2EZ6A

Crystal structure of aquifex aeolicus rnase iii (d44n) complexed with product of double-stranded rna processing
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
218
structure length
218
Chain Sequence
MLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGNALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 28-MER
publication title Structural Insight into the Mechanism of Double-Stranded RNA Processing by Ribonuclease III.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
total genus 80
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2005-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 2ez6A01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ez6A02
4X65E 3OTOE 2JVAA 4WYQB 4JI0E 4X62E 2RSMA 4OOGC 4M2ZA 3C4BA 2LBSB 2DB2A 4NXNE 4LFAE 3N3WA 1N34E 2N3HA 1J26A 1ZBTA 5BR8E 4JI6E 1YYKA 1EKZA 3T1YE 4LF5E 1PKPA 3P1XA 4JI1E 4B3RE 4KHPE 3ADLA 1T4NA 2E5LE 1RQ0A 2L2MA 1T4LB 3RV1A 4LF4E 4DUZE 1FKAE 2UXDE 1UILA 4NXME 4DV0E 4DR6E 2QVWA 2LUQA 2RS7A 3T1HE 2KHXA 1IBLE 4OUNA 2CPNA 2UXCE 2LTRA 3O2RA 4B3SE 1J5EE 5LMNE 2F4VE 2B7VA 3ADJA 1HNXE 2RTXA 4DR3E 1U61A 1FJGE 2LJHA 4GKKE 2HHHE 1GQEA 2FFLA 4M30A 1T4OA 1XNRE 4LF8E 2DIXA 4DR4E 1I4SA 2NUGA 1YYOA 1YZ9A 4DV2E 1IBME 1I94E 4LFCE 4JI7E 4LF7E 1WHNA 4DV5E 4AQYE 1XMOE 4DUYE 2VQEE 3VYXA 1JFZA 4JI8E 4GKJE 4B3ME 3ADIA 2UUCE 2L2KB 4X64E 4X66E 4YHHE 4DR5E 4JI5E 1HR0E 4K0KE 4DV7E 2EZ6A 4LF9E 2LRSA 2GSLA 4YY3E 1X48A 2UUAE 3O2RB 2UUBE 2L3CA 5LMUE 4JI4E 2L3JA 1HNZE 1N33E 2NUFA 1RC7A 2B7TA 2LUPB 1RC5A 2JY9A 1O0WA 3C4TA 4JI3E 2L33A 2A11A 4LFBE 2NUEA 4JYAE 2LTSA 1X47A 4JI2E 4OX9E 4DR7E 2IHR1 1N32E 1UHZA 1HNWE 4DV3E 3VYYA 1QU6A 3HTXA 3LLHA 1YYWA 4DR1E 4DV1E 1N36E 4B3TE 2UXBE 4DV4E 2EB1A 3RV0A 1STUA 4DR2E 1DI2A 2DMYA 2YT4A 3ADGA 3J7Yp 2N3GA 1WHQA 2MDRA 5IWAE 4DV6E 1IBKE 4LF6E 4DKKA 2RS6A 5CFFE 4JV5E 2NA2A 1XNQE 2UU9E 2VQFE 2L2NA 4X8WA 2B3TB 2ZM6E 1XMQE 4WFTA 1X49A
chains in the Genus database with same CATH superfamily
