1O0WA

Crystal structure of ribonuclease iii (tm1102) from thermotoga maritima at 2.0 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
238
structure length
238
Chain Sequence
HHMNESERKIVEEFQKETGINFKNEELLFRALCHSSYANEQNQAGRKDVESNEKLEFLGDAVLELFVCEILYKKYPEAEVGDLARVKSAAASEEVLAMVSRKMNLGKFLFLGKGEEKTGGRDRDSILADAFEALLAAIYLDQGYEKIKELFEQEFEFYIEKIMKGEMLFDYKTALQEIVQSEHKVPPEYILVRTEKNDGDRIFVVEVRVNGKTIATGKGRTKKEAEKEAARIAYEKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Ribonuclease III (TM1102) from Thermotoga maritima at 2.0 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Ribonuclease III
total genus 93
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2002-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF14622 Ribonucleas_3_3 Ribonuclease-III-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 1o0wA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1o0wA02
2N3HA 1IBME 1O0WA 1WHNA 2L2MA 2LTSA 2ZM6E 1J5EE 2DMYA 1T4NA 4DV0E 4JI4E 3N3WA 3OTOE 2L3CA 2IHR1 4LF6E 4GKKE 3T1HE 1YYWA 1QU6A 4YY3E 2JVAA 2VQEE 2B3TB 1FJGE 3VYXA 2LRSA 2LBSB 5CFFE 3T1YE 2DB2A 2L2NA 1YZ9A 1X49A 4DKKA 1I4SA 1T4OA 2UU9E 4NXME 1X47A 4DV4E 4LFAE 1UILA 4LF8E 1IBLE 4X64E 4JI2E 2LUPB 4DR7E 4JI1E 1UHZA 4JI7E 2GSLA 1WHQA 4DV5E 2HHHE 2EB1A 1RQ0A 2UUBE 4DV2E 3RV1A 5IWAE 4DR5E 1N32E 4B3RE 2VQFE 4JI6E 4DUYE 4X8WA 1PKPA 2N3GA 3P1XA 2UUAE 4JI0E 1HNWE 3J7Yp 4JYAE 2A11A 1RC7A 5LMUE 4DV1E 1FKAE 4B3ME 4WYQB 3HTXA 2CPNA 1RC5A 4WFTA 1N34E 1X48A 2DIXA 3VYYA 2NA2A 2L33A 3ADGA 2FFLA 2NUGA 3O2RA 4JI3E 2JY9A 4DV7E 4KHPE 2KHXA 4OUNA 2F4VE 4AQYE 4X66E 4DUZE 4DR2E 4M30A 2RS6A 3LLHA 1T4LB 1HR0E 4B3TE 4LFCE 5LMNE 1IBKE 5BR8E 2YT4A 3ADJA 4LF4E 3RV0A 3ADIA 4DV6E 4GKJE 2UUCE 1XMQE 1XNQE 4X65E 4DR3E 1HNZE 1U61A 2RSMA 1EKZA 2MDRA 4LF9E 1ZBTA 4OX9E 1XNRE 4DR1E 2EZ6A 1N36E 1HNXE 4K0KE 3O2RB 4JI8E 3C4BA 4LF7E 4M2ZA 2B7TA 3ADLA 4YHHE 2UXDE 4B3SE 1I94E 2B7VA 1GQEA 2L2KB 4LF5E 2RTXA 2E5LE 4DR4E 4LFBE 1J26A 2LUQA 4JV5E 2UXCE 1XMOE 1DI2A 3C4TA 4JI5E 4DV3E 1YYKA 4DR6E 1JFZA 2LTRA 1N33E 2L3JA 4NXNE 2NUEA 1STUA 2UXBE 2NUFA 4OOGC 1YYOA 2RS7A 2LJHA 4X62E 2QVWA
chains in the Genus database with same CATH superfamily
