1YYWA

Crystal structure of rnase iii from aquifex aeolicus complexed with double stranded rna at 2.8-angstrom resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
219
structure length
219
Chain Sequence
KMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords 5'-R(*AP*AP*AP*UP*AP*UP*AP*UP*AP*UP*UP*U)-3'
publication title Intermediate states of ribonuclease III in complex with double-stranded RNA
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 62
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2005-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 1yywA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1yywA02
3P1XA 2DMYA 4DV5E 4DR5E 2EZ6A 3C4BA 1WHQA 4JI1E 2UXCE 1UHZA 4AQYE 1IBKE 4M2ZA 3ADJA 4DKKA 4X62E 1FJGE 4LF4E 1T4LB 4DV1E 2LRSA 2L2MA 4JV5E 2RS6A 3LLHA 1HNZE 2N3GA 3T1YE 4X65E 1I4SA 4LFBE 5BR8E 2FFLA 1I94E 4DV3E 1XMQE 3ADLA 1YZ9A 5CFFE 4LF5E 4GKJE 2UUCE 2VQEE 1YYWA 4GKKE 2DB2A 2UUBE 4DR2E 2LUPB 2UXDE 3N3WA 2B7VA 4X66E 4DR6E 4M30A 4K0KE 2B3TB 4WYQB 1XNRE 2B7TA 4JI5E 1EKZA 4DV2E 3J7Yp 1RC7A 1T4OA 1ZBTA 4B3SE 2LTSA 2QVWA 1YYKA 1X47A 2JY9A 1U61A 1XNQE 4LF8E 3ADIA 4JI0E 4OOGC 4JYAE 4LFCE 2JVAA 1JFZA 1YYOA 2DIXA 2RSMA 4WFTA 3C4TA 4YHHE 2NA2A 4DV0E 4LF6E 1RC5A 2VQFE 3OTOE 1UILA 5LMNE 4OX9E 4JI4E 4OUNA 2IHR1 1XMOE 3T1HE 4NXNE 4DV6E 3HTXA 2UUAE 1T4NA 2L3CA 1GQEA 2LJHA 4X8WA 4JI3E 4LF7E 2E5LE 2YT4A 2GSLA 4JI7E 4YY3E 2UU9E 3O2RB 2NUFA 1J5EE 1PKPA 4B3TE 2L2KB 4JI8E 1J26A 1HR0E 4DR7E 2LTRA 4X64E 3O2RA 4B3ME 1HNWE 1X48A 2N3HA 2ZM6E 4NXME 1QU6A 3VYYA 2RS7A 4JI6E 2LUQA 1X49A 4DUZE 2UXBE 4JI2E 1N32E 1FKAE 2L2NA 4DV7E 1HNXE 4B3RE 2LBSB 1N36E 2L33A 1N34E 2NUGA 4LF9E 2L3JA 4LFAE 2MDRA 3ADGA 4DR4E 4DR3E 2KHXA 2EB1A 1N33E 2A11A 2RTXA 3RV1A 1STUA 2CPNA 5LMUE 4DV4E 2F4VE 3VYXA 3RV0A 4DR1E 2HHHE 5IWAE 4DUYE 1RQ0A 2NUEA 1IBLE 1IBME 1WHNA 4KHPE 1DI2A 1O0WA
chains in the Genus database with same CATH superfamily
