1O0WA

Crystal structure of ribonuclease iii (tm1102) from thermotoga maritima at 2.0 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
238
structure length
238
Chain Sequence
HHMNESERKIVEEFQKETGINFKNEELLFRALCHSSYANEQNQAGRKDVESNEKLEFLGDAVLELFVCEILYKKYPEAEVGDLARVKSAAASEEVLAMVSRKMNLGKFLFLGKGEEKTGGRDRDSILADAFEALLAAIYLDQGYEKIKELFEQEFEFYIEKIMKGEMLFDYKTALQEIVQSEHKVPPEYILVRTEKNDGDRIFVVEVRVNGKTIATGKGRTKKEAEKEAARIAYEKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease III
publication title Crystal structure of Ribonuclease III (TM1102) from Thermotoga maritima at 2.0 A resolution
rcsb
source organism Thermotoga maritima
total genus 93
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2002-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF14622 Ribonucleas_3_3 Ribonuclease-III-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 1o0wA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1o0wA02
4B3ME 4DR1E 4LFCE 1XMOE 1T4OA 3RV0A 2RS6A 1XNQE 1N36E 4LF4E 1HNZE 3LLHA 4X8WA 1HR0E 3VYXA 3ADIA 2VQFE 2DB2A 1XNRE 2NA2A 3VYYA 2CPNA 2JY9A 4DUZE 1T4LB 4JI1E 2A11A 2LJHA 1YZ9A 1X48A 2RS7A 1GQEA 2KHXA 1N34E 4LF7E 4DV0E 2UUAE 4JI5E 2L3CA 1YYOA 5IWAE 4X64E 3O2RA 3O2RB 4JI7E 2QVWA 1IBKE 2DIXA 4KHPE 4LFAE 1WHNA 4AQYE 1N32E 1IBLE 2VQEE 4YHHE 4JI2E 5CFFE 2NUEA 4DR4E 2E5LE 3C4TA 1X49A 1EKZA 2L2NA 2HHHE 4X62E 3T1HE 1I4SA 4B3SE 2LBSB 2N3GA 4JV5E 4LF6E 1WHQA 2L33A 1T4NA 2UXCE 2LRSA 4OX9E 3RV1A 2NUGA 2L2KB 4B3TE 3ADLA 1IBME 2UUBE 1YYKA 2DMYA 1ZBTA 1JFZA 4DV7E 1STUA 1X47A 4JI8E 4WFTA 4K0KE 4JI3E 4X65E 3T1YE 4DV2E 4JYAE 1U61A 2UU9E 4DV3E 4DR3E 1RC5A 1O0WA 4JI6E 1FJGE 2YT4A 3C4BA 4DUYE 1DI2A 2L2MA 3ADGA 1PKPA 2LTRA 4DR7E 5LMNE 1J5EE 2RSMA 2LTSA 1I94E 4X66E 2UUCE 4DKKA 1RC7A 2LUQA 5BR8E 2IHR1 4GKKE 2UXDE 1HNXE 3OTOE 4NXME 4M2ZA 2B7TA 3J7Yp 1QU6A 2NUFA 4LF5E 1XMQE 3ADJA 4LF8E 4DR6E 2GSLA 1FKAE 4WYQB 4DV4E 2N3HA 1HNWE 4LF9E 4OUNA 4B3RE 4GKJE 2EZ6A 1UHZA 2FFLA 2F4VE 4JI4E 2B7VA 3HTXA 2RTXA 2LUPB 1RQ0A 4NXNE 4DV1E 4DV5E 2B3TB 2MDRA 2UXBE 3N3WA 4YY3E 4DR5E 1UILA 1N33E 4M30A 4DR2E 4JI0E 4OOGC 2JVAA 4DV6E 3P1XA 2EB1A 1J26A 2L3JA 5LMUE 4LFBE 2ZM6E 1YYWA
chains in the Genus database with same CATH superfamily
