1YYWA

Crystal structure of rnase iii from aquifex aeolicus complexed with double stranded rna at 2.8-angstrom resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
219
structure length
219
Chain Sequence
KMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intermediate states of ribonuclease III in complex with double-stranded RNA
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
molecule keywords 5'-R(*AP*AP*AP*UP*AP*UP*AP*UP*AP*UP*UP*U)-3'
total genus 62
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2005-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 1yywA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1yywA02
2UXCE 1X49A 2UXDE 4OX9E 2NUGA 1FKAE 2B7TA 2UUAE 1IBLE 1WHNA 4DV1E 1HNZE 4X62E 3C4TA 4DV2E 2UU9E 4LF5E 4X66E 1EKZA 2YT4A 4M2ZA 1O0WA 4X65E 4JYAE 1STUA 2LTSA 4JI2E 4DV0E 1QU6A 4DR2E 1N33E 2CPNA 4OOGC 4LF6E 4DR4E 4DR7E 1X47A 2L3JA 1XMQE 4NXNE 3ADGA 1FJGE 4JI1E 2LRSA 4JI4E 2KHXA 4DKKA 4GKJE 4LF7E 2LUPB 4DR6E 3RV0A 3HTXA 3P1XA 1HNXE 1UILA 4GKKE 2FFLA 4LFAE 2LBSB 3N3WA 3VYYA 1T4LB 1U61A 2B3TB 1I4SA 3ADJA 4LFBE 2L33A 2UUCE 2EZ6A 2DIXA 4LF8E 2NA2A 4DV3E 3OTOE 4WYQB 2UUBE 4JI3E 4DR5E 4DV5E 1YZ9A 4DR3E 3RV1A 4AQYE 4LF4E 4DV6E 2ZM6E 1XNQE 4M30A 5CFFE 4JV5E 4NXME 1N32E 4JI7E 3C4BA 4DUYE 2LTRA 1X48A 4K0KE 2E5LE 4WFTA 4B3TE 3J7Yp 2DMYA 2A11A 1RC7A 3LLHA 2N3GA 4X64E 2NUFA 4YHHE 4DV4E 4JI6E 2IHR1 1XMOE 1YYOA 4JI8E 2DB2A 2RS7A 4B3RE 4B3SE 2LUQA 1DI2A 2L2MA 2RS6A 3T1YE 3VYXA 1T4OA 4LFCE 1IBKE 3ADLA 2B7VA 1HR0E 2L3CA 4YY3E 4KHPE 2LJHA 4LF9E 2JY9A 2RTXA 4JI0E 3ADIA 2EB1A 3T1HE 1T4NA 4DUZE 1YYWA 1UHZA 2L2KB 1I94E 2HHHE 2RSMA 2VQEE 5IWAE 4B3ME 2UXBE 1GQEA 2GSLA 1IBME 2F4VE 3O2RA 2VQFE 4DR1E 5LMUE 1PKPA 1RC5A 3O2RB 5BR8E 1J26A 4X8WA 1J5EE 1N36E 4DV7E 2NUEA 1RQ0A 1HNWE 1JFZA 2JVAA 2QVWA 1XNRE 1N34E 1YYKA 4OUNA 4JI5E 2N3HA 2L2NA 1ZBTA 2MDRA 5LMNE 1WHQA
chains in the Genus database with same CATH superfamily