4DR5E 2L8TA 2YPNA 3KWRA 1IQSA 4AQYE 1IBKE 2MC5A 3ADJA 2EPOA 4X62E 1SR9A 4RH8A 4LF4E 3HPZA 2FTXB 2YTOA 2EPKX 2LRSA 4JV5E 1LLMC 2CT1A 4X65E 2L6MA 3EPLA 2EMIA 4BCAA 2A25A 2ELYA 4J8ZA 2YWQA 2EPUA 2YTIA 4LF5E 2JXPA 2LT7A 2UUCE 4NZVA 2MKNA 4GKKE 2B7VA 2M4IA 4X66E 2EOZA 1ZTDA 2WBUA 2RSIA 4K0KE 2EMHA 4WYQB 5KL6A 4JI5E 4DV2E 5A6BD 3BIDA 4ZYHA 2DLKA 2EMZA 1IQOA 3ECRA 4JI0E 2Q8UA 4ZYDA 4DV0E 1PJQA 4LF6E 1UILA 1X3CA 2ENAA 1N3GA 2EPMX 2M1SA 1JK1A 3T1HE 3HTXA 4TUIA 1A1GA 3JTZA 4F9CB 4JI3E 2EOSA 2YT4A 3O2RB 1RMDA 3AUZA 4GZNC 3L00A 2RQLA 1UN6B 2HGHA 2EORA 1HNWE 1UBDC 2N3HA 2ZM6E 1T39A 2RS7A 4JI6E 1X49A 4JI2E 3OMLA 4B3RE 4DV7E 1MGTA 1IMUA 5A6AA 1GTKA 2NUGA 1BBGA 4MLQA 4LF9E 2LO3A 4O4KA 2EPRA 5T6JA 2DLQA 1YUJA 3BF2A 2FGGA 2A11A 2RTXA 4DV4E 2EPZA 5IV8B 2EOHA 4DR1E 2CSHA 3MHSC 2ENHA 5DNYA 3IWBA 1QNTA 2V85A 2YZTA 1IBLE 1WHNA 2KOUA 4GEQB 3F6GA 2EZ6A 3C4BA 2UXCE 3TQMA 2YU5A 5LLQA 5KL5A 2JOXA 1EH7A 2PRTA 5A6JA 1I4SA 2LV2A 5KL2A 2FFLA 1I94E 1BB8A 1DQ3A 2ELZA 2YTGA 1YZ9A 2ODRD 1X6FA 2DB2A 2F8BA 2NABA 4DR2E 2DRPA 4DR6E 3VHTB 2EMKA 2E1MA 5IXMB 2B7TA 2EN6A 4R2SA 5AE3A 1YPNA 2YTEA 3J7Yp 1DGCA 2EOIA 4B3SE 2EPXA 2LTSA 4R2DA 4BC9A 1YYKA 2JY9A 1XNQE 2EMLA 2EM3A 1PJTA 1KYQA 1WRJA 1GZ6A 4LFCE 1NEIA 2RSMA 2YTDA 4R03A 4WFTA 3C4TA 4YHHE 2NA2A 1SFEA 2VQFE 2YTNA 4OUNA 4LTYA 1AAYA 2IHR1 1XMOE 1NCSA 4NXNE 4RHBB 2VF1A 2LVHA 3M99B 4Q35B 1GQEA 2EM9A 4X8WA 4YY3E 4R2RA 1J5EE 2NUFA 1EH6A 1PKPA 2YRHA 4DMIA 4LU9A 2L2KB 3HXLA 2ENCA 3THOB 2EQ1A 2LTRA 4X64E 1A1KA 3IWDA 1MEYC 2RPCA 5AE2A 4Q28A 2EL5A 1QU6A 2M7QA 1YUIA 2UXBE 2L2NA 2WBTA 4F9AB 2LBSB 1F2IG 1N36E 1N34E 3DF6A 4FK5C 5AE1A 3ADGA 4DR4E 2EPAA 5LMUE 3RV1A 1STUA 3DJWA 1Z1BA 5A6BA 4F6NA 4R8OA 3VYXA 2EN2A 3RV0A 3MSWA 2HHHE 2DMIA 2EPPA 4ZYGA 2H36X 1YSAC 2CTDA 2EN7A 2NUEA 3EPHA 1DI2A 5FLXC 3HQ1A 2EOFA 2EM8A 4NHRA 3P1XA 1WHQA 4JI1E 2V88A 1UHZA 4M2ZA 3BGHA 4DKKA 2EMGA 4BHBA 2EOOA 3IWCA 2YRMA 2L2MA 4BS9A 5ADZA 2EL6A 3QG5C 2N3GA 2GHFA 2DSYA 2V86A 1B69A 1P47A 4DV3E 4F2JC 1T38A 2L92A 3ADLA 2EN4A 4O43A 2EPNA 5CFFE 2WBSA 4GKJE 3KZZA 2VQEE 1YYWA 5AC4A 4IS1C 2UUBE 2UXDE 2EMYA 4P7DA 2EM7A 3J81C 1G2DC 2B3TB 4X9JA 1XNRE 4HEIA 2EN8A 5A69A 1X47A 1U61A 3ADIA 4BBYA 2MC6A 3J80C 2HJJA 2JVAA 1YYOA 2DIXA 4BMJA 3EPJA 3EPKA 5LMNE 4JI4E 1TF3A 2EPCA 2R76A 2JWOA 2EM5A 2EM2A 2L3CA 2EN3A 2E5LE 2GSLA 2LCEA 2EMWA 2EMFA 2EJ4A 4B3TE 4O24A 2K4VA 1J26A 1HR0E 2ODRC 2EM4A 2VE7C 1L4SA 2EOJA 4IJDA 1X48A 2EN1A 3VYYA 4O5GA 2LUQA 3UK3C 4BC7A 3THNA 4DUZE 3C6MA 2I13A 3VK6A 2M9AA 1ZU1A 1N32E 1A1FA 2JYAA 1FKAE 1HNXE 2YSOA 1A1LA 2KONA 2GLIA 2L3JA 4LFAE 2MDRA 1X6HA 4WXCA 2HC5A 3ZOQB 2EB1A 4M0VA 2CPNA 