2EQ1A 2EOXA 4B3ME 4IS1C 1XMOE 2EM4A 5AE3A 2EPAA 2ODRD 3KZYA 3ADIA 2YTQA 2V89A 2DB2A 2GHFA 2CPNA 1PJSA 2JY9A 4JI1E 1YZ9A 5KL7A 3THNA 1GZ6A 4LF7E 4RH8A 2UUAE 3C6MA 4X64E 1LLMC 4KHPE 1N32E 1YFHA 1N3GA 2L2NA 4M9VC 1X6EA 3T1HE 1I4SA 2JYAA 3AV0A 2HGHA 1MEYC 2WZOA 3EPLA 1Z1BA 1G2FC 4IJDA 2V88A 1T4NA 1WXRA 3EPKA 2MKDA 3LMLA 1YUJA 4MLQA 3KZZA 2L2KB 2EPPA 2I9IA 2EOHA 4HTGA 1IBME 4P78A 2UUBE 1ZBTA 4L8NA 1JFZA 4ZYHA 2EOMA 3ZOQB 2YTGA 2ELZA 3T1YE 4JYAE 1U61A 4O24A 1AH5A 3F6HA 3C4BA 4DUYE 2CSHA 2L2MA 4X9JA 3MHSC 2ENCA 1PKPA 2MDGA 3J81C 4DR7E 2EN3A 2YWQA 1J5EE 3JTZA 2FTXB 2IHR1 1TF6A 4GKKE 2D9HA 4R8OA 2RPCA 2EPNA 3OTOE 2LJUA 1NEIA 2EMHA 2EMGA 4MLVA 1QU6A 4DR6E 1A1JA 2EPZA 1SFEA 2EMWA 2FV4B 4WSGA 4F9AB 4LF9E 4GKJE 1BBOA 2EMKA 3HTXA 2YTNA 2EM9A 3BBGA 2LUPB 1QNTA 4Q35B 2EN2A 2H36X 4NXNE 4DV5E 2B3TB 2YZTA 2EOIA 1UILA 5KL6A 2DGCA 2NABA 4KZSA 2YSPA 5F3WA 5IXMB 3IWDA 4LFBE 2FGGA 4DR1E 4F6MA 2YRMA 1N36E 2LVHA 3J7AG 4X8WA 4LU9A 2EM5A 1HR0E 3VYXA 2F8BA 5KL4A 1T4LB 2EPOA 2RS7A 4J8ZA 4DV0E 2L3CA 4BMJA 1YYOA 2EMIA 2R76A 2WBSA 1P47A 3EPHA 2DIXA 1WHNA 3MSWA 4AQYE 2VQEE 1L4SA 4R2CA 4R2DA 4F9BB 5CFFE 3DJWA 2PRTA 2E5LE 1X49A 2B9DA 2Q8UA 2HHHE 2LE2A 2EM0A 4B3SE 2DLKA 4JV5E 3BF2A 1WHQA 2L33A 5KL3A 5ADZA 2L92A 2EM6A 4OX9E 2YTPA 4R03A 2V85A 3MHHC 2EOEA 2EPMX 1UN6B 2EORA 1A1HA 4DV7E 4R2RA 1STUA 1WRJA 1X47A 4JI8E 4K0KE 2DRPA 2L8TA 1PJQA 4JI3E 4I8OA 2JWOA 4DV2E 4GEQB 1IQSA 2EPLX 2N8XA 2EPCA 2EMZA 5AC5A 2JXPA 2YSOA 2YT4A 5A6AA 2EWLA 3ADGA 1NCSA 1A1LA 5A6JA 2YPNA 2LTRA 2VE7C 2ENHA 3VHTB 5LMNE 2BBGA 2EMFA 2EJ4A 2EM2A 4X66E 4R2PA 1RC7A 2LUQA 5AE1A 3RMPA 4M2ZA 2B7TA 3J7Yp 2YTFA 2EN8A 2LV2A 4LF8E 1MGTA 2GSLA 2VRDA 2N3HA 2WCC3 3IWBA 4B3RE 1UHZA 2B7VA 2EMLA 2RTXA 1RQ0A 2YTJA 3THOB 4R2SA 2EQ0A 4DV1E 2UXBE 2ADRA 2E1MA 2J7JA 2MKNA 4JI0E 4Q28A 4P7DA 4DV6E 2EOSA 4LTYA 2EM8A 1J26A 4WX9A 2ZM6E 1YYWA 1T4OA 3RV0A 2RS6A 3J80C 4LF4E 1HNZE 2R1FA 4L5NC 5KL2A 1IMUA 2BB8A 1KYQA 3BIDA 2VQFE 1WJPA 2EL5A 4WSPA 1XNRE 2NA2A 4DUZE 2A11A 5AASA 2MC6A 5DNYA 1GQEA 1GTKA 2KHXA 5LLQA 1N34E 2M1SA 2M4IA 3OMLA 4RHBB 1X5WA 2M7QA 3K6QA 3O2RA 3VK6A 3O2RB 1DQ3A 2QVWA 2EL6A 4JI7E 1IBLE 1PDAA 4O5GA 3QG5C 1B69A 4DR4E 2V87A 3C4TA 2YTEA 1EKZA 3FIGA 2RSIA 4WXDA 4NHRA 2LBSB 4F6NA 4LF6E 2V83A 5A6BA 1YPNA 2DLQA 5IT9C 4TUIA 2UXCE 2LRSA 3JU0A 1AAYA 2MC5A 4ZYEA 