1YYWA

Crystal structure of rnase iii from aquifex aeolicus complexed with double stranded rna at 2.8-angstrom resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
219
structure length
219
Chain Sequence
KMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*AP*AP*UP*AP*UP*AP*UP*AP*UP*UP*U)-3'
publication title Intermediate states of ribonuclease III in complex with double-stranded RNA
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
total genus 62
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2005-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 1yywA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1yywA02
1UILA 2ZM6E 1HNXE 2N3GA 2F4VE 4OUNA 3N3WA 2NUEA 2JVAA 5BR8E 3VYXA 2UXBE 4JI5E 1PKPA 4B3RE 4X64E 4LF4E 1N36E 1STUA 4DR5E 2UUAE 4LF6E 1J5EE 4K0KE 4X65E 2LRSA 4X66E 1O0WA 4LF5E 2UXDE 3HTXA 1FJGE 4OOGC 4JI0E 2QVWA 1YYWA 5LMUE 1XMOE 4DR2E 2RTXA 3VYYA 2L2MA 4OX9E 1RC7A 1T4OA 4LFBE 1X47A 3ADJA 4DV7E 1QU6A 1I94E 2L3JA 1YZ9A 2UUCE 2B7TA 4M2ZA 4B3TE 4DV6E 1X48A 5LMNE 1X49A 2IHR1 1JFZA 4YY3E 2L2KB 1J26A 4GKJE 2N3HA 5IWAE 4DV0E 4JYAE 4WFTA 2GSLA 3T1HE 4B3ME 4DV3E 4DR4E 3C4TA 2RS6A 4JI8E 3OTOE 1IBME 2UU9E 1XNQE 2HHHE 1FKAE 4JV5E 3ADIA 4DR7E 2NA2A 2EB1A 2A11A 1YYOA 4X62E 1HNZE 2EZ6A 4LF8E 3T1YE 1T4NA 1IBLE 1N32E 3O2RB 1ZBTA 1GQEA 2RS7A 4DKKA 2KHXA 2LTSA 4JI1E 1U61A 4JI7E 2DMYA 2B7VA 2LBSB 4NXME 2NUFA 2UUBE 1HNWE 3P1XA 4DV1E 1WHQA 3RV0A 4DR3E 1UHZA 2B3TB 4JI6E 1I4SA 2LTRA 1EKZA 4DR1E 4KHPE 4JI3E 1RQ0A 2E5LE 3C4BA 2RSMA 4DV5E 1XMQE 2LUPB 3O2RA 2VQEE 4LF9E 4NXNE 3J7Yp 1RC5A 2L2NA 4DV4E 1YYKA 1N34E 4JI4E 4DR6E 4GKKE 1T4LB 2FFLA 2JY9A 2LUQA 1N33E 1DI2A 2NUGA 3RV1A 5CFFE 3ADGA 2L3CA 3LLHA 4YHHE 4LFAE 2L33A 4X8WA 3ADLA 1WHNA 2MDRA 2DB2A 4DV2E 4LFCE 4LF7E 1HR0E 2YT4A 2DIXA 4M30A 4DUZE 1IBKE 2CPNA 4DUYE 2VQFE 4B3SE 4JI2E 2LJHA 4AQYE 1XNRE 4WYQB 2UXCE
chains in the Genus database with same CATH superfamily
1HNXE 2EL6A 2DLKA 2LJUA 2N3GA 3IWBA 2EM9A 2JR1A 3J7AG 3VYXA 2EMGA 4B3RE 3C6KA 4K0KE 2LRSA 2UXDE 2EOJA 1BBGA 2CSHA 3HTXA 3KWRA 1FJGE 4MLQA 2VE7C 2EMLA 4M0VA 5KL2A 5LMUE 2VF1A 2EORA 3C6MA 2L2MA 1YSAC 4F54A 3F6GA 2N8XA 2EMFA 4RHBB 2ELYA 2ODRC 2B7TA 4B3TE 1Z1BA 5LMNE 4IJDA 4R2AA 1JFZA 2V87A 5KL3A 2L2KB 4GKJE 1J26A 1L4SA 2EMZA 