1IBME 1WHNA 2L2MA 2YTGA 1J5EE 2EPUA 5A6BA 2DGCA 2MKNA 4DV0E 4BC7A 4JI4E 4O4KA 4TUGA 2EN4A 2YTPA 2JVAA 1X6HA 2LRSA 2YPNA 4LU9A 5KL2A 1TF3A 4NXME 1X47A 1X5WA 2L8TA 1UILA 3F6GA 2FTXB 4R8OA 2LUPB 2EPZA 4O5GA 4F9CB 2HHHE 1N32E 4JI6E 1PDAA 2LMZA 2N8XA 4Q28A 2EMKA 2JPAA 4JI0E 2JYAA 1HNWE 2A11A 5LMUE 4DV1E 3QG5C 1SR9A 4B3ME 3HTXA 2CPNA 2EQ0A 2DIXA 1P47A 2EPMX 5KL5A 2WBTA 3KWRA 2VRDA 2EOHA 2JOXA 4DV7E 3ECRA 3OMLA 3H09A 2EN1A 4AQYE 4X66E 1JK1A 3MSWA 2YRMA 2GPIA 2EPLX 1T4LB 2EMHA 1F2IG 4WSGA 2NABA 2V88A 2ELZA 1IBKE 2JXPA 4LF4E 5KL6A 2EPAA 4X65E 1XNQE 5A6JA 2R76A 4ZYEA 1SFEA 2WBUA 1EKZA 1YSAC 3FIGA 1AH5A 5A6BD 2WCC3 3BBGA 1YPNA 4F6NA 3ADLA 2UXDE 4J8ZA 1I94E 2PRTA 2LCEA 4IJDA 3DJWA 2KONA 2LUQA 4BC9A 1BBOA 2UXCE 1XMOE 2YTDA 2YTQA 2M7QA 2LT7A 2YWQA 4JI5E 1ZU1A 4DMIA 1YYKA 3C6KA 1JFZA 2K4VA 2LTRA 1PJSA 2RS7A 4X62E 2EOZA 1O0WA 2WBSA 2LTSA 4BHBA 2ZM6E 2V8QB 4F2JC 2CTDA 2YSOA 1GTKA 2DMYA 2EPXA 2EPCA 3N3WA 3OTOE 2L3CA 2IHR1 1JK2A 2EM7A 3T1HE 1YYWA 1QU6A 1A1LA 2B3TB 2EMIA 3IWCA 2EMBA 3T1YE 1G2DC 1X49A 4DKKA 1MGTA 1T4OA 2UU9E 4LFAE 2EMCA 4L5NC 4JI2E 2EMFA 4DR7E 2CSHA 4JI1E 2GSLA 4KZSA 4DV5E 1RQ0A 2ADRA 4DV2E 4N4RB 3RV1A 4RHBB 2VQFE 4X8WA 1ZTDA 5A6KA 3THOB 1DGCA 2EMXA 4JYAE 2EM3A 5AC5A 3MHHC 1RC7A 2FGGA 2G7HA 3EPJA 4WX9A 4O24A 5A2QC 1A1KA 3KZZA 4WXCA 4F54A 1X48A 4MLVA 1QNTA 5KL3A 1A1IA 2L33A 4JI3E 2JY9A 2M9AA 1YFHA 1HR0E 4B3TE 4BMJA 1NCSA 5KL4A 3ADJA 2JR1A 4KWYA 1KJKA 2V87A 3RV0A 1EH6A 4X9JA 3IWDA 4DR3E 2ODRD 4R2AA 2ODRC 2V86A 2EM9A 4BHCA 1HNXE 4MLQA 3O2RB 2V83A 4LF7E 4R2CA 5AE1A 3KZYA 2E1MA 2EMZA 2YTJA 2B7TA 2EOEA 4ZYHA 2RTXA 3C6MA 4ZYGA 2EOXA 2LE2A 4LFBE 4LTYA 5AC4A 5IV8B 2CT1A 3UK3C 4I8OA 2VE7C 2Q8UA 4ZYDA 1WRJA 1B69A 1EH7A 4DV3E 2ENHA 4R2RA 2EPKX 1T38A 2NUEA 4R03A 1STUA 2J7JA 1PJQA 1IQSA 2EOIA 1YYOA 2EOQA 2GHFA 1YUJA 2QVWA 2JWOA 2EPNA 2N3HA 3EPLA 2YTNA 4BS9A 2V85A 4Q35B 1T4NA 1UN6B 3EQ1A 4WXDA 4LF6E 3EPHA 1Z1BA 4GKKE 3K6QA 4BBYA 4FK5C 3VYXA 2EP3A 5A6AA 3VK6A 2L2NA 2I9IA 2HJJA 4DV4E 4GZNC 2MC5A 2R1FA 1UHZA 1WHQA 1X6FA 2EB1A 5KL7A 2UUBE 4DR5E 5IWAE 4NZVA 2EN2A 5TSEA 4HEIA 3BGHA 4B3RE 3LMLA 5FLXC 2N3GA 1DQ3A 2UUAE 2DMIA 4R2QA 1T39A 3J7Yp 4F9AB 4P78A 2MDGA 1FKAE 1WJPA 2ENAA 2EOSA 3HQ1A 3THNA 5IT9C 2EOYA 3JTZA 3VYYA 5F3WA 2ENCA 2NA2A 2NUGA 4R2PA 3O2RA 2EN6A 2EQ1A 5DNYA 2A25A 4OUNA 2KHXA 3TQMA 4M9VC 2F4VE 4DUZE 2EWLA 2VF1A 3LLHA 3J81C 4TUIA 1L4SA 2EM2A 4LFCE 5LMNE 2YT4A 2RSIA 3ADIA 2EM8A 4DV6E 4GKJE 