5AC4A 2K7IA 1YYKA 2DMIA 3IWCA 1DGCA 5A6KA 3M99B 5A69A 2JR1A 4WFTA 2EP3A 2VF1A 4X65E 1BBGA 4ZYDA 3HQ1A 2UU9E 4R2QA 4DV3E 4JI6E 1RC5A 1O0WA 1FJGE 2EPUA 3EPJA 2I13A 1KJKA 1I94E 1TF3A 5BR8E 4NZVA 5KL5A 3HXLA 4F2JC 4NXME 1A1FA 2G7HA 3ECRA 2EOZA 2LCEA 4LF5E 2HJJA 5A2QC 1ZU1A 1FKAE 1JK1A 2EMBA 4BHBA 2FFLA 3EQ1A 2F4VE 1IQOA 2EM7A 4JI4E 1EH7A 3BGHA 5TSEA 2MDRA 3HPZA 2EOFA 4M30A 2EMXA 3P1XA 2L3JA 2V86A 3JAMC 1F2IG 1X3CA 4DMIA 2ODRC 4LFCE 1XNQE 1ZAAC 2EPKX 2EOYA 3LLHA 5FLXC 2JOXA 4R2AA 4N4RB 2EOOA 1A1GA 3VYYA 4BC7A 3L00A 2EPRA 2LJHA 1X48A 2YU8A 3DF6A 2EMCA 4JI5E 4WPYA 1PJTA 4O43A 4KWYA 5IWAE 2RQLA 2L6MA 2EM3A 1IBKE 4LFAE 1ZR9A 2K4VA 4M0VA 2GPIA 1T38A 4YHHE 1EH8A 2WBTA 3UK3C 2EN1A 4JI2E 2NUEA 2LMZA 2DSYA 2CT1A 4X62E 1A1IA 1G2DC 5A6BD 2YTDA 2N3GA 1A1KA 2YTIA 3RV1A 2NUGA 1UBDC 2WBUA 1X6FA 4B3TE 3ADLA 3H09A 2DMYA 2CTDA 2LO3A 2JP9A 3F6GA 1RMDA 4BBYA 1YSAC 2JPAA 2KOUA 4GZNC 2EN7A 1ZBQA 2EOJA 2EMYA 2EMAA 2E72A 4DR3E 2ELYA 2YTOA 4BHCA 1DI2A 3HPSA 1JK2A 3TQMA 2EN6A 4ZYGA 4R2EA 2EE8A 4BCAA 2RSMA 2LTSA 2UUCE 2YRHA 4DKKA 2V8QB 1YUIA 1SR9A 4BS9A 2UXDE 5AE2A 1HNXE 2ENAA 4TUGA 2EPXA 2NUFA 4HEIA 1XMQE 2EL4A 3ADJA 5T6JA 4F9CB 5IV8B 4WYQB 4DV4E 1BB8A 1ZTDA 4O4KA 1HNWE 2JOBA 4OUNA 2EZ6A 2YU5A 1EH6A 4BC9A 4F54A 3AUZA 1TN9A 2EN4A 3C6KA 2YRKA 4FK5C 3N3WA 4YY3E 4DR5E 2A25A 4WXCA 2KONA 1N33E 2LT7A 2EQ3A 4DR2E 1T39A 2HC5A 4OOGC 1X6HA 2JVAA 2GLIA 2EB1A 2M9AA 2EOQA 5LL6R 5LMUE 3KWRA
chains in the Genus database with same CATH topology
4B3ME 4DR1E 4LFCE 1XMOE 1T4OA 3RV0A 2RS6A 1XNQE 1N36E 3J80C 5AE3A 4LF4E 3J7AG 1HNZE 2ODRD 3LLHA 4X8WA 4L5NC 5FLXC 4LU9A 1HR0E 3VYXA 2JOXA 3ADIA 2F8BA 2V89A 2VQFE 4WSPA 2DB2A 1XNRE 2NA2A 3VYYA 2CPNA 2JY9A 4BC7A 4DUZE 1T4LB 2A11A 2LJHA 5AASA 1YZ9A 1X48A 2RS7A 2MC6A 3DF6A 5DNYA 4J8ZA 1GQEA 1GZ6A 2KHXA 1N34E 2M1SA 2M4IA 3OMLA 4DV0E 2UUAE 2L3CA 4JI5E 4WPYA 1YYOA 4BMJA 5IWAE 2M7QA 4X64E 3K6QA 3O2RA 2L6MA 3VK6A 4LF7E 3O2RB 1DQ3A 2QVWA 4JI7E 2DIXA 1IBKE 4LFAE 4KHPE 1WHNA 2K4VA 3MSWA 4M0VA 4AQYE 1N32E 1IBLE 2VQEE 4YHHE 4F9BB 4JI2E 5CFFE 3DJWA 2NUEA 2LMZA 4DR4E 2DSYA 2V87A 3C4TA 1X49A 2B9DA 1EKZA 2L2NA 3FIGA 2LE2A 4X62E 2E5LE 3T1HE 2HHHE 1I4SA 3AV0A 4B3SE 2WZOA 2LBSB 1FJGE 2N3GA 4JV5E 4LF6E 1WHQA 2V83A 2L33A 2V88A 5ADZA 1T4NA 1WXRA 5IT9C 