5IWAE 4R2CA 4DV0E 3T1HE 4BBYA 1UBDC 4B3ME 1SFEA 2EJ4A 2RS6A 1IBME 2VRDA 5AE3A 2LT7A 4NZVA 2HHHE 2YWQA 3HXLA 2NA2A 4O43A 2Q8UA 3THNA 2EMXA 2EZ6A 4R2RA 2YTNA 1P47A 2EPMX 4ZYEA 2V8QB 2EOMA 2BBGA 5LL6R 1AH5A 4BHCA 4O24A 4WXCA 4JI1E 1RMDA 1U61A 3TQMA 1ZAAC 2LBSB 2RPCA 4NXME 1HNWE 2UUBE 4NHRA 2LO3A 4DR3E 1ZU1A 1PDAA 2B3TB 4R2DA 4I8OA 4P78A 2WCC3 4KHPE 4JI3E 4N4RB 4F6MA 2E5LE 3C4BA 2RSMA 4DV5E 1XMQE 4F2JC 4R03A 2J7JA 2LUPB 1TF6A 4GZNC 4IS1C 3J7Yp 2FV4B 2L2NA 1GTKA 4O5GA 2FFLA 1X3CA 3LLHA 3J80C 2NABA 3ADLA 2G7HA 2DGCA 4R2PA 2DSYA 2EM4A 1GZ6A 2CPNA 4ZYGA 2I13A 2VQFE 4HTGA 4O4KA 2A25A 2M7QA 2ZM6E 1A1JA 2EOYA 2F4VE 4JI5E 1X6FA 4X64E 4LF4E 2EPUA 2EMBA 2ENCA 1F2IG 4LF6E 5AC5A 2EPZA 4LF5E 2PRTA 2YTGA 2YU8A 1EH7A 1PJQA 2V85A 2EPRA 1T4OA 1EH6A 4X9JA 2JYAA 2KOUA 4DV7E 2EM2A 3THOB 2CTDA 1I94E 2UUCE 4M2ZA 2V88A 4M9VC 3HQ1A 1JK2A 2HJJA 2I9IA 1X49A 1PJSA 5KL5A 4ZYDA 2EM0A 2EMKA 3MHHC 2N3HA 2RQLA 1JK1A 1N3GA 2EM3A 2EQ0A 2EN1A 2YRHA 2EPOA 2K4VA 3EPKA 2UU9E 2EMWA 2ADRA 3J81C 2YTFA 1FKAE 2A11A 4R8OA 5F3WA 1HNZE 2JOBA 4LF8E 2YRMA 2MDGA 2RSIA 3O2RB 2YU5A 1A1FA 1A1IA 2RS7A 1WJPA 3OMLA 4BHBA 4JI7E 3BIDA 4BS9A 2EOHA 4HEIA 3VK6A 5DNYA 2NUFA 2BB8A 2JP9A 5A2QC 1WHQA 1A1KA 1WXRA 3IWCA 4JI6E 2YTQA 2CT1A 1EKZA 5TSEA 4WPYA 4P7DA 2DLQA 1RQ0A 2YZTA 1A1LA 1BB8A 2EOFA 2LCEA 2EQ3A 1IQSA 2MKNA 2EN8A 3O2RA 5LLQA 2EWLA 2EOXA 4DV4E 2WBSA 1AAYA 2DMIA 2JY9A 5KL4A 2LUQA 2L8TA 2R1FA 2NUGA 3RV1A 5CFFE 2L3CA 4Q35B 1ZR9A 2YPNA 2L33A 2V89A 1B69A 1G2DC 2DB2A 2R76A 4LF7E 1HR0E 2DIXA 3EPLA 2V83A 2MKDA 1DQ3A 4GEQB 1YUJA 4WXDA 4DUYE 4LU9A 4WSPA 2LV2A 3BGHA 1WRJA 2EMIA 2M4IA 2WBUA 4OUNA 2EN3A 1EH8A 5BR8E 3AUZA 2LMZA 2YTEA 1STUA 2DRPA 4KWYA 2UUAE 4X65E 4X66E 1MGTA 2EM8A 4JI0E 1YYWA 2EOEA 2YSPA 1TN9A 1XMOE 2EN2A 2RTXA 3JTZA 4OX9E 2GPIA 4L8NA 3AV0A 1X47A 1SR9A 2YTPA 2EM7A 3JU0A 1KJKA 2MC5A 4FK5C 4YY3E 4RH8A 4R2EA 3HPZA 2EPKX 1X6HA 2EP3A 1DGCA 1YUIA 2D9HA 2EOSA 4JYAE 4TUGA 3C4TA 2ENAA 3UK3C 1UN6B 4JI8E 4TUIA 3OTOE 3ECRA 4BC9A 4L5NC 4DR7E 2EB1A 1YYOA 4F9CB 5FLXC 4J8ZA 1IBLE 3BBGA 1ZBTA 2EPXA 2WBTA 4DKKA 2LTSA 3LMLA 4ZYHA 1T38A 2FTXB 1LLMC 3DJWA 1ZBQA 2YRKA 4DV1E 1A1HA 3RV0A 3VHTB 1IQOA 2HC5A 1YPNA 1BBOA 5KL7A 2LTRA 4DR1E 4WSGA 4BCAA 3QG5C 1A1GA 2EMHA 2EM5A 4DMIA 2VQEE 2JXPA 2EN4A 2F8BA 2EM6A 3HPSA 