1O0WA

Crystal structure of ribonuclease iii (tm1102) from thermotoga maritima at 2.0 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
238
structure length
238
Chain Sequence
HHMNESERKIVEEFQKETGINFKNEELLFRALCHSSYANEQNQAGRKDVESNEKLEFLGDAVLELFVCEILYKKYPEAEVGDLARVKSAAASEEVLAMVSRKMNLGKFLFLGKGEEKTGGRDRDSILADAFEALLAAIYLDQGYEKIKELFEQEFEFYIEKIMKGEMLFDYKTALQEIVQSEHKVPPEYILVRTEKNDGDRIFVVEVRVNGKTIATGKGRTKKEAEKEAARIAYEKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease III
publication title Crystal structure of Ribonuclease III (TM1102) from Thermotoga maritima at 2.0 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 93
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2002-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF14622 Ribonucleas_3_3 Ribonuclease-III-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 1o0wA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1o0wA02
1YYKA 1QU6A 2LTSA 2IHR1 2A11A 2UUCE 1U61A 2GSLA 4JYAE 1YYWA 1IBME 2L33A 3OTOE 1HNWE 2FFLA 2EB1A 4NXNE 2JVAA 2EZ6A 1DI2A 2LJHA 2LBSB 2UU9E 4LFAE 2LTRA 4X66E 4LF5E 2DMYA 2N3HA 4WFTA 1N32E 2LRSA 3ADJA 4DV7E 1IBLE 1XNRE 2DIXA 4WYQB 4DV1E 4DR5E 1X47A 2RSMA 1O0WA 1WHNA 1HR0E 4DR4E 4DV2E 3N3WA 1UILA 4B3SE 3ADLA 4X8WA 4DR7E 2HHHE 4OOGC 1X49A 2UUBE 1FKAE 4M30A 2MDRA 1X48A 5CFFE 1N36E 3C4BA 3T1HE 1RC5A 3P1XA 3ADGA 1XMQE 2UUAE 4M2ZA 4JI1E 4DUZE 1N33E 4JI6E 1GQEA 4JI3E 3J7Yp 3C4TA 2NUFA 5LMNE 3LLHA 4DV4E 1J5EE 1IBKE 5LMUE 2ZM6E 4DKKA 1N34E 4LF8E 2L3JA 1HNXE 2UXCE 1JFZA 4DUYE 3RV1A 1J26A 1YZ9A 2NA2A 2JY9A 2VQFE 2N3GA 4DR1E 2L2KB 3O2RB 2CPNA 3VYYA 4X64E 2DB2A 2RS6A 3VYXA 4DV3E 5IWAE 4JI7E 2YT4A 1RC7A 4B3ME 1XNQE 4JI2E 2UXDE 2NUEA 1UHZA 2E5LE 2UXBE 2RTXA 4LF9E 3RV0A 4OUNA 1FJGE 4NXME 1EKZA 4GKKE 4DR3E 2VQEE 1I94E 4GKJE 4LF7E 2L2MA 4DV6E 2B7VA 4DR2E 4DV5E 4LF6E 2L2NA 3T1YE 2F4VE 4OX9E 5BR8E 2LUPB 1YYOA 4B3RE 4AQYE 4KHPE 4DR6E 4JI4E 4JV5E 1STUA 4LF4E 3ADIA 3HTXA 4K0KE 1I4SA 2RS7A 1T4OA 4DV0E 1WHQA 1T4LB 2LUQA 2KHXA 1RQ0A 4YHHE 1HNZE 2QVWA 2B3TB 2B7TA 4X65E 4JI0E 4JI5E 2L3CA 4LFBE 1PKPA 4LFCE 1T4NA 1ZBTA 4YY3E 4X62E 4B3TE 1XMOE 3O2RA 2NUGA 4JI8E
chains in the Genus database with same CATH superfamily
