1YYWA

Crystal structure of rnase iii from aquifex aeolicus complexed with double stranded rna at 2.8-angstrom resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
219
structure length
219
Chain Sequence
KMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*AP*AP*UP*AP*UP*AP*UP*AP*UP*UP*U)-3'
publication title Intermediate states of ribonuclease III in complex with double-stranded RNA
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
total genus 62
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2005-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 1yywA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1yywA02
4WFTA 4OX9E 1X47A 4JI1E 2NUGA 4DR2E 1T4LB 2DIXA 4JI5E 2VQEE 4DKKA 1O0WA 3ADGA 2NUEA 1HNXE 2LRSA 3C4TA 1N32E 1FKAE 2NUFA 2JVAA 3O2RA 4LFCE 1N33E 4X62E 2UUAE 1EKZA 2YT4A 4DR4E 1N36E 1YZ9A 3T1YE 4KHPE 4AQYE 1XNRE 3VYYA 4JV5E 2L2KB 1N34E 2B7VA 4JI2E 1X48A 2DMYA 5LMNE 2ZM6E 4DV6E 4NXNE 2F4VE 1X49A 1RC5A 2GSLA 2EB1A 2LBSB 1XMQE 4B3TE 1FJGE 3HTXA 4DR7E 4LFBE 1DI2A 4B3ME 2UXCE 4LF8E 1IBKE 4M2ZA 2JY9A 2L3JA 1IBLE 2IHR1 4DV2E 4LF6E 1HR0E 3T1HE 1YYKA 2UUBE 4B3SE 5BR8E 4X66E 4JI6E 4LF9E 4LF4E 4YHHE 4DUZE 2L3CA 3N3WA 1RC7A 2UXDE 4DV1E 4JI7E 2RS6A 1WHNA 1IBME 3ADLA 2KHXA 1YYOA 4JYAE 1STUA 1XMOE 2DB2A 1HNZE 4OUNA 2LUPB 1U61A 1J5EE 4JI0E 4YY3E 4DV7E 3RV0A 2UU9E 1UHZA 1J26A 2LUQA 4LF5E 1QU6A 4NXME 2RS7A 4DV3E 3C4BA 2UUCE 4LFAE 4DV5E 2LTRA 2RTXA 4DR6E 1T4NA 2B3TB 4WYQB 1JFZA 3ADJA 2LJHA 5LMUE 4M30A 4DV0E 1WHQA 4OOGC 3O2RB 4DR5E 2N3HA 2N3GA 1ZBTA 4X64E 1PKPA 3VYXA 3RV1A 4X65E 4JI4E 2VQFE 2RSMA 4GKJE 1YYWA 2L2MA 2QVWA 1I4SA 1XNQE 4DUYE 3P1XA 4DR1E 2L2NA 2NA2A 4LF7E 1GQEA 5IWAE 4X8WA 2EZ6A 2LTSA 2MDRA 4DV4E 2B7TA 5CFFE 4JI8E 1HNWE 4DR3E 2E5LE 3ADIA 1UILA 1RQ0A 4JI3E 2A11A 1T4OA 2CPNA 1I94E 4B3RE 2UXBE 4K0KE 2L33A 3LLHA 4GKKE 2HHHE 3OTOE 2FFLA 3J7Yp
chains in the Genus database with same CATH superfamily
2MDGA 2V83A 1NEIA 2EPRA 4DR2E 2EPXA 3VHTB 2EMCA 2VQEE 2EOHA 2NUEA 1T38A 2M4IA 2MC5A 5DNYA 2CSHA 4NHRA 2M9AA 4R2CA 1N33E 4RHBB 2EM2A 4TUIA 4DR4E 4IJDA 2YTFA 1QNTA 3F6GA 2BBGA 2CT1A 4IS1C 2EN6A 2EPAA 1X48A 2DGCA 1ZBQA 4KZSA 3J81C 4F9AB 2DLKA 2EN8A 2ZM6E 5AASA 2V87A 3IWBA 2GSLA 2EB1A 4F9BB 4B3ME 1AAYA 3LMLA 3KWRA 2VRDA 2YWQA 