2L92A 3LMLA 4TUIA 2UXCE 2LRSA 4OX9E 3RV1A 2NUGA 2L2KB 4B3TE 4R03A 2V85A 3JU0A 2MC5A 1IBME 3ADLA 4P78A 2UUBE 1YYKA 3H09A 2DMYA 3IWCA 1ZBTA 4L8NA 1JFZA 4DV7E 1STUA 1X47A 3F6GA 2JR1A 4BBYA 4JI8E 4WFTA 4K0KE 3ZOQB 2KOUA 2L8TA 4JI3E 1ZBQA 4I8OA 2JWOA 2VF1A 4X65E 4DV2E 3T1YE 3HQ1A 4GEQB 4JYAE 1U61A 2UU9E 4DV3E 4DR3E 1RC5A 1O0WA 3F6HA 4JI6E 2YT4A 3C4BA 4DUYE 2EWLA 2L2MA 3ADGA 1DI2A 3HPSA 1PKPA 3J81C 2LTRA 2VE7C 4DR7E 5LMNE 4BCAA 1J5EE 2RSMA 2LTSA 3JTZA 4X66E 1I94E 2UUCE 2FTXB 4DKKA 1RC7A 2LUQA 2V8QB 5BR8E 2IHR1 5AE1A 1SR9A 4BS9A 3HXLA 3RMPA 4GKKE 2UXDE 4R8OA 5AE2A 3OTOE 1HNXE 4NXME 4M2ZA 2B7TA 3J7Yp 2G7HA 4TUGA 1QU6A 2NUFA 4LF5E 1XMQE 3ADJA 4LF8E 4JI1E 4DR6E 5A2QC 2GSLA 2FV4B 5T6JA 4F9CB 1FKAE 4WYQB 4F9AB 4DV4E 2N3HA 2ZM6E 1HNWE 2JOBA 4OUNA 1YYWA 3IWBA 2EZ6A 4LF9E 4B3RE 4GKJE 1UHZA 4BC9A 4F54A 2FFLA 3AUZA 2F4VE 4LFBE 4JI4E 2B7VA 3HTXA 2RTXA 2LUPB 1RQ0A 4NXNE 2H36X 4DV1E 4DV5E 2B3TB 2MDRA 3HPZA 2YZTA 2UXBE 3N3WA 2E1MA 4YY3E 4DR5E 1UILA 2KONA 1N33E 4M30A 4DR2E 4JI0E 4OOGC 2JVAA 4KZSA 4P7DA 3P1XA 4Q28A 4DV6E 4LTYA 2EB1A 5F3WA 1J26A 2L3JA 5LL6R 2V86A 3JAMC 5LMUE 3IWDA 4DMIA 2ODRC 2FGGA 3KWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M E;  4DR1 E;  4LFC E;  1XMO E;  1T4O A;  3RV0 A;  2RS6 A;  1XNQ E;  1N36 E;  4LF4 E;  1HNZ E;  3LLH A;  4X8W A;  1HR0 E;  3VYX A;  3ADI A;  2VQF E;  2DB2 A;  1XNR E;  2NA2 A;  3VYY A;  2CPN A;  2JY9 A;  4DUZ E;  1T4L B;  4JI1 E;  2A11 A;  2LJH A;  1YZ9 A;  1X48 A;  2RS7 A;  1GQE A;  2KHX A;  1N34 E;  4LF7 E;  4DV0 E;  2UUA E;  4JI5 E;  2L3C A;  1YYO A;  5IWA E;  4X64 E;  3O2R A;  3O2R B;  4JI7 E;  2QVW A;  1IBK E;  2DIX A;  4KHP E;  4LFA E;  1WHN A;  4AQY E;  1N32 E;  1IBL E;  2VQE E;  4YHH E;  4JI2 E;  5CFF E;  2NUE A;  4DR4 E;  2E5L E;  3C4T A;  1X49 A;  1EKZ A;  2L2N A;  2HHH E;  4X62 E;  3T1H E;  1I4S A;  4B3S E;  2LBS B;  2N3G A;  4JV5 E;  4LF6 E;  1WHQ A;  2L33 A;  1T4N A;  2UXC E;  2LRS A;  4OX9 E;  3RV1 A;  2NUG A;  2L2K B;  4B3T E;  3ADL A;  1IBM E;  2UUB E;  1YYK A;  2DMY A;  1ZBT A;  1JFZ A;  4DV7 E;  1STU A;  1X47 A;  4JI8 E;  4WFT A;  4K0K E;  4JI3 E;  4X65 E;  3T1Y E;  4DV2 E;  4JYA E;  1U61 A;  2UU9 E;  4DV3 E;  4DR3 E;  1RC5 A;  1O0W A;  4JI6 E;  1FJG E;  2YT4 A;  3C4B A;  4DUY E;  