1QU6A 2DGCA 2R76A 1F2IG 2YTEA 3J7AG 2UUCE 5KL2A 4BMJA 3JU0A 2L33A 3IWDA 1QNTA 1ZR9A 4LU9A 2YPNA 1YSAC 1N32E 4LF5E 1A1KA 4WFTA 4BCAA 2EM6A 4DV7E 1DGCA 1X47A 1G2DC 2M7QA 2EPMX 4F9CB 2EOSA 1O0WA 1P47A 5LL6R 5F3WA 2LMZA 3HPSA 1UILA 4B3SE 3ADLA 4DR7E 2HHHE 1X49A 2J7JA 2EMCA 2EPPA 4R2QA 1PJTA 2JOXA 1X48A 5CFFE 3T1HE 4BS9A 3C6MA 2EPKX 4O24A 2VRDA 1PJQA 5KL7A 2PRTA 4JI1E 5AE3A 4WX9A 5LMNE 1IBKE 2ENCA 2EN1A 2R1FA 5IV8B 2JPAA 1A1LA 1YZ9A 2EORA 1X6EA 2RS6A 2MC6A 2M4IA 4BHBA 5IWAE 2YT4A 1RC7A 4B3ME 1AH5A 2EE8A 2EOQA 4JI2E 2B9DA 2VE7C 2D9HA 2JXPA 2EOHA 4LF9E 1ZAAC 2DSYA 2H36X 1FJGE 1EKZA 1X6HA 1TF3A 4GKKE 2EMLA 3HQ1A 4Q28A 4NHRA 2MKDA 4DV6E 4LF7E 3T1YE 2F4VE 2WBUA 3DJWA 5FLXC 2BBGA 2ENHA 4AQYE 1JK2A 4KHPE 4BC9A 4JV5E 2WBSA 5IXMB 1T39A 4LF4E 1GTKA 3ADIA 2EOMA 4HEIA 4K0KE 4HTGA 2RS7A 2LVHA 4DMIA 3ECRA 5ADZA 1NEIA 1T4LB 2LUQA 3IWCA 2V85A 2QVWA 1TF6A 2B7TA 5A6BA 4X65E 2EPZA 2EOXA 1PKPA 2LV2A 1T4NA 2DMIA 2EN7A 5AE1A 3IWBA 1B69A 4JI8E 4F9AB 2YU8A 2KOUA 1U61A 2GSLA 1PJSA 1YYWA 5IT9C 2CSHA 2EM3A 1EH7A 3EPHA 5A6KA 2LJHA 2UU9E 1UBDC 4WSGA 5A2QC 2EMZA 2RQLA 1ZU1A 2N3HA 1X5WA 2HJJA 2L6MA 2LRSA 2I9IA 4ZYGA 1IBLE 1XNRE 4WYQB 4DV1E 4DR5E 1BBGA 2LO3A 1WHNA 1HR0E 2EP3A 3HXLA 2EOOA 4OOGC 3JTZA 4R2DA 1FKAE 1MGTA 2UUBE 1DQ3A 2DRPA 4O43A 4RH8A 2EPNA 4M30A 2VF1A 2ENAA 3KZYA 1RC5A 3P1XA 2YSPA 1XMQE 3J80C 2E1MA 3THOB 4M0VA 2NUFA 2EOYA 4F9BB 4DV4E 2EMGA 2ZM6E 4DKKA 2L3JA 5AE2A 4RHBB 3RV1A 2YTDA 2YTFA 1JK1A 1J26A 1G2FC 2JY9A 3F6GA 2N3GA 1A1GA 4Q35B 2L2KB 2EM0A 5AASA 4P78A 2EN6A 2LT7A 4L8NA 4KZSA 4GZNC 3THNA 1T38A 3C6KA 4F6NA 4F54A 1XNQE 2E5LE 4N4RB 2UXBE 4NZVA 3EPKA 2YTQA 2N8XA 3RV0A 5A6JA 5DNYA 1GZ6A 2MKNA 2EL4A 4IJDA 3HPZA 2MC5A 1I94E 2YTIA 4DR2E 2EMYA 4DV5E 2L2NA 4R2RA 1YUIA 2A25A 2EMXA 5BR8E 3ZOQB 2LUPB 2YTOA 3BIDA 4DR6E 2DLQA 3HTXA 4I8OA 2ADRA 3RMPA 2JP9A 1WHQA 2WBTA 2L92A 1ZBQA 1BBOA 2EM5A 4MLQA 1HNZE 4X9JA 2B3TB 2EMFA 2EPOA 3H09A 3MHHC 4JI0E 4JI5E 2EQ0A 4X62E 2WCC3 1XMOE 3J81C 2EMKA 4BC7A 1UN6B 2EM2A 2F8BA 2IHR1 3AV0A 2V87A 4JYAE 5A6AA 1IBME 1KJKA 2KONA 4J8ZA 1BB8A 2EM4A 2EL6A 1HNWE 2M1SA 2EB1A 1X6FA 3L00A 2JVAA 2EPXA 1DI2A 2EM7A 2GPIA 4MLVA 2LBSB 4LFAE 2DMYA 2EOZA 4P7DA 2V83A 2EQ3A 2EMAA 2EM9A 5KL6A 4DR4E 2GHFA 3N3WA 1KYQA 4R2SA 4LTYA 1N36E 3C4BA 4R2AA 2K7IA 2JYAA 2JOBA 2UUAE 4DUZE 1GQEA 3J7Yp 3C4TA 2NABA 2EN3A 3MHSC 2V86A 5LMUE 4LF8E 3MSWA 3LMLA 1PDAA 2UXCE 4DUYE 3VK6A 2V89A 2NA2A 4FK5C 