2UUCE 1XMQE 1HNZE 1U61A 2MDRA 1ZBTA 2LJUA 1XNRE 4DR1E 2EZ6A 5ADZA 4K0KE 1LLMC 2F8BA 2BB8A 2EOMA 4L8NA 4JI8E 3L00A 2YU5A 2L92A 5LL6R 4YHHE 4B3SE 2B7VA 2L2KB 3J80C 2I13A 4LF5E 1AAYA 4O43A 2YU8A 2E5LE 4DR4E 1IMUA 2LV2A 1J26A 4JV5E 2H36X 5A69A 2EN3A 1A1FA 2EOJA 3C4TA 3EPKA 3M99B 4DR6E 2EMAA 4NXNE 3HPSA 2EL6A 2FV4B 2MKDA 4OOGC 2RPCA 3AUZA 2LJHA 2EPOA 2EOOA 3DF6A 2EOFA 1X3CA 4R2EA 2MC6A 2EORA 2YRKA 4YY3E 2EN8A 2VQEE 1FJGE 2LBSB 5CFFE 4HTGA 1ZBQA 2DB2A 1NEIA 4WPYA 1YZ9A 2EPRA 2HGHA 1EH8A 1I4SA 2M4IA 4LF8E 1IBLE 4X64E 2YTFA 2EL5A 3HXLA 4F9BB 4R2SA 4R2DA 2EMLA 4M0VA 1A1JA 5T6JA 2KOUA 2DSYA 4JI7E 4BCAA 2YTOA 1UBDC 4DUYE 1PKPA 3P1XA 2E72A 3MHSC 2YSPA 4GEQB 1A1GA 3HPZA 4WYQB 2EMGA 1RC5A 1ZR9A 4WFTA 3VHTB 1KYQA 1N34E 2EE8A 2EMWA 2B9DA 2EM6A 2WZOA 2YRHA 3ADGA 2FFLA 3JU0A 2V89A 2EJ4A 2YTEA 4KHPE 4DR2E 4M30A 5AASA 2RS6A 4NHRA 2JP9A 2EM5A 3IWBA 4WSPA 3ZOQB 2HC5A 5LLQA 1G2FC 2LO3A 1PJTA 2L6MA 5BR8E 5AE3A 2K7IA 1TF6A 4RH8A 1ZAAC 2YTIA 2DLQA 2RSMA 2EN7A 4LF9E 3RMPA 4OX9E 1N36E 2D9HA 3J7AG 1RMDA 3C4BA 4M2ZA 3BIDA 1MEYC 2YZTA 2M1SA 1BBGA 1IQOA 5AE2A 1GQEA 2DLKA 4IS1C 5IXMB 2RQLA 2EL4A 2JOBA 3BF2A 2LVHA 1BB8A 2EPPA 4P7DA 1WXRA 2GLIA 1X6EA 2EMYA 1DI2A 3JAMC 1N3GA 2EM0A 1A1HA 1YUIA 2DRPA 1N33E 2L3JA 1TN9A 3F6HA 2EM4A 2ELYA 2BBGA 2UXBE 2NUFA 1GZ6A 4F6MA 2EQ3A 3AV0A
chains in the Genus database with same CATH topology
2N3HA 1IBME 1O0WA 1WHNA 2L2MA 2LTSA 2ZM6E 2V8QB 4BS9A 1J5EE 2V85A 2DMYA 2MC6A 1T4NA 4BC7A 4DV0E 3N3WA 4JI4E 3OTOE 4TUGA 2L3CA 2IHR1 4LF6E 4GKKE 3K6QA 1YYWA 4BBYA 1QU6A 4YY3E 3T1HE 2JVAA 2VQEE 2B3TB 1FJGE 3VYXA 2LRSA 2LBSB 3IWCA 5CFFE 4LU9A 3VK6A 1ZBQA 3T1YE 2DB2A 4WPYA 2L2NA 1YZ9A 1X49A 4DKKA 1I4SA 1T4OA 2UU9E 4NXME 1X47A 2L8TA 2M4IA 4DV4E 1UILA 4LFAE 4LF8E 2MC5A 4X64E 3HXLA 4F9BB 3F6GA 1IBLE 3DF6A 4L5NC 4JI2E 2FTXB 4R8OA 2LUPB 4M0VA 4DR7E 5T6JA 2KOUA 4JI1E 1UHZA 2DSYA 2GSLA 1WHQA 4KZSA 4JI7E 4BCAA 2EB1A 1RQ0A 4F9CB 4DV2E 4DV5E 2HHHE 3RV1A 5IWAE 4DR5E 2UUBE 1N32E 4B3RE 2VQFE 4JI6E 4DUYE 3LMLA 2LMZA 4X8WA 1PKPA 5FLXC 2N3GA 3P1XA 1DQ3A 4Q28A 2UUAE 4JI0E 1HNWE 3J7Yp 4F9AB 4JYAE 2A11A 1RC7A 2FGGA 4P78A 4GEQB 5LMUE 3HPZA 4DV1E 2G7HA 1FKAE 1SR9A 4B3ME 3HQ1A 5A2QC 4WYQB 3HTXA 2CPNA 1RC5A 4WFTA 5IT9C 4F54A 1N34E 1X48A 2DIXA 3JTZA 3VYYA 5F3WA 2B9DA 2NA2A 2L33A 2WZOA 3ADGA 2FFLA 