3ZOQB 2JVAA 4WYQB 1BBGA 2EM9A 2EM8A 3BBGA 4OOGC 2LBSB 2DB2A 1EH8A 2JOXA 2EPCA 2ADRA 2R1FA 2EPRA 2V86A 2EMFA 1A1JA 2RSIA 5KL2A 3IWDA 2EN1A 2V8QB 3T1YE 1PKPA 3P1XA 1A1KA 1GZ6A 1T4NA 2DLQA 4HTGA 1RQ0A 1PDAA 2EOIA 2YTQA 2B9DA 1FKAE 1UILA 4NXME 4ZYEA 4DR6E 2QVWA 2K7IA 2JWOA 2KHXA 4IJDA 2UXCE 4LTYA 2EPZA 1J5EE 2KONA 1A1HA 2ODRD 4GKKE 2EOHA 1XNRE 2A25A 4LF8E 2CT1A 2V87A 2NABA 2EL6A 3BIDA 1PJTA 2EN7A 1WHNA 4WSPA 3HPSA 3LMLA 4AQYE 2LVHA 1X6EA 2YRMA 2EMKA 4BMJA 2DRPA 1DQ3A 4ZYHA 3EPHA 3ADIA 2UUCE 2EPUA 4DR5E 4GEQB 4MLVA 1HR0E 4K0KE 4ZYGA 4DV7E 2EPAA 3M99B 4F9AB 2CTDA 2EZ6A 1X6FA 1T38A 1G2DC 2YTFA 4P78A 1X48A 3O2RB 4Q35B 2L3CA 4O24A 5KL7A 2DMIA 2EN8A 1RC7A 1NEIA 2EN4A 3C6KA 2JY9A 2I13A 4R2DA 4JI3E 2L33A 2YTEA 2YU5A 3L00A 3THNA 2JR1A 3DF6A 3JU0A 2EOOA 2EE8A 5AC4A 3RMPA 3H09A 2EOYA 1STUA 3J81C 2YT4A 3ADGA 5AE2A 2ODRC 2EQ0A 1MEYC 2RS6A 2HC5A 5FLXC 2NA2A 2EM0A 4WFTA 4X65E 2YPNA 5AE1A 2JPAA 5ADZA 4RHBB 4JI0E 1SR9A 4X62E 2FGGA 4NXNE 3MHHC 4L5NC 2EMCA 1WXRA 3VK6A 5BR8E 1ZTDA 4B3RE 3C6MA 3ADLA 2EQ1A 4J8ZA 2MC5A 3RV1A 2ELYA 5AC5A 4F9CB 2EMHA 2DGCA 3KWRA 4DV0E 2EN2A 2RS7A 3AV0A 3T1HE 3THOB 1IBLE 1EH6A 2EL5A 1JK1A 2FTXB 2MDGA 1AAYA 2GHFA 4HEIA 2EOMA 2EM7A 3KZYA 2M9AA 1X5WA 3UK3C 2YTIA 1FJGE 4O5GA 2LJHA 2HHHE 2FFLA 3BGHA 1I94E 4DV5E 1YSAC 2EMXA 4DUYE 2VQEE 3VYXA 1ZU1A 2HJJA 1YUIA 4O4KA 1A1GA 2MKNA 2YTGA 1T39A 2L2KB 1P47A 1X6HA 2JOBA 4WSGA 4GZNC 2EPLX 2J7JA 4L8NA 3J80C 2L8TA 4R2PA 4YY3E 2EL4A 2UUAE 4WXCA 2EM4A 4LU9A 2EOEA 1N33E 2NUFA 2LMZA 2LUPB 5LL6R 3EPLA 2LT7A 3C4TA 4LFBE 2A11A 2YTNA 3HPZA 2EP3A 2YWQA 4ZYDA 2LTSA 2YRKA 2YSOA 4JI2E 3OMLA 2V89A 1MGTA 2WBUA 1HNWE 3K6QA 1QU6A 4DMIA 3HTXA 1NCSA 2WZOA 4DV1E 4B3TE 4DV4E 2EB1A 4DR2E 2EPOA 2DMYA 1YFHA 1LLMC 4BBYA 3J7Yp 5IWAE 2MDRA 2N8XA 2FV4B 1IBKE 4JV5E 4DKKA 5CFFE 4BCAA 1ZR9A 5A6KA 2JP9A 2GPIA 2VQFE 2L2NA 4X8WA 5KL4A 2R76A 1X49A 2MC6A 2V88A 5KL5A 3EPKA 4IS1C 3DJWA 2EOSA 2YTOA 1KJKA 1N34E 2N3HA 3VHTB 5IV8B 1J26A 1ZBTA 1WRJA 1TF6A 2YU8A 4NZVA 5AASA 2RPCA 1EKZA 4LF5E 4KHPE 1IQSA 4JI1E 2E5LE 2EM6A 2EMLA 2L2MA 2EPXA 3F6HA 2UXDE 4R2CA 2LUQA 2EM3A 1PJQA 2LCEA 5TSEA 2VE7C 3O2RA 3AUZA 3F6GA 2EMAA 2Q8UA 2JYAA 5F3WA 3IWCA 2EPKX 4MLQA 3JTZA 2B7VA 2EOFA 5LMNE 1HNXE 2F4VE 4DR3E 2H36X 2JXPA 1T4OA 1IQOA 2M4IA 1YZ9A 4DV2E 2DSYA 1DGCA 4LFCE 4JI7E 1YUJA 2ENCA 1B69A 1XMOE 2YTJA 3BF2A 1JFZA 4KWYA 4JI8E 4GKJE 2L6MA 2BB8A 3JAMC 2I9IA 5DNYA 4YHHE 1A1LA 4BHBA 1TN9A 2EPMX 2EOXA 2EN6A 2YSPA 2BBGA 4R2EA 4RH8A 1BB8A 1A1IA 2UUBE 2LJUA 2EWLA 5LMUE 4M9VC 2WBSA 2EOZA 2L3JA 1HNZE 3KZZA 1O0WA 4BS9A 2ENAA 2EMZA 2EM2A 2YZTA 4JYAE 