4M9VC 1IBLE 2EM0A 3H09A 3IWCA 2V88A 2YTJA 1ZU1A 1YSAC 2YTNA 4BS9A 1ZAAC 2WBSA 5AE1A 4L5NC 2L92A 3EPHA 1WHNA 2ENAA 3MSWA 1IQOA 2DMIA 4JYAE 1KYQA 2EMKA 2EN7A 3ECRA 2JP9A 4OUNA 1BBOA 3BIDA 2LUPB 1U61A 1J5EE 2EOYA 2MKDA 2EE8A 2LCEA 2RQLA 3RV0A 2LVHA 2LUQA 4LFAE 4R2RA 3HQ1A 2YTOA 1T4NA 1JFZA 2EN1A 2EL4A 2LJHA 1AH5A 3JAMC 4NZVA 1TF6A 2N3GA 2EORA 4X64E 2EP3A 3EPKA 4ZYDA 4JI4E 2VQFE 2RSMA 1I4SA 2WCC3 5A6AA 4DR1E 2EMGA 4TUGA 1PJQA 4X8WA 4ZYEA 4WX9A 2EQ3A 4DV4E 3C6MA 2HJJA 4DR3E 5IV8B 4R2AA 1I94E 2EQ0A 2EWLA 4F6NA 3HXLA 4MLQA 4Q28A 2EMYA 1X47A 4JI1E 2NUGA 1T4LB 2CTDA 1EH6A 2DIXA 4DKKA 1O0WA 1N32E 3VK6A 4F6MA 1MEYC 2G7HA 3O2RA 2EPKX 4LFCE 2EN2A 5KL3A 1YZ9A 5IXMB 5FLXC 4AQYE 4F54A 3VYYA 4BCAA 2B7VA 5LLQA 4JI2E 2EMZA 4WXCA 4NXNE 1NCSA 4B3TE 2LBSB 1XMQE 4BHBA 1FJGE 2WZOA 2YTGA 2JOBA 1WRJA 4FK5C 1IBKE 2L3JA 1X3CA 2IHR1 4LTYA 2EMBA 1X6HA 4B3SE 2R76A 4X66E 3BF2A 4RH8A 4DUZE 2F8BA 1X5WA 2EM9A 1YUJA 1RC7A 2WBTA 1EH7A 2KONA 2EOQA 2KHXA 3JTZA 4F9CB 2YTEA 2VE7C 1BB8A 2FTXB 1ZTDA 2V89A 4WPYA 2YU8A 4YY3E 2UU9E 2DSYA 4WSGA 5TSEA 3ZOQB 1IQSA 2RS7A 3C4BA 3HPSA 2LTRA 2E1MA 4DR6E 2B3TB 2DRPA 3C6KA 2DLQA 1L4SA 2A25A 1PJSA 4HEIA 2YRMA 1WHQA 3UK3C 2FV4B 4OOGC 1GZ6A 5KL7A 5F3WA 5A6JA 3MHHC 2EPUA 1ZBTA 1MGTA 3RV1A 3JU0A 4GKJE 1YYWA 2EPPA 2KOUA 2EM5A 4DUYE 2ELYA 5A6BD 4R2DA 2L2NA 4LF7E 2YTIA 4M0VA 5IWAE 2ODRD 2EMHA 3THOB 2M1SA 2LTSA 1JK1A 2B7TA 5CFFE 1HNWE 2JWOA 2YPNA 1UILA 1SFEA 1GTKA 4JI3E 1WXRA 1T4OA 2CPNA 4B3RE 3THNA 2L33A 4R2PA 1B69A 1Z1BA 4O5GA 4OX9E 2EL5A 5KL4A 1A1IA 4J8ZA 4O24A 2GPIA 4DMIA 5T6JA 2L6MA 4P78A 2EM3A 4KWYA 2FGGA 1ZR9A 3OMLA 2JVAA 1A1GA 4X62E 1EKZA 3T1YE 1SR9A 1XNRE 5AE3A 4JV5E 2L2KB 1X6EA 3EPJA 1PJTA 2DMYA 1YFHA 3HPZA 1X6FA 5A69A 1X49A 1RC5A 3HTXA 4DR7E 2RPCA 2ENHA 4O43A 1DI2A 2UXCE 3AUZA 4M2ZA 2JY9A 3DF6A 4DV2E 3TQMA 4LF6E 1HR0E 2H36X 2I13A 3T1HE 1JK2A 5BR8E 2EOOA 2YZTA 4GZNC 4JI6E 4LF9E 2D9HA 4YHHE 3N3WA 2UXDE 4WXDA 4DV1E 4JI7E 2RS6A 5ADZA 3RMPA 5IT9C 1IBME 2JPAA 3ADLA 1WJPA 3K6QA 1A1LA 2JYAA 1A1JA 2HC5A 3KZYA 4WSPA 4BBYA 1XMOE 1HNZE 2MKNA 2GHFA 4BHCA 4ZYHA 1F2IG 2GLIA 1UHZA 1J26A 4R2QA 2I9IA 2E72A 2UUCE 4DV5E 3AV0A 4P7DA 3BBGA 4Q35B 3ADJA 4WYQB 3EPLA 2JR1A 4F2JC 1BBGA 5LMUE 4DV0E 1G2DC 3O2RB 2LT7A 2EMLA 2EL6A 1LLMC 1A1FA 2EM7A 2B9DA 2N8XA 2LO3A 