4M9VC 2LCEA 2EOMA 1A1KA 4I8OA 1KJKA 4R2EA 2J7JA 3JAMC 4DV1E 1HNZE 3C4TA 5AASA 1YFHA 1EH6A 3RMPA 2EM5A 2EOEA 4DV0E 1QU6A 2I13A 4DR2E 4HTGA 4DR4E 4R2SA 2LO3A 1NCSA 2LT7A 2VRDA 2L3JA 1GTKA 3AUZA 2EL4A 4R03A 4FK5C 3RV0A 3H09A 1ZBQA 2EOSA 5AC4A 3MHSC 3HTXA 4O24A 2HJJA 2V88A 2V85A 2LBSB 1RMDA 4BHBA 2JOBA 2UUCE 3KZYA 2KOUA 4LF8E 3FIGA 2RPCA 2EM7A 3RV1A 2EMWA 2EL5A 1TF6A 3ZOQB 3HPZA 2I9IA 2FGGA 3C6MA 4NXME 2R76A 2YSOA 2ENAA 3C4BA 3MHHC 2EN4A 4DUYE 4WX9A 1X48A 4ZYHA 3KZZA 2E5LE 2LVHA 4HEIA 3BBGA 1LLMC 4WXCA 4O4KA 4X64E 3BF2A 2L92A 1SFEA 2K4VA 1IMUA 4JI6E 4KZSA 5T6JA 2DB2A 1F2IG 2VE7C 4Q28A 2E1MA 1PJTA 2DGCA 1IBKE 2L3CA 2BBGA 2DSYA 4BHCA 4KHPE 1X6EA 2JY9A 3ADIA 4RH8A 5FLXC 3DF6A 2EMKA 1UHZA 3J7AG 3M99B 2RSMA 2VQEE 2UXBE 4B3ME 2ENHA 2GSLA 2F4VE 3IWCA 3O2RA 5TSEA 4F6MA 3F6HA 1MGTA 2EMCA 1X6FA 2LMZA 3BGHA 1P47A 2EOFA 4IJDA 2YU8A 2EPKX 2RSIA 4BCAA 1N36E 2JVAA 1XNRE 2R1FA 1N34E 2DMIA 4WXDA 4JI5E 1WHQA 2RQLA 2YTIA 5KL6A 2ELZA 2EMZA 2EPNA 1EH8A 2UXDE 1FKAE 1WRJA 2ODRC 2EOYA 3OMLA 3THNA 4X66E 1EKZA 2YT4A 4JYAE 4JI2E 2YTPA 1N33E 4OOGC 4O43A 1X47A 2EM2A 2JR1A 3EPHA 5A6BD 3ADGA 4JI1E 2FV4B 4L5NC 4LF7E 2LUPB 2MDGA 2YTEA 1N3GA 2MKDA 2L6MA 2EOJA 4GKKE 3VYYA 2EM8A 1T4LB 2E72A 4LFBE 1DQ3A 1T38A 2EZ6A 2YTDA 2MKNA 4TUIA 5AE3A 2JPAA 1YZ9A 4WSGA 2GHFA 2ODRD 1SR9A 2YTNA 2EOQA 1JK2A 4BMJA 1TN9A 2ZM6E 1XNQE 4M30A 2EM4A 5CFFE 1DGCA 4JV5E 2GPIA 4GEQB 2EE8A 3THOB 2JP9A 4K0KE 4WFTA 4B3TE 5DNYA 3J7Yp 3EPKA 2DMYA 3AV0A 2EPRA 2LJUA 1GZ6A 2EPAA 2N3GA 2LV2A 4YHHE 4DV4E 1XMOE 1YYOA 4O5GA 2YTFA 2EMFA 2YWQA 1DI2A 2LUQA 3BIDA 1Z1BA 2HGHA 2EOIA 2RS6A 3T1YE 4L8NA 1UBDC 2EPLX 1WXRA 1BBOA 1ZU1A 1HR0E 4R2AA 1G2FC 1WJPA 3DJWA 1YPNA 2YZTA 2ENCA 2EMAA 1YYWA 2G7HA 1I94E 5IWAE 2M7QA 3QG5C 1IBME 1PDAA 3JTZA 4NHRA 4DR1E 1T39A 1PKPA 1RC5A 4Q35B 2EOHA 3IWDA 3O2RB 2EPUA 5IT9C 1J26A 4F9CB 4X8WA 1J5EE 4DV7E 2NUEA 2H36X 2EQ3A 1A1IA 2B9DA 2QVWA 3C6KA 2N3HA 2EPMX 4LTYA 2MC5A 2MDRA 4X9JA 5LMNE 2EMHA 2BB8A 2UXCE 1NEIA 1X49A 5AC5A 4N4RB 2B7TA 2UUAE 1MEYC 3HQ1A 2DLQA 2LE2A 4M2ZA 1STUA 2LTSA 2EPZA 2K7IA 4BBYA 2EM9A 2JYAA 1YSAC 1UN6B 4LF6E 3K6QA 4DR7E 2ADRA 4MLQA 1ZAAC 1XMQE 4NXNE 1FJGE 2LRSA 4DKKA 4GKJE 4F2JC 4DR6E 2M1SA 1HNXE 2YTJA 4IS1C 4KWYA 2FFLA 3N3WA 3LMLA 2B3TB 1I4SA 3ADJA 2EN6A 2L33A 5A6KA 2NA2A 3OTOE 2UUBE 4JI3E 2WZOA 4DR5E 1PJSA 4AQYE 2EN3A 4DV6E 2EN1A 2EOOA 1N32E 4JI7E 2CTDA 1B69A 3VHTB 2EM6A 1AH5A 2PRTA 2EMXA 2EN2A 4F54A 2A11A 2YRHA 5KL2A 1X3CA 3LLHA 2NUFA 4R2QA 2V8QB 2IHR1 2JWOA 1YUJA 2RS7A 4B3RE 4B3SE 2L2MA 2YRMA 2EORA 2M4IA 3ADLA 2B7VA 4F9AB 2YRKA 2EPXA 4YY3E 2KONA 2LJHA 5ADZA 2RTXA 1AAYA 4JI0E 4ZYEA 