3F6HA 1WJPA 2N8XA 1PJSA 3HPSA 3H09A 1ZBQA 4WXDA 2YU8A 2YRKA 5IWAE 4DUYE 2V83A 3K6QA 4BHCA 1TF6A 2EE8A 4KHPE 2R1FA 1JK2A 2EOXA 1O0WA 4WSGA 4R2PA 2DMYA 4DV5E 4R2AA 4WX9A 2ADRA 5A2QC 1FJGE 2YTJA 1T4LB 5A6KA 2MKDA 4DV1E 3JAMC 3RMPA 2RS6A 2EQ3A 3LLHA 1HNZE 2V89A 2D9HA 2EMCA 1PDAA 4LFBE 1ZAAC 5BR8E 2WCC3 5AASA 4R2QA 2JOBA 1XMQE 4TUGA 5KL4A 2B9DA 4F9BB 4M9VC 2FV4B 1A1IA 2LUPB 3N3WA 4N4RB 4M30A 2YSPA 4L5NC 1X6EA 2JP9A 1EKZA 4MLVA 2YTQA 2GPIA 4ZYEA 1X5WA 2LJUA 1RC7A 1EH8A 1T4OA 4F54A 1ZBTA 2BB8A 2QVWA 2V87A 3AV0A 4LF8E 4OOGC 4JYAE 3JU0A 2BBGA 3T1YE 1JFZA 2K7IA 1KJKA 1TN9A 1A1JA 1RC5A 2WZOA 3MHHC 4R2EA 3OTOE 4L8NA 4OX9E 2DGCA 2EPLX 4DV6E 1G2FC 2UUAE 1T4NA 2LJHA 4HTGA 4LF7E 3KZYA 4JI7E 2UU9E 5LL6R 1AH5A 2EOQA 4JI8E 5F3WA 2EMXA 4DR7E 3BBGA 3O2RA 3FIGA 2EM0A 2EM6A 1YFHA 5KL7A 4B3ME 2J7JA 2MDGA 4I8OA 4NXME 2EOYA 4KWYA 2JR1A 2JPAA 2EP3A 4KZSA 2E72A 3C6KA 2VRDA 4WPYA 2EMBA 2L33A 2YTFA 1A1HA 2EL4A 3EQ1A 1BBOA 5KL3A 4DR3E 2KHXA 2YTPA 1N33E 5AC5A 5TSEA 2I9IA 4P78A 2F4VE 2EQ0A 2G7HA 2V8QB 1WXRA 2EOMA 2EOEA 4R2CA 4F6MA 1RQ0A 2LE2A 5IT9C 1ZR9A 2LMZA 4WSPA 1IBME 3J7AG 2EWLA 3LMLA 2EMAA
chains in the Genus database with same CATH topology
4GEQB 3P1XA 2DMYA 3F6GA 4DV5E 2EZ6A 3C4BA 1WHQA 2L8TA 2V88A 3KWRA 4DR5E 1UHZA 4JI1E 2UXCE 5A2QC 4AQYE 4M2ZA 2MC5A 3ADJA 1IBKE 4DKKA 1SR9A 4X62E 4LF4E 1FJGE 3HPZA 2FTXB 1T4LB 4DV1E 3JAMC 2JOXA 3IWCA 3RMPA 2LRSA 2L2MA 4JV5E 4BS9A 5ADZA 2RS6A 3LLHA 1HNZE 2N3GA 2V89A 3T1YE 4X65E 1I4SA 2DSYA 2V86A 4LFBE 2L6MA 5BR8E 2FFLA 4BCAA 4DV3E 1I94E 5AASA 2JOBA 1XMQE 2L92A 1DQ3A 4J8ZA 3ADLA 1YZ9A 4TUGA 5CFFE 2B9DA 2ODRD 4LF5E 4F9BB 4GKJE 2UUCE 2VQEE 1YYWA 4GKKE 2FV4B 2F8BA 2DB2A 4DR2E 2LUPB 2UUBE 3N3WA 2B7VA 2M4IA 4X66E 4P7DA 4M30A 4L5NC 3J81C 2E1MA 4DR6E 2B3TB 4K0KE 4WYQB 1XNRE 2B7TA 4JI5E 5AE3A 4DV0E 1EKZA 4DV2E 3J7Yp 1RC7A 1T4OA 4F54A 1ZBTA 4B3SE 2LTSA 2QVWA 4BC9A 1YYKA 2V87A 1X47A 3AV0A 2JY9A 1U61A 1XNQE 4LF8E 3ADIA 4BBYA 4JI0E 4OOGC 2MC6A 3JU0A 1GZ6A 3J80C 4JYAE 4LFCE 2JVAA 1JFZA 1YYOA 2DIXA 2RSMA 4R03A 3C4TA 4WFTA 2NA2A 4BMJA 4YHHE 1RC5A 2WZOA 4LF6E 2VQFE 3OTOE 1UILA 4L8NA 5LMNE 4OX9E 2M1SA 4JI4E 4OUNA 4LTYA 2IHR1 1XMOE 3T1HE 4NXNE 5FLXC 4DV6E 2VF1A 2JWOA 4TUIA 3HTXA 3JTZA 4F9CB 1T4NA 3HQ1A 1GQEA 2LJHA 4X8WA 2L3CA 2UUAE 4JI3E 4LF7E 