2EM8A 2L2MA 2QVWA 4BC7A 2J7JA 2EMIA 3J7AG 3KZZA 2JXPA 1A1HA 2PRTA 4N4RB 1T39A 1DGCA 2V8QB 2EZ6A 3F6HA 1N3GA 3J80C 1UN6B 2MDRA 2RSIA 2EJ4A 2ENCA 2EQ1A 3IWDA 4LU9A 1RQ0A 5AC5A 4ZYGA 2A11A 3LLHA 3OTOE 2FFLA 3J7Yp 2M7QA 1RMDA 4WFTA 4BC9A 2EPZA 4JI5E 2LJUA 3ADGA 2EPCA 3EQ1A 5LL6R 4R2EA 1HNXE 2LRSA 3M99B 3C4TA 1KJKA 1EH8A 1FKAE 2NUFA 5A6BA 2UUAE 2YT4A 1N36E 4KHPE 2EOXA 2EPOA 1N34E 2EN3A 3L00A 5KL5A 2YTPA 5LMNE 2EM6A 4DV6E 2LV2A 1TF3A 2F4VE 3DJWA 2YRKA 4LFBE 4LF8E 1IMUA 4BMJA 2LMZA 4R8OA 2EPMX 4L8NA 1YYKA 1DQ3A 2EOJA 2EOIA 2UUBE 3FIGA 4LF4E 2L8TA 2L3CA 2YTDA 2HGHA 2EMAA 2ELZA 2V85A 1YYOA 1STUA 2EOMA 1PDAA 2EOEA 2DB2A 2MC6A 2EMWA 5A2QC 4JI0E 4O4KA 5KL2A 4DV7E 3MHSC 1P47A 1UBDC 4LF5E 1QU6A 2EPNA 4NXME 4DV3E 2JOXA 1G2FC 2RTXA 2LE2A 2EN4A 4HTGA 2YSOA 5AE2A 2YSPA 2EMFA 2NABA 2K7IA 4MLVA 4M30A 2EPLX 4X9JA 2EMXA 2WBUA 2YU5A 4DR5E 2N3HA 5AC4A 2K4VA 4I8OA 1PKPA 3VYXA 5KL6A 4X65E 2V86A 2EOFA 1TN9A 2EM4A 2YTQA 1A1KA 3QG5C 2EOZA 1YPNA 2ADRA 1XNQE 4GEQB 2R1FA 2BB8A 3P1XA 2NA2A 3BGHA 1GQEA 5A6KA 2ODRC 4JI8E 2VF1A 2Q8UA 2YRHA 2E5LE 3ADIA 4R2SA 2EOSA 2UXBE 1YUIA 4K0KE 4R03A 4GKKE 2HHHE
chains in the Genus database with same CATH topology
4WFTA 4OX9E 1X47A 2V83A 4JI1E 2NUGA 4DR2E 4BC9A 1T4LB 2DIXA 4JI5E 2VQEE 4J8ZA 4DKKA 1O0WA 3ADGA 4DMIA 5LL6R 2NUEA 5T6JA 2L6MA 1HNXE 4P78A 2LRSA 2M4IA 3C4TA 1N32E 3VK6A 2FGGA 2MC5A 1FKAE 3OMLA 2NUFA 5DNYA 2JVAA 2G7HA 3O2RA 4LFCE 1N33E 4X62E 2UUAE 4TUIA 1EKZA 2YT4A 4DR4E 1N36E 1YZ9A 1SR9A 5FLXC 4AQYE 4F54A 5AE3A 3T1YE 3VYYA 4BCAA 1XNRE 2L2KB 4JV5E 1N34E 2B7VA 3F6GA 4JI2E 1X48A 2DMYA 1ZBQA 4KZSA 3J81C 4F9AB 2ZM6E 5LMNE 4DV6E 4NXNE 3HPZA 5AASA 3DJWA 2F4VE 1X49A 1RC5A 2GSLA 2EB1A 2V87A 3IWBA 4F9BB 2WZOA 2LBSB 1XMQE 1FJGE 2JOBA 4DR7E 4LFBE 4B3ME 1DI2A 3LMLA 3AUZA 1IBKE 4LF8E 4M2ZA 3KWRA 2UXCE 2JY9A 2L3JA 4BMJA 2LMZA 4R8OA 1IBLE 2IHR1 3DF6A 4L8NA 3H09A 4DV2E 3IWCA 2V88A 4LTYA 2H36X 1HR0E 4LF6E 3T1HE 1YYKA 1DQ3A 2UUBE 4B3SE 3FIGA 5BR8E 2YZTA 4X66E 4BS9A 4JI6E 4LF9E 4LF4E 2L8TA 5AE1A 4YHHE 4L5NC 2F8BA 4DUZE 2L3CA 3N3WA 1RC7A 2L92A 2UXDE 4DV1E 4JI7E 2RS6A 1WHNA 2KONA 5ADZA 3RMPA 3MSWA 5IT9C 1IBME 3ADLA 2V85A 2KHXA 3K6QA 1YYOA 3JTZA 4JYAE 1STUA 4F9CB 4KHPE 4WSPA 2DB2A 2VE7C 4BBYA 1XMOE 4OUNA 2MC6A 1HNZE 2LUPB 2FTXB 1U61A 1J5EE 2V89A 