3JU0A 2NUGA 3KWRA 2V89A 3O2RA 4JI3E 2JOXA 2JY9A 5DNYA 3OMLA 4DV7E 3H09A 2KHXA 4OUNA 2F4VE 4KHPE 4AQYE 4X66E 4DUZE 4DR2E 3MSWA 4M30A 2EWLA 2RS6A 2VF1A 3LLHA 5AASA 3J81C 1T4LB 4TUIA 3IWBA 4WSPA 1HR0E 3ZOQB 2V88A 4B3TE 4BMJA 4LFCE 5LMNE 1IBKE 2L6MA 5BR8E 2YT4A 3ADJA 5AE3A 2JR1A 2V87A 3RV0A 4LF4E 3ADIA 4DV6E 4GKJE 2UUCE 3IWDA 1XMQE 4X65E 4DR3E 1HNZE 1U61A 2ODRD 1XNQE 2RSMA 2ODRC 1EKZA 2MDRA 2V86A 4LF9E 1ZBTA 3RMPA 4OX9E 1XNRE 3FIGA 2EZ6A 5ADZA 4DR1E 1N36E 1HNXE 4K0KE 3O2RB 2F8BA 2V83A 4JI8E 4L8NA 3C4BA 4LF7E 4M2ZA 5AE1A 3J7AG 2E1MA 2YZTA 2B7TA 2L92A 2M1SA 3ADLA 5LL6R 4YHHE 2UXDE 4J8ZA 5AE2A 2B7VA 1I94E 4B3SE 1GQEA 2L2KB 3J80C 4LF5E 2RTXA 2E5LE 4DR4E 2LE2A 4LFBE 3DJWA 2JOBA 1J26A 2KONA 2LUQA 4LTYA 4BC9A 4JV5E 2H36X 2UXCE 4P7DA 1WXRA 1XMOE 4I8OA 2M7QA 2VE7C 1DI2A 3C4TA 4JI5E 4DV3E 4DMIA 3JAMC 1YYKA 4DR6E 1JFZA 2K4VA 2LTRA 1N33E 2L3JA 3F6HA 4NXNE 2NUEA 1STUA 3HPSA 2FV4B 4R03A 2UXBE 2NUFA 1GZ6A 4OOGC 1YYOA 2RS7A 2LJHA 3AUZA 3AV0A 4X62E 2QVWA 2JWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N3H A;  1IBM E;  1O0W A;  1WHN A;  2L2M A;  2LTS A;  2ZM6 E;  1J5E E;  2DMY A;  1T4N A;  4DV0 E;  4JI4 E;  3N3W A;  3OTO E;  2L3C A;  2IHR 1;  4LF6 E;  4GKK E;  3T1H E;  1YYW A;  1QU6 A;  4YY3 E;  2JVA A;  2VQE E;  2B3T B;  1FJG E;  3VYX A;  2LRS A;  2LBS B;  5CFF E;  3T1Y E;  2DB2 A;  2L2N A;  1YZ9 A;  1X49 A;  4DKK A;  1I4S A;  1T4O A;  2UU9 E;  4NXM E;  1X47 A;  4DV4 E;  4LFA E;  1UIL A;  4LF8 E;  1IBL E;  4X64 E;  4JI2 E;  2LUP B;  4DR7 E;  4JI1 E;  1UHZ A;  4JI7 E;  2GSL A;  1WHQ A;  4DV5 E;  2HHH E;  2EB1 A;  1RQ0 A;  2UUB E;  4DV2 E;  3RV1 A;  5IWA E;  4DR5 E;  1N32 E;  4B3R E;  2VQF E;  4JI6 E;  4DUY E;  4X8W A;  1PKP A;  2N3G A;  3P1X A;  2UUA E;  4JI0 E;  1HNW E;  3J7Y p;  4JYA E;  2A11 A;  1RC7 A;  5LMU E;  4DV1 E;  1FKA E;  4B3M E;  4WYQ B;  3HTX A;  2CPN A;  1RC5 A;  4WFT A;  1N34 E;  1X48 A;  2DIX A;  3VYY A;  2NA2 A;  2L33 A;  3ADG A;  2FFL A;  2NUG A;  3O2R A;  4JI3 E;  2JY9 A;  4DV7 E;  4KHP E;  2KHX A;  4OUN A;  2F4V E;  4AQY E;  4X66 E;  4DUZ E;  4DR2 E;  4M30 A;  2RS6 A;  3LLH A;  1T4L B;  1HR0 E;  4B3T E;  4LFC E;  5LMN E;  1IBK E;  5BR8 E;  2YT4 A;  3ADJ A;  4LF4 E;  3RV0 A;  3ADI A;  4DV6 E;  4GKJ E;  2UUC E;  1XMQ E;  1XNQ E;  4X65 E;  4DR3 E;  1HNZ E;  