1DI2 A;  2L2M A;  3ADG A;  1PKP A;  2LTR A;  4DR7 E;  5LMN E;  1J5E E;  2RSM A;  2LTS A;  1I94 E;  4X66 E;  2UUC E;  4DKK A;  1RC7 A;  2LUQ A;  5BR8 E;  2IHR 1;  4GKK E;  2UXD E;  1HNX E;  3OTO E;  4NXM E;  4M2Z A;  2B7T A;  3J7Y p;  1QU6 A;  2NUF A;  4LF5 E;  1XMQ E;  3ADJ A;  4LF8 E;  4DR6 E;  2GSL A;  1FKA E;  4WYQ B;  4DV4 E;  2N3H A;  1HNW E;  4LF9 E;  4OUN A;  4B3R E;  4GKJ E;  2EZ6 A;  1UHZ A;  2FFL A;  2F4V E;  4JI4 E;  2B7V A;  3HTX A;  2RTX A;  2LUP B;  1RQ0 A;  4NXN E;  4DV1 E;  4DV5 E;  2B3T B;  2MDR A;  2UXB E;  3N3W A;  4YY3 E;  4DR5 E;  1UIL A;  1N33 E;  4M30 A;  4DR2 E;  4JI0 E;  4OOG C;  2JVA A;  4DV6 E;  3P1X A;  2EB1 A;  1J26 A;  2L3J A;  5LMU E;  4LFB E;  2ZM6 E;  1YYW A; 
#chains in the Genus database with same CATH topology
 2EQ1 A;  2EOX A;  4B3M E;  4IS1 C;  1XMO E;  2EM4 A;  5AE3 A;  2EPA A;  2ODR D;  3KZY A;  3ADI A;  2YTQ A;  2V89 A;  2DB2 A;  2GHF A;  2CPN A;  1PJS A;  2JY9 A;  4JI1 E;  1YZ9 A;  5KL7 A;  3THN A;  1GZ6 A;  4LF7 E;  4RH8 A;  2UUA E;  3C6M A;  4X64 E;  1LLM C;  4KHP E;  1N32 E;  1YFH A;  1N3G A;  2L2N A;  4M9V C;  1X6E A;  3T1H E;  1I4S A;  2JYA A;  3AV0 A;  2HGH A;  1MEY C;  2WZO A;  3EPL A;  1Z1B A;  1G2F C;  4IJD A;  2V88 A;  1T4N A;  1WXR A;  3EPK A;  2MKD A;  3LML A;  1YUJ A;  4MLQ A;  3KZZ A;  2L2K B;  2EPP A;  2I9I A;  2EOH A;  4HTG A;  1IBM E;  4P78 A;  2UUB E;  1ZBT A;  4L8N A;  1JFZ A;  4ZYH A;  2EOM A;  3ZOQ B;  2YTG A;  2ELZ A;  3T1Y E;  4JYA E;  1U61 A;  4O24 A;  1AH5 A;  3F6H A;  3C4B A;  4DUY E;  2CSH A;  2L2M A;  4X9J A;  3MHS C;  2ENC A;  1PKP A;  2MDG A;  3J81 C;  4DR7 E;  2EN3 A;  2YWQ A;  1J5E E;  3JTZ A;  2FTX B;  2IHR 1;  1TF6 A;  4GKK E;  2D9H A;  4R8O A;  2RPC A;  2EPN A;  3OTO E;  2LJU A;  1NEI A;  2EMH A;  2EMG A;  4MLV A;  1QU6 A;  4DR6 E;  1A1J A;  2EPZ A;  1SFE A;  2EMW A;  2FV4 B;  4WSG A;  4F9A B;  4LF9 E;  4GKJ E;  1BBO A;  2EMK A;  3HTX A;  2YTN A;  2EM9 A;  3BBG A;  2LUP B;  1QNT A;  4Q35 B;  2EN2 A;  2H36 X;  4NXN E;  4DV5 E;  2B3T B;  2YZT A;  2EOI A;  1UIL A;  5KL6 A;  2DGC A;  2NAB A;  4KZS A;  2YSP A;  5F3W A;  5IXM B;  3IWD A;  4LFB E;  2FGG A;  4DR1 E;  4F6M A;  2YRM A;  1N36 E;  2LVH A;  3J7A G;  4X8W A;  4LU9 A;  2EM5 A;  1HR0 E;  3VYX A;  