2EPAA 2WZOA 5AC4A 2YTOA 1T4LB 1N33E 2EMAA 1DI2A 4Q28A 4KZSA 3ADGA 2KONA 4YHHE 2FGGA 4LFAE 2M9AA 5IV8B 2B9DA 3FIGA 1X6EA 2GHFA 4DV2E 4LFCE 4F6NA 2YT4A 3KZYA 4JI2E 2LJHA 3JAMC 2UXCE 1UILA 2EQ1A 5A6KA 2YTDA 3L00A 2UXBE 3N3WA 2NUEA 2EOOA 2JVAA 2L6MA 3K6QA 1PKPA 1YFHA 1KYQA 2JWOA 1N36E 1G2FC 4DR5E 3EQ1A 2K7IA 2EN7A 1J5EE 2ENHA 1O0WA 5AE1A 3H09A 1X5WA 4OOGC 4WX9A 2QVWA 1NCSA 4DR2E 3VYYA 1QNTA 2EN6A 2EL5A 1RC7A 4LFBE 3ADJA 3RMPA 4F9BB 1QU6A 1ZTDA 1T39A 2L3JA 1YZ9A 1MEYC 4DV6E 1X48A 2EOZA 2IHR1 2ELZA 2EMYA 4WFTA 2GSLA 4DV3E 4DR4E 4LTYA 5AASA 2YSOA 1XNQE 2EPLX 4JV5E 5IXMB 2EOQA 3ADIA 4X62E 5A6BA 5AE2A 3T1YE 4BMJA 1T4NA 1N32E 3DF6A 4F9AB 4R2QA 1GQEA 2EPCA 2KHXA 1IMUA 2DMYA 2B7VA 5A6AA 3KZZA 2EMCA 2MC6A 3P1XA 3ZOQB 1UHZA 2E1MA 5ADZA 1I4SA 2L92A 5IT9C 1PJTA 2LE2A 5A69A 2JPAA 5A6JA 5A6BD 4BC7A 3MHSC 3EPJA 2ODRD 5T6JA 4LF9E 4NXNE 3EPHA 1RC5A 2EOIA 3MSWA 1YYKA 2V86A 1N34E 4JI4E 4DR6E 4GKKE 3F6HA 2YTJA 2H36X 2EPNA 2JOXA 4X8WA 1NEIA 1WHNA 2MDRA 4MLVA 2GLIA 5KL6A 2EPPA 2LVHA 4M30A 2M1SA 4DUZE 2E72A 2EL4A 3M99B 1IBKE 1TF3A 3BF2A 2HGHA 4B3SE 2YTIA 4R2SA 1XNRE 4AQYE 4WYQB 2EE8A 3IWDA
chains in the Genus database with same CATH topology
1UILA 2ZM6E 1HNXE 2M4IA 2N3GA 3IWBA 2F4VE 2JR1A 4OUNA 3N3WA 2NUEA 2JVAA 2L6MA 5BR8E 3J7AG 3K6QA 3AUZA 4JI5E 1PKPA 2LMZA 4B3RE 4X64E 2JWOA 4LF4E 1N36E 1STUA 4DR5E 2UUAE 4LF6E 1J5EE 4K0KE 4X65E 2LRSA 4X66E 1O0WA 5AE1A 4LF5E 2UXDE 3H09A 3HTXA 3KWRA 1FJGE 4OOGC 2VE7C 4M0VA 4JI0E 2QVWA 1YYWA 5LMUE 1XMOE 2VF1A 4DR2E 2RTXA 2V85A 3JTZA 2L2MA 3VYYA 4OX9E 4F54A 1RC7A 1T4OA 3F6GA 3AV0A 4L8NA 1X47A 4LFBE 3ADJA 1SR9A 2KOUA 4DV7E 3RMPA 4F9BB 1QU6A 3JU0A 1I94E 2L3JA 1YZ9A 2ODRC 2B7TA 2UUCE 4M2ZA 2MC5A 2V88A 3HQ1A 4DV6E 4B3TE 1X48A 5LMNE 2UXBE 1X49A 2IHR1 1JFZA 2V87A 4YY3E 2L2KB 3HPZA 4GKJE 1J26A 2N3HA 5IWAE 4DV0E 4JYAE 4TUGA 4WFTA 2GSLA 3T1HE 4BBYA 4B3ME 4DV3E 4DR4E 3C4TA 2K4VA 2RS6A 4LTYA 4JI8E 5AASA 4TUIA 3OTOE 1IBME 2UU9E 4BC9A 5AE3A 1XNQE 3J81C 2HHHE 1FKAE 4JV5E 4L5NC 3ADIA 3HXLA 4DR7E 2NA2A 4AQYE 2EB1A 2A11A 1YYOA 4R8OA 4X62E 4F9CB 5F3WA 5AE2A 1HNZE 2EZ6A 2JOBA 5FLXC 3T1YE 4LF8E 4J8ZA 4BMJA 1T4NA 2V8QB 1IBLE 1N32E 3DF6A 4F9AB 3O2RB 1ZBTA 1GQEA 5LL6R 2RS7A 4DKKA 2KHXA 2LTSA 3LMLA 4JI1E 3OMLA 1U61A 4JI7E 4BS9A 2DMYA 2B7VA 2FTXB 2LBSB 