1U61 A;  2RSM A;  1EKZ A;  2MDR A;  4LF9 E;  1ZBT A;  4OX9 E;  1XNR E;  4DR1 E;  2EZ6 A;  1N36 E;  1HNX E;  4K0K E;  3O2R B;  4JI8 E;  3C4B A;  4LF7 E;  4M2Z A;  2B7T A;  3ADL A;  4YHH E;  2UXD E;  4B3S E;  1I94 E;  2B7V A;  1GQE A;  2L2K B;  4LF5 E;  2RTX A;  2E5L E;  4DR4 E;  4LFB E;  1J26 A;  2LUQ A;  4JV5 E;  2UXC E;  1XMO E;  1DI2 A;  3C4T A;  4JI5 E;  4DV3 E;  1YYK A;  4DR6 E;  1JFZ A;  2LTR A;  1N33 E;  2L3J A;  4NXN E;  2NUE A;  1STU A;  2UXB E;  2NUF A;  4OOG C;  1YYO A;  2RS7 A;  2LJH A;  4X62 E;  2QVW A; 
#chains in the Genus database with same CATH topology
 1IBM E;  1WHN A;  2L2M A;  2YTG A;  1J5E E;  2EPU A;  5A6B A;  2DGC A;  2MKN A;  4DV0 E;  4BC7 A;  4JI4 E;  4O4K A;  4TUG A;  2EN4 A;  2YTP A;  2JVA A;  1X6H A;  2LRS A;  2YPN A;  4LU9 A;  5KL2 A;  1TF3 A;  4NXM E;  1X47 A;  1X5W A;  2L8T A;  1UIL A;  3F6G A;  2FTX B;  4R8O A;  2LUP B;  2EPZ A;  4O5G A;  4F9C B;  2HHH E;  1N32 E;  4JI6 E;  1PDA A;  2LMZ A;  2N8X A;  4Q28 A;  2EMK A;  2JPA A;  4JI0 E;  2JYA A;  1HNW E;  2A11 A;  5LMU E;  4DV1 E;  3QG5 C;  1SR9 A;  4B3M E;  3HTX A;  2CPN A;  2EQ0 A;  2DIX A;  1P47 A;  2EPM X;  5KL5 A;  2WBT A;  3KWR A;  2VRD A;  2EOH A;  2JOX A;  4DV7 E;  3ECR A;  3OML A;  3H09 A;  2EN1 A;  4AQY E;  4X66 E;  1JK1 A;  3MSW A;  2YRM A;  2GPI A;  2EPL X;  1T4L B;  2EMH A;  1F2I G;  4WSG A;  2NAB A;  2V88 A;  2ELZ A;  1IBK E;  2JXP A;  4LF4 E;  5KL6 A;  2EPA A;  4X65 E;  1XNQ E;  5A6J A;  2R76 A;  4ZYE A;  1SFE A;  2WBU A;  1EKZ A;  1YSA C;  3FIG A;  1AH5 A;  5A6B D;  2WCC 3;  3BBG A;  1YPN A;  4F6N A;  3ADL A;  2UXD E;  4J8Z A;  1I94 E;  2PRT A;  2LCE A;  4IJD A;  3DJW A;  2KON A;  2LUQ A;  4BC9 A;  1BBO A;  2UXC E;  1XMO E;  2YTD A;  2YTQ A;  2M7Q A;  2LT7 A;  2YWQ A;  4JI5 E;  1ZU1 A;  4DMI A;  1YYK A;  3C6K A;  1JFZ A;  2K4V A;  2LTR A;  1PJS A;  2RS7 A;  4X62 E;  2EOZ A;  1O0W A;  2WBS A;  2LTS A;  4BHB A;  2ZM6 E;  2V8Q B;  4F2J C;  2CTD A;  2YSO A;  1GTK A;  2DMY A;  2EPX A;  2EPC A;  3N3W A;  3OTO E;  2L3C A;  2IHR 1;  1JK2 A;  2EM7 A;  3T1H E;  1YYW A;  1QU6 A;  1A1L A;  2B3T B;  2EMI A;  3IWC A;  2EMB A;  3T1Y E;  1G2D C;  1X49 A;  4DKK A;  1MGT A;  1T4O A;  2UU9 E;  4LFA E;  2EMC A;  4L5N C;  4JI2 E;  2EMF A;  4DR7 E;  2CSH A;  4JI1 E;  2GSL A;  4KZS A;  4DV5 