2EL6A 4ZYDA 2EB1A 1A1HA 3T1HE 4ZYGA 1T4NA 4DUZE 2WBUA 2V86A 2M9AA 2EOXA 4GZNC 4R2DA 2A25A 4R2CA 3UK3C 1GQEA 1BB8A 2JXPA 2VQFE 1A1FA 5LMUE 2MC6A 1QNTA 2EMYA 2EMLA 5BR8E 4NZVA 2Q8UA 2YTQA 1JK1A 1JFZA 2YU5A 4R2RA 1YYKA 4OUNA 4WPYA 4F9BB 3EPLA 1ZBTA 2EMBA 3VK6A 5F3WA 2EN8A 2CSHA 2EPOA 2NABA 4OX9E 2NUGA 2D9HA 2EQ0A 1WHNA 4WSPA 1IBLE 4X62E 5IV8B 4P78A 4DV2E 2GLIA 2UU9E 4LF5E 3ECRA 2EMGA 1O0WA 4X65E 4RHBB 2EWLA 3F6GA 4BC9A 2CPNA 1IQOA 5KL7A 1KYQA 4LU9A 4JI4E 1A1JA 2JOXA 1ZR9A 2KHXA 3HPSA 2V83A 3P1XA 1UILA 3IWBA 5KL4A 3J80C 1ZTDA 2VF1A 4LFAE 2EPCA 1U61A 2WCC3 1TF3A 4F6NA 2DIXA 1L4SA 4DV3E 4WYQB 1X5WA 2EQ1A 4DV5E 2EN7A 4DR3E 4LF4E 2YTOA 2EOZA 1G2DC 2LTRA 3HXLA 5A6JA 5A6AA 4P7DA 5AE2A 2EMIA 5AE1A 2YTGA 5A69A 4TUGA 3MSWA 1RC7A 3KWRA 1X6HA 4DMIA 4JI8E 2YPNA 2V89A 3JU0A 4R2PA 4J8ZA 2V87A 3VYXA 1T4OA 4LFCE 2N8XA 1YUIA 5LLQA 2FTXB 3EPJA 4LF9E 2WBSA 3L00A 2DRPA 3EQ1A 1A1LA 1IQSA 2EP3A 5KL3A 2WBTA 2YSPA 3J81C 5LL6R 1PJQA 2L8TA 2L2KB 5KL5A 2HHHE 1A1GA 3TQMA 4MLVA 2F8BA 2ELYA 2EJ4A 2EPPA 5IXMB 2EM0A 4M0VA 4BS9A 2CT1A 1BBGA 1EH7A 4R8OA 1RQ0A 4BC7A 1HNWE 5A2QC 2HC5A 5A6BA 2L2NA 2DLKA 2EM3A
chains in the Genus database with same CATH topology
2UXCE 1X49A 2UXDE 4I8OA 4OX9E 2NUGA 1FKAE 2B7TA 2UUAE 4WSPA 1WHNA 3JAMC 4DV1E 2ODRC 3C4TA 4X62E 1IBLE 5AASA 3HQ1A 1HNZE 4P78A 4DV2E 3OMLA 2UU9E 4LF5E 4X66E 3RMPA 2LE2A 1EKZA 2YT4A 4M2ZA 1O0WA 4X65E 4JYAE 1STUA 2LTSA 4JI2E 4DV0E 1QU6A 2EWLA 3F6GA 4BC9A 2CPNA 4BBYA 4DR2E 1N33E 4OOGC 4LF6E 4DR4E 3K6QA 4DR7E 1X47A 2JR1A 4LU9A 2L3JA 3AUZA 1XMQE 4NXNE 3ADGA 4R03A 4JI1E 2LRSA 2FV4B 2JOXA 2KHXA 2MDRA 4DKKA 4JI4E 4GKJE 3HPSA 4L5NC 4LF7E 2LUPB 4DR6E 3RV0A 2M1SA 1ZBQA 2V83A 3H09A 3P1XA 1UILA 1HNXE 3IWBA 3HTXA 2L6MA 4GKKE 3J80C 2V88A 2V85A 2FFLA 2VF1A 2LBSB 3N3WA 3VYYA 1T4LB 1U61A 2B3TB 3LMLA 4LFAE 1I4SA 3ADJA 4LFBE 1DQ3A 2L33A 2JOBA 2UUCE 2EZ6A 2DIXA 2KOUA 4LF8E 2NA2A 4DV3E 4TUIA 5AE3A 4WYQB 3OTOE 2UUBE 4JI3E 2WZOA 3FIGA 4DV5E 4DR5E 1YZ9A 4DR3E 3RV1A 2ODRD 4AQYE 1SR9A 4LF4E 4DV6E 4BMJA 3ZOQB 3HPZA 2ZM6E 4M30A 2FGGA 1XNQE 5CFFE 4JV5E 4NXME 1N32E 4JI7E 3C4BA 4DUYE 4GEQB 2LTRA 3HXLA 4P7DA 5AE2A 1X48A 5AE1A 4K0KE 2E5LE 4WFTA 4B3TE 5DNYA 3J7Yp 2DMYA 3AV0A 4F54A 2A11A 4TUGA 3MSWA 1GZ6A 1RC7A 3LLHA 2N3GA 4X64E 2NUFA 3KWRA 2V8QB 2L92A 