3DJWA 4NXME 3VK6A 5DNYA 1ZBQA 2NUFA 2UUBE 1HNWE 2MC6A 3P1XA 5A2QC 1WHQA 4DV1E 3RV0A 1WXRA 3IWCA 3ZOQB 4DR3E 1UHZA 2B3TB 2E1MA 4JI6E 5ADZA 1I4SA 2LTRA 1EKZA 2L92A 4I8OA 5IT9C 4P78A 2LE2A 4DR1E 4BCAA 4WPYA 4KHPE 4P7DA 4JI3E 2UXCE 1RQ0A 2E5LE 3C4BA 2RSMA 2YZTA 4DV5E 1XMQE 4BC7A 4R03A 2LUPB 2ODRD 4DMIA 3O2RA 5T6JA 2VQEE 4LF9E 4NXNE 3J7Yp 2FV4B 1RC5A 2L2NA 2EWLA 2F8BA 1YYKA 2V86A 3MSWA 4DV4E 3HPSA 2WZOA 1N34E 4JI4E 4DR6E 4GKKE 1T4LB 2FFLA 2JY9A 3F6HA 3VYXA 2H36X 2LUQA 1N33E 2L8TA 1DI2A 2NUGA 4Q28A 3RV1A 4KZSA 5CFFE 2JOXA 3ADGA 2L3CA 2KONA 3LLHA 2FGGA 4YHHE 3J80C 4LFAE 2L33A 2B9DA 4X8WA 2V89A 3FIGA 3ADLA 1WHNA 2G7HA 2MDRA 2DB2A 4DV2E 4LFCE 4LF7E 1HR0E 2YT4A 2DSYA 2DIXA 4M30A 1GZ6A 2M1SA 2V83A 4DUZE 1IBKE 1DQ3A 2CPNA 4GEQB 4DUYE 2VQFE 4B3SE 4LU9A 4JI2E 2LJHA 4WSPA 2M7QA 1XNRE 4WYQB 3JAMC 3IWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UIL A;  2ZM6 E;  1HNX E;  2N3G A;  2F4V E;  4OUN A;  3N3W A;  2NUE A;  2JVA A;  5BR8 E;  3VYX A;  2UXB E;  4JI5 E;  1PKP A;  4B3R E;  4X64 E;  4LF4 E;  1N36 E;  1STU A;  4DR5 E;  2UUA E;  4LF6 E;  1J5E E;  4K0K E;  4X65 E;  2LRS A;  4X66 E;  1O0W A;  4LF5 E;  2UXD E;  3HTX A;  1FJG E;  4OOG C;  4JI0 E;  2QVW A;  1YYW A;  5LMU E;  1XMO E;  4DR2 E;  2RTX A;  3VYY A;  2L2M A;  4OX9 E;  1RC7 A;  1T4O A;  4LFB E;  1X47 A;  3ADJ A;  4DV7 E;  1QU6 A;  1I94 E;  2L3J A;  1YZ9 A;  2UUC E;  2B7T A;  4M2Z A;  4B3T E;  4DV6 E;  1X48 A;  5LMN E;  1X49 A;  2IHR 1;  1JFZ A;  4YY3 E;  2L2K B;  1J26 A;  4GKJ E;  2N3H A;  5IWA E;  4DV0 E;  4JYA E;  4WFT A;  2GSL A;  3T1H E;  4B3M E;  4DV3 E;  4DR4 E;  3C4T A;  2RS6 A;  4JI8 E;  3OTO E;  1IBM E;  2UU9 E;  1XNQ E;  2HHH E;  1FKA E;  4JV5 E;  3ADI A;  4DR7 E;  2NA2 A;  2EB1 A;  2A11 A;  1YYO A;  4X62 E;  1HNZ E;  2EZ6 A;  4LF8 E;  3T1Y E;  1T4N A;  1IBL E;  1N32 E;  3O2R B;  1ZBT A;  1GQE A;  2RS7 A;  4DKK A;  2KHX A;  2LTS A;  4JI1 E;  1U61 A;  4JI7 E;  2DMY A;  2B7V A;  2LBS B;  4NXM E;  2NUF A;  2UUB E;  1HNW E;  3P1X A;  4DV1 E;  1WHQ A;  3RV0 A;  4DR3 E;  1UHZ A;  2B3T B;  4JI6 E;  1I4S A;  2LTR A;  1EKZ A;  4DR1 E;  4KHP E;  4JI3 E;  1RQ0 A;  2E5L E;  3C4B A;  2RSM A;  4DV5 E;  1XMQ E;  2LUP B;  3O2R A;  2VQE E;  4LF9 E;  4NXN E;  3J7Y p;  1RC5 A;  2L2N A;  4DV4 