E;  1RQ0 A;  2ADR A;  4DV2 E;  4N4R B;  3RV1 A;  4RHB B;  2VQF E;  4X8W A;  1ZTD A;  5A6K A;  3THO B;  1DGC A;  2EMX A;  4JYA E;  2EM3 A;  5AC5 A;  3MHH C;  1RC7 A;  2FGG A;  2G7H A;  3EPJ A;  4WX9 A;  4O24 A;  5A2Q C;  1A1K A;  3KZZ A;  4WXC A;  4F54 A;  1X48 A;  4MLV A;  1QNT A;  5KL3 A;  1A1I A;  2L33 A;  4JI3 E;  2JY9 A;  2M9A A;  1YFH A;  1HR0 E;  4B3T E;  4BMJ A;  1NCS A;  5KL4 A;  3ADJ A;  2JR1 A;  4KWY A;  1KJK A;  2V87 A;  3RV0 A;  1EH6 A;  4X9J A;  3IWD A;  4DR3 E;  2ODR D;  4R2A A;  2ODR C;  2V86 A;  2EM9 A;  4BHC A;  1HNX E;  4MLQ A;  3O2R B;  2V83 A;  4LF7 E;  4R2C A;  5AE1 A;  3KZY A;  2E1M A;  2EMZ A;  2YTJ A;  2B7T A;  2EOE A;  4ZYH A;  2RTX A;  3C6M A;  4ZYG A;  2EOX A;  2LE2 A;  4LFB E;  4LTY A;  5AC4 A;  5IV8 B;  2CT1 A;  3UK3 C;  4I8O A;  2VE7 C;  2Q8U A;  4ZYD A;  1WRJ A;  1B69 A;  1EH7 A;  4DV3 E;  2ENH A;  4R2R A;  2EPK X;  1T38 A;  2NUE A;  4R03 A;  1STU A;  2J7J A;  1PJQ A;  1IQS A;  2EOI A;  1YYO A;  2EOQ A;  2GHF A;  1YUJ A;  2QVW A;  2JWO A;  2EPN A;  2N3H A;  3EPL A;  2YTN A;  4BS9 A;  2V85 A;  4Q35 B;  1T4N A;  1UN6 B;  3EQ1 A;  4WXD A;  4LF6 E;  3EPH A;  1Z1B A;  4GKK E;  3K6Q A;  4BBY A;  4FK5 C;  3VYX A;  2EP3 A;  5A6A A;  3VK6 A;  2L2N A;  2I9I A;  2HJJ A;  4DV4 E;  4GZN C;  2MC5 A;  2R1F A;  1UHZ A;  1WHQ A;  1X6F A;  2EB1 A;  5KL7 A;  2UUB E;  4DR5 E;  5IWA E;  4NZV A;  2EN2 A;  5TSE A;  4HEI A;  3BGH A;  4B3R E;  3LML A;  5FLX C;  2N3G A;  1DQ3 A;  2UUA E;  2DMI A;  4R2Q A;  1T39 A;  3J7Y p;  4F9A B;  4P78 A;  2MDG A;  1FKA E;  1WJP A;  2ENA A;  2EOS A;  3HQ1 A;  3THN A;  5IT9 C;  2EOY A;  3JTZ A;  3VYY A;  5F3W A;  2ENC A;  2NA2 A;  2NUG A;  4R2P A;  3O2R A;  2EN6 A;  2EQ1 A;  5DNY A;  2A25 A;  4OUN A;  2KHX A;  3TQM A;  4M9V C;  2F4V E;  4DUZ E;  2EWL A;  2VF1 A;  3LLH A;  3J81 C;  4TUI A;  1L4S A;  2EM2 A;  4LFC E;  5LMN E;  2YT4 A;  2RSI A;  3ADI A;  2EM8 A;  4DV6 E;  4GKJ E;  2UUC E;  1XMQ E;  1HNZ E;  1U61 A;  2MDR A;  1ZBT A;  2LJU A;  1XNR E;  4DR1 E;  2EZ6 A;  5ADZ A;  4K0K E;  1LLM C;  2F8B A;  2BB8 A;  2EOM A;  4L8N A;  4JI8 E;  3L00 A;  2YU5 A;  2L92 A;  5LL6 R;  4YHH E;  4B3S E;  2B7V A;  2L2K B;  3J80 C;  2I13 A;  4LF5 E;  1AAY A;  4O43 A;  2YU8 A;  2E5L E;  4DR4 E;  1IMU A;  2LV2 A;  1J26 A;  4JV5 E;  2H36 X;  