5IXMB 5KL3A 1JK2A 1X47A 4OX9E 2RQLA 2IHR1 1N32E 4N4RB 1UHZA 3IWBA 1RMDA 4R2QA 4DV3E 5KL6A 4X9JA 3LLHA 3EPJA 2EPPA 5IT9C 2UXBE 3RV0A 2WBTA 2ENHA 2N3GA 1WHQA 4DV6E 1TF3A 2EM5A 2VF1A 4LF6E 2MKDA 4M0VA 2K4VA 2B3TB 4F2JC 1XMQE 3EQ1A 2KOUA 3OTOE 2EOJA 3TQMA 5A2QC 2RSMA 4R8OA 4M2ZA 3C4BA 2EMYA 4LFAE 3N3WA 4R03A 2E1MA 2EORA 1AH5A 2EMBA 4NHRA 1X3CA 2M7QA 1A1FA 4JI6E 1YYKA 2L92A 2WCC3 2LO3A 5A6JA 1T4LB 5A6BD 1ZAAC 4LF4E 4DUZE 1PJSA 2EMWA 1EH7A 4WXDA 4OUNA 2CPNA 2YTDA 5LLQA 2LTRA 4BHCA 4Q28A 4B3SE 2G7HA 1IMUA 5A6BA 2VRDA 3ADJA 2RTXA 4TUIA 1U61A 1QNTA 1GQEA 4M30A 2DIXA 4DR4E 4WPYA 1I4SA 1Z1BA 2NUGA 1SFEA 2GLIA 1YYOA 1IBME 2V85A 1WJPA 4LF7E 1KYQA 1GTKA 2CSHA 4F54A 2V83A 4B3ME 4BC9A 2EQ3A 4X64E 2M1SA 4X66E 2PRTA 4KZSA 1L4SA 4JI5E 5A69A 2LV2A 1UN6B 3FIGA 4TUGA 4R2SA 5T6JA 1ZBQA 3HXLA 4LF9E 5AE3A 2LRSA 5A6AA 2GSLA 2F8BA 4I8OA 3MSWA 4JI4E 2D9HA 4FK5C 2B7TA 1YPNA 1BBOA 2EJ4A 1RC5A 2EMIA 4F9BB 2NUEA 4WX9A 4R2RA 4DR7E 2E72A 3MHSC 2EMGA 3VYYA 4R2AA 2EOQA 1YYWA 4DR1E 1N36E 1N3GA 3HQ1A 4F6MA 1DI2A 2LE2A 2YTPA 2DLKA 2YRHA 1G2FC 4BC7A 1UBDC 2HGHA 3J7AG 4P7DA 1XNQE 2UU9E 2EPNA 4F6NA 2ZM6E 2ELZA 3QG5C 3ECRA 1F2IG 4O43A 2EN3A
chains in the Genus database with same CATH topology
2KOUA 4X65E 3ZOQB 3OTOE 2JVAA 5AE1A 4WYQB 5A2QC 5ADZA 4JI0E 1SR9A 4X62E 3J7AG 2RSMA 4R8OA 3DJWA 4OOGC 4M2ZA 3C4BA 2FGGA 2DB2A 2LBSB 4NXNE 2JOXA 4LFAE 3N3WA 4R03A 2E1MA 4L5NC 1N34E 2N3HA 1WXRA 1J26A 1ZBTA 2V86A 2M7QA 3VK6A 5BR8E 3IWDA 5AASA 4JI6E 1YYKA 1EKZA 2L92A 2V8QB 1PKPA 3P1XA 3T1YE 4JI1E 4LF5E 3ADLA 1GZ6A 1T4NA 2E5LE 1RQ0A 4J8ZA 2L2MA 2V88A 2MC5A 1T4LB 1HNWE 3RV1A 4LF4E 3F6HA 4DUZE 4F9CB 4JV5E 2B9DA 3KWRA 1FKAE 1UILA 4NXME 2UXDE 4DV0E 4DR6E 2QVWA 2LUQA 2RS7A 2JWOA 3AV0A 3T1HE 2KHXA 1IBLE 4OUNA 2CPNA 4LTYA 2UXCE 2LTRA 2VE7C 3O2RA 4Q28A 4B3SE 3AUZA 3F6GA 2G7HA 1J5EE 2FTXB 5F3WA 2KONA 3IWCA 5LMNE 3JTZA 2B7VA 3ADJA 1HNXE 2F4VE 2ODRD 2RTXA 1U61A 4TUIA 4DR3E 2LJHA 2H36X 2HHHE 1GQEA 2FFLA 4M30A 1T4OA 1XNRE 4LF8E 4GKKE 2DIXA 4DR4E 4WPYA 1I4SA 2V87A 2NUGA 2M4IA 1YYOA 1YZ9A 4DV2E 1IBME 2V85A 2DSYA 1I94E 4LFCE 4JI7E 4LF7E 1WHNA 4WSPA 4DV5E 3HPSA 3LMLA 4AQYE 1XMOE 4DUYE 2VQEE 3VYXA 4F54A 4BMJA 1JFZA 4JI8E 1DQ3A 2V83A 4GKJE 4KHPE 2L6MA 4B3ME 3ADIA 4BC9A 2UUCE 3JAMC 2L2KB 4X64E 2M1SA 5DNYA 4X66E 