E;  1YYK A;  1N34 E;  4JI4 E;  4DR6 E;  4GKK E;  1T4L B;  2FFL A;  2JY9 A;  2LUQ A;  1N33 E;  1DI2 A;  2NUG A;  3RV1 A;  5CFF E;  3ADG A;  2L3C A;  3LLH A;  4YHH E;  4LFA E;  2L33 A;  4X8W A;  3ADL A;  1WHN A;  2MDR A;  2DB2 A;  4DV2 E;  4LFC E;  4LF7 E;  1HR0 E;  2YT4 A;  2DIX A;  4M30 A;  4DUZ E;  1IBK E;  2CPN A;  4DUY E;  2VQF E;  4B3S E;  4JI2 E;  2LJH A;  4AQY E;  1XNR E;  4WYQ B;  2UXC E; 
#chains in the Genus database with same CATH topology
 1HNX E;  2EL6 A;  2DLK A;  2LJU A;  2N3G A;  3IWB A;  2EM9 A;  2JR1 A;  3J7A G;  3VYX A;  2EMG A;  4B3R E;  3C6K A;  4K0K E;  2LRS A;  2UXD E;  2EOJ A;  1BBG A;  2CSH A;  3HTX A;  3KWR A;  1FJG E;  4MLQ A;  2VE7 C;  2EML A;  4M0V A;  5KL2 A;  5LMU E;  2VF1 A;  2EOR A;  3C6M A;  2L2M A;  1YSA C;  4F54 A;  3F6G A;  2N8X A;  2EMF A;  4RHB B;  2ELY A;  2ODR C;  2B7T A;  4B3T E;  1Z1B A;  5LMN E;  4IJD A;  4R2A A;  1JFZ A;  2V87 A;  5KL3 A;  2L2K B;  4GKJ E;  1J26 A;  1L4S A;  2EMZ A;  5IWA E;  4R2C A;  4DV0 E;  3T1H E;  4BBY A;  1UBD C;  4B3M E;  1SFE A;  2EJ4 A;  2RS6 A;  1IBM E;  2VRD A;  5AE3 A;  2LT7 A;  4NZV A;  2HHH E;  2YWQ A;  3HXL A;  2NA2 A;  4O43 A;  2Q8U A;  3THN A;  2EMX A;  2EZ6 A;  4R2R A;  2YTN A;  1P47 A;  2EPM X;  4ZYE A;  2V8Q B;  2EOM A;  2BBG A;  5LL6 R;  1AH5 A;  4BHC A;  4O24 A;  4WXC A;  4JI1 E;  1RMD A;  1U61 A;  3TQM A;  1ZAA C;  2LBS B;  2RPC A;  4NXM E;  1HNW E;  2UUB E;  4NHR A;  2LO3 A;  4DR3 E;  1ZU1 A;  1PDA A;  2B3T B;  4R2D A;  4I8O A;  4P78 A;  2WCC 3;  4KHP E;  4JI3 E;  4N4R B;  4F6M A;  2E5L E;  3C4B A;  2RSM A;  4DV5 E;  1XMQ E;  4F2J C;  4R03 A;  2J7J A;  2LUP B;  1TF6 A;  4GZN C;  4IS1 C;  3J7Y p;  2FV4 B;  2L2N A;  1GTK A;  4O5G A;  2FFL A;  1X3C A;  3LLH A;  3J80 C;  2NAB A;  3ADL A;  2G7H A;  2DGC A;  4R2P A;  2DSY A;  2EM4 A;  1GZ6 A;  2CPN A;  4ZYG A;  2I13 A;  2VQF E;  4HTG A;  4O4K A;  2A25 A;  2M7Q A;  2ZM6 E;  1A1J A;  2EOY A;  2F4V E;  4JI5 E;  1X6F A;  4X64 E;  4LF4 E;  2EPU A;  2EMB A;  2ENC A;  1F2I G;  4LF6 E;  5AC5 A;  2EPZ A;  4LF5 E;  2PRT A;  2YTG A;  2YU8 A;  1EH7 A;  1PJQ A;  2V85 A;  2EPR A;  1T4O A;  1EH6 A;  4X9J A;  2JYA A;  2KOU A;  4DV7 E;  2EM2 A;  3THO B;  2CTD A;  1I94 E;  2UUC E;  4M2Z A;  2V88 A;  4M9V C;  3HQ1 A;  1JK2 