5A69 A;  2EN3 A;  1A1F A;  2EOJ A;  3C4T A;  3EPK A;  3M99 B;  4DR6 E;  2EMA A;  4NXN E;  3HPS A;  2EL6 A;  2FV4 B;  2MKD A;  4OOG C;  2RPC A;  3AUZ A;  2LJH A;  2EPO A;  2EOO A;  3DF6 A;  2EOF A;  1X3C A;  4R2E A;  2MC6 A;  2EOR A;  2YRK A;  4YY3 E;  2EN8 A;  2VQE E;  1FJG E;  2LBS B;  5CFF E;  4HTG A;  1ZBQ A;  2DB2 A;  1NEI A;  4WPY A;  1YZ9 A;  2EPR A;  2HGH A;  1EH8 A;  1I4S A;  2M4I A;  4LF8 E;  1IBL E;  4X64 E;  2YTF A;  2EL5 A;  3HXL A;  4F9B B;  4R2S A;  4R2D A;  2EML A;  4M0V A;  1A1J A;  5T6J A;  2KOU A;  2DSY A;  4JI7 E;  4BCA A;  2YTO A;  1UBD C;  4DUY E;  1PKP A;  3P1X A;  2E72 A;  3MHS C;  2YSP A;  4GEQ B;  1A1G A;  3HPZ A;  4WYQ B;  2EMG A;  1RC5 A;  1ZR9 A;  4WFT A;  3VHT B;  1KYQ A;  1N34 E;  2EE8 A;  2EMW A;  2B9D A;  2EM6 A;  2WZO A;  2YRH A;  3ADG A;  2FFL A;  3JU0 A;  2V89 A;  2EJ4 A;  2YTE A;  4KHP E;  4DR2 E;  4M30 A;  5AAS A;  2RS6 A;  4NHR A;  2JP9 A;  2EM5 A;  3IWB A;  4WSP A;  3ZOQ B;  2HC5 A;  5LLQ A;  1G2F C;  2LO3 A;  1PJT A;  2L6M A;  5BR8 E;  5AE3 A;  2K7I A;  1TF6 A;  4RH8 A;  1ZAA C;  2YTI A;  2DLQ A;  2RSM A;  2EN7 A;  4LF9 E;  3RMP A;  4OX9 E;  1N36 E;  2D9H A;  3J7A G;  1RMD A;  3C4B A;  4M2Z A;  3BID A;  1MEY C;  2YZT A;  2M1S A;  1BBG A;  1IQO A;  5AE2 A;  1GQE A;  2DLK A;  4IS1 C;  5IXM B;  2RQL A;  2EL4 A;  2JOB A;  3BF2 A;  2LVH A;  1BB8 A;  2EPP A;  4P7D A;  1WXR A;  2GLI A;  1X6E A;  2EMY A;  1DI2 A;  3JAM C;  1N3G A;  2EM0 A;  1A1H A;  1YUI A;  2DRP A;  1N33 E;  2L3J A;  1TN9 A;  3F6H A;  2EM4 A;  2ELY A;  2BBG A;  2UXB E;  2NUF A;  1GZ6 A;  4F6M A;  2EQ3 A;  3AV0 A; 
#chains in the Genus database with same CATH homology
 2N3H A;  1IBM E;  1O0W A;  1WHN A;  2L2M A;  2LTS A;  2ZM6 E;  2V8Q B;  4BS9 A;  1J5E E;  2V85 A;  2DMY A;  2MC6 A;  1T4N A;  4BC7 A;  4DV0 E;  3N3W A;  4JI4 E;  3OTO E;  4TUG A;  2L3C A;  2IHR 1;  4LF6 E;  4GKK E;  3K6Q A;  1YYW A;  4BBY A;  1QU6 A;  4YY3 E;  3T1H E;  2JVA A;  2VQE E;  2B3T B;  1FJG E;  3VYX A;  2LRS A;  2LBS B;  3IWC A;  5CFF E;  4LU9 A;  3VK6 A;  1ZBQ A;  3T1Y E;  2DB2 A;  4WPY A;  2L2N A;  1YZ9 A;  1X49 A;  4DKK A;  1I4S A;  1T4O A;  2UU9 E;  4NXM E;  1X47 A;  2L8T A;  2M4I A;  4DV4 E;  1UIL A;  4LFA E;  4LF8 E;  2MC5 A;  4X64 E;  3HXL A;  4F9B B;  3F6G A;  1IBL E;  3DF6 A;  