4YHHE 4KZSA 4DR5E 4JI5E 4GEQB 3FIGA 2JOBA 4TUGA 1HR0E 4K0KE 5T6JA 4DV7E 1ZBQA 4F9AB 2EZ6A 3HXLA 4L8NA 4LF9E 5AE3A 2LRSA 3J80C 2L8TA 2GSLA 4YY3E 4P78A 1X48A 2UUAE 3O2RB 2F8BA 2UUBE 2L3CA 2EWLA 3MSWA 4I8OA 4LU9A 5LMUE 4JI4E 2L3JA 1HNZE 1N33E 2NUFA 1RC7A 2B7TA 2LMZA 2LUPB 5LL6R 1RC5A 2JY9A 1O0WA 4BS9A 3C4TA 4JI3E 2L33A 2A11A 4LFBE 4F9BB 3HPZA 2NUEA 2YZTA 4JYAE 2LTSA 2JR1A 1X47A 3DF6A 3JU0A 4JI2E 3OMLA 4OX9E 2IHR1 1N32E 4DR7E 2V89A 1UHZA 3IWBA 4DV3E 3VYYA 3K6QA 1QU6A 3RMPA 4DMIA 1IBKE 3H09A 2WZOA 3LLHA 3HTXA 1YYWA 4DR1E 4DV1E 5IT9C 1N36E 4B3TE 3HQ1A 4DV4E 2EB1A 2UXBE 3RV0A 1STUA 3J81C 4DR2E 1DI2A 2DMYA 2LE2A 2YT4A 3ADGA 5AE2A 4BBYA 3J7Yp 2N3GA 2ODRC 1WHQA 2MDRA 4BC7A 5IWAE 2FV4B 4DV6E 2VF1A 4P7DA 2RS6A 4DKKA 4BCAA 5CFFE 5FLXC 2NA2A 4M0VA 4LF6E 1XNQE 4B3RE 2UU9E 2K4VA 2VQFE 2L2NA 4X8WA 2B3TB 2ZM6E 1XMQE 4WFTA 1X49A 1FJGE 2MC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X65 E;  3OTO E;  2JVA A;  4WYQ B;  4JI0 E;  4X62 E;  2RSM A;  4OOG C;  4M2Z A;  3C4B A;  2LBS B;  2DB2 A;  4NXN E;  4LFA E;  3N3W A;  1N34 E;  2N3H A;  1J26 A;  1ZBT A;  5BR8 E;  4JI6 E;  1YYK A;  1EKZ A;  3T1Y E;  4LF5 E;  1PKP A;  3P1X A;  4JI1 E;  4B3R E;  4KHP E;  3ADL A;  1T4N A;  2E5L E;  1RQ0 A;  2L2M A;  1T4L B;  3RV1 A;  4LF4 E;  4DUZ E;  1FKA E;  2UXD E;  1UIL A;  4NXM E;  4DV0 E;  4DR6 E;  2QVW A;  2LUQ A;  2RS7 A;  3T1H E;  2KHX A;  1IBL E;  4OUN A;  2CPN A;  2UXC E;  2LTR A;  3O2R A;  4B3S E;  1J5E E;  5LMN E;  2F4V E;  2B7V A;  3ADJ A;  1HNX E;  2RTX A;  4DR3 E;  1U61 A;  1FJG E;  2LJH A;  4GKK E;  2HHH E;  1GQE A;  2FFL A;  4M30 A;  1T4O A;  1XNR E;  4LF8 E;  2DIX A;  4DR4 E;  1I4S A;  2NUG A;  1YYO A;  1YZ9 A;  4DV2 E;  1IBM E;  1I94 E;  4LFC E;  4JI7 E;  4LF7 E;  1WHN A;  4DV5 E;  4AQY E;  1XMO E;  4DUY E;  2VQE E;  3VYX A;  1JFZ A;  4JI8 E;  4GKJ E;  4B3M E;  3ADI A;  2UUC E;  2L2K B;  4X64 E;  4X66 E;  4YHH E;  4DR5 E;  4JI5 E;  1HR0 E;  4K0K E;  4DV7 E;  2EZ6 A;  4LF9 E;  2LRS A;  2GSL A;  4YY3 E;  1X48 A;  2UUA E;  3O2R B;  2UUB E;  2L3C A;  5LMU E;  4JI4 E;  2L3J A;  1HNZ E;  1N33 E;  2NUF A;  1RC7 A;  2B7T A;  2LUP B;  1RC5 A;  2JY9 A;  1O0W A;  3C4T A;  4JI3 E;  2L33 A;  2A11 A;  4LFB E;  2NUE A;  4JYA E;  2LTS A;  1X47 A;  4JI2 E;  4OX9 E;  4DR7 E;  