1YYWA

Crystal structure of rnase iii from aquifex aeolicus complexed with double stranded rna at 2.8-angstrom resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
219
structure length
219
Chain Sequence
b'KMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*AP*AP*UP*AP*UP*AP*UP*AP*UP*UP*U)-3'
publication title Intermediate states of ribonuclease III in complex with double-stranded RNA
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
total genus 62
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2005-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 1yywA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1yywA02
2L2KB 1N32E 1DI2A 2HHHE 2NUEA 4GKJE 3C4TA 2YT4A 4LF6E 1U61A 1PKPA 1FJGE 4DR4E 2UU9E 4JI5E 5IWAE 4X64E 2RS6A 4JI6E 4YHHE 4X65E 4DV0E 5CFFE 2NA2A 1J5EE 4JYAE 1FKAE 1I94E 1O0WA 1RC7A 1T4LB 2RSMA 4DUZE 4DV6E 4JI0E 4M30A 3ADIA 1WHNA 4KHPE 2L2NA 1YYOA 3ADJA 2RTXA 3HTXA 4DKKA 2UUBE 4JI7E 1IBKE 1WHQA 2JY9A 1ZBTA 4JI8E 2N3GA 2UUAE 4K0KE 4DUYE 2L3CA 2LJHA 3J7Yp 2N3HA 1T4NA 4JI3E 1YYKA 2UXCE 1RQ0A 4AQYE 2L2MA 4GKKE 5LMUE 1UHZA 2IHR1 2LTRA 1J26A 4NXME 2B7TA 2DIXA 2VQEE 3RV1A 1XMQE 2NUFA 2DB2A 4M2ZA 3P1XA 2LTSA 4DR1E 3VYXA 1EKZA 4LFBE 2LBSB 4DV2E 2EZ6A 4B3SE 1N33E 4LF8E 2EB1A 2CPNA 1T4OA 3LLHA 1HNXE 2UUCE 3C4BA 3T1YE 2QVWA 1GQEA 4JI4E 1X49A 2MDRA 4X66E 4DV1E 4B3TE 2E5LE 4LF5E 2UXBE 2F4VE 2GSLA 4LFAE 3ADGA 5BR8E 1RC5A 1N36E 4DR6E 1QU6A 4LF9E 3N3WA 2LRSA 4JI2E 2L3JA 2LUQA 4NXNE 1I4SA 4LF7E 2ZM6E 4YY3E 4DV7E 2A11A 3T1HE 4DV3E 4DV4E 4B3ME 2B3TB 4DR7E 3O2RA 1X47A 4DR2E 1STUA 1IBLE 4JV5E 3ADLA 4DV5E 4B3RE 2VQFE 4DR5E 4DR3E 1XMOE 1HNWE 1HNZE 4LFCE 2UXDE 1JFZA 1YZ9A 1X48A 5LMNE 2RS7A 1UILA 1N34E 4X62E 4OUNA 2L33A 3OTOE 4X8WA 2FFLA 2DMYA 4WYQB 3VYYA 3O2RB 2LUPB 4LF4E 1HR0E 2JVAA 2NUGA 2KHXA 4WFTA 1XNQE 4OOGC 2B7VA 3RV0A 4OX9E 1XNRE 1YYWA 1IBME 4JI1E
chains in the Genus database with same CATH superfamily
