1O0WA

Crystal structure of ribonuclease iii (tm1102) from thermotoga maritima at 2.0 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
238
structure length
238
Chain Sequence
HHMNESERKIVEEFQKETGINFKNEELLFRALCHSSYANEQNQAGRKDVESNEKLEFLGDAVLELFVCEILYKKYPEAEVGDLARVKSAAASEEVLAMVSRKMNLGKFLFLGKGEEKTGGRDRDSILADAFEALLAAIYLDQGYEKIKELFEQEFEFYIEKIMKGEMLFDYKTALQEIVQSEHKVPPEYILVRTEKNDGDRIFVVEVRVNGKTIATGKGRTKKEAEKEAARIAYEKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Ribonuclease III (TM1102) from Thermotoga maritima at 2.0 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Ribonuclease III
total genus 93
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2002-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF14622 Ribonucleas_3_3 Ribonuclease-III-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 1o0wA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1o0wA02
2RS7A 4OX9E 2B7TA 3VYYA 1T4LB 2B3TB 2L33A 3OTOE 4JI5E 4GKKE 4DUZE 3ADJA 3T1HE 1FJGE 4LF6E 1WHNA 4X64E 2N3HA 2UXCE 2VQFE 2LUQA 5LMUE 4LF8E 5BR8E 1RQ0A 4DR6E 1IBME 1GQEA 4X8WA 4DR7E 2LTSA 4YHHE 4DV1E 1N33E 2LBSB 1UILA 4X65E 4K0KE 1XMOE 2N3GA 4LF7E 3VYXA 4JI0E 1ZBTA 3N3WA 3T1YE 4NXME 1T4OA 1T4NA 4AQYE 4JI1E 2GSLA 3ADGA 5IWAE 2L2MA 2UUBE 3C4TA 3ADIA 2NA2A 1HNWE 2EB1A 4JI8E 1PKPA 1N36E 1HNZE 3O2RB 2LRSA 1J26A 2L2NA 1XMQE 3J7Yp 1RC5A 2LJHA 1YYWA 1YYOA 2L2KB 4B3SE 2JY9A 2QVWA 1RC7A 2HHHE 1X47A 4KHPE 1I4SA 4DR3E 4DR5E 4WYQB 2FFLA 2VQEE 4M30A 1U61A 4JYAE 2A11A 4B3TE 4GKJE 2L3JA 4JI7E 4DV5E 4B3ME 4DV7E 1HNXE 1UHZA 2UXDE 4LF4E 4B3RE 4LFAE 3ADLA 2KHXA 2UXBE 1YYKA 1STUA 2DB2A 1IBKE 2UUCE 2ZM6E 1O0WA 4DKKA 4JI6E 2RS6A 4DV6E 1JFZA 2DIXA 1N34E 3RV1A 4DV4E 2L3CA 4DR2E 4LF9E 1X49A 2DMYA 4DR4E 2NUEA 4JI3E 1FKAE 4LFBE 2UU9E 3P1XA 3LLHA 3HTXA 1N32E 3O2RA 5CFFE 1DI2A 1WHQA 4JV5E 2NUGA 2E5LE 4DV3E 4DV2E 4LF5E 2RTXA 2CPNA 4WFTA 4OUNA 1IBLE 2MDRA 2JVAA 2UUAE 4LFCE 2LTRA 1QU6A 4DR1E 4JI2E 2EZ6A 1I94E 2RSMA 2YT4A 2LUPB 4X66E 4DUYE 4X62E 3RV0A 1EKZA 4JI4E 4NXNE 4OOGC 4DV0E 1X48A 2B7VA 4M2ZA 1XNQE 5LMNE 4YY3E 1J5EE 3C4BA 1YZ9A 2IHR1 1HR0E 1XNRE 2F4VE 2NUFA
chains in the Genus database with same CATH superfamily
1X3CA 2YTOA 1TN9A 2RS7A 2B7TA 3VYYA 2YTEA 2L33A 1T4LB 2BB8A 3OTOE 4GKKE 2EQ1A 5KL3A 1G2FC 1WHNA 1YPNA 4BC7A 4M0VA 4M9VC 2LUQA 4LF8E 2VRDA 1SR9A 1RQ0A 4DR6E 1N3GA 2LO3A 4DR7E 4MLVA 3C6KA 1N33E 2ADRA 1YSAC 1XMOE 3HQ1A 2EOXA 4R2CA 3EPHA 1ZBTA 2ENAA 2FGGA 2VE7C 4O43A 1ZBQA 1IQSA 1ZTDA 1HNWE 1N36E 1AAYA 2LRSA 3MSWA 4R03A 1J26A 1XMQE 1X5WA 2LJHA 4R2PA 2V83A 4R2EA 2L2KB 1UN6B 2EMHA 2JY9A 1X47A 2LMZA 4DR3E 3KZZA 1WRJA 2VF1A 1BBGA 4BBYA 2VQEE 1U61A 2ELYA 4DV5E 4DV7E 2N8XA 2JOBA 2EQ0A 5AASA 4F9BB 2DB2A 4WSPA 2K7IA 4R2RA 4DKKA 4JI6E 1DGCA 2EN1A 2LT7A 2RS6A 2EOZA 2HC5A 2V85A 4F2JC 2ENCA 2MC5A 2YTJA 4RH8A 4DR2E 4IJDA 1EH6A 4DR4E 3HPSA 4JI3E 1ZAAC 2YSOA 1JK2A 3THNA 1P47A 4F6NA 2EPXA 1WHQA 4JV5E 5IXMB 2NUGA 1KYQA 2E5LE 4DMIA 3HPZA 5LL6R 1KJKA 1SFEA 2MDRA 2YTDA 2K4VA 5F3WA 2UUAE 4DR1E 4JI2E 2EZ6A 4F9CB 3EPLA 4R2AA 3RV0A 1EKZA 2EPAA 2EPLX 2YTNA 2YTIA 2B7VA 4M2ZA 2DGCA 2EPCA 2EOJA 3C4BA 1YFHA 1BBOA 1XNRE 2DSYA 2F4VE 2YTPA 2Q8UA 1NEIA 1PJSA 3FIGA 2B3TB 2EPPA 4JI5E 2EMLA 3T1HE 2GPIA 4X64E 3BIDA 2WCC3 2J7JA 2N3HA 1GTKA 5LMUE 1T39A 2EM3A 3F6GA 5A2QC 2R1FA 1IBME 1Z1BA 2EN8A 2LTSA 2LBSB 2EOMA 2WZOA 2EMXA 2YTQA 2EP3A 4LF7E 3VYXA 4JI0E 2EL5A 3N3WA 3T1YE 2RQLA 2YRMA 4JI1E 3ADGA 4MLQA 2EOEA 4NHRA 4RHBB 3C4TA 4ZYGA 2I13A 2UUBE 2EB1A 4JI8E 5KL2A 2EPNA 3J81C 1A1GA 2MKDA 2E1MA 2EM4A 2PRTA 1QNTA 1YYWA 4R2DA 4B3SE 1A1HA 2BBGA 2R76A 2FTXB 2LVHA 1I4SA 2EPZA 2GHFA 2NABA 2FV4B 3HXLA 2FFLA 2YU8A 4GEQB 3MHSC 4M30A 2EM7A 4GKJE 2EOOA 2HGHA 2L3JA 3IWDA 4JI7E 4B3ME 1PJQA 2EMFA 4LF4E 4WX9A 1STUA 4WXCA 2JYAA 2V86A 2YTFA 2E72A 2YU5A 5AE1A 1A1KA 2L3CA 1JK1A 2JWOA 2EPKX 4BCAA 2MKNA 4O24A 1T38A 2NUEA 4GZNC 1ZU1A 2EOQA 3P1XA 1N32E 3O2RA 2H36X 2V88A 5CFFE 1DI2A 4BC9A 1RMDA 2EMKA 2M4IA 1UBDC 4DV3E 2RTXA 2ODRD 1IBLE 2M7QA 1A1IA 2DMIA 1X6FA 4LFCE 1QU6A 1I94E 4WSGA 4KWYA 2EPMX 1X6EA 2LV2A 4JI4E 4BHCA 4OOGC 1MEYC 1X48A 3ZOQB 2JPAA 1XNQE 3BF2A 3OMLA 5LMNE 4YY3E 1J5EE 3LMLA 3VHTB 2IHR1 5LLQA 1HR0E 4X9JA 3VK6A 2YRHA 3AV0A 2DRPA 4KZSA 1F2IG 3ADJA 2CTDA 3JAMC 1FJGE 4LF6E 2EM0A 2UXCE 2L92A 5A69A 5DNYA 3ECRA 5BR8E 4WXDA 4ZYDA 5A6AA 4LTYA 1GQEA 4X8WA 2YWQA 4YHHE 3IWBA 4X65E 2GLIA 2N3GA 3KZYA 2KOUA 2DLKA 3H09A 1T4NA 5IWAE 2L6MA 2EMWA 1WJPA 2EL6A 1IQOA 2EWLA 3RMPA 2L8TA 2EM5A 1HNZE 5ADZA 3JU0A 4NZVA 1RC7A 4I8OA 1EH8A 5IV8B 2HHHE 5KL6A 2EE8A 4DR5E 4F6MA 4WYQB 2YZTA 2V87A 2M9AA 4J8ZA 2EOSA 2KONA 4B3TE 4P78A 3M99B 4BMJA 1HNXE 4B3RE 4LFAE 3ADLA 