2IHR 1;  1N32 E;  1UHZ A;  1HNW E;  4DV3 E;  3VYY A;  1QU6 A;  3HTX A;  3LLH A;  1YYW A;  4DR1 E;  4DV1 E;  1N36 E;  4B3T E;  2UXB E;  4DV4 E;  2EB1 A;  3RV0 A;  1STU A;  4DR2 E;  1DI2 A;  2DMY A;  2YT4 A;  3ADG A;  3J7Y p;  2N3G A;  1WHQ A;  2MDR A;  5IWA E;  4DV6 E;  1IBK E;  4LF6 E;  4DKK A;  2RS6 A;  5CFF E;  4JV5 E;  2NA2 A;  1XNQ E;  2UU9 E;  2VQF E;  2L2N A;  4X8W A;  2B3T B;  2ZM6 E;  1XMQ E;  4WFT A;  1X49 A; 
#chains in the Genus database with same CATH topology
 3ZOQ B;  2JVA A;  4WYQ B;  1BBG A;  2EM9 A;  2EM8 A;  3BBG A;  4OOG C;  2LBS B;  2DB2 A;  1EH8 A;  2JOX A;  2EPC A;  2ADR A;  2R1F A;  2EPR A;  2V86 A;  2EMF A;  1A1J A;  2RSI A;  5KL2 A;  3IWD A;  2EN1 A;  2V8Q B;  3T1Y E;  1PKP A;  3P1X A;  1A1K A;  1GZ6 A;  1T4N A;  2DLQ A;  4HTG A;  1RQ0 A;  1PDA A;  2EOI A;  2YTQ A;  2B9D A;  1FKA E;  1UIL A;  4NXM E;  4ZYE A;  4DR6 E;  2QVW A;  2K7I A;  2JWO A;  2KHX A;  4IJD A;  2UXC E;  4LTY A;  2EPZ A;  1J5E E;  2KON A;  1A1H A;  2ODR D;  4GKK E;  2EOH A;  1XNR E;  2A25 A;  4LF8 E;  2CT1 A;  2V87 A;  2NAB A;  2EL6 A;  3BID A;  1PJT A;  2EN7 A;  1WHN A;  4WSP A;  3HPS A;  3LML A;  4AQY E;  2LVH A;  1X6E A;  2YRM A;  2EMK A;  4BMJ A;  2DRP A;  1DQ3 A;  4ZYH A;  3EPH A;  3ADI A;  2UUC E;  2EPU A;  4DR5 E;  4GEQ B;  4MLV A;  1HR0 E;  4K0K E;  4ZYG A;  4DV7 E;  2EPA A;  3M99 B;  4F9A B;  2CTD A;  2EZ6 A;  1X6F A;  1T38 A;  1G2D C;  2YTF A;  4P78 A;  1X48 A;  3O2R B;  4Q35 B;  2L3C A;  4O24 A;  5KL7 A;  2DMI A;  2EN8 A;  1RC7 A;  1NEI A;  2EN4 A;  3C6K A;  2JY9 A;  2I13 A;  4R2D A;  4JI3 E;  2L33 A;  2YTE A;  2YU5 A;  3L00 A;  3THN A;  2JR1 A;  3DF6 A;  3JU0 A;  2EOO A;  2EE8 A;  5AC4 A;  3RMP A;  3H09 A;  2EOY A;  1STU A;  3J81 C;  2YT4 A;  3ADG A;  5AE2 A;  2ODR C;  2EQ0 A;  1MEY C;  2RS6 A;  2HC5 A;  5FLX C;  2NA2 A;  2EM0 A;  4WFT A;  4X65 E;  2YPN A;  5AE1 A;  2JPA A;  5ADZ A;  4RHB B;  4JI0 E;  1SR9 A;  4X62 E;  2FGG A;  4NXN E;  3MHH C;  4L5N C;  2EMC A;  1WXR A;  3VK6 A;  5BR8 E;  1ZTD A;  4B3R E;  3C6M A;  3ADL A;  2EQ1 A;  4J8Z A;  2MC5 A;  3RV1 A;  2ELY A;  5AC5 A;  4F9C B;  2EMH A;  2DGC A;  3KWR A;  4DV0 E;  2EN2 A;  2RS7 A;  3AV0 A;  3T1H E;  3THO B;  1IBL E;  1EH6 A;  2EL5 A;  1JK1 A;  2FTX B;  2MDG A;  1AAY A;  2GHF