2RSIA 4BBYA 2VQFE 2YZTA 4DR1E 2LE2A 2EPRA 4ZYEA 1Z1BA 2EOEA 2EL5A 2CTDA 2ELZA 4BHCA 3TQMA 2DLKA 5KL4A 4R03A 2JWOA 3EQ1A 2UXDE 3UK3C 2NUEA 2RTXA 4O4KA 2ODRD 4OUNA 2EM8A 3KWRA 2EMBA 4R2PA 1NCSA 4DR3E 2EPCA 4TUGA 2YTPA 4WPYA 4LF6E 4GEQB 2K4VA 2L8TA 4F2JC 4WXDA 2FGGA 4B3RE 1EH6A 3DF6A 2G7HA 3EPLA 4O5GA 4L5NC 1I4SA 2ODRC 2HGHA 5AC4A 3BF2A 4DV0E 2EOIA 3BBGA 1X3CA 2YTNA 1WRJA 1TN9A 2KHXA 4KWYA 2EOFA 3JAMC 1N3GA 1IQOA 1ZBTA 4B3TE 2EOJA 3O2RA 1YYKA 2LTSA 2A11A 2LCEA 2YTGA 1RMDA 3OTOE 2JR1A 2EN8A 2FFLA 1MEYC 2MDGA 4NXNE 1L4SA 2EZ6A 2LTRA 4X66E 4LFBE 3ADJA 4IS1C 5KL3A 2Q8UA 1AAYA 2DIXA 4WSPA 3EPJA 2RSMA 5KL5A 2BB8A 5TSEA 4DV2E 4X8WA 1IQSA 2EPLX 2YRHA 2EN2A 2MDRA 1YUJA 2YRKA 3ADGA 4M2ZA 4WXCA 1N33E 1ZTDA 4JI6E 4JI3E 2E72A 1WJPA 2FV4B 3LLHA 1YPNA 1J5EE 1N34E 3AUZA 1HNXE 1JFZA 5T6JA 2EMIA 1WXRA 2EWLA 2YU5A 3O2RB 2CPNA 3VYYA 4X64E 2EN4A 2DB2A 3VYXA 1A1FA 2EPAA 1YFHA 4DV3E 2GLIA 4JI7E 4ZYHA 2EMWA 2CT1A 1UHZA 2YRMA 1IMUA 3VHTB 5LLQA 5A6BD 1A1HA 4NXME 2EPUA 4R2CA 3FIGA 3K6QA 2VQEE 2YSOA 2HC5A 4GKJE 2L2MA 2B7VA 2YWQA 1A1IA 4OX9E 2ELYA 1YYOA 2EQ1A 5A69A 4JI4E 1A1JA 1STUA 3BGHA 3F6HA 1T4OA 3OMLA 4R8OA 5AC5A 1LLMC 4R2EA 2EMHA 1SFEA 2LJUA 3M99B 1RQ0A 2V88A 4YHHE 2RPCA 4ZYDA 1EH8A 2WZOA 4M9VC 1SR9A 2EJ4A 4F6MA 3KZZA 2V8QB 2L3CA 4LFCE 4YY3E 2YTJA 3QG5C 2M9AA 2I13A 4TUIA 2NUGA 2FTXB
chains in the Genus database with same CATH topology
4BC7A 1YYKA 1QU6A 2F8BA 2LTSA 2IHR1 2A11A 4F9AB 2UUCE 2KOUA 3J7AG 1U61A 2GSLA 2V87A 3AV0A 1YYWA 4BMJA 5IT9C 3JU0A 1IBME 4JYAE 2L33A 2KONA 3IWDA 4J8ZA 3OTOE 2JR1A 1HNWE 2FFLA 4LU9A 2M1SA 2EB1A 4NXNE 2JVAA 2EZ6A 1DI2A 2LJHA 2LBSB 2UU9E 4LFAE 2LTRA 4X66E 5A2QC 2DMYA 2N3HA 4WFTA 4LF5E 2L6MA 2LRSA 2V83A 3ADJA 4P7DA 4BCAA 4DV7E 1IBLE 1XNRE 2DIXA 4WSPA 4WYQB 4DV1E 4DR5E 1X47A 2RSMA 2M7QA 4F9CB 1O0WA 1WHNA 5LL6R 1HR0E 1N32E 4DR4E 4DV2E 5F3WA 2LMZA 3N3WA 3HPSA 1UILA 4B3SE 3ADLA 3HXLA 4X8WA 4DR7E 2HHHE 4OOGC 1X49A 3JTZA 1FKAE 2UUBE 1DQ3A 4LTYA 4M30A 2JOXA 2MDRA 1X48A 5CFFE 2VF1A 1N36E 3C4BA 3T1HE 1RC5A 3P1XA 4BS9A 3ADGA 1XMQE 2JOBA 4M2ZA 2E1MA 3J80C 2UUAE 4JI1E 4DUZE 5AE3A 1N33E 4JI6E 1GQEA 4JI3E 4M0VA 3J7Yp 3C4TA 2NUFA 2FV4B 4F9BB 3LLHA 5LMNE 4DV4E 1J5EE 2V86A 5LMUE 2ZM6E 1IBKE 4DKKA 1N34E 4LF8E 2L3JA 5AE2A 3MSWA 3AUZA 3LMLA 1HNXE 2UXCE 1JFZA 4DUYE 3RV1A 5T6JA 3VK6A 