4BC9A 2EN6A 5AE2A 3HXLA 1DI2A 4GKJE 2EM5A 4M9VC 4TUGA 1PJQA 1TN9A 2EOEA 1F2IG 2YTNA 4YHHE 2EMIA 2ENHA 2NA2A 2EJ4A 4NZVA 1J5EE 3EPHA 4JYAE 1O0WA 2YU5A 2EMBA 1L4SA 3JU0A 2EPMX 2YRKA 2E1MA 2EM3A 4Q35B 2LV2A 2RTXA 3HQ1A 3VK6A 2UUBE 1YUIA 3HTXA 1WHQA 1ZBTA 2N3GA 2YU8A 2WBSA 2LJHA 2EN2A 2CTDA 1RQ0A 2EPAA 2LVHA 4GKKE 2IHR1 1XMQE 4MLQA 4M2ZA 4DR1E 2EWLA 2EM7A 2I9IA 1IMUA 2EOQA 1UBDC 2EMHA 4F6NA 2LMZA 5KL3A 1N33E 2EB1A 3AV0A 5A6AA 2ADRA 1X3CA 2YPNA 4F9CB 1HNXE 5LLQA 3T1YE 4F54A 2I13A 2DGCA 2EM4A 1BBGA 2EE8A 1MEYC 2LT7A 2E5LE 2EOOA 2F4VE 2NABA 4LFAE 5BR8E 2EPOA 2JWOA 1PDAA 1N36E 2LRSA 4JI2E 4LF7E 1G2FC 2ZM6E 3MSWA 1X6HA 4LU9A 4DR7E 1X47A 4JV5E 3ADLA 2EN1A 2VQFE 4O5GA 2JOXA 4DR5E 1PJSA 3HPSA 4BHCA 2JYAA 4R2AA 4BBYA 4LFCE 2UXDE 2K4VA 5KL4A 2FGGA 1X48A 2EM0A 1N34E 2L33A 4X8WA 3UK3C 3F6HA 2YRMA 5A69A 2DLKA 2JVAA 4X9JA 2KHXA 4GZNC 4R2PA 2YSPA 3JAMC 4NHRA 3RV0A 3J80C 2L2KB 1BBOA 5KL6A 2HHHE 3KZZA 3FIGA 2YT4A 4LF6E 1PKPA 3IWDA 1FJGE 2EMWA 3BF2A 2V8QB 1MGTA 2UU9E 2R76A 5T6JA 4X64E 2LE2A 4DV0E 2KOUA 1A1FA 2LJUA 1PJTA 2ODRD 1T4LB 1YFHA 2HC5A 3ADIA 4KHPE 2RPCA 2L2NA 2DRPA 1YYOA 4WXCA 5ADZA 4DKKA 2A25A 2EORA 1IBKE 2YWQA 2WZOA 2EMZA 2EPLX 2JY9A 2V88A 4MLVA 4JI8E 2HGHA 2DLQA 2DSYA 3THOB 3TQMA 2L3CA 4P78A 1A1GA 2EMCA 5LL6R 1YYKA 2UXCE 5AE1A 5FLXC 1J26A 2V89A 4Q28A 2DMIA 2NUFA 5IXMB 4ZYEA 3J81C 2EM8A 3P1XA 1T38A 5KL7A 3THNA 4GEQB 4TUIA 2EOYA 2LBSB 3LMLA 4DV2E 2EZ6A 2JP9A 4B3SE 4LF8E 2EOFA 2YTQA 2Q8UA 3OMLA 2CPNA 1T4OA 2YTPA 4IJDA 2EN3A 5TSEA 2B9DA 1NEIA 1X49A 2KONA 2EOXA 2ELYA 4DV1E 5AC4A 1SFEA 2EPRA 1X6EA 2MC5A 2EOSA 1QU6A 2MKNA 1I4SA 4LTYA 2MKDA 2YSOA 3EPLA 2RQLA 3H09A 3T1HE 4DV3E 1TF6A 1GZ6A 2YRHA 2B3TB 4HEIA 5A6BA 5AASA 3O2RA 4I8OA 1STUA 4L5NC 4DR2E 4R2EA 1KJKA 2EOHA 3EPJA 1G2DC 3IWBA 2GHFA 1HNZE 2EP3A 2ODRC 1JFZA 5LMNE 1QNTA 1EH6A 2YTFA 4HTGA 4OUNA 3OTOE 3O2RB 1ZBQA 1TF3A 1HR0E 3BBGA 2V83A 4WFTA 2YTOA 1IQSA 2B7VA 4OX9E 1YYWA 4BS9A 1IBME 2EL5A 1N32E 3K6QA 1KYQA 2ENAA 2EL4A 4DR4E 2FTXB 3QG5C 2EMGA 5KL5A 2J7JA 5IWAE 2WBUA 4JI5E 1NCSA 1A1JA 2EN7A 4JI6E 4F9BB 5CFFE 2WCC3 4WSGA 2EQ1A 2EMKA 2YTEA 5A6KA 1RC7A 4ZYDA 1A1LA 4DUZE 4DV6E 4JI0E 2GPIA 4M30A 1WHNA 1ZU1A 2M9AA 2PRTA 2JOBA 5A2QC 2G7HA 3IWCA 2JPAA 2UUAE 2YTJA 3C6MA 1BB8A 4JI3E 1ZTDA 3HPZA 1JK1A 4R2SA 3JTZA 1AAYA 1X5WA 4AQYE 2MC6A 2BBGA 2EQ3A 2LTRA 2V87A 5LMUE 2B7TA 4O24A 2DIXA 1DQ3A 1LLMC 2EM2A 1RMDA 2LTSA 4R2DA 1EKZA 2F8BA 3VHTB 3J7AG 4P7DA 4KWYA 2JXPA 2LO3A 1YUJA 3LLHA 4BC7A 1B69A 4RHBB 5AC5A 1GQEA 2EM6A 1IQOA 2EN8A 2MDRA 2EM9A 2L92A 4X66E 2YTGA 1SR9A 4B3TE 4LF5E 2UXBE 4FK5C 1RC5A 4R03A 4DR6E 2CSHA 3AUZA 2CT1A 2LUQA 3M99B 