A;  4HEI A;  2EOM A;  2EM7 A;  3KZY A;  2M9A A;  1X5W A;  3UK3 C;  2YTI A;  1FJG E;  4O5G A;  2LJH A;  2HHH E;  2FFL A;  3BGH A;  1I94 E;  4DV5 E;  1YSA C;  2EMX A;  4DUY E;  2VQE E;  3VYX A;  1ZU1 A;  2HJJ A;  1YUI A;  4O4K A;  1A1G A;  2MKN A;  2YTG A;  1T39 A;  2L2K B;  1P47 A;  1X6H A;  2JOB A;  4WSG A;  4GZN C;  2EPL X;  2J7J A;  4L8N A;  3J80 C;  2L8T A;  4R2P A;  4YY3 E;  2EL4 A;  2UUA E;  4WXC A;  2EM4 A;  4LU9 A;  2EOE A;  1N33 E;  2NUF A;  2LMZ A;  2LUP B;  5LL6 R;  3EPL A;  2LT7 A;  3C4T A;  4LFB E;  2A11 A;  2YTN A;  3HPZ A;  2EP3 A;  2YWQ A;  4ZYD A;  2LTS A;  2YRK A;  2YSO A;  4JI2 E;  3OML A;  2V89 A;  1MGT A;  2WBU A;  1HNW E;  3K6Q A;  1QU6 A;  4DMI A;  3HTX A;  1NCS A;  2WZO A;  4DV1 E;  4B3T E;  4DV4 E;  2EB1 A;  4DR2 E;  2EPO A;  2DMY A;  1YFH A;  1LLM C;  4BBY A;  3J7Y p;  5IWA E;  2MDR A;  2N8X A;  2FV4 B;  1IBK E;  4JV5 E;  4DKK A;  5CFF E;  4BCA A;  1ZR9 A;  5A6K A;  2JP9 A;  2GPI A;  2VQF E;  2L2N A;  4X8W A;  5KL4 A;  2R76 A;  1X49 A;  2MC6 A;  2V88 A;  5KL5 A;  3EPK A;  4IS1 C;  3DJW A;  2EOS A;  2YTO A;  1KJK A;  1N34 E;  2N3H A;  3VHT B;  5IV8 B;  1J26 A;  1ZBT A;  1WRJ A;  1TF6 A;  2YU8 A;  4NZV A;  5AAS A;  2RPC A;  1EKZ A;  4LF5 E;  4KHP E;  1IQS A;  4JI1 E;  2E5L E;  2EM6 A;  2EML A;  2L2M A;  2EPX A;  3F6H A;  2UXD E;  4R2C A;  2LUQ A;  2EM3 A;  1PJQ A;  2LCE A;  5TSE A;  2VE7 C;  3O2R A;  3AUZ A;  3F6G A;  2EMA A;  2Q8U A;  2JYA A;  5F3W A;  3IWC A;  2EPK X;  4MLQ A;  3JTZ A;  2B7V A;  2EOF A;  5LMN E;  1HNX E;  2F4V E;  4DR3 E;  2H36 X;  2JXP A;  1T4O A;  1IQO A;  2M4I A;  1YZ9 A;  4DV2 E;  2DSY A;  1DGC A;  4LFC E;  4JI7 E;  1YUJ A;  2ENC A;  1B69 A;  1XMO E;  2YTJ A;  3BF2 A;  1JFZ A;  4KWY A;  4JI8 E;  4GKJ E;  2L6M A;  2BB8 A;  3JAM C;  2I9I A;  5DNY A;  4YHH E;  1A1L A;  4BHB A;  1TN9 A;  2EPM X;  2EOX A;  2EN6 A;  2YSP A;  2BBG A;  4R2E A;  4RH8 A;  1BB8 A;  1A1I A;  2UUB E;  2LJU A;  2EWL A;  5LMU E;  4M9V C;  2WBS A;  2EOZ A;  2L3J A;  1HNZ E;  3KZZ A;  1O0W A;  4BS9 A;  2ENA A;  2EMZ A;  2EM2 A;  2YZT A;  4JYA E;  5IXM B;  5KL3 A;  1JK2 A;  1X47 A;  4OX9 E;  2RQL A;  2IHR 1;  1N32 E;  4N4R B;  1UHZ A;  3IWB A;  1RMD A;  4R2Q A;  4DV3 E;  5KL6 A;  4X9J A;  3LLH A;  3EPJ A;  2EPP A;  5IT9 C;  