2EJ4A 2UXBE 1YYKA 3K6QA 1PJTA 2EOFA 2UUCE 2ZM6E 4TUIA 2EMAA 3F6HA 3IWCA 3C6MA 4DV4E 2DLQA 4N4RB 5A6BA 2EN7A 2DMYA 2EORA 4IS1C 1FKAE 4LFBE 4F9AB 2UU9E 3HTXA 4BS9A 2LJUA 2EMYA 2EM6A 1TF3A 1DQ3A 4Q28A 3EQ1A 4TUGA 1A1JA 4FK5C 1AH5A 1YUJA 3BGHA 4LF5E 2CPNA 4OUNA 2EPRA 2EN6A 2V89A 5A6KA 2LTRA 3J7AG 5A6BD 4X66E 3KWRA 4HTGA 4DUYE 5FLXC 2M1SA 2MC6A 3THOB 1PDAA 4L5NC 2B9DA 1WXRA 4R2QA 1A1FA 4Q35B 1X6HA 2YPNA 3L00A 2EOHA 3EPKA 5KL5A 4OX9E 5KL4A 4DUZE 2ODRC 2YTGA 2G7HA 2VQFE 2EN4A 2RPCA 5AE2A 3UK3C 5IT9C 4BHBA 1GZ6A 5TSEA 2F8BA 2EOIA 4DV1E 1UILA 2JXPA 2EL4A 4K0KE 4HEIA 3DJWA 5KL7A 3AUZA 4NXME 1T4OA 5AC4A 4AQYE 2YSPA 2GSLA 2JOXA 2EPUA 2EM8A 2D9HA 3QG5C 2L2MA 5A6JA 1ZR9A 3ADIA 2NA2A 4ZYEA 2V8QB 2EMCA 1PKPA 3EPJA 4O5GA 2CT1A 3O2RB 2EOYA 2L2NA 2I9IA 2LCEA 3J7Yp 2CSHA 1RC5A 2ELZA 4R8OA 1YYOA 2QVWA 4KHPE 2EQ3A 2EMIA 1L4SA 5AE3A 3J80C 4O4KA 4R2SA 4JYAE 2A11A 2EMGA 1UHZA 2ENHA 2WBTA 2UXDE 2KHXA 1IBKE 1O0WA 4WPYA 1LLMC 3DF6A 4DV6E 1JFZA 3BBGA 2DIXA 2EN3A 3RV1A 5T6JA 4F54A 1N34E 2EN2A 2RSIA 4P7DA 4LF9E 1X49A 2EMBA 2JR1A 3LLHA 2EM9A 4L8NA 4ZYHA 2JP9A 2MDGA 2YRKA 1A1LA 4DV2E 1EH7A 1B69A 4WFTA 1G2DC 1YUIA 1MGTA 2WBSA 2JVAA 4LU9A 2RSMA 2YT4A 2LUPB 5AC5A 4X62E 2A25A 4NXNE 2LE2A 4DV0E 3MHHC 2WBUA 2HJJA 1TF6A 1IMUA 2EM2A 3JTZA 2EMZA 1NCSA 2EPOA 3TQMA 1BB8A 1YZ9A 2NUFA
chains in the Genus database with same CATH topology
2RS7A 4KZSA 4OX9E 2B7TA 3VYYA 3FIGA 2B3TB 2L33A 1T4LB 3OTOE 4JI5E 4GKKE 4DUZE 3ADJA 3T1HE 3JAMC 2ODRC 1FJGE 4LF6E 1WHNA 4X64E 4BC7A 4M0VA 2G7HA 2N3HA 2UXCE 2L92A 5DNYA 2VQFE 2LUQA 5LMUE 5AE2A 4LF8E 1SR9A 5IT9C 5BR8E 1RQ0A 3F6GA 5A2QC 4DR6E 1GZ6A 4LTYA 1IBME 1GQEA 4X8WA 4DR7E 2F8BA 2LTSA 4YHHE 3IWBA 4DV1E 1N33E 2LBSB 1UILA 2WZOA 4X65E 4K0KE 1XMOE 2N3GA 4LF7E 3HQ1A 4JI0E 3DJWA 3VYXA 3AUZA 2KOUA 1ZBTA 3N3WA 3T1YE 4NXME 1T4OA 3H09A 1T4NA 4AQYE 2FGGA 2VE7C 2GSLA 2JOXA 2L6MA 3ADGA 5IWAE 4JI1E 1ZBQA 2L2MA 2UUBE 3C4TA 3ADIA 2EWLA 2NA2A 2EB1A 2V8QB 3RMPA 1HNWE 4JI8E 4NXNE 1PKPA 2L8TA 1N36E 1HNZE 5ADZA 3J81C 3O2RB 2LRSA 2E1MA 3MSWA 2L2NA 4R03A 1XMQE 1J26A 3J7Yp 1RC5A 2LJHA 4R8OA 2V83A 1YYWA 1YYOA 2L2KB 4B3SE 3JU0A 2JY9A 2QVWA 1RC7A 2FTXB 1X47A 2LMZA 4I8OA 2HHHE 1I4SA 4KHPE 4DR3E 5AE3A 3J80C 4DR5E 4WYQB 2FV4B 2V87A 2YZTA 3HXLA 2FFLA 4GEQB 2VF1A 4J8ZA 4BBYA 2VQEE 4M30A 1U61A 4JYAE 