4L5N C;  4JI2 E;  2FTX B;  4R8O A;  2LUP B;  4M0V A;  4DR7 E;  5T6J A;  2KOU A;  4JI1 E;  1UHZ A;  2DSY A;  2GSL A;  1WHQ A;  4KZS A;  4JI7 E;  4BCA A;  2EB1 A;  1RQ0 A;  4F9C B;  4DV2 E;  4DV5 E;  2HHH E;  3RV1 A;  5IWA E;  4DR5 E;  2UUB E;  1N32 E;  4B3R E;  2VQF E;  4JI6 E;  4DUY E;  3LML A;  2LMZ A;  4X8W A;  1PKP A;  5FLX C;  2N3G A;  3P1X A;  1DQ3 A;  4Q28 A;  2UUA E;  4JI0 E;  1HNW E;  3J7Y p;  4F9A B;  4JYA E;  2A11 A;  1RC7 A;  2FGG A;  4P78 A;  4GEQ B;  5LMU E;  3HPZ A;  4DV1 E;  2G7H A;  1FKA E;  1SR9 A;  4B3M E;  3HQ1 A;  5A2Q C;  4WYQ B;  3HTX A;  2CPN A;  1RC5 A;  4WFT A;  5IT9 C;  4F54 A;  1N34 E;  1X48 A;  2DIX A;  3JTZ A;  3VYY A;  5F3W A;  2B9D A;  2NA2 A;  2L33 A;  2WZO A;  3ADG A;  2FFL A;  3JU0 A;  2NUG A;  3KWR A;  2V89 A;  3O2R A;  4JI3 E;  2JOX A;  2JY9 A;  5DNY A;  3OML A;  4DV7 E;  3H09 A;  2KHX A;  4OUN A;  2F4V E;  4KHP E;  4AQY E;  4X66 E;  4DUZ E;  4DR2 E;  3MSW A;  4M30 A;  2EWL A;  2RS6 A;  2VF1 A;  3LLH A;  5AAS A;  3J81 C;  1T4L B;  4TUI A;  3IWB A;  4WSP A;  1HR0 E;  3ZOQ B;  2V88 A;  4B3T E;  4BMJ A;  4LFC E;  5LMN E;  1IBK E;  2L6M A;  5BR8 E;  2YT4 A;  3ADJ A;  5AE3 A;  2JR1 A;  2V87 A;  3RV0 A;  4LF4 E;  3ADI A;  4DV6 E;  4GKJ E;  2UUC E;  3IWD A;  1XMQ E;  4X65 E;  4DR3 E;  1HNZ E;  1U61 A;  2ODR D;  1XNQ E;  2RSM A;  2ODR C;  1EKZ A;  2MDR A;  2V86 A;  4LF9 E;  1ZBT A;  3RMP A;  4OX9 E;  1XNR E;  3FIG A;  2EZ6 A;  5ADZ A;  4DR1 E;  1N36 E;  1HNX E;  4K0K E;  3O2R B;  2F8B A;  2V83 A;  4JI8 E;  4L8N A;  3C4B A;  4LF7 E;  4M2Z A;  5AE1 A;  3J7A G;  2E1M A;  2YZT A;  2B7T A;  2L92 A;  2M1S A;  3ADL A;  5LL6 R;  4YHH E;  2UXD E;  4J8Z A;  5AE2 A;  2B7V A;  1I94 E;  4B3S E;  1GQE A;  2L2K B;  3J80 C;  4LF5 E;  2RTX A;  2E5L E;  4DR4 E;  2LE2 A;  4LFB E;  3DJW A;  2JOB A;  1J26 A;  2KON A;  2LUQ A;  4LTY A;  4BC9 A;  4JV5 E;  2H36 X;  2UXC E;  4P7D A;  1WXR A;  1XMO E;  4I8O A;  2M7Q A;  2VE7 C;  1DI2 A;  3C4T A;  4JI5 E;  4DV3 E;  4DMI A;  3JAM C;  1YYK A;  4DR6 E;  1JFZ A;  2K4V A;  2LTR A;  1N33 E;  2L3J A;  3F6H A;  4NXN E;  2NUE A;  1STU A;  3HPS A;  2FV4 B;  4R03 A;  2UXB E;  2NUF A;  1GZ6 A;  4OOG C;  1YYO A;  2RS7 A;  2LJH A;  3AUZ A;  3AV0 A;  4X62 E;  2QVW A;  2JWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...