4WPYA 5A2QC 4JI0E 4YY3E 4DV7E 3RV0A 2DSYA 1UHZA 2UU9E 3ZOQB 1J26A 2LUQA 4LF5E 1QU6A 4NXME 2RS7A 4DV3E 3C4BA 3HTXA 3HPSA 2JOXA 2UUCE 4LFAE 4DV5E 3AV0A 2LTRA 3HQ1A 2RTXA 4P7DA 2LE2A 2E1MA 4DR6E 1T4NA 2B3TB 5AE2A 4WYQB 1JFZA 3ADJA 2LJHA 2JR1A 3JAMC 4B3TE 5LMUE 4M30A 4DV0E 1WHQA 2FV4B 4OOGC 1GZ6A 3O2RB 4DR5E 5F3WA 2N3HA 2N3GA 2K4VA 1ZBTA 4I8OA 1PKPA 4X64E 3VYXA 3RV1A 2B9DA 4X65E 4JI4E 2VQFE 2RSMA 3JU0A 4GKJE 2V86A 1YYWA 2L2MA 2QVWA 2KOUA 4BC7A 1I4SA 1XNQE 3J7AG 4DUYE 4GEQB 3P1XA 4DR1E 2L2NA 2NA2A 4TUGA 4LF7E 1GQEA 4M0VA 5IWAE 4X8WA 2ODRD 2EZ6A 2V8QB 2M1SA 3F6HA 2LTSA 3J80C 2MDRA 2ODRC 4DV4E 2B7TA 5CFFE 4JI8E 2VF1A 1HNWE 3IWDA 4LU9A 2JWOA 4DR3E 2E5LE 3ADIA 1UILA 1RQ0A 4JI3E 1WXRA 2A11A 1T4OA 2CPNA 1I94E 4B3RE 2UXBE 2EWLA 4R03A 2L33A 4K0KE 3HXLA 3LLHA 4Q28A 2HHHE 4GKKE 3OTOE 2FFLA 3J7Yp 2M7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFT A;  4OX9 E;  1X47 A;  4JI1 E;  2NUG A;  4DR2 E;  1T4L B;  2DIX A;  4JI5 E;  2VQE E;  4DKK A;  1O0W A;  3ADG A;  2NUE A;  1HNX E;  2LRS A;  3C4T A;  1N32 E;  1FKA E;  2NUF A;  2JVA A;  3O2R A;  4LFC E;  1N33 E;  4X62 E;  2UUA E;  1EKZ A;  2YT4 A;  4DR4 E;  1N36 E;  1YZ9 A;  3T1Y E;  4KHP E;  4AQY E;  1XNR E;  3VYY A;  4JV5 E;  2L2K B;  1N34 E;  2B7V A;  4JI2 E;  1X48 A;  2DMY A;  5LMN E;  2ZM6 E;  4DV6 E;  4NXN E;  2F4V E;  1X49 A;  1RC5 A;  2GSL A;  2EB1 A;  2LBS B;  1XMQ E;  4B3T E;  1FJG E;  3HTX A;  4DR7 E;  4LFB E;  1DI2 A;  4B3M E;  2UXC E;  4LF8 E;  1IBK E;  4M2Z A;  2JY9 A;  2L3J A;  1IBL E;  2IHR 1;  4DV2 E;  4LF6 E;  1HR0 E;  3T1H E;  1YYK A;  2UUB E;  4B3S E;  5BR8 E;  4X66 E;  4JI6 E;  4LF9 E;  4LF4 E;  4YHH E;  4DUZ E;  2L3C A;  3N3W A;  1RC7 A;  2UXD E;  4DV1 E;  4JI7 E;  2RS6 A;  1WHN A;  1IBM E;  3ADL A;  2KHX A;  1YYO A;  4JYA E;  1STU A;  1XMO E;  2DB2 A;  1HNZ E;  4OUN A;  2LUP B;  1U61 A;  1J5E E;  4JI0 E;  4YY3 E;  4DV7 E;  3RV0 A;  2UU9 E;  1UHZ A;  1J26 A;  2LUQ A;  4LF5 E;  1QU6 A;  4NXM E;  2RS7 A;  4DV3 E;  3C4B A;  2UUC E;  4LFA E;  4DV5 E;  2LTR A;  2RTX A;  4DR6 E;  1T4N A;  2B3T B;  4WYQ B;  1JFZ A;  3ADJ A;  2LJH A;  5LMU E;  4M30 A;  4DV0 E;  1WHQ A;  4OOG C;  3O2R B;  4DR5 E;  2N3H A;  2N3G A;  1ZBT A;  4X64 E;  1PKP A;  3VYX A;  3RV1 A;  4X65 E;  4JI4 E;  2VQF E;  2RSM A;  4GKJ E;  1YYW A;  2L2M A;  2QVW A;  1I4S A;  1XNQ E;  4DUY E;  3P1X A;  4DR1 E;  2L2N A;  2NA2 A;  4LF7 E;  1GQE A;  5IWA E;  4X8W A;  2EZ6 A;  2LTS A;  2MDR A;  4DV4 E;  2B7T A;  5CFF E;  4JI8 E;  1HNW E;  4DR3 E;  2E5L E;  3ADI A;  1UIL A;  1RQ0 A;  4JI3 E;  2A11 A;  1T4O A;  2CPN A;  1I94 E;  4B3R E;  2UXB E;  4K0K E;  2L33 A;  3LLH A;  4GKK E;  2HHH E;  3OTO E;  2FFL A;  3J7Y p; 
#chains in the Genus database with same CATH topology
 2MDG A;  2V83 A;  1NEI A;  2EPR A;  4DR2 E;  2EPX A;  3VHT B;  2EMC A;  2VQE E;  2EOH A;  2NUE A;  1T38 A;  2M4I A;  2MC5 A;  5DNY A;  2CSH A;  4NHR A;  2M9A A;  4R2C A;  1N33 E;  4RHB B;  2EM2 A;  4TUI A;  4DR4 E;  4IJD A;  2YTF A;  1QNT A;  3F6G A;  2BBG A;  2CT1 A;  4IS1 C;  2EN6 A;  2EPA A;  1X48 A;  2DGC A;  1ZBQ A;  4KZS A;  3J81 C;  4F9A B;  2DLK A;  2EN8 A;  2ZM6 E;  5AAS A;  2V87 A;  3IWB A;  2GSL A;  2EB1 A;  4F9B B;  4B3M E;  1AAY A;  3LML A;  3KWR A;  2VRD A;  2YWQ A;  4M9V C;  1IBL E;  2EM0 A;  3H09 A;  3IWC A;  2V88 A;  2YTJ A;  1ZU1 A;  1YSA C;  2YTN A;  4BS9 A;  1ZAA C;  2WBS A;  5AE1 A;  4L5N C;  2L92 A;  3EPH A;  1WHN A;  2ENA A;  3MSW A;  1IQO A;  2DMI A;  4JYA E;  1KYQ A;  2EMK A;  2EN7 A;  3ECR A;  2JP9 A;  4OUN A;  1BBO A;  3BID A;  2LUP B;  1U61 A;  1J5E E;  2EOY A;  2MKD A;  2EE8 A;  2LCE A;  2RQL A;  3RV0 A;  2LVH A;  2LUQ A;  4LFA E;  4R2R A;  3HQ1 A;  2YTO A;  1T4N A;  1JFZ A;  2EN1 A;  2EL4 A;  2LJH A;  1AH5 A;  3JAM C;  4NZV A;  1TF6 A;  2N3G A;  2EOR A;  4X64 E;  2EP3 A;  3EPK A;  4ZYD A;  4JI4 E;  2VQF E;  2RSM A;  1I4S A;  2WCC 3;  5A6A A;  4DR1 E;  2EMG A;  4TUG A;  1PJQ A;  4X8W A;  4ZYE A;  4WX9 A;  2EQ3 A;  4DV4 E;  3C6M A;  2HJJ A;  4DR3 E;  5IV8 B;  4R2A A;  1I94 E;  2EQ0 A;  2EWL A;  4F6N A;  3HXL A;  4MLQ A;  4Q28 A;  2EMY A;  1X47 A;  4JI1 E;  2NUG A;  1T4L B;  2CTD A;  1EH6 A;  2DIX A;  4DKK A;  1O0W A;  1N32 E;  3VK6 A;  4F6M A;  1MEY C;  2G7H A;  3O2R A;  2EPK X;  4LFC E;  2EN2 A;  5KL3 A;  1YZ9 A;  5IXM B;  5FLX C;  4AQY E;  4F54 A;  3VYY A;  4BCA A;  2B7V A;  5LLQ A;  4JI2 E;  2EMZ A;  4WXC A;  4NXN E;  1NCS A;  4B3T E;  2LBS B;  1XMQ E;  4BHB A;  1FJG E;  2WZO A;  2YTG A;  2JOB A;  1WRJ A;  4FK5 C;  1IBK E;  2L3J A;  1X3C A;  2IHR 1;  4LTY