A;  2HJJ A;  2I9I A;  1X49 A;  1PJS A;  5KL5 A;  4ZYD A;  2EM0 A;  2EMK A;  3MHH C;  2N3H A;  2RQL A;  1JK1 A;  1N3G A;  2EM3 A;  2EQ0 A;  2EN1 A;  2YRH A;  2EPO A;  2K4V A;  3EPK A;  2UU9 E;  2EMW A;  2ADR A;  3J81 C;  2YTF A;  1FKA E;  2A11 A;  4R8O A;  5F3W A;  1HNZ E;  2JOB A;  4LF8 E;  2YRM A;  2MDG A;  2RSI A;  3O2R B;  2YU5 A;  1A1F A;  1A1I A;  2RS7 A;  1WJP A;  3OML A;  4BHB A;  4JI7 E;  3BID A;  4BS9 A;  2EOH A;  4HEI A;  3VK6 A;  5DNY A;  2NUF A;  2BB8 A;  2JP9 A;  5A2Q C;  1WHQ A;  1A1K A;  1WXR A;  3IWC A;  4JI6 E;  2YTQ A;  2CT1 A;  1EKZ A;  5TSE A;  4WPY A;  4P7D A;  2DLQ A;  1RQ0 A;  2YZT A;  1A1L A;  1BB8 A;  2EOF A;  2LCE A;  2EQ3 A;  1IQS A;  2MKN A;  2EN8 A;  3O2R A;  5LLQ A;  2EWL A;  2EOX A;  4DV4 E;  2WBS A;  1AAY A;  2DMI A;  2JY9 A;  5KL4 A;  2LUQ A;  2L8T A;  2R1F A;  2NUG A;  3RV1 A;  5CFF E;  2L3C A;  4Q35 B;  1ZR9 A;  2YPN A;  2L33 A;  2V89 A;  1B69 A;  1G2D C;  2DB2 A;  2R76 A;  4LF7 E;  1HR0 E;  2DIX A;  3EPL A;  2V83 A;  2MKD A;  1DQ3 A;  4GEQ B;  1YUJ A;  4WXD A;  4DUY E;  4LU9 A;  4WSP A;  2LV2 A;  3BGH A;  1WRJ A;  2EMI A;  2M4I A;  2WBU A;  4OUN A;  2EN3 A;  1EH8 A;  5BR8 E;  3AUZ A;  2LMZ A;  2YTE A;  1STU A;  2DRP A;  4KWY A;  2UUA E;  4X65 E;  4X66 E;  1MGT A;  2EM8 A;  4JI0 E;  1YYW A;  2EOE A;  2YSP A;  1TN9 A;  1XMO E;  2EN2 A;  2RTX A;  3JTZ A;  4OX9 E;  2GPI A;  4L8N A;  3AV0 A;  1X47 A;  1SR9 A;  2YTP A;  2EM7 A;  3JU0 A;  1KJK A;  2MC5 A;  4FK5 C;  4YY3 E;  4RH8 A;  4R2E A;  3HPZ A;  2EPK X;  1X6H A;  2EP3 A;  1DGC A;  1YUI A;  2D9H A;  2EOS A;  4JYA E;  4TUG A;  3C4T A;  2ENA A;  3UK3 C;  1UN6 B;  4JI8 E;  4TUI A;  3OTO E;  3ECR A;  4BC9 A;  4L5N C;  4DR7 E;  2EB1 A;  1YYO A;  4F9C B;  5FLX C;  4J8Z A;  1IBL E;  3BBG A;  1ZBT A;  2EPX A;  2WBT A;  4DKK A;  2LTS A;  3LML A;  4ZYH A;  1T38 A;  2FTX B;  1LLM C;  3DJW A;  1ZBQ A;  2YRK A;  4DV1 E;  1A1H A;  3RV0 A;  3VHT B;  1IQO A;  2HC5 A;  1YPN A;  1BBO A;  5KL7 A;  2LTR A;  4DR1 E;  4WSG A;  4BCA A;  3QG5 C;  1A1G A;  2EMH A;  2EM5 A;  4DMI A;  2VQE E;  2JXP A;  2EN4 A;  2F8B A;  2EM6 A;  3HPS A;  2EPA A;  2WZO A;  5AC4 A;  2YTO A;  1T4L B;  1N33 E;  2EMA A;  1DI2 A;  4Q28 A;  4KZS A;  3ADG A;  2KON A;  4YHH E;  2FGG A;  4LFA E;  2M9A