2K4VA 4YHHE 4DV4E 4JI6E 4DMIA 2IHR1 2JWOA 1YYOA 1XMOE 4KZSA 5T6JA 4JI8E 2DB2A 2RS7A 4B3RE 2V89A 3JU0A 2LUQA 4B3SE 1DI2A 2L2MA 4J8ZA 2VE7C 2V87A 3VK6A 4Q28A 2RS6A 3T1YE 2E1MA 3VYXA 4L8NA 1T4OA 4LFCE 1WXRA 2M4IA 1IBKE 3ADLA 2B7VA 4F9AB 2FTXB 2L3CA 1HR0E 4YY3E 2KONA 2LJHA 2DSYA 4KHPE 4LF9E 5ADZA 3DJWA 2JY9A 2RTXA 4JI0E 3ADIA 2EB1A 3T1HE 5FLXC 3DF6A 2YZTA 1T4NA 4DUZE 3J81C 5LL6R 2V86A 2G7HA 1YYWA 1UHZA 2L8TA 2L2KB 1I94E 2HHHE 3J7AG 2RSMA 2VQEE 5IWAE 4B3ME 2UXBE 2M7QA 1GQEA 2GSLA 1IBME 3IWCA 2F8BA 3O2RA 3JTZA 2F4VE 2VQFE 4DR1E 3F6HA 5LMUE 2MC6A 1PKPA 1RC5A 3IWDA 3O2RB 2LMZA 4M0VA 5BR8E 4BS9A 5IT9C 1FJGE 1J26A 4F9CB 4X8WA 1J5EE 4BCAA 1N36E 4DV7E 2NUEA 2H36X 1RQ0A 4BC7A 1HNWE 1JFZA 2JVAA 2B9DA 2QVWA 1XNRE 5A2QC 1N34E 1YYKA 4OUNA 4WPYA 4F9BB 2N3HA 2L2NA 4JI5E 4LTYA 1ZBTA 2MC5A 4R8OA 5F3WA 5LMNE 1WHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC E;  1X49 A;  2UXD E;  4OX9 E;  2NUG A;  1FKA E;  2B7T A;  2UUA E;  1IBL E;  1WHN A;  4DV1 E;  1HNZ E;  4X62 E;  3C4T A;  4DV2 E;  2UU9 E;  4LF5 E;  4X66 E;  1EKZ A;  2YT4 A;  4M2Z A;  1O0W A;  4X65 E;  4JYA E;  1STU A;  2LTS A;  4JI2 E;  4DV0 E;  1QU6 A;  4DR2 E;  1N33 E;  2CPN A;  4OOG C;  4LF6 E;  4DR4 E;  4DR7 E;  1X47 A;  2L3J A;  1XMQ E;  4NXN E;  3ADG A;  1FJG E;  4JI1 E;  2LRS A;  4JI4 E;  2KHX A;  4DKK A;  4GKJ E;  4LF7 E;  2LUP B;  4DR6 E;  3RV0 A;  3HTX A;  3P1X A;  1HNX E;  1UIL A;  4GKK E;  2FFL A;  4LFA E;  2LBS B;  3N3W A;  3VYY A;  1T4L B;  1U61 A;  2B3T B;  1I4S A;  3ADJ A;  4LFB E;  2L33 A;  2UUC E;  2EZ6 A;  2DIX A;  4LF8 E;  2NA2 A;  4DV3 E;  3OTO E;  4WYQ B;  2UUB E;  4JI3 E;  4DR5 E;  4DV5 E;  1YZ9 A;  4DR3 E;  3RV1 A;  4AQY E;  4LF4 E;  4DV6 E;  2ZM6 E;  1XNQ E;  4M30 A;  5CFF E;  4JV5 E;  4NXM E;  1N32 E;  4JI7 E;  3C4B A;  4DUY E;  2LTR A;  1X48 A;  4K0K E;  2E5L E;  4WFT A;  4B3T E;  3J7Y p;  2DMY A;  2A11 A;  1RC7 A;  3LLH A;  2N3G A;  4X64 E;  2NUF A;  4YHH E;  4DV4 E;  4JI6 E;  2IHR 1;  1XMO E;  1YYO A;  4JI8 E;  2DB2 A;  2RS7 A;  4B3R E;  4B3S E;  2LUQ A;  1DI2 A;  2L2M A;  2RS6 A;  3T1Y E;  3VYX A;  1T4O A;  4LFC E;  1IBK E;  3ADL A;  2B7V A;  1HR0 E;  2L3C A;  4YY3 E;  4KHP E;  2LJH A;  4LF9 E;  2JY9 A;  2RTX A;  4JI0 E;  3ADI A;  2EB1 A;  3T1H E;  1T4N A;  4DUZ E;  1YYW A;  1UHZ A;  2L2K B;  1I94 E;  2HHH E;  2RSM A;  2VQE E;  5IWA E;  4B3M E;  2UXB E;  1GQE A;  2GSL A;  1IBM E;  2F4V E;  3O2R A;  2VQF E;  4DR1 E;  5LMU E;  1PKP A;  1RC5 A;  3O2R B;  5BR8 E;  1J26 A;  4X8W A;  1J5E E;  1N36 E;  4DV7 E;  2NUE A;  1RQ0 A;  1HNW E;  1JFZ A;  2JVA A;  2QVW A;  1XNR E;  1N34 E;  1YYK A;  4OUN A;  4JI5 E;  2N3H A;  2L2N A;  1ZBT A;  2MDR A;  5LMN E;  1WHQ A; 
#chains in the Genus database with same CATH topology
 4M9V C;  2LCE A;  2EOM A;  1A1K A;  4I8O A;  1KJK A;  4R2E A;  2J7J A;  3JAM C;  4DV1 E;  1HNZ E;  3C4T A;  5AAS A;  1YFH A;  1EH6 A;  3RMP A;  2EM5 A;  2EOE A;  4DV0 E;  1QU6 A;  2I13 A;  4DR2 E;  4HTG A;  4DR4 E;  4R2S A;  2LO3 A;  1NCS A;  2LT7 A;  2VRD A;  2L3J A;  1GTK A;  3AUZ A;  2EL4 A;  4R03 A;  4FK5 C;  3RV0 A;  3H09 A;  1ZBQ A;  2EOS A;  5AC4 A;  3MHS C;  3HTX A;  4O24 A;  2HJJ A;  2V88 A;  2V85 A;  2LBS B;  1RMD A;  4BHB A;  2JOB A;  2UUC E;  3KZY A;  2KOU A;  4LF8 E;  3FIG A;  2RPC A;  2EM7 A;  3RV1 A;  2EMW A;  2EL5 A;  1TF6 A;  3ZOQ B;  3HPZ A;  2I9I A;  2FGG A;  3C6M A;  4NXM E;  2R76 A;  2YSO A;  2ENA A;  3C4B A;  3MHH C;  2EN4 A;  4DUY E;  4WX9 A;  1X48 A;  4ZYH A;  3KZZ A;  2E5L E;  2LVH A;  4HEI A;  3BBG A;  1LLM C;  4WXC A;  4O4K A;  4X64 E;  3BF2 A;  2L92 A;  1SFE A;  2K4V A;  1IMU A;  4JI6 E;  4KZS A;  5T6J A;  2DB2 A;  1F2I G;  2VE7 C;  4Q28 A;  2E1M A;  1PJT A;  2DGC A;  1IBK E;  2L3C A;  2BBG A;  2DSY A;  4BHC A;  4KHP E;  1X6E A;  2JY9 A;  3ADI A;  4RH8 A;  5FLX C;  3DF6 A;  2EMK A;  1UHZ A;  3J7A G;  3M99 B;  2RSM A;  2VQE E;  2UXB E;  4B3M E;  2ENH A;  2GSL A;  2F4V E;  3IWC A;  3O2R A;  5TSE A;  4F6M A;  3F6H A;  1MGT A;  2EMC A;  1X6F A;  2LMZ A;  3BGH A;  1P47 A;  2EOF A;  4IJD A;  2YU8 A;  2EPK X;  2RSI A;  4BCA A;  1N36 E;  2JVA A;  1XNR E;  2R1F A;  1N34 E;  2DMI A;  4WXD A;  4JI5 E;  1WHQ A;  2RQL A;  2YTI A;  5KL6 A;  2ELZ A;  2EMZ A;  2EPN A;  1EH8 A;  2UXD E;  1FKA E;  1WRJ A;  2ODR C;  2EOY A;  3OML A;  3THN A;  4X66 E;  1EKZ A;  2YT4 A;  4JYA E;  4JI2 E;  2YTP A;  1N33 E;  4OOG C;  4O43 A;  1X47 A;  2EM2 A;  2JR1 A;  3EPH A;  5A6B D;  3ADG A;  4JI1 E;  2FV4 B;  4L5N C;  4LF7 E;  2LUP B;  2MDG A;  2YTE A;  1N3G A;  2MKD A;  2L6M A;  2EOJ A;  4GKK