2VRDA 4DV4E 4B3ME 3MHHC 1UN6B 2EMXA 2YTDA 3KWRA 2EQ0A 1A1HA 4KZSA 4ZYGA 4DV5E 3BIDA 1ZR9A 4R8OA 5IV8B 2BB8A 4WSPA 2RS7A 1UILA 4X62E 2L6MA 2FFLA 2LUPB 2EL6A 4L8NA 3EPKA 2V86A 4JI1E 2ENCA 1JK2A 2H36X 5AE3A 2NUEA 2JR1A 4N4RB 3C4TA 2HJJA 1Z1BA 1U61A 1P47A 1X6FA 2EN4A 2RSIA 2WBTA 1A1IA 2RS6A 4WX9A 2EOJA 4X65E 2MDGA 3C6KA 1FKAE 1I94E 2EPNA 2RSMA 5IT9C 4IS1C 2EMFA 1DGCA 3F6GA 2EMYA 3ADJA 2EMLA 4JI7E 2GLIA 2EOMA 4J8ZA 2EPCA 4K0KE 4DUYE 3J7Yp 2N3HA 1T4NA 2M4IA 4DMIA 4F6MA 2ELZA 2V85A 2EPPA 1YSAC 2E72A 1EH8A 2L2MA 1UHZA 4NXME 3BGHA 5A6JA 2VQEE 3RV1A 4R2QA 4R2RA 2DB2A 4BCAA 1N3GA 3VYXA 2D9HA 1GTKA 1WJPA 4LFBE 2N8XA 4BHBA 2EPKX 2EPZA 3L00A 5F3WA 2UUCE 3C4BA 2R1FA 2QVWA 1AH5A 4JI4E 2FV4B 2LCEA 2GSLA 3ZOQB 3ADGA 4BMJA 2VF1A 4LF9E 3N3WA 1WXRA 2L3JA 4NXNE 4O4KA 2EOZA 4YY3E 4DV7E 4O43A 2A11A 2K7IA 2M1SA 1T39A 4R2CA 4ZYHA 1IBLE 2EPXA 4B3RE 4DR3E 2VE7C 4F9AB 1XMOE 2EPUA 1WRJA 1HNWE 3MHSC 2M7QA 5DNYA 1YZ9A 4WPYA 3RMPA 2YTIA 2DMYA 4WYQB 5A6BD 3VYYA 1A1KA 4LF4E 2NUGA 3DF6A 2L8TA 4M0VA 4WXDA 3EQ1A 1XNQE 1EH7A 2EMAA 4OOGC 1ZAAC 3DJWA 2EOIA 2YZTA 3ECRA 4RH8A 1XNRE 3KZYA 1YPNA 5KL2A 4F2JC
chains in the Genus database with same CATH topology
3J80C 2L2KB 4BC9A 1N32E 1DI2A 5AE2A 3HXLA 3K6QA 2H36X 5AE3A 2HHHE 2NUEA 2JR1A 4GKJE 3FIGA 3C4TA 1XNRE 2YT4A 4LF6E 1U61A 1PKPA 3IWDA 2FTXB 1FJGE 4TUGA 2V8QB 4DR4E 2UU9E 4JI5E 5IWAE 5T6JA 4X64E 2RS6A 4JI6E 2LE2A 4F9BB 2KOUA 4X65E 5CFFE 4YHHE 4DV0E 2NA2A 1J5EE 4JYAE 1FKAE 1I94E 1O0WA 1RC7A 2ODRD 1T4LB 2RSMA 3JU0A 4DUZE 4DV6E 5IT9C 4JI0E 4M30A 3ADIA 1WHNA 2E1MA 3F6GA 4KHPE 2L2NA 1YYOA 3ADJA 5ADZA 2RTXA 3HQ1A 3VK6A 4DKKA 2UUBE 3HTXA 2JOBA 4JI7E 1IBKE 5A2QC 2G7HA 1WHQA 2WZOA 4J8ZA 2JY9A 1ZBTA 2V88A 4JI8E 2N3GA 3IWCA 2UUAE 4K0KE 2DSYA 4DUYE 2L3CA 2LJHA 4P78A 3J7Yp 2N3HA 1T4NA 2M4IA 4JI3E 4DMIA 3HPZA 5LL6R 1YYKA 2UXCE 1RQ0A 3JTZA 5AE1A 2V85A 5FLXC 4AQYE 2L2MA 2MC6A 5LMUE 1UHZA 2IHR1 2LTRA 2V87A 2V89A 4GKKE 4NXME 1J26A 2B7TA 4Q28A 2DIXA 2VQEE 3RV1A 1XMQE 2NUFA 1DQ3A 2DB2A 4BCAA 3J81C 4M2ZA 3P1XA 2LTSA 4DR1E 3VYXA 2EWLA 4GEQB 4TUIA 1EKZA 4LFBE 2F8BA 2LBSB 2LMZA 3LMLA 2EZ6A 4P7DA 4DV2E 4B3SE 3J7AG 4LF8E 1N33E 2EB1A 3AV0A 3OMLA 2CPNA 1T4OA 3LLHA 4F9CB 4BC7A 5F3WA 1HNXE 3C4BA 2UUCE 3T1YE 2QVWA 4F54A 1GQEA 2B9DA 4JI4E 1X49A 2KONA 