3N3WA

2.2 angstrom resolution crystal structure of nuclease domain of ribonuclase iii (rnc) from campylobacter jejuni
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
144
structure length
144
Chain Sequence
b'MKNIEKLEQSLTYEFKDKNLLIHALTHKSFKKSYNNERLEFLGDAVLDLVVGEYLFHKFAKDAEGDLSKLRAALVNEKSFAKIANSLNLGDFILMSVAEENNGGKEKPSILSDALEAIIGAIHLEAGFEFAKTIALRLIEKNFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease III
publication title 2.2 Angstrom Resolution Crystal Structure of Nuclease Domain of Ribonuclase III (rnc) from Campylobacter jejuni
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Hydrolase
total genus 55
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2010-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF14622 Ribonucleas_3_3 Ribonuclease-III-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 3n3wA00
3RV1A 3C4TA 3RV0A 1YYKA 2A11A 2QVWA 2NUEA 2FFLA 4OOGC 4M2ZA 1U61A 2NUGA 1YYOA 1YZ9A 2EB1A 4OUNA 3C4BA 2GSLA 1RC7A 1JFZA 1YYWA 1O0WA 3O2RA 4M30A 3N3WA 3O2RB 2NUFA 1I4SA 1RC5A 2EZ6A
chains in the Genus database with same CATH superfamily
3RV1A 3C4TA 1ZTDA 3RV0A 1YYKA 2A11A 2QVWA 2NUEA 2FFLA 4OOGC 4M2ZA 1U61A 2NUGA 1YYOA 1YZ9A 2EB1A 4OUNA 3C4BA 2GSLA 1RC7A 1JFZA 1YYWA 1O0WA 3O2RA 4M30A 3N3WA 3O2RB 2NUFA 1I4SA 1RC5A 2EZ6A
chains in the Genus database with same CATH topology
3RV1A 3C4TA 3RV0A 1YYKA 2A11A 2QVWA 2NUEA 2FFLA 4OOGC 4M2ZA 1U61A 2NUGA 1YYOA 1YZ9A 2EB1A 4OUNA 3C4BA 2GSLA 1RC7A 1JFZA 1YYWA 1O0WA 3O2RA 4M30A 3N3WA 3O2RB 2NUFA 1I4SA 1RC5A 2EZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RV1 A;  3C4T A;  3RV0 A;  1YYK A;  2A11 A;  2QVW A;  2NUE A;  2FFL A;  4OOG C;  4M2Z A;  1U61 A;  2NUG A;  1YYO A;  1YZ9 A;  2EB1 A;  4OUN A;  3C4B A;  2GSL A;  1RC7 A;  1JFZ A;  1YYW A;  1O0W A;  3O2R A;  4M30 A;  3N3W A;  3O2R B;  2NUF A;  1I4S A;  1RC5 A;  2EZ6 A; 
#chains in the Genus database with same CATH topology
 3RV1 A;  3C4T A;  1ZTD A;  3RV0 A;  1YYK A;  2A11 A;  2QVW A;  2NUE A;  2FFL A;  4OOG C;  4M2Z A;  1U61 A;  2NUG A;  1YYO A;  1YZ9 A;  2EB1 A;  4OUN A;  3C4B A;  2GSL A;  1RC7 A;  1JFZ A;  1YYW A;  1O0W A;  3O2R A;  4M30 A;  3N3W A;  3O2R B;  2NUF A;  1I4S A;  1RC5 A;  2EZ6 A; 
#chains in the Genus database with same CATH homology
 3RV1 A;  3C4T A;  3RV0 A;  1YYK A;  2A11 A;  2QVW A;  2NUE A;  2FFL A;  4OOG C;  4M2Z A;  1U61 A;  2NUG A;  1YYO A;  1YZ9 A;  2EB1 A;  4OUN A;  3C4B A;  2GSL A;  1RC7 A;  1JFZ A;  1YYW A;  1O0W A;  3O2R A;  4M30 A;  3N3W A;  3O2R B;  2NUF A;  1I4S A;  1RC5 A;  2EZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...