2KONA 2A11A 4B3TE 4P78A 4GKJE 2L3JA 3IWDA 4JI7E 4DV5E 4BMJA 4DV7E 1HNXE 1UHZA 2JOBA 4B3ME 2UXDE 5AASA 4LF4E 4LFAE 4F9BB 4B3RE 3ADLA 2KHXA 2UXBE 1YYKA 1STUA 2DB2A 3K6QA 1IBKE 4WSPA 2UUCE 2ZM6E 1O0WA 2V86A 4WPYA 4DKKA 4JI6E 4TUIA 2RS6A 3DF6A 4DV6E 1JFZA 2V85A 2DIXA 3F6HA 3RV1A 3IWCA 5T6JA 4F54A 5AE1A 2MC5A 2L3CA 4DV4E 1N34E 2JWOA 4DR2E 4P7DA 4BCAA 4LF9E 1X49A 2DMYA 3HPSA 4DR4E 2NUEA 4JI3E 1FKAE 4LFBE 4F9AB 2JR1A 3P1XA 3LLHA 2UU9E 3HTXA 4BS9A 1N32E 4L8NA 3O2RA 2H36X 1DQ3A 2V88A 4Q28A 4TUGA 5CFFE 1DI2A 4BC9A 1WHQA 4JV5E 2M4IA 2NUGA 2E5LE 4DV3E 4DV2E 4LF5E 2RTXA 4DMIA 2ODRD 2CPNA 3HPZA 4WFTA 5LL6R 4OUNA 1IBLE 2MDRA 2M7QA 2JVAA 2F4VE 2K4VA 2V89A 2LTRA 5F3WA 1QU6A 4LU9A 2UUAE 4DR1E 4LFCE 3J7AG 4JI2E 2EZ6A 1I94E 2RSMA 2YT4A 4F9CB 2LUPB 4X66E 3KWRA 4DUYE 4X62E 3RV0A 5FLXC 1EKZA 2LE2A 4OOGC 2M1SA 2MC6A 4DV0E 4JI4E 1X48A 2B7VA 3ZOQB 4M2ZA 1XNQE 3JTZA 4L5NC 3OMLA 5LMNE 4YY3E 1J5EE 2B9DA 3C4BA 1WXRA 1YZ9A 3LMLA 2IHR1 1HR0E 1XNRE 2DSYA 3VK6A 2NUFA 3AV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RS7 A;  4OX9 E;  2B7T A;  3VYY A;  1T4L B;  2B3T B;  2L33 A;  3OTO E;  4JI5 E;  4GKK E;  4DUZ E;  3ADJ A;  3T1H E;  1FJG E;  4LF6 E;  1WHN A;  4X64 E;  2N3H A;  2UXC E;  2VQF E;  2LUQ A;  5LMU E;  4LF8 E;  5BR8 E;  1RQ0 A;  4DR6 E;  1IBM E;  1GQE A;  4X8W A;  4DR7 E;  2LTS A;  4YHH E;  4DV1 E;  1N33 E;  2LBS B;  1UIL A;  4X65 E;  4K0K E;  1XMO E;  2N3G A;  4LF7 E;  3VYX A;  4JI0 E;  1ZBT A;  3N3W A;  3T1Y E;  4NXM E;  1T4O A;  1T4N A;  4AQY E;  4JI1 E;  2GSL A;  3ADG A;  5IWA E;  2L2M A;  2UUB E;  3C4T A;  3ADI A;  2NA2 A;  1HNW E;  2EB1 A;  4JI8 E;  1PKP A;  1N36 E;  1HNZ E;  3O2R B;  2LRS A;  1J26 A;  2L2N A;  1XMQ E;  3J7Y p;  1RC5 A;  2LJH A;  1YYW A;  1YYO A;  2L2K B;  4B3S E;  2JY9 A;  2QVW A;  1RC7 A;  2HHH E;  1X47 A;  4KHP E;  1I4S A;  4DR3 E;  4DR5 E;  4WYQ B;  2FFL A;  2VQE E;  4M30 A;  1U61 A;  4JYA E;  2A11 A;  4B3T E;  4GKJ E;  2L3J A;  4JI7 E;  4DV5 E;  4B3M E;  4DV7 E;  1HNX E;  1UHZ A;  2UXD E;  4LF4 E;  4B3R E;  4LFA E;  3ADL A;  2KHX A;  2UXB E;  1YYK A;  1STU A;  2DB2 A;  1IBK E;  2UUC E;  2ZM6 E;  1O0W A;  4DKK A;  4JI6 E;  2RS6 A;  4DV6 E;  1JFZ A;  2DIX A;  1N34 E;  3RV1 A;  4DV4 E;  2L3C A;  4DR2 E;  4LF9 E;  1X49 A;  2DMY A;  4DR4 E;  2NUE A;  4JI3 E;  