2MDRA 2L92A 4X66E 4DV1E 1SR9A 2FV4B 4B3TE 2E5LE 4LF5E 2UXBE 2F4VE 2GSLA 4LFAE 3ZOQB 3ADGA 4BMJA 5BR8E 2MC5A 1RC5A 4R03A 2JWOA 2VF1A 1N36E 1QU6A 4LF9E 3N3WA 2LRSA 4JI2E 3AUZA 2LUQA 1WXRA 1I4SA 4LTYA 2L3JA 4LF7E 2ZM6E 4NXNE 4YY3E 4DV7E 3MSWA 2A11A 3H09A 3T1HE 4DV3E 4DV4E 2M1SA 4LU9A 4B3ME 1GZ6A 2B3TB 4DR7E 5AASA 3KWRA 3O2RA 1X47A 4I8OA 1STUA 4L5NC 4KZSA 4DR2E 1IBLE 3ADLA 4DV5E 4B3RE 4JV5E 2VQFE 4DR5E 2JOXA 4DR3E 2VE7C 4F9AB 3HPSA 3IWBA 1XMOE 1HNWE 4R8OA 2M7QA 4BBYA 1HNZE 5DNYA 4LFCE 2K4VA 2UXDE 2FGGA 1JFZA 1YZ9A 1X48A 2ODRC 4WSPA 5LMNE 4WPYA 4DR6E 2RS7A 1UILA 1N34E 4X62E 4OUNA 2L33A 3OTOE 2L6MA 2FFLA 2DMYA 4X8WA 3RMPA 4BS9A 4WYQB 3F6HA 3O2RB 1ZBQA 4L8NA 3VYYA 2LUPB 4LF4E 1HR0E 2JVAA 2NUGA 3DF6A 2L8TA 2KHXA 4M0VA 2V83A 4WFTA 1XNQE 4OOGC 3JAMC 3DJWA 2B7VA 3RV0A 2YZTA 4OX9E 2V86A 1YYWA 1IBME 4JI1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2K B;  1N32 E;  1DI2 A;  2HHH E;  2NUE A;  4GKJ E;  3C4T A;  2YT4 A;  4LF6 E;  1U61 A;  1PKP A;  1FJG E;  4DR4 E;  2UU9 E;  4JI5 E;  5IWA E;  4X64 E;  2RS6 A;  4JI6 E;  4YHH E;  4X65 E;  4DV0 E;  5CFF E;  2NA2 A;  1J5E E;  4JYA E;  1FKA E;  1I94 E;  1O0W A;  1RC7 A;  1T4L B;  2RSM A;  4DUZ E;  4DV6 E;  4JI0 E;  4M30 A;  3ADI A;  1WHN A;  4KHP E;  2L2N A;  1YYO A;  3ADJ A;  2RTX A;  3HTX A;  4DKK A;  2UUB E;  4JI7 E;  1IBK E;  1WHQ A;  2JY9 A;  1ZBT A;  4JI8 E;  2N3G A;  2UUA E;  4K0K E;  4DUY E;  2L3C A;  2LJH A;  3J7Y p;  2N3H A;  1T4N A;  4JI3 E;  1YYK A;  2UXC E;  1RQ0 A;  4AQY E;  2L2M A;  4GKK E;  5LMU E;  1UHZ A;  2IHR 1;  2LTR A;  1J26 A;  4NXM E;  2B7T A;  2DIX A;  2VQE E;  3RV1 A;  1XMQ E;  2NUF A;  2DB2 A;  4M2Z A;  3P1X A;  2LTS A;  4DR1 E;  3VYX A;  1EKZ A;  4LFB E;  2LBS B;  4DV2 E;  2EZ6 A;  4B3S E;  1N33 E;  4LF8 E;  2EB1 A;  2CPN A;  1T4O A;  3LLH A;  1HNX E;  2UUC E;  3C4B A;  3T1Y E;  2QVW A;  1GQE A;  4JI4 E;  1X49 A;  2MDR A;  4X66 E;  4DV1 E;  4B3T E;  2E5L E;  4LF5 E;  2UXB E;  2F4V E;  2GSL A;  4LFA E;  3ADG A;  5BR8 E;  1RC5 A;  1N36 E;  4DR6 E;  1QU6 A;  4LF9 E;  3N3W A;  2LRS A;  4JI2 E;  2L3J A;  2LUQ A;  4NXN E;  1I4S A;  4LF7 E;  2ZM6 E;  4YY3 E;  4DV7 E;  2A11 A;  3T1H E;  4DV3 E;  4DV4 E;  4B3M E;  2B3T B;  4DR7 E;  3O2R A;  1X47 A;  4DR2 E;  1STU A;  1IBL E;  4JV5 