A;  5IV8 B;  2B9D A;  3FIG A;  1X6E A;  2GHF A;  4DV2 E;  4LFC E;  4F6N A;  2YT4 A;  3KZY A;  4JI2 E;  2LJH A;  3JAM C;  2UXC E;  1UIL A;  2EQ1 A;  5A6K A;  2YTD A;  3L00 A;  2UXB E;  3N3W A;  2NUE A;  2EOO A;  2JVA A;  2L6M A;  3K6Q A;  1PKP A;  1YFH A;  1KYQ A;  2JWO A;  1N36 E;  1G2F C;  4DR5 E;  3EQ1 A;  2K7I A;  2EN7 A;  1J5E E;  2ENH A;  1O0W A;  5AE1 A;  3H09 A;  1X5W A;  4OOG C;  4WX9 A;  2QVW A;  1NCS A;  4DR2 E;  3VYY A;  1QNT A;  2EN6 A;  2EL5 A;  1RC7 A;  4LFB E;  3ADJ A;  3RMP A;  4F9B B;  1QU6 A;  1ZTD A;  1T39 A;  2L3J A;  1YZ9 A;  1MEY C;  4DV6 E;  1X48 A;  2EOZ A;  2IHR 1;  2ELZ A;  2EMY A;  4WFT A;  2GSL A;  4DV3 E;  4DR4 E;  4LTY A;  5AAS A;  2YSO A;  1XNQ E;  2EPL X;  4JV5 E;  5IXM B;  2EOQ A;  3ADI A;  4X62 E;  5A6B A;  5AE2 A;  3T1Y E;  4BMJ A;  1T4N A;  1N32 E;  3DF6 A;  4F9A B;  4R2Q A;  1GQE A;  2EPC A;  2KHX A;  1IMU A;  2DMY A;  2B7V A;  5A6A A;  3KZZ A;  2EMC A;  2MC6 A;  3P1X A;  3ZOQ B;  1UHZ A;  2E1M A;  5ADZ A;  1I4S A;  2L92 A;  5IT9 C;  1PJT A;  2LE2 A;  5A69 A;  2JPA A;  5A6J A;  5A6B D;  4BC7 A;  3MHS C;  3EPJ A;  2ODR D;  5T6J A;  4LF9 E;  4NXN E;  3EPH A;  1RC5 A;  2EOI A;  3MSW A;  1YYK A;  2V86 A;  1N34 E;  4JI4 E;  4DR6 E;  4GKK E;  3F6H A;  2YTJ A;  2H36 X;  2EPN A;  2JOX A;  4X8W A;  1NEI A;  1WHN A;  2MDR A;  4MLV A;  2GLI A;  5KL6 A;  2EPP A;  2LVH A;  4M30 A;  2M1S A;  4DUZ E;  2E72 A;  2EL4 A;  3M99 B;  1IBK E;  1TF3 A;  3BF2 A;  2HGH A;  4B3S E;  2YTI A;  4R2S A;  1XNR E;  4AQY E;  4WYQ B;  2EE8 A;  3IWD A; 
#chains in the Genus database with same CATH homology
 1UIL A;  2ZM6 E;  1HNX E;  2M4I A;  2N3G A;  3IWB A;  2F4V E;  2JR1 A;  4OUN A;  3N3W A;  2NUE A;  2JVA A;  2L6M A;  5BR8 E;  3J7A G;  3K6Q A;  3AUZ A;  4JI5 E;  1PKP A;  2LMZ A;  4B3R E;  4X64 E;  2JWO A;  4LF4 E;  1N36 E;  1STU A;  4DR5 E;  2UUA E;  4LF6 E;  1J5E E;  4K0K E;  4X65 E;  2LRS A;  4X66 E;  1O0W A;  5AE1 A;  4LF5 E;  2UXD E;  3H09 A;  3HTX A;  3KWR A;  1FJG E;  4OOG C;  2VE7 C;  4M0V A;  4JI0 E;  2QVW A;  1YYW A;  5LMU E;  1XMO E;  2VF1 A;  4DR2 E;  2RTX A;  2V85 A;  3JTZ A;  2L2M A;  3VYY A;  4OX9 E;  4F54 A;  1RC7 A;  1T4O A;  3F6G A;  3AV0 A;  4L8N A;  1X47 A;  4LFB E;  3ADJ A;  1SR9 A;  2KOU A;  4DV7 E;  3RMP