E;  3VYY A;  2EM8 A;  1T4L B;  2E72 A;  4LFB E;  1DQ3 A;  1T38 A;  2EZ6 A;  2YTD A;  2MKN A;  4TUI A;  5AE3 A;  2JPA A;  1YZ9 A;  4WSG A;  2GHF A;  2ODR D;  1SR9 A;  2YTN A;  2EOQ A;  1JK2 A;  4BMJ A;  1TN9 A;  2ZM6 E;  1XNQ E;  4M30 A;  2EM4 A;  5CFF E;  1DGC A;  4JV5 E;  2GPI A;  4GEQ B;  2EE8 A;  3THO B;  2JP9 A;  4K0K E;  4WFT A;  4B3T E;  5DNY A;  3J7Y p;  3EPK A;  2DMY A;  3AV0 A;  2EPR A;  2LJU A;  1GZ6 A;  2EPA A;  2N3G A;  2LV2 A;  4YHH E;  4DV4 E;  1XMO E;  1YYO A;  4O5G A;  2YTF A;  2EMF A;  2YWQ A;  1DI2 A;  2LUQ A;  3BID A;  1Z1B A;  2HGH A;  2EOI A;  2RS6 A;  3T1Y E;  4L8N A;  1UBD C;  2EPL X;  1WXR A;  1BBO A;  1ZU1 A;  1HR0 E;  4R2A A;  1G2F C;  1WJP A;  3DJW A;  1YPN A;  2YZT A;  2ENC A;  2EMA A;  1YYW A;  2G7H A;  1I94 E;  5IWA E;  2M7Q A;  3QG5 C;  1IBM E;  1PDA A;  3JTZ A;  4NHR A;  4DR1 E;  1T39 A;  1PKP A;  1RC5 A;  4Q35 B;  2EOH A;  3IWD A;  3O2R B;  2EPU A;  5IT9 C;  1J26 A;  4F9C B;  4X8W A;  1J5E E;  4DV7 E;  2NUE A;  2H36 X;  2EQ3 A;  1A1I A;  2B9D A;  2QVW A;  3C6K A;  2N3H A;  2EPM X;  4LTY A;  2MC5 A;  2MDR A;  4X9J A;  5LMN E;  2EMH A;  2BB8 A;  2UXC E;  1NEI A;  1X49 A;  5AC5 A;  4N4R B;  2B7T A;  2UUA E;  1MEY C;  3HQ1 A;  2DLQ A;  2LE2 A;  4M2Z A;  1STU A;  2LTS A;  2EPZ A;  2K7I A;  4BBY A;  2EM9 A;  2JYA A;  1YSA C;  1UN6 B;  4LF6 E;  3K6Q A;  4DR7 E;  2ADR A;  4MLQ A;  1ZAA C;  1XMQ E;  4NXN E;  1FJG E;  2LRS A;  4DKK A;  4GKJ E;  4F2J C;  4DR6 E;  2M1S A;  1HNX E;  2YTJ A;  4IS1 C;  4KWY A;  2FFL A;  3N3W A;  3LML A;  2B3T B;  1I4S A;  3ADJ A;  2EN6 A;  2L33 A;  5A6K A;  2NA2 A;  3OTO E;  2UUB E;  4JI3 E;  2WZO A;  4DR5 E;  1PJS A;  4AQY E;  2EN3 A;  4DV6 E;  2EN1 A;  2EOO A;  1N32 E;  4JI7 E;  2CTD A;  1B69 A;  3VHT B;  2EM6 A;  1AH5 A;  2PRT A;  2EMX A;  2EN2 A;  4F54 A;  2A11 A;  2YRH A;  5KL2 A;  1X3C A;  3LLH A;  2NUF A;  4R2Q A;  2V8Q B;  2IHR 1;  2JWO A;  1YUJ A;  2RS7 A;  4B3R E;  4B3S E;  2L2M A;  2YRM A;  2EOR A;  2M4I A;  3ADL A;  2B7V A;  4F9A B;  2YRK A;  2EPX A;  4YY3 E;  2KON A;  2LJH A;  5ADZ A;  2RTX A;  1AAY A;  4JI0 E;  4ZYE A;  2EL6 A;  4ZYD A;  2EB1 A;  1A1H A;  3T1H E;  4ZYG A;  1T4N A;  4DUZ E;  2WBU A;  2V86 A;  2M9A A;  2EOX A;  4GZN C;  4R2D A;  2A25 A;  4R2C A;  3UK3 