1J26A 1WXRA 2V89A 1YZ9A 2NA2A 2EWLA 4BBYA 2JY9A 2VQFE 3F6GA 2YZTA 2N3GA 4DR1E 2LE2A 2L2KB 3O2RB 2CPNA 4JI8E 3VYYA 4X64E 5AASA 2DB2A 2RS6A 3VYXA 4P78A 2MC6A 4L8NA 2M4IA 4KZSA 4DV3E 5IWAE 4JI7E 2YT4A 1RC7A 4B3ME 4R03A 4F54A 2JWOA 1XNQE 4JI2E 2UXDE 2NUEA 2B9DA 1UHZA 2VE7C 2E5LE 2UXBE 2RTXA 4LF9E 3RV0A 2DSYA 2ODRD 4OUNA 2H36X 1FJGE 3KWRA 5DNYA 1EKZA 4NXME 4GKKE 3HQ1A 4Q28A 1GZ6A 4DR3E 3FIGA 3K6QA 2VQEE 3HPZA 2MC5A 1I94E 4GKJE 4LF7E 2L2MA 4DV6E 2B7VA 4TUGA 4DR2E 4DV5E 4WPYA 4LF6E 2L2NA 2K4VA 4GEQB 3T1YE 4OX9E 2F4VE 5BR8E 2L8TA 3DJWA 5FLXC 3ZOQB 2LUPB 1YYOA 2FGGA 4B3RE 4AQYE 4KHPE 3DF6A 4DR6E 4BC9A 4JI4E 4JV5E 2G7HA 1STUA 4LF4E 4L5NC 3ADIA 3F6HA 3HTXA 1I4SA 2ODRC 4K0KE 2RS7A 4I8OA 1T4OA 4DV0E 4DMIA 3OMLA 4R8OA 5ADZA 3RMPA 1WHQA 2L92A 1ZBQA 1T4LB 2LUQA 2KHXA 3IWCA 1RQ0A 2V88A 4YHHE 1HNZE 2V85A 2QVWA 2B3TB 2WZOA 1SR9A 2B7TA 3H09A 4X65E 4JI0E 3JAMC 4JI5E 2V8QB 2L3CA 1PKPA 4LFBE 4LFCE 1T4NA 1ZBTA 4YY3E 5AE1A 3IWBA 4X62E 4B3TE 1XMOE 3J81C 3O2RA 4TUIA 2NUGA 2FTXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYK A;  1QU6 A;  2LTS A;  2IHR 1;  2A11 A;  2UUC E;  1U61 A;  2GSL A;  4JYA E;  1YYW A;  1IBM E;  2L33 A;  3OTO E;  1HNW E;  2FFL A;  2EB1 A;  4NXN E;  2JVA A;  2EZ6 A;  1DI2 A;  2LJH A;  2LBS B;  2UU9 E;  4LFA E;  2LTR A;  4X66 E;  4LF5 E;  2DMY A;  2N3H A;  4WFT A;  1N32 E;  2LRS A;  3ADJ A;  4DV7 E;  1IBL E;  1XNR E;  2DIX A;  4WYQ B;  4DV1 E;  4DR5 E;  1X47 A;  2RSM A;  1O0W A;  1WHN A;  1HR0 E;  4DR4 E;  4DV2 E;  3N3W A;  1UIL A;  4B3S E;  3ADL A;  4X8W A;  4DR7 E;  2HHH E;  4OOG C;  1X49 A;  2UUB E;  1FKA E;  4M30 A;  2MDR A;  1X48 A;  5CFF E;  1N36 E;  3C4B A;  3T1H E;  1RC5 A;  3P1X A;  3ADG A;  1XMQ E;  2UUA E;  4M2Z A;  4JI1 E;  4DUZ E;  1N33 E;  4JI6 E;  1GQE A;  4JI3 E;  3J7Y p;  3C4T A;  2NUF A;  5LMN E;  3LLH A;  4DV4 E;  1J5E E;  1IBK E;  5LMU E;  2ZM6 E;  4DKK A;  1N34 E;  4LF8 E;  2L3J A;  1HNX E;  2UXC E;  1JFZ A;  4DUY E;  3RV1 A;  1J26 A;  1YZ9 A;  2NA2 A;  2JY9 A;  2VQF E;  2N3G A;  4DR1 E;  2L2K B;  3O2R B;  2CPN A;  3VYY A;  4X64 E;  2DB2 A;  2RS6 A;  3VYX A;  4DV3 E;  5IWA E;  4JI7 E;  2YT4 A;  1RC7 A;  4B3M E;  1XNQ E;  4JI2 E;  2UXD E;  2NUE A;  1UHZ A;  2E5L E;  2UXB E;  2RTX A;  4LF9 E;  3RV0 A;  4OUN A;  1FJG E;  4NXM E;  1EKZ A;  4GKK E;  