A;  4LF6 E;  5A6K A;  2LT7 A;  2DB2 A;  2EM9 A;  4F9A B;  1STU A;  5AE3 A;  4OOG C;  2YU5 A;  1ZU1 A;  2EOS A;  2JY9 A;  1IBL E;  2F8B A;  2EMZ A;  2M1S A;  2NA2 A;  1XNR E;  4Q35 B;  2JP9 A;  2EM8 A;  1WJP A;  2EN6 A;  2JXP A;  4DUY E;  2FGG A;  4P7D A;  1XNQ E;  1XMO E;  5ADZ A;  1UIL A;  3ADI A;  4JI6 E;  2EOM A;  1T39 A;  1UHZ A;  2LUP B;  3HQ1 A;  5A6B D;  1QU6 A;  1DI2 A;  2YTE A;  3DJW A;  5CFF E;  4LF8 E;  4R03 A;  3LML A;  1NCS A;  5BR8 E;  1N32 E;  4R2D A;  1YUI A;  1HR0 E;  4JYA E;  2EL6 A;  2LJU A;  5KL6 A;  5IXM B;  3LLH A;  3HTX A;  2JVA A;  2DLQ A;  2EB1 A;  4DV0 E;  3AV0 A;  2LUQ A;  4DKK A;  3IWC A;  1ZBT A;  4O5G A;  2EMG A;  2R76 A;  1A1F A;  2NUG A;  1FJG E;  2A11 A;  4X66 E;  3AUZ A;  2EPU A;  4TUI A;  2L2N A;  2RPC A;  2UUA E;  2ENC A;  2EOY A;  2WZO A;  1F2I G;  1WRJ A;  3IWD A;  2YTJ A;  1T4O A;  3L00 A;  2UUC E;  3EPH A;  1G2F C;  3FIG A;  1HNX E;  2V86 A;  3MHS C;  2GLI A;  2EE8 A;  4L8N A;  2ADR A;  4M0V A;  1IMU A;  5T6J A;  3J7A G;  5F3W A;  2EOI A;  1PKP A;  1N3G A;  4F6N A;  2I9I A;  2MC6 A;  5LMU E;  2JOB A;  2B3T B;  2EPZ A;  4Q28 A;  2DIX A;  4JI7 E;  2HHH E;  2WBS A;  2LO3 A;  2UU9 E;  2BBG A;  2V88 A;  2B7T A;  4WYQ B;  4BHC A;  4F6M A;  4JI5 E;  1ZR9 A;  3HPS A;  2WBU A;  1BBO A;  2HGH A;  2UXC E;  2EMY A;  2EQ3 A;  4NHR A;  4F54 A;  1GZ6 A;  4DV2 E;  3KZY A;  1YFH A;  2EPK X;  1X48 A;  2LTS A;  4GKK E;  1ZAA C;  2UUB E;  4DV6 E;  2LV2 A;  1N34 E;  4B3R E;  1DQ3 A;  2PRT A;  4DR2 E;  2V8Q B;  1HNW E;  1YYO A;  4LU9 A;  2L3J A;  1N36 E;  1I94 E;  1I4S A;  3T1Y E;  4LFB E;  3OML A;  2EN1 A;  2N8X A;  2M7Q A;  2EMH A;  4O4K A;  2L8T A;  4OUN A;  2LMZ A;  2EOQ A;  2EM5 A;  4ZYH A;  2EOR A;  1RMD A;  1IQS A;  2RSI A;  2K7I A;  1RQ0 A;  2ELY A;  2EOZ A;  2EOX A;  1NEI A;  4LF5 E;  1A1G A;  1X5W A;  3H09 A;  1UBD C;  2EOJ A;  1ZTD A;  2YTI A;  4JI8 E;  4R2P A;  4R2Q A;  4DR1 E;  1BB8 A;  4MLQ A;  4DV7 E;  3EQ1 A;  1BBG A;  2LBS B;  2GHF A;  2KOU A;  2VF1 A;  4R8O A;  4JI4 