E;  3ADL A;  4DV5 E;  4B3R E;  2VQF E;  4DR5 E;  4DR3 E;  1XMO E;  1HNW E;  1HNZ E;  4LFC E;  2UXD E;  1JFZ A;  1YZ9 A;  1X48 A;  5LMN E;  2RS7 A;  1UIL A;  1N34 E;  4X62 E;  4OUN A;  2L33 A;  3OTO E;  4X8W A;  2FFL A;  2DMY A;  4WYQ B;  3VYY A;  3O2R B;  2LUP B;  4LF4 E;  1HR0 E;  2JVA A;  2NUG A;  2KHX A;  4WFT A;  1XNQ E;  4OOG C;  2B7V A;  3RV0 A;  4OX9 E;  1XNR E;  1YYW A;  1IBM E;  4JI1 E; 
#chains in the Genus database with same CATH topology
 4BC9 A;  2EN6 A;  5AE2 A;  3HXL A;  1DI2 A;  4GKJ E;  2EM5 A;  4M9V C;  4TUG A;  1PJQ A;  1TN9 A;  2EOE A;  1F2I G;  2YTN A;  4YHH E;  2EMI A;  2ENH A;  2NA2 A;  2EJ4 A;  4NZV A;  1J5E E;  3EPH A;  4JYA E;  1O0W A;  2YU5 A;  2EMB A;  1L4S A;  3JU0 A;  2EPM X;  2YRK A;  2E1M A;  2EM3 A;  4Q35 B;  2LV2 A;  2RTX A;  3HQ1 A;  3VK6 A;  2UUB E;  1YUI A;  3HTX A;  1WHQ A;  1ZBT A;  2N3G A;  2YU8 A;  2WBS A;  2LJH A;  2EN2 A;  2CTD A;  1RQ0 A;  2EPA A;  2LVH A;  4GKK E;  2IHR 1;  1XMQ E;  4MLQ A;  4M2Z A;  4DR1 E;  2EWL A;  2EM7 A;  2I9I A;  1IMU A;  2EOQ A;  1UBD C;  2EMH A;  4F6N A;  2LMZ A;  5KL3 A;  1N33 E;  2EB1 A;  3AV0 A;  5A6A A;  2ADR A;  1X3C A;  2YPN A;  4F9C B;  1HNX E;  5LLQ A;  3T1Y E;  4F54 A;  2I13 A;  2DGC A;  2EM4 A;  1BBG A;  2EE8 A;  1MEY C;  2LT7 A;  2E5L E;  2EOO A;  2F4V E;  2NAB A;  4LFA E;  5BR8 E;  2EPO A;  2JWO A;  1PDA A;  1N36 E;  2LRS A;  4JI2 E;  4LF7 E;  1G2F C;  2ZM6 E;  3MSW A;  1X6H A;  4LU9 A;  4DR7 E;  1X47 A;  4JV5 E;  3ADL A;  2EN1 A;  2VQF E;  4O5G A;  2JOX A;  4DR5 E;  1PJS A;  3HPS A;  4BHC A;  2JYA A;  4R2A A;  4BBY A;  4LFC E;  2UXD E;  2K4V A;  5KL4 A;  2FGG A;  1X48 A;  2EM0 A;  1N34 E;  2L33 A;  4X8W A;  3UK3 C;  3F6H A;  2YRM A;  5A69 A;  2DLK A;  2JVA A;  4X9J A;  2KHX A;  4GZN C;  4R2P A;  2YSP A;  3JAM C;  4NHR A;  3RV0 A;  3J80 C;  2L2K B;  1BBO A;  5KL6 A;  2HHH E;  3KZZ A;  3FIG A;  2YT4 A;  4LF6 E;  1PKP A;  3IWD A;  1FJG E;  2EMW A;  3BF2 A;  2V8Q B;  1MGT A;  2UU9 E;  2R76 A;  5T6J A;  4X64 E;  2LE2 A;  4DV0 E;  2KOU A;  1A1F A;  2LJU A;  1PJT A;  2ODR D;  1T4L B;  1YFH A;  2HC5 A;  3ADI A;  4KHP E;  2RPC A;  2L2N A;  2DRP A;  1YYO A;  4WXC A;  5ADZ A;  4DKK A;  2A25 A;  2EOR A;  1IBK E;  2YWQ A;  2WZO A;  2EMZ A;  2EPL X;  2JY9 A;  2V88 