2E5LE 2YT4A 1O0WA 2GSLA 2UXDE 4JI7E 4YY3E 2UU9E 3O2RB 2NUFA 1J5EE 1PKPA 4B3TE 3AUZA 5LL6R 4DMIA 4LU9A 2L2KB 3HXLA 2K4VA 4JI8E 5F3WA 1J26A 1HR0E 4DR7E 2LTRA 2ODRC 4X64E 2VE7C 3O2RA 3FIGA 3IWDA 4B3ME 5AE2A 1HNWE 4I8OA 4Q28A 1X48A 2N3HA 2ZM6E 4NXME 1QU6A 3VYYA 2RS7A 4JI6E 2LUQA 1X49A 4BC7A 2M7QA 4DUZE 2JR1A 3VK6A 2UXBE 4KZSA 3OMLA 4JI2E 1N32E 1FKAE 2L2NA 4DV7E 1HNXE 4B3RE 4F9AB 1N33E 2LBSB 1N36E 4WPYA 2L33A 1N34E 2KONA 3DF6A 2NUGA 4LF9E 2L3JA 5AE1A 4LFAE 2MDRA 3ADGA 5T6JA 4DR4E 4DR3E 3ZOQB 2KHXA 2EB1A 2FGGA 4M0VA 2A11A 2RTXA 3RV1A 1STUA 2CPNA 3DJWA 3F6HA 5LMUE 4DV4E 4P78A 3HPSA 3H09A 4R8OA 2F4VE 3VYXA 3RV0A 4DR1E 1ZBQA 3MSWA 2HHHE 2G7HA 2V8QB 1WXRA 5IWAE 4DUYE 5DNYA 2V83A 1RQ0A 2H36X 2LE2A 5IT9C 2V85A 2NUEA 2YZTA 2LMZA 3IWBA 3K6QA 1WHNA 4WSPA 1IBLE 1IBME 3J7AG 4KHPE 1DI2A 2EWLA 3LMLA 2KOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P1X A;  2DMY A;  4DV5 E;  4DR5 E;  2EZ6 A;  3C4B A;  1WHQ A;  4JI1 E;  2UXC E;  1UHZ A;  4AQY E;  1IBK E;  4M2Z A;  3ADJ A;  4DKK A;  4X62 E;  1FJG E;  4LF4 E;  1T4L B;  4DV1 E;  2LRS A;  2L2M A;  4JV5 E;  2RS6 A;  3LLH A;  1HNZ E;  2N3G A;  3T1Y E;  4X65 E;  1I4S A;  4LFB E;  5BR8 E;  2FFL A;  1I94 E;  4DV3 E;  1XMQ E;  3ADL A;  1YZ9 A;  5CFF E;  4LF5 E;  4GKJ E;  2UUC E;  2VQE E;  1YYW A;  4GKK E;  2DB2 A;  2UUB E;  4DR2 E;  2LUP B;  2UXD E;  3N3W A;  2B7V A;  4X66 E;  4DR6 E;  4M30 A;  4K0K E;  2B3T B;  4WYQ B;  1XNR E;  2B7T A;  4JI5 E;  1EKZ A;  4DV2 E;  3J7Y p;  1RC7 A;  1T4O A;  1ZBT A;  4B3S E;  2LTS A;  2QVW A;  1YYK A;  1X47 A;  2JY9 A;  1U61 A;  1XNQ E;  4LF8 E;  3ADI A;  4JI0 E;  4OOG C;  4JYA E;  4LFC E;  2JVA A;  1JFZ A;  1YYO A;  2DIX A;  2RSM A;  4WFT A;  3C4T A;  4YHH E;  2NA2 A;  4DV0 E;  4LF6 E;  1RC5 A;  2VQF E;  3OTO E;  1UIL A;  5LMN E;  4OX9 E;  4JI4 E;  4OUN A;  2IHR 1;  1XMO E;  3T1H E;  4NXN E;  4DV6 E;  3HTX A;  2UUA E;  1T4N A;  2L3C A;  1GQE A;  2LJH A;  4X8W A;  4JI3 E;  4LF7 E;  2E5L E;  2YT4 A;  2GSL A;  4JI7 E;  4YY3 E;  2UU9 E;  3O2R B;  2NUF A;  1J5E E;  1PKP A;  4B3T E;  2L2K B;  4JI8 E;  1J26 A;  1HR0 E;  4DR7 E;  2LTR A;  4X64 E;  3O2R A;  4B3M E;  1HNW E;  1X48 A;  2N3H A;  2ZM6 E;  4NXM E;  1QU6 A;  3VYY A;  2RS7 A;  4JI6 E;  2LUQ A;  1X49 A;  4DUZ E;  2UXB