4DR3 E;  2VQE E;  1I94 E;  4GKJ E;  4LF7 E;  2L2M A;  4DV6 E;  2B7V A;  4DR2 E;  4DV5 E;  4LF6 E;  2L2N A;  3T1Y E;  2F4V E;  4OX9 E;  5BR8 E;  2LUP B;  1YYO A;  4B3R E;  4AQY E;  4KHP E;  4DR6 E;  4JI4 E;  4JV5 E;  1STU A;  4LF4 E;  3ADI A;  3HTX A;  4K0K E;  1I4S A;  2RS7 A;  1T4O A;  4DV0 E;  1WHQ A;  1T4L B;  2LUQ A;  2KHX A;  1RQ0 A;  4YHH E;  1HNZ E;  2QVW A;  2B3T B;  2B7T A;  4X65 E;  4JI0 E;  4JI5 E;  2L3C A;  4LFB E;  1PKP A;  4LFC E;  1T4N A;  1ZBT A;  4YY3 E;  4X62 E;  4B3T E;  1XMO E;  3O2R A;  2NUG A;  4JI8 E; 
#chains in the Genus database with same CATH topology
 1QU6 A;  2DGC A;  2R76 A;  1F2I G;  2YTE A;  3J7A G;  2UUC E;  5KL2 A;  4BMJ A;  3JU0 A;  2L33 A;  3IWD A;  1QNT A;  1ZR9 A;  4LU9 A;  2YPN A;  1YSA C;  1N32 E;  4LF5 E;  1A1K A;  4WFT A;  4BCA A;  2EM6 A;  4DV7 E;  1DGC A;  1X47 A;  1G2D C;  2M7Q A;  2EPM X;  4F9C B;  2EOS A;  1O0W A;  1P47 A;  5LL6 R;  5F3W A;  2LMZ A;  3HPS A;  1UIL A;  4B3S E;  3ADL A;  4DR7 E;  2HHH E;  1X49 A;  2J7J A;  2EMC A;  2EPP A;  4R2Q A;  1PJT A;  2JOX A;  1X48 A;  5CFF E;  3T1H E;  4BS9 A;  3C6M A;  2EPK X;  4O24 A;  2VRD A;  1PJQ A;  5KL7 A;  2PRT A;  4JI1 E;  5AE3 A;  4WX9 A;  5LMN E;  1IBK E;  2ENC A;  2EN1 A;  2R1F A;  5IV8 B;  2JPA A;  1A1L A;  1YZ9 A;  2EOR A;  1X6E A;  2RS6 A;  2MC6 A;  2M4I A;  4BHB A;  5IWA E;  2YT4 A;  1RC7 A;  4B3M E;  1AH5 A;  2EE8 A;  2EOQ A;  4JI2 E;  2B9D A;  2VE7 C;  2D9H A;  2JXP A;  2EOH A;  4LF9 E;  1ZAA C;  2DSY A;  2H36 X;  1FJG E;  1EKZ A;  1X6H A;  1TF3 A;  4GKK E;  2EML A;  3HQ1 A;  4Q28 A;  4NHR A;  2MKD A;  4DV6 E;  4LF7 E;  3T1Y E;  2F4V E;  2WBU A;  3DJW A;  5FLX C;  2BBG A;  2ENH A;  4AQY E;  1JK2 A;  4KHP E;  4BC9 A;  4JV5 E;  2WBS A;  5IXM B;  1T39 A;  4LF4 E;  1GTK A;  3ADI A;  2EOM A;  4HEI A;  4K0K E;  4HTG A;  2RS7 A;  2LVH A;  4DMI A;  3ECR A;  5ADZ A;  1NEI A;  1T4L B;  2LUQ A;  3IWC A;  2V85 A;  2QVW A;  1TF6 A;  2B7T A;  5A6B A;  4X65 E;  2EPZ A;  2EOX A;  1PKP A;  2LV2 A;  1T4N A;  2DMI A;  2EN7 A;  5AE1 A;  3IWB A;  1B69 A;  4JI8 E;  4F9A B;  2YU8 A;  2KOU A;  1U61 A;  2GSL A;  1PJS A;  1YYW A;  5IT9 C;  2CSH A;  2EM3 A;  1EH7 A;  3EPH A;  5A6K A;  2LJH A;  2UU9 E;  1UBD C;  4WSG A;  5A2Q C;  2EMZ A;  2RQL A;  1ZU1 A;  2N3H A;  1X5W A;  2HJJ A;  2L6M