A;  4MLV A;  4JI8 E;  2HGH A;  2DLQ A;  2DSY A;  3THO B;  3TQM A;  2L3C A;  4P78 A;  1A1G A;  2EMC A;  5LL6 R;  1YYK A;  2UXC E;  5AE1 A;  5FLX C;  1J26 A;  2V89 A;  4Q28 A;  2DMI A;  2NUF A;  5IXM B;  4ZYE A;  3J81 C;  2EM8 A;  3P1X A;  1T38 A;  5KL7 A;  3THN A;  4GEQ B;  4TUI A;  2EOY A;  2LBS B;  3LML A;  4DV2 E;  2EZ6 A;  2JP9 A;  4B3S E;  4LF8 E;  2EOF A;  2YTQ A;  2Q8U A;  3OML A;  2CPN A;  1T4O A;  2YTP A;  4IJD A;  2EN3 A;  5TSE A;  2B9D A;  1NEI A;  1X49 A;  2KON A;  2EOX A;  2ELY A;  4DV1 E;  5AC4 A;  1SFE A;  2EPR A;  1X6E A;  2MC5 A;  2EOS A;  1QU6 A;  2MKN A;  1I4S A;  4LTY A;  2MKD A;  2YSO A;  3EPL A;  2RQL A;  3H09 A;  3T1H E;  4DV3 E;  1TF6 A;  1GZ6 A;  2YRH A;  2B3T B;  4HEI A;  5A6B A;  5AAS A;  3O2R A;  4I8O A;  1STU A;  4L5N C;  4DR2 E;  4R2E A;  1KJK A;  2EOH A;  3EPJ A;  1G2D C;  3IWB A;  2GHF A;  1HNZ E;  2EP3 A;  2ODR C;  1JFZ A;  5LMN E;  1QNT A;  1EH6 A;  2YTF A;  4HTG A;  4OUN A;  3OTO E;  3O2R B;  1ZBQ A;  1TF3 A;  1HR0 E;  3BBG A;  2V83 A;  4WFT A;  2YTO A;  1IQS A;  2B7V A;  4OX9 E;  1YYW A;  4BS9 A;  1IBM E;  2EL5 A;  1N32 E;  3K6Q A;  1KYQ A;  2ENA A;  2EL4 A;  4DR4 E;  2FTX B;  3QG5 C;  2EMG A;  5KL5 A;  2J7J A;  5IWA E;  2WBU A;  4JI5 E;  1NCS A;  1A1J A;  2EN7 A;  4JI6 E;  4F9B B;  5CFF E;  2WCC 3;  4WSG A;  2EQ1 A;  2EMK A;  2YTE A;  5A6K A;  1RC7 A;  4ZYD A;  1A1L A;  4DUZ E;  4DV6 E;  4JI0 E;  2GPI A;  4M30 A;  1WHN A;  1ZU1 A;  2M9A A;  2PRT A;  2JOB A;  5A2Q C;  2G7H A;  3IWC A;  2JPA A;  2UUA E;  2YTJ A;  3C6M A;  1BB8 A;  4JI3 E;  1ZTD A;  3HPZ A;  1JK1 A;  4R2S A;  3JTZ A;  1AAY A;  1X5W A;  4AQY E;  2MC6 A;  2BBG A;  2EQ3 A;  2LTR A;  2V87 A;  5LMU E;  2B7T A;  4O24 A;  2DIX A;  1DQ3 A;  1LLM C;  2EM2 A;  1RMD A;  2LTS A;  4R2D A;  1EKZ A;  2F8B A;  3VHT B;  3J7A G;  4P7D A;  4KWY A;  2JXP A;  2LO3 A;  1YUJ A;  3LLH A;  4BC7 A;  1B69 A;  4RHB B;  5AC5 A;  1GQE A;  2EM6 A;  1IQO A;  2EN8 A;  2MDR A;  2EM9 A;  2L92 A;  4X66 E;  2YTG A;  1SR9 A;  4B3T E;  4LF5 E;  2UXB E;  4FK5 C;  1RC5 A;  4R03 A;  4DR6 E;  2CSH A;  3AUZ A;  2CT1 A;  2LUQ A;  3M99 B;  2VRD A;  4DV4 E;  4B3M E;  3MHH C;  1UN6 B;  2EMX A;  2YTD A;  3KWR A;  2EQ0 A;  1A1H A;  4KZS A;  4ZYG A;  4DV5 E;  3BID A;  1ZR9 A;  4R8O