E;  4JI2 E;  1N32 E;  1FKA E;  2L2N A;  4DV7 E;  1HNX E;  4B3R E;  2LBS B;  1N36 E;  2L33 A;  1N34 E;  2NUG A;  4LF9 E;  2L3J A;  4LFA E;  2MDR A;  3ADG A;  4DR4 E;  4DR3 E;  2KHX A;  2EB1 A;  1N33 E;  2A11 A;  2RTX A;  3RV1 A;  1STU A;  2CPN A;  5LMU E;  4DV4 E;  2F4V E;  3VYX A;  3RV0 A;  4DR1 E;  2HHH E;  5IWA E;  4DUY E;  1RQ0 A;  2NUE A;  1IBL E;  1IBM E;  1WHN A;  4KHP E;  1DI2 A;  1O0W A; 
#chains in the Genus database with same CATH topology
 4DR5 E;  2L8T A;  2YPN A;  3KWR A;  1IQS A;  4AQY E;  1IBK E;  2MC5 A;  3ADJ A;  2EPO A;  4X62 E;  1SR9 A;  4RH8 A;  4LF4 E;  3HPZ A;  2FTX B;  2YTO A;  2EPK X;  2LRS A;  4JV5 E;  1LLM C;  2CT1 A;  4X65 E;  2L6M A;  3EPL A;  2EMI A;  4BCA A;  2A25 A;  2ELY A;  4J8Z A;  2YWQ A;  2EPU A;  2YTI A;  4LF5 E;  2JXP A;  2LT7 A;  2UUC E;  4NZV A;  2MKN A;  4GKK E;  2B7V A;  2M4I A;  4X66 E;  2EOZ A;  1ZTD A;  2WBU A;  2RSI A;  4K0K E;  2EMH A;  4WYQ B;  5KL6 A;  4JI5 E;  4DV2 E;  5A6B D;  3BID A;  4ZYH A;  2DLK A;  2EMZ A;  1IQO A;  3ECR A;  4JI0 E;  2Q8U A;  4ZYD A;  4DV0 E;  1PJQ A;  4LF6 E;  1UIL A;  1X3C A;  2ENA A;  1N3G A;  2EPM X;  2M1S A;  1JK1 A;  3T1H E;  3HTX A;  4TUI A;  1A1G A;  3JTZ A;  4F9C B;  4JI3 E;  2EOS A;  2YT4 A;  3O2R B;  1RMD A;  3AUZ A;  4GZN C;  3L00 A;  2RQL A;  1UN6 B;  2HGH A;  2EOR A;  1HNW E;  1UBD C;  2N3H A;  2ZM6 E;  1T39 A;  2RS7 A;  4JI6 E;  1X49 A;  4JI2 E;  3OML A;  4B3R E;  4DV7 E;  1MGT A;  1IMU A;  5A6A A;  1GTK A;  2NUG A;  1BBG A;  4MLQ A;  4LF9 E;  2LO3 A;  4O4K A;  2EPR A;  5T6J A;  2DLQ A;  1YUJ A;  3BF2 A;  2FGG A;  2A11 A;  2RTX A;  4DV4 E;  2EPZ A;  5IV8 B;  2EOH A;  4DR1 E;  2CSH A;  3MHS C;  2ENH A;  5DNY A;  3IWB A;  1QNT A;  2V85 A;  2YZT A;  1IBL E;  1WHN A;  2KOU A;  4GEQ B;  3F6G A;  2EZ6 A;  3C4B A;  2UXC E;  3TQM A;  2YU5 A;  5LLQ A;  5KL5 A;  2JOX A;  1EH7 A;  2PRT A;  5A6J A;  1I4S A;  2LV2 A;  5KL2 A;  2FFL A;  1I94 E;  1BB8 A;  1DQ3 A;  2ELZ A;  2YTG A;  1YZ9 A;  2ODR D;  1X6F A;  2DB2 A;  2F8B A;  2NAB A;  4DR2 E;  2DRP A;  4DR6 E;  3VHT B;  2EMK A;  2E1M A;  5IXM B;  2B7T A;  2EN6 A;  4R2S A;  5AE3 A;  1YPN A;  2YTE A;  3J7Y p;  1DGC A;  2EOI A;  4B3S E;  2EPX A;  2LTS A;  4R2D A;  4BC9 A;  1YYK A;  2JY9 A;  1XNQ E;  2EML A;  2EM3 