A;  2LRS A;  2I9I A;  4ZYG A;  1IBL E;  1XNR E;  4WYQ B;  4DV1 E;  4DR5 E;  1BBG A;  2LO3 A;  1WHN A;  1HR0 E;  2EP3 A;  3HXL A;  2EOO A;  4OOG C;  3JTZ A;  4R2D A;  1FKA E;  1MGT A;  2UUB E;  1DQ3 A;  2DRP A;  4O43 A;  4RH8 A;  2EPN A;  4M30 A;  2VF1 A;  2ENA A;  3KZY A;  1RC5 A;  3P1X A;  2YSP A;  1XMQ E;  3J80 C;  2E1M A;  3THO B;  4M0V A;  2NUF A;  2EOY A;  4F9B B;  4DV4 E;  2EMG A;  2ZM6 E;  4DKK A;  2L3J A;  5AE2 A;  4RHB B;  3RV1 A;  2YTD A;  2YTF A;  1JK1 A;  1J26 A;  1G2F C;  2JY9 A;  3F6G A;  2N3G A;  1A1G A;  4Q35 B;  2L2K B;  2EM0 A;  5AAS A;  4P78 A;  2EN6 A;  2LT7 A;  4L8N A;  4KZS A;  4GZN C;  3THN A;  1T38 A;  3C6K A;  4F6N A;  4F54 A;  1XNQ E;  2E5L E;  4N4R B;  2UXB E;  4NZV A;  3EPK A;  2YTQ A;  2N8X A;  3RV0 A;  5A6J A;  5DNY A;  1GZ6 A;  2MKN A;  2EL4 A;  4IJD A;  3HPZ A;  2MC5 A;  1I94 E;  2YTI A;  4DR2 E;  2EMY A;  4DV5 E;  2L2N A;  4R2R A;  1YUI A;  2A25 A;  2EMX A;  5BR8 E;  3ZOQ B;  2LUP B;  2YTO A;  3BID A;  4DR6 E;  2DLQ A;  3HTX A;  4I8O A;  2ADR A;  3RMP A;  2JP9 A;  1WHQ A;  2WBT A;  2L92 A;  1ZBQ A;  1BBO A;  2EM5 A;  4MLQ A;  1HNZ E;  4X9J A;  2B3T B;  2EMF A;  2EPO A;  3H09 A;  3MHH C;  4JI0 E;  4JI5 E;  2EQ0 A;  4X62 E;  2WCC 3;  1XMO E;  3J81 C;  2EMK A;  4BC7 A;  1UN6 B;  2EM2 A;  2F8B A;  2IHR 1;  3AV0 A;  2V87 A;  4JYA E;  5A6A A;  1IBM E;  1KJK A;  2KON A;  4J8Z A;  1BB8 A;  2EM4 A;  2EL6 A;  1HNW E;  2M1S A;  2EB1 A;  1X6F A;  3L00 A;  2JVA A;  2EPX A;  1DI2 A;  2EM7 A;  2GPI A;  4MLV A;  2LBS B;  4LFA E;  2DMY A;  2EOZ A;  4P7D A;  2V83 A;  2EQ3 A;  2EMA A;  2EM9 A;  5KL6 A;  4DR4 E;  2GHF A;  3N3W A;  1KYQ A;  4R2S A;  4LTY A;  1N36 E;  3C4B A;  4R2A A;  2K7I A;  2JYA A;  2JOB A;  2UUA E;  4DUZ E;  1GQE A;  3J7Y p;  3C4T A;  2NAB A;  2EN3 A;  3MHS C;  2V86 A;  5LMU E;  4LF8 E;  3MSW A;  3LML A;  1PDA A;  2UXC E;  4DUY E;  3VK6 A;  2V89 A;  2NA2 A;  4FK5 C;  2RSI A;  4BBY A;  2VQF E;  2YZT A;  4DR1 E;  2LE2 A;  2EPR A;  4ZYE A;  1Z1B A;  2EOE A;  2EL5 A;  2CTD A;  2ELZ A;  4BHC A;  3TQM A;  2DLK A;  5KL4 A;  4R03 A;  2JWO A;  3EQ1 A;  2UXD E;  3UK3 C;  2NUE A;  2RTX A;  4O4K A;  2ODR D;  4OUN A;  2EM8 A;  3KWR A;  2EMB A;  4R2P A;  1NCS A;  4DR3 E;  2EPC A;  4TUG A;  2YTP A;  4WPY A;  4LF6 E;  4GEQ B;  2K4V A;  2L8T A;  4F2J