1FKA E;  4LFB E;  2UU9 E;  3P1X A;  3LLH A;  3HTX A;  1N32 E;  3O2R A;  5CFF E;  1DI2 A;  1WHQ A;  4JV5 E;  2NUG A;  2E5L E;  4DV3 E;  4DV2 E;  4LF5 E;  2RTX A;  2CPN A;  4WFT A;  4OUN A;  1IBL E;  2MDR A;  2JVA A;  2UUA E;  4LFC E;  2LTR A;  1QU6 A;  4DR1 E;  4JI2 E;  2EZ6 A;  1I94 E;  2RSM A;  2YT4 A;  2LUP B;  4X66 E;  4DUY E;  4X62 E;  3RV0 A;  1EKZ A;  4JI4 E;  4NXN E;  4OOG C;  4DV0 E;  1X48 A;  2B7V A;  4M2Z A;  1XNQ E;  5LMN E;  4YY3 E;  1J5E E;  3C4B A;  1YZ9 A;  2IHR 1;  1HR0 E;  1XNR E;  2F4V E;  2NUF A; 
#chains in the Genus database with same CATH topology
 1X3C A;  2YTO A;  1TN9 A;  2RS7 A;  2B7T A;  3VYY A;  2YTE A;  2L33 A;  1T4L B;  2BB8 A;  3OTO E;  4GKK E;  2EQ1 A;  5KL3 A;  1G2F C;  1WHN A;  1YPN A;  4BC7 A;  4M0V A;  4M9V C;  2LUQ A;  4LF8 E;  2VRD A;  1SR9 A;  1RQ0 A;  4DR6 E;  1N3G A;  2LO3 A;  4DR7 E;  4MLV A;  3C6K A;  1N33 E;  2ADR A;  1YSA C;  1XMO E;  3HQ1 A;  2EOX A;  4R2C A;  3EPH A;  1ZBT A;  2ENA A;  2FGG A;  2VE7 C;  4O43 A;  1ZBQ A;  1IQS A;  1ZTD A;  1HNW E;  1N36 E;  1AAY A;  2LRS A;  3MSW A;  4R03 A;  1J26 A;  1XMQ E;  1X5W A;  2LJH A;  4R2P A;  2V83 A;  4R2E A;  2L2K B;  1UN6 B;  2EMH A;  2JY9 A;  1X47 A;  2LMZ A;  4DR3 E;  3KZZ A;  1WRJ A;  2VF1 A;  1BBG A;  4BBY A;  2VQE E;  1U61 A;  2ELY A;  4DV5 E;  4DV7 E;  2N8X A;  2JOB A;  2EQ0 A;  5AAS A;  4F9B B;  2DB2 A;  4WSP A;  2K7I A;  4R2R A;  4DKK A;  4JI6 E;  1DGC A;  2EN1 A;  2LT7 A;  2RS6 A;  2EOZ A;  2HC5 A;  2V85 A;  4F2J C;  2ENC A;  2MC5 A;  2YTJ A;  4RH8 A;  4DR2 E;  4IJD A;  1EH6 A;  4DR4 E;  3HPS A;  4JI3 E;  1ZAA C;  2YSO A;  1JK2 A;  3THN A;  1P47 A;  4F6N A;  2EPX A;  1WHQ A;  4JV5 E;  5IXM B;  2NUG A;  1KYQ A;  2E5L E;  4DMI A;  3HPZ A;  5LL6 R;  1KJK A;  1SFE A;  2MDR A;  2YTD A;  2K4V A;  5F3W A;  2UUA E;  4DR1 E;  4JI2 E;  2EZ6 A;  4F9C B;  3EPL A;  4R2A A;  3RV0 A;  1EKZ A;  2EPA A;  2EPL X;  2YTN A;  2YTI A;  2B7V A;  4M2Z A;  2DGC A;  2EPC A;  2EOJ A;  3C4B A;  1YFH A;  1BBO A;  1XNR E;  2DSY A;  2F4V E;  2YTP A;  2Q8U A;  1NEI A;  1PJS A;  3FIG A;  2B3T B;  2EPP A;  4JI5 E;  2EML A;  3T1H E;  2GPI A;  4X64 E;  3BID A;  2WCC 3;  2J7J A;  2N3H A;  1GTK A;  5LMU E;  1T39 A;  2EM3 A;  3F6G A;  5A2Q C;  2R1F A;  1IBM E;  1Z1B A;  2EN8 A;  2LTS A;  2LBS B;  2EOM