A;  1PJT A;  1KYQ A;  1WRJ A;  1GZ6 A;  4LFC E;  1NEI A;  2RSM A;  2YTD A;  4R03 A;  4WFT A;  3C4T A;  4YHH E;  2NA2 A;  1SFE A;  2VQF E;  2YTN A;  4OUN A;  4LTY A;  1AAY A;  2IHR 1;  1XMO E;  1NCS A;  4NXN E;  4RHB B;  2VF1 A;  2LVH A;  3M99 B;  4Q35 B;  1GQE A;  2EM9 A;  4X8W A;  4YY3 E;  4R2R A;  1J5E E;  2NUF A;  1EH6 A;  1PKP A;  2YRH A;  4DMI A;  4LU9 A;  2L2K B;  3HXL A;  2ENC A;  3THO B;  2EQ1 A;  2LTR A;  4X64 E;  1A1K A;  3IWD A;  1MEY C;  2RPC A;  5AE2 A;  4Q28 A;  2EL5 A;  1QU6 A;  2M7Q A;  1YUI A;  2UXB E;  2L2N A;  2WBT A;  4F9A B;  2LBS B;  1F2I G;  1N36 E;  1N34 E;  3DF6 A;  4FK5 C;  5AE1 A;  3ADG A;  4DR4 E;  2EPA A;  5LMU E;  3RV1 A;  1STU A;  3DJW A;  1Z1B A;  5A6B A;  4F6N A;  4R8O A;  3VYX A;  2EN2 A;  3RV0 A;  3MSW A;  2HHH E;  2DMI A;  2EPP A;  4ZYG A;  2H36 X;  1YSA C;  2CTD A;  2EN7 A;  2NUE A;  3EPH A;  1DI2 A;  5FLX C;  3HQ1 A;  2EOF A;  2EM8 A;  4NHR A;  3P1X A;  1WHQ A;  4JI1 E;  2V88 A;  1UHZ A;  4M2Z A;  3BGH A;  4DKK A;  2EMG A;  4BHB A;  2EOO A;  3IWC A;  2YRM A;  2L2M A;  4BS9 A;  5ADZ A;  2EL6 A;  3QG5 C;  2N3G A;  2GHF A;  2DSY A;  2V86 A;  1B69 A;  1P47 A;  4DV3 E;  4F2J C;  1T38 A;  2L92 A;  3ADL A;  2EN4 A;  4O43 A;  2EPN A;  5CFF E;  2WBS A;  4GKJ E;  3KZZ A;  2VQE E;  1YYW A;  5AC4 A;  4IS1 C;  2UUB E;  2UXD E;  2EMY A;  4P7D A;  2EM7 A;  3J81 C;  1G2D C;  2B3T B;  4X9J A;  1XNR E;  4HEI A;  2EN8 A;  5A69 A;  1X47 A;  1U61 A;  3ADI A;  4BBY A;  2MC6 A;  3J80 C;  2HJJ A;  2JVA A;  1YYO A;  2DIX A;  4BMJ A;  3EPJ A;  3EPK A;  5LMN E;  4JI4 E;  1TF3 A;  2EPC A;  2R76 A;  2JWO A;  2EM5 A;  2EM2 A;  2L3C A;  2EN3 A;  2E5L E;  2GSL A;  2LCE A;  2EMW A;  2EMF A;  2EJ4 A;  4B3T E;  4O24 A;  2K4V A;  1J26 A;  1HR0 E;  2ODR C;  2EM4 A;  2VE7 C;  1L4S A;  2EOJ A;  4IJD A;  1X48 A;  2EN1 A;  3VYY A;  4O5G A;  2LUQ A;  3UK3 C;  4BC7 A;  3THN A;  4DUZ E;  3C6M A;  2I13 A;  3VK6 A;  2M9A A;  1ZU1 A;  1N32 E;  1A1F A;  2JYA A;  1FKA E;  1HNX E;  2YSO A;  1A1L A;  2KON A;  2GLI A;  2L3J A;  4LFA E;  2MDR A;  1X6H A;  4WXC A;  2HC5 A;  3ZOQ B;  2EB1 A;  4M0V A;  2CPN A;  3F6H A;  1WJP A;  2N8X A;  1PJS A;  3HPS A;  3H09 A;  1ZBQ A;  4WXD A;  2YU8 A;  2YRK A;  5IWA E;  4DUY E;  2V83 A;  3K6Q A;  4BHC A;  1TF6 