C;  1GQE A;  1BB8 A;  2JXP A;  2VQF E;  1A1F A;  5LMU E;  2MC6 A;  1QNT A;  2EMY A;  2EML A;  5BR8 E;  4NZV A;  2Q8U A;  2YTQ A;  1JK1 A;  1JFZ A;  2YU5 A;  4R2R A;  1YYK A;  4OUN A;  4WPY A;  4F9B B;  3EPL A;  1ZBT A;  2EMB A;  3VK6 A;  5F3W A;  2EN8 A;  2CSH A;  2EPO A;  2NAB A;  4OX9 E;  2NUG A;  2D9H A;  2EQ0 A;  1WHN A;  4WSP A;  1IBL E;  4X62 E;  5IV8 B;  4P78 A;  4DV2 E;  2GLI A;  2UU9 E;  4LF5 E;  3ECR A;  2EMG A;  1O0W A;  4X65 E;  4RHB B;  2EWL A;  3F6G A;  4BC9 A;  2CPN A;  1IQO A;  5KL7 A;  1KYQ A;  4LU9 A;  4JI4 E;  1A1J A;  2JOX A;  1ZR9 A;  2KHX A;  3HPS A;  2V83 A;  3P1X A;  1UIL A;  3IWB A;  5KL4 A;  3J80 C;  1ZTD A;  2VF1 A;  4LFA E;  2EPC A;  1U61 A;  2WCC 3;  1TF3 A;  4F6N A;  2DIX A;  1L4S A;  4DV3 E;  4WYQ B;  1X5W A;  2EQ1 A;  4DV5 E;  2EN7 A;  4DR3 E;  4LF4 E;  2YTO A;  2EOZ A;  1G2D C;  2LTR A;  3HXL A;  5A6J A;  5A6A A;  4P7D A;  5AE2 A;  2EMI A;  5AE1 A;  2YTG A;  5A69 A;  4TUG A;  3MSW A;  1RC7 A;  3KWR A;  1X6H A;  4DMI A;  4JI8 E;  2YPN A;  2V89 A;  3JU0 A;  4R2P A;  4J8Z A;  2V87 A;  3VYX A;  1T4O A;  4LFC E;  2N8X A;  1YUI A;  5LLQ A;  2FTX B;  3EPJ A;  4LF9 E;  2WBS A;  3L00 A;  2DRP A;  3EQ1 A;  1A1L A;  1IQS A;  2EP3 A;  5KL3 A;  2WBT A;  2YSP A;  3J81 C;  5LL6 R;  1PJQ A;  2L8T A;  2L2K B;  5KL5 A;  2HHH E;  1A1G A;  3TQM A;  4MLV A;  2F8B A;  2ELY A;  2EJ4 A;  2EPP A;  5IXM B;  2EM0 A;  4M0V A;  4BS9 A;  2CT1 A;  1BBG A;  1EH7 A;  4R8O A;  1RQ0 A;  4BC7 A;  1HNW E;  5A2Q C;  2HC5 A;  5A6B A;  2L2N A;  2DLK A;  2EM3 A; 
#chains in the Genus database with same CATH homology
 2UXC E;  1X49 A;  2UXD E;  4I8O A;  4OX9 E;  2NUG A;  1FKA E;  2B7T A;  2UUA E;  4WSP A;  1WHN A;  3JAM C;  4DV1 E;  2ODR C;  3C4T A;  4X62 E;  1IBL E;  5AAS A;  3HQ1 A;  1HNZ E;  4P78 A;  4DV2 E;  3OML A;  2UU9 E;  4LF5 E;  4X66 E;  3RMP A;  2LE2 A;  1EKZ A;  2YT4 A;  4M2Z A;  1O0W A;  4X65 E;  4JYA E;  1STU A;  2LTS A;  4JI2 E;  4DV0 E;  1QU6 A;  2EWL A;  3F6G A;  4BC9 A;  2CPN A;  4BBY A;  4DR2 E;  1N33 E;  4OOG C;  4LF6 E;  4DR4 E;  3K6Q A;  4DR7 E;  1X47 A;  2JR1 A;  4LU9 A;  2L3J A;  3AUZ A;  1XMQ E;  4NXN E;  3ADG A;  4R03 A;  4JI1 E;  2LRS A;  2FV4 B;  2JOX A;  2KHX A;  2MDR A;  4DKK A;  4JI4 E;  4GKJ E;  3HPS A;  4L5N