A;  4F9B B;  1QU6 A;  3JU0 A;  1I94 E;  2L3J A;  1YZ9 A;  2ODR C;  2B7T A;  2UUC E;  4M2Z A;  2MC5 A;  2V88 A;  3HQ1 A;  4DV6 E;  4B3T E;  1X48 A;  5LMN E;  2UXB E;  1X49 A;  2IHR 1;  1JFZ A;  2V87 A;  4YY3 E;  2L2K B;  3HPZ A;  4GKJ E;  1J26 A;  2N3H A;  5IWA E;  4DV0 E;  4JYA E;  4TUG A;  4WFT A;  2GSL A;  3T1H E;  4BBY A;  4B3M E;  4DV3 E;  4DR4 E;  3C4T A;  2K4V A;  2RS6 A;  4LTY A;  4JI8 E;  5AAS A;  4TUI A;  3OTO E;  1IBM E;  2UU9 E;  4BC9 A;  5AE3 A;  1XNQ E;  3J81 C;  2HHH E;  1FKA E;  4JV5 E;  4L5N C;  3ADI A;  3HXL A;  4DR7 E;  2NA2 A;  4AQY E;  2EB1 A;  2A11 A;  1YYO A;  4R8O A;  4X62 E;  4F9C B;  5F3W A;  5AE2 A;  1HNZ E;  2EZ6 A;  2JOB A;  5FLX C;  3T1Y E;  4LF8 E;  4J8Z A;  4BMJ A;  1T4N A;  2V8Q B;  1IBL E;  1N32 E;  3DF6 A;  4F9A B;  3O2R B;  1ZBT A;  1GQE A;  5LL6 R;  2RS7 A;  4DKK A;  2KHX A;  2LTS A;  3LML A;  4JI1 E;  3OML A;  1U61 A;  4JI7 E;  4BS9 A;  2DMY A;  2B7V A;  2FTX B;  2LBS B;  3DJW A;  4NXM E;  3VK6 A;  5DNY A;  1ZBQ A;  2NUF A;  2UUB E;  1HNW E;  2MC6 A;  3P1X A;  5A2Q C;  1WHQ A;  4DV1 E;  3RV0 A;  1WXR A;  3IWC A;  3ZOQ B;  4DR3 E;  1UHZ A;  2B3T B;  2E1M A;  4JI6 E;  5ADZ A;  1I4S A;  2LTR A;  1EKZ A;  2L92 A;  4I8O A;  5IT9 C;  4P78 A;  2LE2 A;  4DR1 E;  4BCA A;  4WPY A;  4KHP E;  4P7D A;  4JI3 E;  2UXC E;  1RQ0 A;  2E5L E;  3C4B A;  2RSM A;  2YZT A;  4DV5 E;  1XMQ E;  4BC7 A;  4R03 A;  2LUP B;  2ODR D;  4DMI A;  3O2R A;  5T6J A;  2VQE E;  4LF9 E;  4NXN E;  3J7Y p;  2FV4 B;  1RC5 A;  2L2N A;  2EWL A;  2F8B A;  1YYK A;  2V86 A;  3MSW A;  4DV4 E;  3HPS A;  2WZO A;  1N34 E;  4JI4 E;  4DR6 E;  4GKK E;  1T4L B;  2FFL A;  2JY9 A;  3F6H A;  3VYX A;  2H36 X;  2LUQ A;  1N33 E;  2L8T A;  1DI2 A;  2NUG A;  4Q28 A;  3RV1 A;  4KZS A;  5CFF E;  2JOX A;  3ADG A;  2L3C A;  2KON A;  3LLH A;  2FGG A;  4YHH E;  3J80 C;  4LFA E;  2L33 A;  2B9D A;  4X8W A;  2V89 A;  3FIG A;  3ADL A;  1WHN A;  2G7H A;  2MDR A;  2DB2 A;  4DV2 E;  4LFC E;  4LF7 E;  1HR0 E;  2YT4 A;  2DSY A;  2DIX A;  4M30 A;  1GZ6 A;  2M1S A;  2V83 A;  4DUZ E;  1IBK E;  1DQ3 A;  2CPN A;  4GEQ B;  4DUY E;  2VQF E;  4B3S E;  4LU9 A;  4JI2 E;  2LJH A;  4WSP A;  2M7Q A;  1XNR E;  4WYQ B;  3JAM C;  3IWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...