E;  2ODR C;  4JI3 E;  1O0W A;  4KZS A;  2YRH A;  3F6H A;  2LJH A;  3EPL A;  4BC7 A;  4M9V C;  1TF3 A;  2L33 A;  3BID A;  5KL4 A;  5LMN E;  1J5E E;  1YYW A;  1YSA C;  2N3G A;  2DGC A;  1KYQ A;  2YT4 A;  1B69 A;  3EPJ A;  2EN3 A;  2CTD A;  4YHH E;  2EWL A;  2KON A;  1A1I A;  1P47 A;  2EN7 A;  3K6Q A;  2EOO A;  1DGC A;  3ZOQ B;  4M2Z A;  3ADL A;  3TQM A;  2VE7 C;  4NZV A;  1PDA A;  4LFA E;  1JK1 A;  2MC5 A;  4NXM E;  2YTO A;  3ADJ A;  2EL4 A;  2YSP A;  2E5L E;  3VHT B;  3J81 C;  1WHQ A;  4ZYE A;  2CT1 A;  2EN8 A;  2JR1 A;  4YY3 E;  4DR6 E;  5AC5 A;  1QNT A;  4WXC A;  4X65 E;  1A1K A;  1PJT A;  2RS6 A;  2J7J A;  2E72 A;  5IWA E;  1A1J A;  1UN6 B;  1T38 A;  4RH8 A;  2HJJ A;  3JU0 A;  4DR5 E;  2YRM A;  4N4R B;  3THN A;  4LFC E;  4DR3 E;  2JOX A;  1TN9 A;  1EH7 A;  1X49 A;  1WHN A;  1J26 A;  1Z1B A;  5A6J A;  5A69 A;  2LCE A;  4X62 E;  2FV4 B;  2DRP A;  1X6H A;  2EPL X;  1IQO A;  1X6E A;  2BB8 A;  2K4V A;  2JYA A;  2VQF E;  4ZYG A;  1EKZ A;  2KHX A;  2EL5 A;  3KWR A;  2YZT A;  4M30 A;  4P78 A;  2YTP A; 
#chains in the Genus database with same CATH homology
 5FLX C;  4DV5 E;  1XMO E;  1XNQ E;  5ADZ A;  1UIL A;  3ADI A;  4JI6 E;  4L5N C;  1RQ0 A;  1UHZ A;  4JI0 E;  2LUP B;  3ADG A;  4LF5 E;  3HQ1 A;  2DSY A;  3JAM C;  1RC7 A;  1T4N A;  4I8O A;  3H09 A;  1XMQ E;  3RV1 A;  1QU6 A;  2NUF A;  3RMP A;  4BC9 A;  2V89 A;  4DV3 E;  1DI2 A;  3DJW A;  5CFF E;  4LF8 E;  4R03 A;  3LML A;  4JI8 E;  5DNY A;  5BR8 E;  4X64 E;  3T1H E;  4DR1 E;  1N32 E;  4K0K E;  1HR0 E;  4JYA E;  2GSL A;  2NUE A;  2G7H A;  3LLH A;  3HTX A;  3MSW A;  4DV7 E;  2JVA A;  2V85 A;  4DR7 E;  4DV1 E;  2EB1 A;  4DV0 E;  3AV0 A;  2LBS B;  2LUQ A;  4DKK A;  2KOU A;  2M4I A;  3IWC A;  4BBY A;  1ZBT A;  2VF1 A;  4R8O A;  1IBK E;  1HNZ E;  4JI4 E;  2VQE E;  2ODR C;  2RSM A;  4JI3 E;  2NUG A;  5AE1 A;  4GKJ E;  1FJG E;  1O0W A;  4KZS A;  2A11 A;  4DMI A;  4KHP E;  4X66 E;  3AUZ A;  3F6H A;  3HPZ A;  4TUI A;  2LJH A;  4JV5 E;  2L2N A;  1SR9 A;  4BCA A;  2UUA