2UXB E;  3RV0 A;  2WBT A;  2ENH A;  2N3G A;  1WHQ A;  4DV6 E;  1TF3 A;  2EM5 A;  2VF1 A;  4LF6 E;  2MKD A;  4M0V A;  2K4V A;  2B3T B;  4F2J C;  1XMQ E;  3EQ1 A;  2KOU A;  3OTO E;  2EOJ A;  3TQM A;  5A2Q C;  2RSM A;  4R8O A;  4M2Z A;  3C4B A;  2EMY A;  4LFA E;  3N3W A;  4R03 A;  2E1M A;  2EOR A;  1AH5 A;  2EMB A;  4NHR A;  1X3C A;  2M7Q A;  1A1F A;  4JI6 E;  1YYK A;  2L92 A;  2WCC 3;  2LO3 A;  5A6J A;  1T4L B;  5A6B D;  1ZAA C;  4LF4 E;  4DUZ E;  1PJS A;  2EMW A;  1EH7 A;  4WXD A;  4OUN A;  2CPN A;  2YTD A;  5LLQ A;  2LTR A;  4BHC A;  4Q28 A;  4B3S E;  2G7H A;  1IMU A;  5A6B A;  2VRD A;  3ADJ A;  2RTX A;  4TUI A;  1U61 A;  1QNT A;  1GQE A;  4M30 A;  2DIX A;  4DR4 E;  4WPY A;  1I4S A;  1Z1B A;  2NUG A;  1SFE A;  2GLI A;  1YYO A;  1IBM E;  2V85 A;  1WJP A;  4LF7 E;  1KYQ A;  1GTK A;  2CSH A;  4F54 A;  2V83 A;  4B3M E;  4BC9 A;  2EQ3 A;  4X64 E;  2M1S A;  4X66 E;  2PRT A;  4KZS A;  1L4S A;  4JI5 E;  5A69 A;  2LV2 A;  1UN6 B;  3FIG A;  4TUG A;  4R2S A;  5T6J A;  1ZBQ A;  3HXL A;  4LF9 E;  5AE3 A;  2LRS A;  5A6A A;  2GSL A;  2F8B A;  4I8O A;  3MSW A;  4JI4 E;  2D9H A;  4FK5 C;  2B7T A;  1YPN A;  1BBO A;  2EJ4 A;  1RC5 A;  2EMI A;  4F9B B;  2NUE A;  4WX9 A;  4R2R A;  4DR7 E;  2E72 A;  3MHS C;  2EMG A;  3VYY A;  4R2A A;  2EOQ A;  1YYW A;  4DR1 E;  1N36 E;  1N3G A;  3HQ1 A;  4F6M A;  1DI2 A;  2LE2 A;  2YTP A;  2DLK A;  2YRH A;  1G2F C;  4BC7 A;  1UBD C;  2HGH A;  3J7A G;  4P7D A;  1XNQ E;  2UU9 E;  2EPN A;  4F6N A;  2ZM6 E;  2ELZ A;  3QG5 C;  3ECR A;  1F2I G;  4O43 A;  2EN3 A; 
#chains in the Genus database with same CATH homology
 2KOU A;  4X65 E;  3ZOQ B;  3OTO E;  2JVA A;  5AE1 A;  4WYQ B;  5A2Q C;  5ADZ A;  4JI0 E;  1SR9 A;  4X62 E;  3J7A G;  2RSM A;  4R8O A;  3DJW A;  4OOG C;  4M2Z A;  3C4B A;  2FGG A;  2DB2 A;  2LBS B;  4NXN E;  2JOX A;  4LFA E;  3N3W A;  4R03 A;  2E1M A;  4L5N C;  1N34 E;  2N3H A;  1WXR A;  1J26 A;  1ZBT A;  2V86 A;  2M7Q A;  3VK6 A;  5BR8 E;  3IWD A;  5AAS A;  4JI6 E;  1YYK A;  1EKZ A;  2L92 A;  2V8Q B;  1PKP A;  3P1X A;  3T1Y E;  4JI1 E;  4LF5 E;  3ADL A;  1GZ6 A;  1T4N A;  2E5L E;  1RQ0 A;  4J8Z A;  2L2M A;  2V88 A;  2MC5 A;  1T4L B;  1HNW E;  3RV1 A;  4LF4 E;  3F6H A;  4DUZ E;  4F9C B;  4JV5 E;  2B9D A;  3KWR A;  1FKA E;  