2F8B A;  5KL4 A;  1T4L B;  2EPO A;  2RS7 A;  4J8Z A;  4DV0 E;  2L3C A;  4BMJ A;  1YYO A;  2EMI A;  2R76 A;  2WBS A;  1P47 A;  3EPH A;  2DIX A;  1WHN A;  3MSW A;  4AQY E;  2VQE E;  1L4S A;  4R2C A;  4R2D A;  4F9B B;  5CFF E;  3DJW A;  2PRT A;  2E5L E;  1X49 A;  2B9D A;  2Q8U A;  2HHH E;  2LE2 A;  2EM0 A;  4B3S E;  2DLK A;  4JV5 E;  3BF2 A;  1WHQ A;  2L33 A;  5KL3 A;  5ADZ A;  2L92 A;  2EM6 A;  4OX9 E;  2YTP A;  4R03 A;  2V85 A;  3MHH C;  2EOE A;  2EPM X;  1UN6 B;  2EOR A;  1A1H A;  4DV7 E;  4R2R A;  1STU A;  1WRJ A;  1X47 A;  4JI8 E;  4K0K E;  2DRP A;  2L8T A;  1PJQ A;  4JI3 E;  4I8O A;  2JWO A;  4DV2 E;  4GEQ B;  1IQS A;  2EPL X;  2N8X A;  2EPC A;  2EMZ A;  5AC5 A;  2JXP A;  2YSO A;  2YT4 A;  5A6A A;  2EWL A;  3ADG A;  1NCS A;  1A1L A;  5A6J A;  2YPN A;  2LTR A;  2VE7 C;  2ENH A;  3VHT B;  5LMN E;  2BBG A;  2EMF A;  2EJ4 A;  2EM2 A;  4X66 E;  4R2P A;  1RC7 A;  2LUQ A;  5AE1 A;  3RMP A;  4M2Z A;  2B7T A;  3J7Y p;  2YTF A;  2EN8 A;  2LV2 A;  4LF8 E;  1MGT A;  2GSL A;  2VRD A;  2N3H A;  2WCC 3;  3IWB A;  4B3R E;  1UHZ A;  2B7V A;  2EML A;  2RTX A;  1RQ0 A;  2YTJ A;  3THO B;  4R2S A;  2EQ0 A;  4DV1 E;  2UXB E;  2ADR A;  2E1M A;  2J7J A;  2MKN A;  4JI0 E;  4Q28 A;  4P7D A;  4DV6 E;  2EOS A;  4LTY A;  2EM8 A;  1J26 A;  4WX9 A;  2ZM6 E;  1YYW A;  1T4O A;  3RV0 A;  2RS6 A;  3J80 C;  4LF4 E;  1HNZ E;  2R1F A;  4L5N C;  5KL2 A;  1IMU A;  2BB8 A;  1KYQ A;  3BID A;  2VQF E;  1WJP A;  2EL5 A;  4WSP A;  1XNR E;  2NA2 A;  4DUZ E;  2A11 A;  5AAS A;  2MC6 A;  5DNY A;  1GQE A;  1GTK A;  2KHX A;  5LLQ A;  1N34 E;  2M1S A;  2M4I A;  3OML A;  4RHB B;  1X5W A;  2M7Q A;  3K6Q A;  3O2R A;  3VK6 A;  3O2R B;  1DQ3 A;  2QVW A;  2EL6 A;  4JI7 E;  1IBL E;  1PDA A;  4O5G A;  3QG5 C;  1B69 A;  4DR4 E;  2V87 A;  3C4T A;  2YTE A;  1EKZ A;  3FIG A;  2RSI A;  4WXD A;  4NHR A;  2LBS B;  4F6N A;  4LF6 E;  2V83 A;  5A6B A;  1YPN A;  2DLQ A;  5IT9 C;  4TUI A;  2UXC E;  2LRS A;  3JU0 A;  1AAY A;  2MC5 A;  4ZYE A;  5AC4 A;  2K7I A;  1YYK A;  2DMI A;  3IWC A;  1DGC A;  5A6K A;  3M99 B;  5A69 A;  2JR1 A;  4WFT A;  2EP3 A;  2VF1 A;  4X65 E;  1BBG A;  4ZYD A;  3HQ1 A;  2UU9 E;  4R2Q A;  4DV3 E;  4JI6 E;  1RC5 A;  1O0W A;  1FJG E;  2EPU A;  3EPJ A;  2I13 A;  1KJK A;  