E;  5IT9 C;  4WFT A;  4BC7 A;  2FTX B;  2WZO A;  2L33 A;  1J5E E;  2H36 X;  5LMN E;  3C4T A;  1YYW A;  3O2R A;  2B7V A;  2N3G A;  2YT4 A;  4J8Z A;  3VK6 A;  1WXR A;  4LF9 E;  3IWD A;  1X47 A;  3C4B A;  4YHH E;  1T4O A;  3OTO E;  2EWL A;  2LE2 A;  2UUC E;  2KON A;  2V83 A;  4NXN E;  3FIG A;  3K6Q A;  2V86 A;  1HNX E;  3F6G A;  4B3S E;  2L3C A;  4BS9 A;  3JTZ A;  3ZOQ B;  1JFZ A;  4M2Z A;  4L8N A;  4M0V A;  2L2M A;  3ADL A;  4DR4 E;  2N3H A;  3HXL A;  2VE7 C;  5T6J A;  3J7A G;  3VYX A;  5F3W A;  4TUG A;  4LFA E;  2MC5 A;  3J80 C;  4NXM E;  4DUZ E;  1PKP A;  4AQY E;  3ADJ A;  2E5L E;  4JI2 E;  4LF7 E;  2MC6 A;  2MDR A;  5LMU E;  2JOB A;  2B3T B;  4WSP A;  4LF4 E;  2F4V E;  4F9B B;  3J81 C;  4Q28 A;  2DIX A;  4JI7 E;  1WHQ A;  1RC5 A;  3O2R B;  2HHH E;  4F9C B;  2JR1 A;  3P1X A;  5AE2 A;  4YY3 E;  2UU9 E;  2EZ6 A;  2V88 A;  2B7T A;  4DR6 E;  4WYQ B;  4JI1 E;  4JI5 E;  4X65 E;  2RS6 A;  1GQE A;  2DMY A;  3HPS A;  2UXB E;  2UXD E;  5IWA E;  2UXC E;  3N3W A;  4GEQ B;  1GZ6 A;  4X8W A;  2LTR A;  3JU0 A;  4F54 A;  2L2K B;  4DV2 E;  4DR5 E;  2CPN A;  5LL6 R;  1FKA E;  4LFC E;  1X48 A;  2RTX A;  1ZBQ A;  2LTS A;  4WPY A;  1YZ9 A;  4BMJ A;  4DV4 E;  1IBM E;  4DR3 E;  4GKK E;  2JOX A;  4B3M E;  2UUB E;  1N33 E;  2LRS A;  5AAS A;  3J7Y p;  4B3T E;  4LTY A;  4DV6 E;  1N34 E;  4B3R E;  1X49 A;  1DQ3 A;  4DR2 E;  1WHN A;  2E1M A;  2L92 A;  2FFL A;  2V8Q B;  1T4L B;  4LF6 E;  1J26 A;  3RV0 A;  5A2Q C;  2B9D A;  1YYO A;  1HNW E;  4LU9 A;  2L6M A;  2DB2 A;  3DF6 A;  2QVW A;  2L3J A;  4X62 E;  3VYY A;  4F9A B;  1U61 A;  1STU A;  1N36 E;  2FV4 B;  1I4S A;  3T1Y E;  2V87 A;  1I94 E;  5AE3 A;  4OX9 E;  3OML A;  4OOG C;  4LFB E;  2JY9 A;  1IBL E;  2F8B A;  2RS7 A;  2K4V A;  2M7Q A;  2JWO A;  2M1S A;  2NA2 A;  2VQF E;  2L8T A;  4OUN A;  2LMZ A;  1XNR E;  2IHR 1;  3IWB A;  4DUY E;  1EKZ A;  2FGG A;  2KHX A;  2ODR D;  3KWR A;  2YZT A;  1YYK A;  2ZM6 E;  4M30 A;  4P78 A;  4P7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...