C;  4WXD A;  2FGG A;  4B3R E;  1EH6 A;  3DF6 A;  2G7H A;  3EPL A;  4O5G A;  4L5N C;  1I4S A;  2ODR C;  2HGH A;  5AC4 A;  3BF2 A;  4DV0 E;  2EOI A;  3BBG A;  1X3C A;  2YTN A;  1WRJ A;  1TN9 A;  2KHX A;  4KWY A;  2EOF A;  3JAM C;  1N3G A;  1IQO A;  1ZBT A;  4B3T E;  2EOJ A;  3O2R A;  1YYK A;  2LTS A;  2A11 A;  2LCE A;  2YTG A;  1RMD A;  3OTO E;  2JR1 A;  2EN8 A;  2FFL A;  1MEY C;  2MDG A;  4NXN E;  1L4S A;  2EZ6 A;  2LTR A;  4X66 E;  4LFB E;  3ADJ A;  4IS1 C;  5KL3 A;  2Q8U A;  1AAY A;  2DIX A;  4WSP A;  3EPJ A;  2RSM A;  5KL5 A;  2BB8 A;  5TSE A;  4DV2 E;  4X8W A;  1IQS A;  2EPL X;  2YRH A;  2EN2 A;  2MDR A;  1YUJ A;  2YRK A;  3ADG A;  4M2Z A;  4WXC A;  1N33 E;  1ZTD A;  4JI6 E;  4JI3 E;  2E72 A;  1WJP A;  2FV4 B;  3LLH A;  1YPN A;  1J5E E;  1N34 E;  3AUZ A;  1HNX E;  1JFZ A;  5T6J A;  2EMI A;  1WXR A;  2EWL A;  2YU5 A;  3O2R B;  2CPN A;  3VYY A;  4X64 E;  2EN4 A;  2DB2 A;  3VYX A;  1A1F A;  2EPA A;  1YFH A;  4DV3 E;  2GLI A;  4JI7 E;  4ZYH A;  2EMW A;  2CT1 A;  1UHZ A;  2YRM A;  1IMU A;  3VHT B;  5LLQ A;  5A6B D;  1A1H A;  4NXM E;  2EPU A;  4R2C A;  3FIG A;  3K6Q A;  2VQE E;  2YSO A;  2HC5 A;  4GKJ E;  2L2M A;  2B7V A;  2YWQ A;  1A1I A;  4OX9 E;  2ELY A;  1YYO A;  2EQ1 A;  5A69 A;  4JI4 E;  1A1J A;  1STU A;  3BGH A;  3F6H A;  1T4O A;  3OML A;  4R8O A;  5AC5 A;  1LLM C;  4R2E A;  2EMH A;  1SFE A;  2LJU A;  3M99 B;  1RQ0 A;  2V88 A;  4YHH E;  2RPC A;  4ZYD A;  1EH8 A;  2WZO A;  4M9V C;  1SR9 A;  2EJ4 A;  4F6M A;  3KZZ A;  2V8Q B;  2L3C A;  4LFC E;  4YY3 E;  2YTJ A;  3QG5 C;  2M9A A;  2I13 A;  4TUI A;  2NUG A;  2FTX B; 
#chains in the Genus database with same CATH homology
 4BC7 A;  1YYK A;  1QU6 A;  2F8B A;  2LTS A;  2IHR 1;  2A11 A;  4F9A B;  2UUC E;  2KOU A;  3J7A G;  1U61 A;  2GSL A;  2V87 A;  3AV0 A;  1YYW A;  4BMJ A;  5IT9 C;  3JU0 A;  1IBM E;  4JYA E;  2L33 A;  2KON A;  3IWD A;  4J8Z A;  3OTO E;  2JR1 A;  1HNW E;  2FFL A;  4LU9 A;  2M1S A;  2EB1 A;  4NXN E;  2JVA A;  2EZ6 A;  1DI2 A;  2LJH A;  2LBS B;  2UU9 E;  4LFA E;  2LTR A;  4X66 E;  5A2Q C;  2DMY A;  2N3H A;  4WFT A;  4LF5 E;  2L6M A;  2LRS A;  2V83 A;  3ADJ A;  4P7D A;  4BCA A;  4DV7 E;  1IBL E;  1XNR E;  2DIX A;  4WSP A;  4WYQ B;  4DV1 E;  4DR5 E;  1X47 A;  2RSM A;  2M7Q A;  4F9C B;  1O0W A;  1WHN A;  