1UIL A;  4NXM E;  2UXD E;  4DV0 E;  4DR6 E;  2QVW A;  2LUQ A;  2RS7 A;  2JWO A;  3AV0 A;  3T1H E;  2KHX A;  1IBL E;  4OUN A;  2CPN A;  4LTY A;  2UXC E;  2LTR A;  2VE7 C;  3O2R A;  4Q28 A;  4B3S E;  3AUZ A;  3F6G A;  2G7H A;  1J5E E;  2FTX B;  5F3W A;  2KON A;  3IWC A;  5LMN E;  3JTZ A;  2B7V A;  3ADJ A;  1HNX E;  2F4V E;  2ODR D;  2RTX A;  1U61 A;  4TUI A;  4DR3 E;  2LJH A;  2H36 X;  2HHH E;  1GQE A;  2FFL A;  4M30 A;  1T4O A;  1XNR E;  4LF8 E;  4GKK E;  2DIX A;  4DR4 E;  4WPY A;  1I4S A;  2V87 A;  2NUG A;  2M4I A;  1YYO A;  1YZ9 A;  4DV2 E;  1IBM E;  2V85 A;  2DSY A;  1I94 E;  4LFC E;  4JI7 E;  4LF7 E;  1WHN A;  4WSP A;  4DV5 E;  3HPS A;  3LML A;  4AQY E;  1XMO E;  4DUY E;  2VQE E;  3VYX A;  4F54 A;  4BMJ A;  1JFZ A;  4JI8 E;  1DQ3 A;  2V83 A;  4GKJ E;  4KHP E;  2L6M A;  4B3M E;  3ADI A;  4BC9 A;  2UUC E;  3JAM C;  2L2K B;  4X64 E;  2M1S A;  5DNY A;  4X66 E;  4YHH E;  4KZS A;  4DR5 E;  4JI5 E;  4GEQ B;  3FIG A;  2JOB A;  4TUG A;  1HR0 E;  4K0K E;  5T6J A;  4DV7 E;  1ZBQ A;  4F9A B;  2EZ6 A;  3HXL A;  4L8N A;  4LF9 E;  5AE3 A;  2LRS A;  3J80 C;  2L8T A;  2GSL A;  4YY3 E;  4P78 A;  1X48 A;  2UUA E;  3O2R B;  2F8B A;  2UUB E;  2L3C A;  2EWL A;  3MSW A;  4I8O A;  4LU9 A;  5LMU E;  4JI4 E;  2L3J A;  1HNZ E;  1N33 E;  2NUF A;  1RC7 A;  2B7T A;  2LMZ A;  2LUP B;  5LL6 R;  1RC5 A;  2JY9 A;  1O0W A;  4BS9 A;  3C4T A;  4JI3 E;  2L33 A;  2A11 A;  4LFB E;  4F9B B;  3HPZ A;  2NUE A;  2YZT A;  4JYA E;  2LTS A;  2JR1 A;  1X47 A;  3DF6 A;  3JU0 A;  4JI2 E;  3OML A;  4OX9 E;  2IHR 1;  1N32 E;  4DR7 E;  2V89 A;  1UHZ A;  3IWB A;  4DV3 E;  3VYY A;  3K6Q A;  1QU6 A;  3RMP A;  4DMI A;  1IBK E;  3H09 A;  2WZO A;  3LLH A;  3HTX A;  1YYW A;  4DR1 E;  4DV1 E;  5IT9 C;  1N36 E;  4B3T E;  3HQ1 A;  4DV4 E;  2EB1 A;  2UXB E;  3RV0 A;  1STU A;  3J81 C;  4DR2 E;  1DI2 A;  2DMY A;  2LE2 A;  2YT4 A;  3ADG A;  5AE2 A;  4BBY A;  3J7Y p;  2N3G A;  2ODR C;  1WHQ A;  2MDR A;  4BC7 A;  5IWA E;  2FV4 B;  4DV6 E;  2VF1 A;  4P7D A;  2RS6 A;  4DKK A;  4BCA A;  5CFF E;  5FLX C;  2NA2 A;  4M0V A;  4LF6 E;  1XNQ E;  4B3R E;  2UU9 E;  2K4V A;  2VQF E;  2L2N A;  4X8W A;  2B3T B;  2ZM6 E;  1XMQ E;  4WFT A;  1X49 A;  1FJG E;  2MC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...