1I94 E;  1TF3 A;  5BR8 E;  4NZV A;  5KL5 A;  3HXL A;  4F2J C;  4NXM E;  1A1F A;  2G7H A;  3ECR A;  2EOZ A;  2LCE A;  4LF5 E;  2HJJ A;  5A2Q C;  1ZU1 A;  1FKA E;  1JK1 A;  2EMB A;  4BHB A;  2FFL A;  3EQ1 A;  2F4V E;  1IQO A;  2EM7 A;  4JI4 E;  1EH7 A;  3BGH A;  5TSE A;  2MDR A;  3HPZ A;  2EOF A;  4M30 A;  2EMX A;  3P1X A;  2L3J A;  2V86 A;  3JAM C;  1F2I G;  1X3C A;  4DMI A;  2ODR C;  4LFC E;  1XNQ E;  1ZAA C;  2EPK X;  2EOY A;  3LLH A;  5FLX C;  2JOX A;  4R2A A;  4N4R B;  2EOO A;  1A1G A;  3VYY A;  4BC7 A;  3L00 A;  2EPR A;  2LJH A;  1X48 A;  2YU8 A;  3DF6 A;  2EMC A;  4JI5 E;  4WPY A;  1PJT A;  4O43 A;  4KWY A;  5IWA E;  2RQL A;  2L6M A;  2EM3 A;  1IBK E;  4LFA E;  1ZR9 A;  2K4V A;  4M0V A;  2GPI A;  1T38 A;  4YHH E;  1EH8 A;  2WBT A;  3UK3 C;  2EN1 A;  4JI2 E;  2NUE A;  2LMZ A;  2DSY A;  2CT1 A;  4X62 E;  1A1I A;  1G2D C;  5A6B D;  2YTD A;  2N3G A;  1A1K A;  2YTI A;  3RV1 A;  2NUG A;  1UBD C;  2WBU A;  1X6F A;  4B3T E;  3ADL A;  3H09 A;  2DMY A;  2CTD A;  2LO3 A;  2JP9 A;  3F6G A;  1RMD A;  4BBY A;  1YSA C;  2JPA A;  2KOU A;  4GZN C;  2EN7 A;  1ZBQ A;  2EOJ A;  2EMY A;  2EMA A;  2E72 A;  4DR3 E;  2ELY A;  2YTO A;  4BHC A;  1DI2 A;  3HPS A;  1JK2 A;  3TQM A;  2EN6 A;  4ZYG A;  4R2E A;  2EE8 A;  4BCA A;  2RSM A;  2LTS A;  2UUC E;  2YRH A;  4DKK A;  2V8Q B;  1YUI A;  1SR9 A;  4BS9 A;  2UXD E;  5AE2 A;  1HNX E;  2ENA A;  4TUG A;  2EPX A;  2NUF A;  4HEI A;  1XMQ E;  2EL4 A;  3ADJ A;  5T6J A;  4F9C B;  5IV8 B;  4WYQ B;  4DV4 E;  1BB8 A;  1ZTD A;  4O4K A;  1HNW E;  2JOB A;  4OUN A;  2EZ6 A;  2YU5 A;  1EH6 A;  4BC9 A;  4F54 A;  3AUZ A;  1TN9 A;  2EN4 A;  3C6K A;  2YRK A;  4FK5 C;  3N3W A;  4YY3 E;  4DR5 E;  2A25 A;  4WXC A;  2KON A;  1N33 E;  2LT7 A;  2EQ3 A;  4DR2 E;  1T39 A;  2HC5 A;  4OOG C;  1X6H A;  2JVA A;  2GLI A;  2EB1 A;  2M9A A;  2EOQ A;  5LL6 R;  5LMU E;  3KWR A; 
#chains in the Genus database with same CATH homology