A;  2EE8 A;  4KHP E;  2R1F A;  1JK2 A;  2EOX A;  1O0W A;  4WSG A;  4R2P A;  2DMY A;  4DV5 E;  4R2A A;  4WX9 A;  2ADR A;  5A2Q C;  1FJG E;  2YTJ A;  1T4L B;  5A6K A;  2MKD A;  4DV1 E;  3JAM C;  3RMP A;  2RS6 A;  2EQ3 A;  3LLH A;  1HNZ E;  2V89 A;  2D9H A;  2EMC A;  1PDA A;  4LFB E;  1ZAA C;  5BR8 E;  2WCC 3;  5AAS A;  4R2Q A;  2JOB A;  1XMQ E;  4TUG A;  5KL4 A;  2B9D A;  4F9B B;  4M9V C;  2FV4 B;  1A1I A;  2LUP B;  3N3W A;  4N4R B;  4M30 A;  2YSP A;  4L5N C;  1X6E A;  2JP9 A;  1EKZ A;  4MLV A;  2YTQ A;  2GPI A;  4ZYE A;  1X5W A;  2LJU A;  1RC7 A;  1EH8 A;  1T4O A;  4F54 A;  1ZBT A;  2BB8 A;  2QVW A;  2V87 A;  3AV0 A;  4LF8 E;  4OOG C;  4JYA E;  3JU0 A;  2BBG A;  3T1Y E;  1JFZ A;  2K7I A;  1KJK A;  1TN9 A;  1A1J A;  1RC5 A;  2WZO A;  3MHH C;  4R2E A;  3OTO E;  4L8N A;  4OX9 E;  2DGC A;  2EPL X;  4DV6 E;  1G2F C;  2UUA E;  1T4N A;  2LJH A;  4HTG A;  4LF7 E;  3KZY A;  4JI7 E;  2UU9 E;  5LL6 R;  1AH5 A;  2EOQ A;  4JI8 E;  5F3W A;  2EMX A;  4DR7 E;  3BBG A;  3O2R A;  3FIG A;  2EM0 A;  2EM6 A;  1YFH A;  5KL7 A;  4B3M E;  2J7J A;  2MDG A;  4I8O A;  4NXM E;  2EOY A;  4KWY A;  2JR1 A;  2JPA A;  2EP3 A;  4KZS A;  2E72 A;  3C6K A;  2VRD A;  4WPY A;  2EMB A;  2L33 A;  2YTF A;  1A1H A;  2EL4 A;  3EQ1 A;  1BBO A;  5KL3 A;  4DR3 E;  2KHX A;  2YTP A;  1N33 E;  5AC5 A;  5TSE A;  2I9I A;  4P78 A;  2F4V E;  2EQ0 A;  2G7H A;  2V8Q B;  1WXR A;  2EOM A;  2EOE A;  4R2C A;  4F6M A;  1RQ0 A;  2LE2 A;  5IT9 C;  1ZR9 A;  2LMZ A;  4WSP A;  1IBM E;  3J7A G;  2EWL A;  3LML A;  2EMA A; 
#chains in the Genus database with same CATH homology
 4GEQ B;  3P1X A;  2DMY A;  3F6G A;  4DV5 E;  2EZ6 A;  3C4B A;  1WHQ A;  2L8T A;  2V88 A;  3KWR A;  4DR5 E;  1UHZ A;  4JI1 E;  2UXC E;  5A2Q C;  4AQY E;  4M2Z A;  2MC5 A;  3ADJ A;  1IBK E;  4DKK A;  1SR9 A;  4X62 E;  4LF4 E;  1FJG E;  3HPZ A;  2FTX B;  1T4L B;  4DV1 E;  3JAM C;  2JOX A;  3IWC A;  3RMP A;  2LRS A;  2L2M A;  4JV5 E;  4BS9 A;  5ADZ A;  2RS6 A;  3LLH A;  1HNZ E;  2N3G A;  2V89 A;  3T1Y E;  4X65 E;  1I4S A;  2DSY A;  2V86 A;  4LFB E;  2L6M A;  5BR8 E;  2FFL A;  4BCA A;  4DV3 E;  1I94 E;  5AAS A;  2JOB A;  1XMQ E;  2L92 A;  1DQ3 A;  4J8Z A;  3ADL A;  1YZ9 A;  4TUG A;  5CFF E;  2B9D A;  2ODR D;  4LF5 E;  4F9B B;  4GKJ E;  2UUC E;  2VQE E;  1YYW A;  4GKK E;  2FV4 B;  2F8B A;  2DB2 A;  4DR2 E;  2LUP B;  2UUB E;  3N3W A;  2B7V A;  2M4I A;  4X66 E;  4P7D A;  4M30 A;  4L5N C;  3J81 C;  2E1M A;  4DR6 E;  2B3T B;  4K0K E;  4WYQ B;  1XNR E;  2B7T A;  4JI5 E;  5AE3 A;  4DV0 E;  1EKZ A;  4DV2 E;  3J7Y p;  1RC7 A;  1T4O A;  4F54 A;  1ZBT A;  4B3S E;  2LTS A;  2QVW A;  4BC9 A;  1YYK A;  2V87 A;  1X47 A;  3AV0 A;  2JY9 A;  1U61 A;  1XNQ E;  4LF8 E;  3ADI A;  4BBY A;  4JI0 E;  4OOG C;  2MC6 A;  3JU0 A;  1GZ6 A;  3J80 C;  4JYA E;  4LFC E;  2JVA A;  1JFZ A;  1YYO A;  2DIX A;  2RSM A;  4R03 A;  3C4T A;  4WFT A;  2NA2 A;  4BMJ A;  4YHH E;  1RC5 A;  2WZO A;  4LF6 E;  2VQF E;  3OTO E;  1UIL A;  4L8N A;  5LMN E;  4OX9 E;  2M1S A;  4JI4 E;  4OUN A;  4LTY A;  2IHR 1;  1XMO E;  3T1H E;  4NXN E;  5FLX C;  4DV6 E;  2VF1 A;  2JWO A;  4TUI A;  3HTX A;  3JTZ A;  4F9C B;  1T4N A;  3HQ1 A;  1GQE A;  2LJH A;  4X8W A;  2L3C A;  2UUA E;  4JI3 E;  4LF7 E;  2E5L E;  2YT4 A;  1O0W A;  2GSL A;  2UXD E;  4JI7 E;  4YY3 E;  2UU9 E;  3O2R B;  2NUF A;  1J5E E;  1PKP A;  4B3T E;  3AUZ A;  5LL6 R;  4DMI A;  4LU9 A;  2L2K B;  3HXL A;  2K4V A;  4JI8 E;  5F3W A;  1J26 A;  1HR0 E;  4DR7 E;  2LTR A;  2ODR C;  4X64 E;  2VE7 C;  3O2R A;  3FIG A;  3IWD A;  4B3M E;  5AE2 A;  1HNW E;  4I8O A;  4Q28 A;  1X48 A;  2N3H A;  2ZM6 E;  4NXM E;  1QU6 A;  3VYY A;  2RS7 A;  4JI6 E;  2LUQ A;  1X49 A;  4BC7 A;  2M7Q A;  4DUZ E;  2JR1 A;  3VK6 A;  2UXB E;  4KZS A;  3OML A;  4JI2 E;  1N32 E;  1FKA E;  2L2N A;  4DV7 E;  1HNX E;  4B3R E;  4F9A B;  1N33 E;  2LBS B;  1N36 E;  4WPY A;  2L33 A;  1N34 E;  2KON A;  3DF6 A;  2NUG A;  4LF9 E;  2L3J A;  5AE1 A;  4LFA E;  2MDR A;  3ADG A;  5T6J A;  4DR4 E;  4DR3 E;  3ZOQ B;  2KHX A;  2EB1 A;  2FGG A;  4M0V A;  2A11 A;  2RTX A;  3RV1 A;  1STU A;  2CPN A;  3DJW A;  3F6H A;  5LMU E;  4DV4 E;  4P78 A;  3HPS A;  3H09 A;  4R8O A;  2F4V E;  3VYX A;  3RV0 A;  4DR1 E;  1ZBQ A;  3MSW A;  2HHH E;  2G7H A;  2V8Q B;  1WXR A;  5IWA E;  4DUY E;  5DNY A;  2V83 A;  1RQ0 A;  2H36 X;  2LE2 A;  5IT9 C;  2V85 A;  2NUE A;  2YZT A;  2LMZ A;  3IWB A;  3K6Q A;  1WHN A;  4WSP A;  1IBL E;  1IBM E;  3J7A G;  4KHP E;  1DI2 A;  2EWL A;  3LML A;  2KOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...