5LL6 R;  1HR0 E;  1N32 E;  4DR4 E;  4DV2 E;  5F3W A;  2LMZ A;  3N3W A;  3HPS A;  1UIL A;  4B3S E;  3ADL A;  3HXL A;  4X8W A;  4DR7 E;  2HHH E;  4OOG C;  1X49 A;  3JTZ A;  1FKA E;  2UUB E;  1DQ3 A;  4LTY A;  4M30 A;  2JOX A;  2MDR A;  1X48 A;  5CFF E;  2VF1 A;  1N36 E;  3C4B A;  3T1H E;  1RC5 A;  3P1X A;  4BS9 A;  3ADG A;  1XMQ E;  2JOB A;  4M2Z A;  2E1M A;  3J80 C;  2UUA E;  4JI1 E;  4DUZ E;  5AE3 A;  1N33 E;  4JI6 E;  1GQE A;  4JI3 E;  4M0V A;  3J7Y p;  3C4T A;  2NUF A;  2FV4 B;  4F9B B;  3LLH A;  5LMN E;  4DV4 E;  1J5E E;  2V86 A;  5LMU E;  2ZM6 E;  1IBK E;  4DKK A;  1N34 E;  4LF8 E;  2L3J A;  5AE2 A;  3MSW A;  3AUZ A;  3LML A;  1HNX E;  2UXC E;  1JFZ A;  4DUY E;  3RV1 A;  5T6J A;  3VK6 A;  1J26 A;  1WXR A;  2V89 A;  1YZ9 A;  2NA2 A;  2EWL A;  4BBY A;  2JY9 A;  2VQF E;  3F6G A;  2YZT A;  2N3G A;  4DR1 E;  2LE2 A;  2L2K B;  3O2R B;  2CPN A;  4JI8 E;  3VYY A;  4X64 E;  5AAS A;  2DB2 A;  2RS6 A;  3VYX A;  4P78 A;  2MC6 A;  4L8N A;  2M4I A;  4KZS A;  4DV3 E;  5IWA E;  4JI7 E;  2YT4 A;  1RC7 A;  4B3M E;  4R03 A;  4F54 A;  2JWO A;  1XNQ E;  4JI2 E;  2UXD E;  2NUE A;  2B9D A;  1UHZ A;  2VE7 C;  2E5L E;  2UXB E;  2RTX A;  4LF9 E;  3RV0 A;  2DSY A;  2ODR D;  4OUN A;  2H36 X;  1FJG E;  3KWR A;  5DNY A;  1EKZ A;  4NXM E;  4GKK E;  3HQ1 A;  4Q28 A;  1GZ6 A;  4DR3 E;  3FIG A;  3K6Q A;  2VQE E;  3HPZ A;  2MC5 A;  1I94 E;  4GKJ E;  4LF7 E;  2L2M A;  4DV6 E;  2B7V A;  4TUG A;  4DR2 E;  4DV5 E;  4WPY A;  4LF6 E;  2L2N A;  2K4V A;  4GEQ B;  3T1Y E;  4OX9 E;  2F4V E;  5BR8 E;  2L8T A;  3DJW A;  5FLX C;  3ZOQ B;  2LUP B;  1YYO A;  2FGG A;  4B3R E;  4AQY E;  4KHP E;  3DF6 A;  4DR6 E;  4BC9 A;  4JI4 E;  4JV5 E;  2G7H A;  1STU A;  4LF4 E;  4L5N C;  3ADI A;  3F6H A;  3HTX A;  1I4S A;  2ODR C;  4K0K E;  2RS7 A;  4I8O A;  1T4O A;  4DV0 E;  4DMI A;  3OML A;  4R8O A;  5ADZ A;  3RMP A;  1WHQ A;  2L92 A;  1ZBQ A;  1T4L B;  2LUQ A;  2KHX A;  3IWC A;  1RQ0 A;  2V88 A;  4YHH E;  1HNZ E;  2V85 A;  2QVW A;  2B3T B;  2WZO A;  1SR9 A;  2B7T A;  3H09 A;  4X65 E;  4JI0 E;  3JAM C;  4JI5 E;  2V8Q B;  2L3C A;  1PKP A;  4LFB E;  4LFC E;  1T4N A;  1ZBT A;  4YY3 E;  5AE1 A;  3IWB A;  4X62 E;  4B3T E;  1XMO E;  3J81 C;  3O2R A;  4TUI A;  2NUG A;  2FTX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...