A;  5IV8 B;  2BB8 A;  4WSP A;  2RS7 A;  1UIL A;  4X62 E;  2L6M A;  2FFL A;  2LUP B;  2EL6 A;  4L8N A;  3EPK A;  2V86 A;  4JI1 E;  2ENC A;  1JK2 A;  2H36 X;  5AE3 A;  2NUE A;  2JR1 A;  4N4R B;  3C4T A;  2HJJ A;  1Z1B A;  1U61 A;  1P47 A;  1X6F A;  2EN4 A;  2RSI A;  2WBT A;  1A1I A;  2RS6 A;  4WX9 A;  2EOJ A;  4X65 E;  2MDG A;  3C6K A;  1FKA E;  1I94 E;  2EPN A;  2RSM A;  5IT9 C;  4IS1 C;  2EMF A;  1DGC A;  3F6G A;  2EMY A;  3ADJ A;  2EML A;  4JI7 E;  2GLI A;  2EOM A;  4J8Z A;  2EPC A;  4K0K E;  4DUY E;  3J7Y p;  2N3H A;  1T4N A;  2M4I A;  4DMI A;  4F6M A;  2ELZ A;  2V85 A;  2EPP A;  1YSA C;  2E72 A;  1EH8 A;  2L2M A;  1UHZ A;  4NXM E;  3BGH A;  5A6J A;  2VQE E;  3RV1 A;  4R2Q A;  4R2R A;  2DB2 A;  4BCA A;  1N3G A;  3VYX A;  2D9H A;  1GTK A;  1WJP A;  4LFB E;  2N8X A;  4BHB A;  2EPK X;  2EPZ A;  3L00 A;  5F3W A;  2UUC E;  3C4B A;  2R1F A;  2QVW A;  1AH5 A;  4JI4 E;  2FV4 B;  2LCE A;  2GSL A;  3ZOQ B;  3ADG A;  4BMJ A;  2VF1 A;  4LF9 E;  3N3W A;  1WXR A;  2L3J A;  4NXN E;  4O4K A;  2EOZ A;  4YY3 E;  4DV7 E;  4O43 A;  2A11 A;  2K7I A;  2M1S A;  1T39 A;  4R2C A;  4ZYH A;  1IBL E;  2EPX A;  4B3R E;  4DR3 E;  2VE7 C;  4F9A B;  1XMO E;  2EPU A;  1WRJ A;  1HNW E;  3MHS C;  2M7Q A;  5DNY A;  1YZ9 A;  4WPY A;  3RMP A;  2YTI A;  2DMY A;  4WYQ B;  5A6B D;  3VYY A;  1A1K A;  4LF4 E;  2NUG A;  3DF6 A;  2L8T A;  4M0V A;  4WXD A;  3EQ1 A;  1XNQ E;  1EH7 A;  2EMA A;  4OOG C;  1ZAA C;  3DJW A;  2EOI A;  2YZT A;  3ECR A;  4RH8 A;  1XNR E;  3KZY A;  1YPN A;  5KL2 A;  4F2J C; 
#chains in the Genus database with same CATH homology
 3J80 C;  2L2K B;  4BC9 A;  1N32 E;  1DI2 A;  5AE2 A;  3HXL A;  3K6Q A;  2H36 X;  5AE3 A;  2HHH E;  2NUE A;  2JR1 A;  4GKJ E;  3FIG A;  3C4T A;  1XNR E;  2YT4 A;  4LF6 E;  1U61 A;  1PKP A;  3IWD A;  2FTX B;  1FJG E;  4TUG A;  2V8Q B;  4DR4 E;  2UU9 E;  4JI5 E;  5IWA E;  5T6J A;  4X64 E;  2RS6 A;  4JI6 E;  2LE2 A;  4F9B B;  2KOU A;  4X65 E;  5CFF E;  4YHH E;  4DV0 E;  2NA2 A;  1J5E E;  4JYA E;  1FKA E;  1I94 E;  1O0W A;  1RC7 A;  2ODR D;  1T4L B;  2RSM A;  3JU0 A;  4DUZ E;  4DV6 E;  5IT9 C;  4JI0 E;  4M30 A;  3ADI A;  1WHN A;  2E1M A;  3F6G A;  4KHP E;  2L2N A;  1YYO A;  3ADJ A;  5ADZ A;  2RTX A;  3HQ1 A;  3VK6 A;  4DKK A;  2UUB