A;  2WZO A;  2EMX A;  2YTQ A;  2EP3 A;  4LF7 E;  3VYX A;  4JI0 E;  2EL5 A;  3N3W A;  3T1Y E;  2RQL A;  2YRM A;  4JI1 E;  3ADG A;  4MLQ A;  2EOE A;  4NHR A;  4RHB B;  3C4T A;  4ZYG A;  2I13 A;  2UUB E;  2EB1 A;  4JI8 E;  5KL2 A;  2EPN A;  3J81 C;  1A1G A;  2MKD A;  2E1M A;  2EM4 A;  2PRT A;  1QNT A;  1YYW A;  4R2D A;  4B3S E;  1A1H A;  2BBG A;  2R76 A;  2FTX B;  2LVH A;  1I4S A;  2EPZ A;  2GHF A;  2NAB A;  2FV4 B;  3HXL A;  2FFL A;  2YU8 A;  4GEQ B;  3MHS C;  4M30 A;  2EM7 A;  4GKJ E;  2EOO A;  2HGH A;  2L3J A;  3IWD A;  4JI7 E;  4B3M E;  1PJQ A;  2EMF A;  4LF4 E;  4WX9 A;  1STU A;  4WXC A;  2JYA A;  2V86 A;  2YTF A;  2E72 A;  2YU5 A;  5AE1 A;  1A1K A;  2L3C A;  1JK1 A;  2JWO A;  2EPK X;  4BCA A;  2MKN A;  4O24 A;  1T38 A;  2NUE A;  4GZN C;  1ZU1 A;  2EOQ A;  3P1X A;  1N32 E;  3O2R A;  2H36 X;  2V88 A;  5CFF E;  1DI2 A;  4BC9 A;  1RMD A;  2EMK A;  2M4I A;  1UBD C;  4DV3 E;  2RTX A;  2ODR D;  1IBL E;  2M7Q A;  1A1I A;  2DMI A;  1X6F A;  4LFC E;  1QU6 A;  1I94 E;  4WSG A;  4KWY A;  2EPM X;  1X6E A;  2LV2 A;  4JI4 E;  4BHC A;  4OOG C;  1MEY C;  1X48 A;  3ZOQ B;  2JPA A;  1XNQ E;  3BF2 A;  3OML A;  5LMN E;  4YY3 E;  1J5E E;  3LML A;  3VHT B;  2IHR 1;  5LLQ A;  1HR0 E;  4X9J A;  3VK6 A;  2YRH A;  3AV0 A;  2DRP A;  4KZS A;  1F2I G;  3ADJ A;  2CTD A;  3JAM C;  1FJG E;  4LF6 E;  2EM0 A;  2UXC E;  2L92 A;  5A69 A;  5DNY A;  3ECR A;  5BR8 E;  4WXD A;  4ZYD A;  5A6A A;  4LTY A;  1GQE A;  4X8W A;  2YWQ A;  4YHH E;  3IWB A;  4X65 E;  2GLI A;  2N3G A;  3KZY A;  2KOU A;  2DLK A;  3H09 A;  1T4N A;  5IWA E;  2L6M A;  2EMW A;  1WJP A;  2EL6 A;  1IQO A;  2EWL A;  3RMP A;  2L8T A;  2EM5 A;  1HNZ E;  5ADZ A;  3JU0 A;  4NZV A;  1RC7 A;  4I8O A;  1EH8 A;  5IV8 B;  2HHH E;  5KL6 A;  2EE8 A;  4DR5 E;  4F6M A;  4WYQ B;  2YZT A;  2V87 A;  2M9A A;  4J8Z A;  2EOS A;  2KON A;  4B3T E;  4P78 A;  3M99 B;  4BMJ A;  1HNX E;  4B3R E;  4LFA E;  3ADL A;  2EJ4 A;  2UXB E;  1YYK A;  3K6Q A;  1PJT A;  2EOF A;  2UUC E;  2ZM6 E;  4TUI A;  2EMA A;  3F6H A;  3IWC A;  3C6M A;  4DV4 E;  2DLQ A;  4N4R B;  5A6B A;  2EN7 A;  2DMY A;  2EOR A;  4IS1 C;  1FKA E;  4LFB E;  4F9A B;  2UU9 E;  3HTX A;  4BS9 A;  2LJU A;  2EMY A;  2EM6 A;  1TF3 A;  1DQ3 A;  4Q28 A;  3EQ1 A;  4TUG A;  1A1J A;  4FK5 C;  1AH5 A;  1YUJ A;  