A;  2EMB A;  1X6H A;  4B3S E;  2R76 A;  4X66 E;  3BF2 A;  4RH8 A;  4DUZ E;  2F8B A;  1X5W A;  2EM9 A;  1YUJ A;  1RC7 A;  2WBT A;  1EH7 A;  2KON A;  2EOQ A;  2KHX A;  3JTZ A;  4F9C B;  2YTE A;  2VE7 C;  1BB8 A;  2FTX B;  1ZTD A;  2V89 A;  4WPY A;  2YU8 A;  4YY3 E;  2UU9 E;  2DSY A;  4WSG A;  5TSE A;  3ZOQ B;  1IQS A;  2RS7 A;  3C4B A;  3HPS A;  2LTR A;  2E1M A;  4DR6 E;  2B3T B;  2DRP A;  3C6K A;  2DLQ A;  1L4S A;  2A25 A;  1PJS A;  4HEI A;  2YRM A;  1WHQ A;  3UK3 C;  2FV4 B;  4OOG C;  1GZ6 A;  5KL7 A;  5F3W A;  5A6J A;  3MHH C;  2EPU A;  1ZBT A;  1MGT A;  3RV1 A;  3JU0 A;  4GKJ E;  1YYW A;  2EPP A;  2KOU A;  2EM5 A;  4DUY E;  2ELY A;  5A6B D;  4R2D A;  2L2N A;  4LF7 E;  2YTI A;  4M0V A;  5IWA E;  2ODR D;  2EMH A;  3THO B;  2M1S A;  2LTS A;  1JK1 A;  2B7T A;  5CFF E;  1HNW E;  2JWO A;  2YPN A;  1UIL A;  1SFE A;  1GTK A;  4JI3 E;  1WXR A;  1T4O A;  2CPN A;  4B3R E;  3THN A;  2L33 A;  4R2P A;  1B69 A;  1Z1B A;  4O5G A;  4OX9 E;  2EL5 A;  5KL4 A;  1A1I A;  4J8Z A;  4O24 A;  2GPI A;  4DMI A;  5T6J A;  2L6M A;  4P78 A;  2EM3 A;  4KWY A;  2FGG A;  1ZR9 A;  3OML A;  2JVA A;  1A1G A;  4X62 E;  1EKZ A;  3T1Y E;  1SR9 A;  1XNR E;  5AE3 A;  4JV5 E;  2L2K B;  1X6E A;  3EPJ A;  1PJT A;  2DMY A;  1YFH A;  3HPZ A;  1X6F A;  5A69 A;  1X49 A;  1RC5 A;  3HTX A;  4DR7 E;  2RPC A;  2ENH A;  4O43 A;  1DI2 A;  2UXC E;  3AUZ A;  4M2Z A;  2JY9 A;  3DF6 A;  4DV2 E;  3TQM A;  4LF6 E;  1HR0 E;  2H36 X;  2I13 A;  3T1H E;  1JK2 A;  5BR8 E;  2EOO A;  2YZT A;  4GZN C;  4JI6 E;  4LF9 E;  2D9H A;  4YHH E;  3N3W A;  2UXD E;  4WXD A;  4DV1 E;  4JI7 E;  2RS6 A;  5ADZ A;  3RMP A;  5IT9 C;  1IBM E;  2JPA A;  3ADL A;  1WJP A;  3K6Q A;  1A1L A;  2JYA A;  1A1J A;  2HC5 A;  3KZY A;  4WSP A;  4BBY A;  1XMO E;  1HNZ E;  2MKN A;  2GHF A;  4BHC A;  4ZYH A;  1F2I G;  2GLI A;  1UHZ A;  1J26 A;  4R2Q A;  2I9I A;  2E72 A;  2UUC E;  4DV5 E;  3AV0 A;  4P7D A;  3BBG A;  4Q35 B;  3ADJ A;  4WYQ B;  3EPL A;  2JR1 A;  4F2J C;  1BBG A;  5LMU E;  4DV0 E;  1G2D C;  3O2R B;  2LT7 A;  2EML A;  2EL6 A;  1LLM C;  1A1F A;  2EM7 A;  2B9D A;  2N8X A;  2LO3 A;  2EM8 A;  2L2M A;  2QVW A;  4BC7 A;  2J7J A;  2EMI A;  3J7A G;  3KZZ A;  2JXP A;  1A1H A;  2PRT A;  4N4R B;  1T39 A;  1DGC A;  2V8Q B;  2EZ6 