C;  4LF7 E;  2LUP B;  4DR6 E;  3RV0 A;  2M1S A;  1ZBQ A;  2V83 A;  3H09 A;  3P1X A;  1UIL A;  1HNX E;  3IWB A;  3HTX A;  2L6M A;  4GKK E;  3J80 C;  2V88 A;  2V85 A;  2FFL A;  2VF1 A;  2LBS B;  3N3W A;  3VYY A;  1T4L B;  1U61 A;  2B3T B;  3LML A;  4LFA E;  1I4S A;  3ADJ A;  4LFB E;  1DQ3 A;  2L33 A;  2JOB A;  2UUC E;  2EZ6 A;  2DIX A;  2KOU A;  4LF8 E;  2NA2 A;  4DV3 E;  4TUI A;  5AE3 A;  4WYQ B;  3OTO E;  2UUB E;  4JI3 E;  2WZO A;  3FIG A;  4DV5 E;  4DR5 E;  1YZ9 A;  4DR3 E;  3RV1 A;  2ODR D;  4AQY E;  1SR9 A;  4LF4 E;  4DV6 E;  4BMJ A;  3ZOQ B;  3HPZ A;  2ZM6 E;  4M30 A;  2FGG A;  1XNQ E;  5CFF E;  4JV5 E;  4NXM E;  1N32 E;  4JI7 E;  3C4B A;  4DUY E;  4GEQ B;  2LTR A;  3HXL A;  4P7D A;  5AE2 A;  1X48 A;  5AE1 A;  4K0K E;  2E5L E;  4WFT A;  4B3T E;  5DNY A;  3J7Y p;  2DMY A;  3AV0 A;  4F54 A;  2A11 A;  4TUG A;  3MSW A;  1GZ6 A;  1RC7 A;  3LLH A;  2N3G A;  4X64 E;  2NUF A;  3KWR A;  2V8Q B;  2L92 A;  2K4V A;  4YHH E;  4DV4 E;  4JI6 E;  4DMI A;  2IHR 1;  2JWO A;  1YYO A;  1XMO E;  4KZS A;  5T6J A;  4JI8 E;  2DB2 A;  2RS7 A;  4B3R E;  2V89 A;  3JU0 A;  2LUQ A;  4B3S E;  1DI2 A;  2L2M A;  4J8Z A;  2VE7 C;  2V87 A;  3VK6 A;  4Q28 A;  2RS6 A;  3T1Y E;  2E1M A;  3VYX A;  4L8N A;  1T4O A;  4LFC E;  1WXR A;  2M4I A;  1IBK E;  3ADL A;  2B7V A;  4F9A B;  2FTX B;  2L3C A;  1HR0 E;  4YY3 E;  2KON A;  2LJH A;  2DSY A;  4KHP E;  4LF9 E;  5ADZ A;  3DJW A;  2JY9 A;  2RTX A;  4JI0 E;  3ADI A;  2EB1 A;  3T1H E;  5FLX C;  3DF6 A;  2YZT A;  1T4N A;  4DUZ E;  3J81 C;  5LL6 R;  2V86 A;  2G7H A;  1YYW A;  1UHZ A;  2L8T A;  2L2K B;  1I94 E;  2HHH E;  3J7A G;  2RSM A;  2VQE E;  5IWA E;  4B3M E;  2UXB E;  2M7Q A;  1GQE A;  2GSL A;  1IBM E;  3IWC A;  2F8B A;  3O2R A;  3JTZ A;  2F4V E;  2VQF E;  4DR1 E;  3F6H A;  5LMU E;  2MC6 A;  1PKP A;  1RC5 A;  3IWD A;  3O2R B;  2LMZ A;  4M0V A;  5BR8 E;  4BS9 A;  5IT9 C;  1FJG E;  1J26 A;  4F9C B;  4X8W A;  1J5E E;  4BCA A;  1N36 E;  4DV7 E;  2NUE A;  2H36 X;  1RQ0 A;  4BC7 A;  1HNW E;  1JFZ A;  2JVA A;  2B9D A;  2QVW A;  1XNR E;  5A2Q C;  1N34 E;  1YYK A;  4OUN A;  4WPY A;  4F9B B;  2N3H A;  2L2N A;  4JI5 E;  4LTY A;  1ZBT A;  2MC5 A;  4R8O A;  5F3W A;  5LMN E;  1WHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...