3BGH A;  4LF5 E;  2CPN A;  4OUN A;  2EPR A;  2EN6 A;  2V89 A;  5A6K A;  2LTR A;  3J7A G;  5A6B D;  4X66 E;  3KWR A;  4HTG A;  4DUY E;  5FLX C;  2M1S A;  2MC6 A;  3THO B;  1PDA A;  4L5N C;  2B9D A;  1WXR A;  4R2Q A;  1A1F A;  4Q35 B;  1X6H A;  2YPN A;  3L00 A;  2EOH A;  3EPK A;  5KL5 A;  4OX9 E;  5KL4 A;  4DUZ E;  2ODR C;  2YTG A;  2G7H A;  2VQF E;  2EN4 A;  2RPC A;  5AE2 A;  3UK3 C;  5IT9 C;  4BHB A;  1GZ6 A;  5TSE A;  2F8B A;  2EOI A;  4DV1 E;  1UIL A;  2JXP A;  2EL4 A;  4K0K E;  4HEI A;  3DJW A;  5KL7 A;  3AUZ A;  4NXM E;  1T4O A;  5AC4 A;  4AQY E;  2YSP A;  2GSL A;  2JOX A;  2EPU A;  2EM8 A;  2D9H A;  3QG5 C;  2L2M A;  5A6J A;  1ZR9 A;  3ADI A;  2NA2 A;  4ZYE A;  2V8Q B;  2EMC A;  1PKP A;  3EPJ A;  4O5G A;  2CT1 A;  3O2R B;  2EOY A;  2L2N A;  2I9I A;  2LCE A;  3J7Y p;  2CSH A;  1RC5 A;  2ELZ A;  4R8O A;  1YYO A;  2QVW A;  4KHP E;  2EQ3 A;  2EMI A;  1L4S A;  5AE3 A;  3J80 C;  4O4K A;  4R2S A;  4JYA E;  2A11 A;  2EMG A;  1UHZ A;  2ENH A;  2WBT A;  2UXD E;  2KHX A;  1IBK E;  1O0W A;  4WPY A;  1LLM C;  3DF6 A;  4DV6 E;  1JFZ A;  3BBG A;  2DIX A;  2EN3 A;  3RV1 A;  5T6J A;  4F54 A;  1N34 E;  2EN2 A;  2RSI A;  4P7D A;  4LF9 E;  1X49 A;  2EMB A;  2JR1 A;  3LLH A;  2EM9 A;  4L8N A;  4ZYH A;  2JP9 A;  2MDG A;  2YRK A;  1A1L A;  4DV2 E;  1EH7 A;  1B69 A;  4WFT A;  1G2D C;  1YUI A;  1MGT A;  2WBS A;  2JVA A;  4LU9 A;  2RSM A;  2YT4 A;  2LUP B;  5AC5 A;  4X62 E;  2A25 A;  4NXN E;  2LE2 A;  4DV0 E;  3MHH C;  2WBU A;  2HJJ A;  1TF6 A;  1IMU A;  2EM2 A;  3JTZ A;  2EMZ A;  1NCS A;  2EPO A;  3TQM A;  1BB8 A;  1YZ9 A;  2NUF A; 
#chains in the Genus database with same CATH homology
 2RS7 A;  4KZS A;  4OX9 E;  2B7T A;  3VYY A;  3FIG A;  2B3T B;  2L33 A;  1T4L B;  3OTO E;  4JI5 E;  4GKK E;  4DUZ E;  3ADJ A;  3T1H E;  3JAM C;  2ODR C;  1FJG E;  4LF6 E;  1WHN A;  4X64 E;  4BC7 A;  4M0V A;  2G7H A;  2N3H A;  2UXC E;  2L92 A;  5DNY A;  2VQF E;  2LUQ A;  5LMU E;  5AE2 A;  4LF8 E;  1SR9 A;  5IT9 C;  5BR8 E;  1RQ0 A;  3F6G A;  5A2Q C;  4DR6 E;  1GZ6 A;  4LTY A;  1IBM E;  1GQE A;  4X8W A;  4DR7 E;  2F8B A;  2LTS A;  4YHH E;  3IWB A;  4DV1 E;  1N33 E;  2LBS B;  1UIL A;  2WZO A;  4X65 E;  4K0K E;  1XMO E;  2N3G A;  4LF7 E;  3HQ1 A;  4JI0 E;  3DJW A;  3VYX A;  3AUZ A;  2KOU A;  1ZBT A;  