A;  3F6H A;  1N3G A;  3J80 C;  1UN6 B;  2MDR A;  2RSI A;  2EJ4 A;  2ENC A;  2EQ1 A;  3IWD A;  4LU9 A;  1RQ0 A;  5AC5 A;  4ZYG A;  2A11 A;  3LLH A;  3OTO E;  2FFL A;  3J7Y p;  2M7Q A;  1RMD A;  4WFT A;  4BC9 A;  2EPZ A;  4JI5 E;  2LJU A;  3ADG A;  2EPC A;  3EQ1 A;  5LL6 R;  4R2E A;  1HNX E;  2LRS A;  3M99 B;  3C4T A;  1KJK A;  1EH8 A;  1FKA E;  2NUF A;  5A6B A;  2UUA E;  2YT4 A;  1N36 E;  4KHP E;  2EOX A;  2EPO A;  1N34 E;  2EN3 A;  3L00 A;  5KL5 A;  2YTP A;  5LMN E;  2EM6 A;  4DV6 E;  2LV2 A;  1TF3 A;  2F4V E;  3DJW A;  2YRK A;  4LFB E;  4LF8 E;  1IMU A;  4BMJ A;  2LMZ A;  4R8O A;  2EPM X;  4L8N A;  1YYK A;  1DQ3 A;  2EOJ A;  2EOI A;  2UUB E;  3FIG A;  4LF4 E;  2L8T A;  2L3C A;  2YTD A;  2HGH A;  2EMA A;  2ELZ A;  2V85 A;  1YYO A;  1STU A;  2EOM A;  1PDA A;  2EOE A;  2DB2 A;  2MC6 A;  2EMW A;  5A2Q C;  4JI0 E;  4O4K A;  5KL2 A;  4DV7 E;  3MHS C;  1P47 A;  1UBD C;  4LF5 E;  1QU6 A;  2EPN A;  4NXM E;  4DV3 E;  2JOX A;  1G2F C;  2RTX A;  2LE2 A;  2EN4 A;  4HTG A;  2YSO A;  5AE2 A;  2YSP A;  2EMF A;  2NAB A;  2K7I A;  4MLV A;  4M30 A;  2EPL X;  4X9J A;  2EMX A;  2WBU A;  2YU5 A;  4DR5 E;  2N3H A;  5AC4 A;  2K4V A;  4I8O A;  1PKP A;  3VYX A;  5KL6 A;  4X65 E;  2V86 A;  2EOF A;  1TN9 A;  2EM4 A;  2YTQ A;  1A1K A;  3QG5 C;  2EOZ A;  1YPN A;  2ADR A;  1XNQ E;  4GEQ B;  2R1F A;  2BB8 A;  3P1X A;  2NA2 A;  3BGH A;  1GQE A;  5A6K A;  2ODR C;  4JI8 E;  2VF1 A;  2Q8U A;  2YRH A;  2E5L E;  3ADI A;  4R2S A;  2EOS A;  2UXB E;  1YUI A;  4K0K E;  4R03 A;  4GKK E;  2HHH E; 
#chains in the Genus database with same CATH homology
 4WFT A;  4OX9 E;  1X47 A;  2V83 A;  4JI1 E;  2NUG A;  4DR2 E;  4BC9 A;  1T4L B;  2DIX A;  4JI5 E;  2VQE E;  4J8Z A;  4DKK A;  1O0W A;  3ADG A;  4DMI A;  5LL6 R;  2NUE A;  5T6J A;  2L6M A;  1HNX E;  4P78 A;  2LRS A;  2M4I A;  3C4T A;  1N32 E;  3VK6 A;  2FGG A;  2MC5 A;  1FKA E;  3OML A;  2NUF A;  5DNY A;  2JVA A;  2G7H A;  3O2R A;  4LFC E;  1N33 E;  4X62 E;  2UUA E;  4TUI A;  1EKZ A;  2YT4 A;  4DR4 E;  1N36 E;  1YZ9 A;  1SR9 A;  5FLX C;  4AQY E;  4F54 A;  5AE3 A;  3T1Y E;  3VYY A;  4BCA A;  1XNR E;  2L2K B;  4JV5 E;  1N34 E;  2B7V A;  3F6G A;  4JI2 E;  1X48 A;  2DMY A;  1ZBQ A;  4KZS A;  3J81 C;  4F9A B;  2ZM6 E;  5LMN E;  4DV6 