E;  3HTX A;  2JOB A;  4JI7 E;  1IBK E;  5A2Q C;  2G7H A;  1WHQ A;  2WZO A;  4J8Z A;  2JY9 A;  1ZBT A;  2V88 A;  4JI8 E;  2N3G A;  3IWC A;  2UUA E;  4K0K E;  2DSY A;  4DUY E;  2L3C A;  2LJH A;  4P78 A;  3J7Y p;  2N3H A;  1T4N A;  2M4I A;  4JI3 E;  4DMI A;  3HPZ A;  5LL6 R;  1YYK A;  2UXC E;  1RQ0 A;  3JTZ A;  5AE1 A;  2V85 A;  5FLX C;  4AQY E;  2L2M A;  2MC6 A;  5LMU E;  1UHZ A;  2IHR 1;  2LTR A;  2V87 A;  2V89 A;  4GKK E;  4NXM E;  1J26 A;  2B7T A;  4Q28 A;  2DIX A;  2VQE E;  3RV1 A;  1XMQ E;  2NUF A;  1DQ3 A;  2DB2 A;  4BCA A;  3J81 C;  4M2Z A;  3P1X A;  2LTS A;  4DR1 E;  3VYX A;  2EWL A;  4GEQ B;  4TUI A;  1EKZ A;  4LFB E;  2F8B A;  2LBS B;  2LMZ A;  3LML A;  2EZ6 A;  4P7D A;  4DV2 E;  4B3S E;  3J7A G;  4LF8 E;  1N33 E;  2EB1 A;  3AV0 A;  3OML A;  2CPN A;  1T4O A;  3LLH A;  4F9C B;  4BC7 A;  5F3W A;  1HNX E;  3C4B A;  2UUC E;  3T1Y E;  2QVW A;  4F54 A;  1GQE A;  2B9D A;  4JI4 E;  1X49 A;  2KON A;  2MDR A;  2L92 A;  4X66 E;  4DV1 E;  1SR9 A;  2FV4 B;  4B3T E;  2E5L E;  4LF5 E;  2UXB E;  2F4V E;  2GSL A;  4LFA E;  3ZOQ B;  3ADG A;  4BMJ A;  5BR8 E;  2MC5 A;  1RC5 A;  4R03 A;  2JWO A;  2VF1 A;  1N36 E;  1QU6 A;  4LF9 E;  3N3W A;  2LRS A;  4JI2 E;  3AUZ A;  2LUQ A;  1WXR A;  1I4S A;  4LTY A;  2L3J A;  4LF7 E;  2ZM6 E;  4NXN E;  4YY3 E;  4DV7 E;  3MSW A;  2A11 A;  3H09 A;  3T1H E;  4DV3 E;  4DV4 E;  2M1S A;  4LU9 A;  4B3M E;  1GZ6 A;  2B3T B;  4DR7 E;  5AAS A;  3KWR A;  3O2R A;  1X47 A;  4I8O A;  1STU A;  4L5N C;  4KZS A;  4DR2 E;  1IBL E;  3ADL A;  4DV5 E;  4B3R E;  4JV5 E;  2VQF E;  4DR5 E;  2JOX A;  4DR3 E;  2VE7 C;  4F9A B;  3HPS A;  3IWB A;  1XMO E;  1HNW E;  4R8O A;  2M7Q A;  4BBY A;  1HNZ E;  5DNY A;  4LFC E;  2K4V A;  2UXD E;  2FGG A;  1JFZ A;  1YZ9 A;  1X48 A;  2ODR C;  4WSP A;  5LMN E;  4WPY A;  4DR6 E;  2RS7 A;  1UIL A;  1N34 E;  4X62 E;  4OUN A;  2L33 A;  3OTO E;  2L6M A;  2FFL A;  2DMY A;  4X8W A;  3RMP A;  4BS9 A;  4WYQ B;  3F6H A;  3O2R B;  1ZBQ A;  4L8N A;  3VYY A;  2LUP B;  4LF4 E;  1HR0 E;  2JVA A;  2NUG A;  3DF6 A;  2L8T A;  2KHX A;  4M0V A;  2V83 A;  4WFT A;  1XNQ E;  4OOG C;  3JAM C;  3DJW A;  2B7V A;  3RV0 A;  2YZT A;  4OX9 E;  2V86 A;  1YYW A;  1IBM E;  4JI1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...