3N3W A;  3T1Y E;  4NXM E;  1T4O A;  3H09 A;  1T4N A;  4AQY E;  2FGG A;  2VE7 C;  2GSL A;  2JOX A;  2L6M A;  3ADG A;  5IWA E;  4JI1 E;  1ZBQ A;  2L2M A;  2UUB E;  3C4T A;  3ADI A;  2EWL A;  2NA2 A;  2EB1 A;  2V8Q B;  3RMP A;  1HNW E;  4JI8 E;  4NXN E;  1PKP A;  2L8T A;  1N36 E;  1HNZ E;  5ADZ A;  3J81 C;  3O2R B;  2LRS A;  2E1M A;  3MSW A;  2L2N A;  4R03 A;  1XMQ E;  1J26 A;  3J7Y p;  1RC5 A;  2LJH A;  4R8O A;  2V83 A;  1YYW A;  1YYO A;  2L2K B;  4B3S E;  3JU0 A;  2JY9 A;  2QVW A;  1RC7 A;  2FTX B;  1X47 A;  2LMZ A;  4I8O A;  2HHH E;  1I4S A;  4KHP E;  4DR3 E;  5AE3 A;  3J80 C;  4DR5 E;  4WYQ B;  2FV4 B;  2V87 A;  2YZT A;  3HXL A;  2FFL A;  4GEQ B;  2VF1 A;  4J8Z A;  4BBY A;  2VQE E;  4M30 A;  1U61 A;  4JYA E;  2KON A;  2A11 A;  4B3T E;  4P78 A;  4GKJ E;  2L3J A;  3IWD A;  4JI7 E;  4DV5 E;  4BMJ A;  4DV7 E;  1HNX E;  1UHZ A;  2JOB A;  4B3M E;  2UXD E;  5AAS A;  4LF4 E;  4LFA E;  4F9B B;  4B3R E;  3ADL A;  2KHX A;  2UXB E;  1YYK A;  1STU A;  2DB2 A;  3K6Q A;  1IBK E;  4WSP A;  2UUC E;  2ZM6 E;  1O0W A;  2V86 A;  4WPY A;  4DKK A;  4JI6 E;  4TUI A;  2RS6 A;  3DF6 A;  4DV6 E;  1JFZ A;  2V85 A;  2DIX A;  3F6H A;  3RV1 A;  3IWC A;  5T6J A;  4F54 A;  5AE1 A;  2MC5 A;  2L3C A;  4DV4 E;  1N34 E;  2JWO A;  4DR2 E;  4P7D A;  4BCA A;  4LF9 E;  1X49 A;  2DMY A;  3HPS A;  4DR4 E;  2NUE A;  4JI3 E;  1FKA E;  4LFB E;  4F9A B;  2JR1 A;  3P1X A;  3LLH A;  2UU9 E;  3HTX A;  4BS9 A;  1N32 E;  4L8N A;  3O2R A;  2H36 X;  1DQ3 A;  2V88 A;  4Q28 A;  4TUG A;  5CFF E;  1DI2 A;  4BC9 A;  1WHQ A;  4JV5 E;  2M4I A;  2NUG A;  2E5L E;  4DV3 E;  4DV2 E;  4LF5 E;  2RTX A;  4DMI A;  2ODR D;  2CPN A;  3HPZ A;  4WFT A;  5LL6 R;  4OUN A;  1IBL E;  2MDR A;  2M7Q A;  2JVA A;  2F4V E;  2K4V A;  2V89 A;  2LTR A;  5F3W A;  1QU6 A;  4LU9 A;  2UUA E;  4DR1 E;  4LFC E;  3J7A G;  4JI2 E;  2EZ6 A;  1I94 E;  2RSM A;  2YT4 A;  4F9C B;  2LUP B;  4X66 E;  3KWR A;  4DUY E;  4X62 E;  3RV0 A;  5FLX C;  1EKZ A;  2LE2 A;  4OOG C;  2M1S A;  2MC6 A;  4DV0 E;  4JI4 E;  1X48 A;  2B7V A;  3ZOQ B;  4M2Z A;  1XNQ E;  3JTZ A;  4L5N C;  3OML A;  5LMN E;  4YY3 E;  1J5E E;  2B9D A;  3C4B A;  1WXR A;  1YZ9 A;  3LML A;  2IHR 1;  1HR0 E;  1XNR E;  2DSY A;  3VK6 A;  2NUF A;  3AV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...