E;  4NXN E;  3HPZ A;  5AAS A;  3DJW A;  2F4V E;  1X49 A;  1RC5 A;  2GSL A;  2EB1 A;  2V87 A;  3IWB A;  4F9B B;  2WZO A;  2LBS B;  1XMQ E;  1FJG E;  2JOB A;  4DR7 E;  4LFB E;  4B3M E;  1DI2 A;  3LML A;  3AUZ A;  1IBK E;  4LF8 E;  4M2Z A;  3KWR A;  2UXC E;  2JY9 A;  2L3J A;  4BMJ A;  2LMZ A;  4R8O A;  1IBL E;  2IHR 1;  3DF6 A;  4L8N A;  3H09 A;  4DV2 E;  3IWC A;  2V88 A;  4LTY A;  2H36 X;  1HR0 E;  4LF6 E;  3T1H E;  1YYK A;  1DQ3 A;  2UUB E;  4B3S E;  3FIG A;  5BR8 E;  2YZT A;  4X66 E;  4BS9 A;  4JI6 E;  4LF9 E;  4LF4 E;  2L8T A;  5AE1 A;  4YHH E;  4L5N C;  2F8B A;  4DUZ E;  2L3C A;  3N3W A;  1RC7 A;  2L92 A;  2UXD E;  4DV1 E;  4JI7 E;  2RS6 A;  1WHN A;  2KON A;  5ADZ A;  3RMP A;  3MSW A;  5IT9 C;  1IBM E;  3ADL A;  2V85 A;  2KHX A;  3K6Q A;  1YYO A;  3JTZ A;  4JYA E;  1STU A;  4F9C B;  4KHP E;  4WSP A;  2DB2 A;  2VE7 C;  4BBY A;  1XMO E;  4OUN A;  2MC6 A;  1HNZ E;  2LUP B;  2FTX B;  1U61 A;  1J5E E;  2V89 A;  4WPY A;  5A2Q C;  4JI0 E;  4YY3 E;  4DV7 E;  3RV0 A;  2DSY A;  1UHZ A;  2UU9 E;  3ZOQ B;  1J26 A;  2LUQ A;  4LF5 E;  1QU6 A;  4NXM E;  2RS7 A;  4DV3 E;  3C4B A;  3HTX A;  3HPS A;  2JOX A;  2UUC E;  4LFA E;  4DV5 E;  3AV0 A;  2LTR A;  3HQ1 A;  2RTX A;  4P7D A;  2LE2 A;  2E1M A;  4DR6 E;  1T4N A;  2B3T B;  5AE2 A;  4WYQ B;  1JFZ A;  3ADJ A;  2LJH A;  2JR1 A;  3JAM C;  4B3T E;  5LMU E;  4M30 A;  4DV0 E;  1WHQ A;  2FV4 B;  4OOG C;  1GZ6 A;  3O2R B;  4DR5 E;  5F3W A;  2N3H A;  2N3G A;  2K4V A;  1ZBT A;  4I8O A;  1PKP A;  4X64 E;  3VYX A;  3RV1 A;  2B9D A;  4X65 E;  4JI4 E;  2VQF E;  2RSM A;  3JU0 A;  4GKJ E;  2V86 A;  1YYW A;  2L2M A;  2QVW A;  2KOU A;  4BC7 A;  1I4S A;  1XNQ E;  3J7A G;  4DUY E;  4GEQ B;  3P1X A;  4DR1 E;  2L2N A;  2NA2 A;  4TUG A;  4LF7 E;  1GQE A;  4M0V A;  5IWA E;  4X8W A;  2ODR D;  2EZ6 A;  2V8Q B;  2M1S A;  3F6H A;  2LTS A;  3J80 C;  2MDR A;  2ODR C;  4DV4 E;  2B7T A;  5CFF E;  4JI8 E;  2VF1 A;  1HNW E;  3IWD A;  4LU9 A;  2JWO A;  4DR3 E;  2E5L E;  3ADI A;  1UIL A;  1RQ0 A;  4JI3 E;  1WXR A;  2A11 A;  1T4O A;  2CPN A;  1I94 E;  4B3R E;  2UXB E;  2EWL A;  4R03 A;  2L33 A;  4K0K E;  3HXL A;  3LLH A;  4Q28 A;  2HHH E;  4GKK E;  3OTO E;  2FFL A;  3J7Y p;  2M7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...