 4B3M E;  4DR1 E;  4LFC E;  1XMO E;  1T4O A;  3RV0 A;  2RS6 A;  1XNQ E;  1N36 E;  3J80 C;  5AE3 A;  4LF4 E;  3J7A G;  1HNZ E;  2ODR D;  3LLH A;  4X8W A;  4L5N C;  5FLX C;  4LU9 A;  1HR0 E;  3VYX A;  2JOX A;  3ADI A;  2F8B A;  2V89 A;  2VQF E;  4WSP A;  2DB2 A;  1XNR E;  2NA2 A;  3VYY A;  2CPN A;  2JY9 A;  4BC7 A;  4DUZ E;  1T4L B;  2A11 A;  2LJH A;  5AAS A;  1YZ9 A;  1X48 A;  2RS7 A;  2MC6 A;  3DF6 A;  5DNY A;  4J8Z A;  1GQE A;  1GZ6 A;  2KHX A;  1N34 E;  2M1S A;  2M4I A;  3OML A;  4DV0 E;  2UUA E;  2L3C A;  4JI5 E;  4WPY A;  1YYO A;  4BMJ A;  5IWA E;  2M7Q A;  4X64 E;  3K6Q A;  3O2R A;  2L6M A;  3VK6 A;  4LF7 E;  3O2R B;  1DQ3 A;  2QVW A;  4JI7 E;  2DIX A;  1IBK E;  4LFA E;  4KHP E;  1WHN A;  2K4V A;  3MSW A;  4M0V A;  4AQY E;  1N32 E;  1IBL E;  2VQE E;  4YHH E;  4F9B B;  4JI2 E;  5CFF E;  3DJW A;  2NUE A;  2LMZ A;  4DR4 E;  2DSY A;  2V87 A;  3C4T A;  1X49 A;  2B9D A;  1EKZ A;  2L2N A;  3FIG A;  2LE2 A;  4X62 E;  2E5L E;  3T1H E;  2HHH E;  1I4S A;  3AV0 A;  4B3S E;  2WZO A;  2LBS B;  1FJG E;  2N3G A;  4JV5 E;  4LF6 E;  1WHQ A;  2V83 A;  2L33 A;  2V88 A;  5ADZ A;  1T4N A;  1WXR A;  5IT9 C;  2L92 A;  3LML A;  4TUI A;  2UXC E;  2LRS A;  4OX9 E;  3RV1 A;  2NUG A;  2L2K B;  4B3T E;  4R03 A;  2V85 A;  3JU0 A;  2MC5 A;  1IBM E;  3ADL A;  4P78 A;  2UUB E;  1YYK A;  3H09 A;  2DMY A;  3IWC A;  1ZBT A;  4L8N A;  1JFZ A;  4DV7 E;  1STU A;  1X47 A;  3F6G A;  2JR1 A;  4BBY A;  4JI8 E;  4WFT A;  4K0K E;  3ZOQ B;  2KOU A;  2L8T A;  4JI3 E;  1ZBQ A;  4I8O A;  2JWO A;  2VF1 A;  4X65 E;  4DV2 E;  3T1Y E;  3HQ1 A;  4GEQ B;  4JYA E;  1U61 A;  2UU9 E;  4DV3 E;  4DR3 E;  1RC5 A;  1O0W A;  3F6H A;  4JI6 E;  2YT4 A;  3C4B A;  4DUY E;  2EWL A;  2L2M A;  3ADG A;  1DI2 A;  3HPS A;  1PKP A;  3J81 C;  2LTR A;  2VE7 C;  4DR7 E;  5LMN E;  4BCA A;  1J5E E;  2RSM A;  2LTS A;  3JTZ A;  4X66 E;  1I94 E;  2UUC E;  2FTX B;  4DKK A;  1RC7 A;  2LUQ A;  2V8Q B;  5BR8 E;  2IHR 1;  5AE1 A;  1SR9 A;  4BS9 A;  3HXL A;  3RMP A;  4GKK E;  2UXD E;  4R8O A;  5AE2 A;  3OTO E;  1HNX E;  4NXM E;  4M2Z A;  2B7T A;  3J7Y p;  2G7H A;  4TUG A;  1QU6 A;  2NUF A;  4LF5 E;  1XMQ E;  3ADJ A;  4LF8 E;  4JI1 E;  4DR6 E;  5A2Q C;  2GSL A;  2FV4 B;  5T6J A;  4F9C B;  1FKA E;  4WYQ B;  4F9A B;  4DV4 E;  2N3H A;  2ZM6 E;  1HNW E;  2JOB A;  4OUN A;  1YYW A;  3IWB A;  2EZ6 A;  4LF9 E;  4B3R E;  4GKJ E;  1UHZ A;  4BC9 A;  4F54 A;  2FFL A;  3AUZ A;  2F4V E;  4LFB E;  4JI4 E;  2B7V A;  3HTX A;  2RTX A;  2LUP B;  1RQ0 A;  4NXN E;  2H36 X;  4DV1 E;  4DV5 E;  2B3T B;  2MDR A;  3HPZ A;  2YZT A;  2UXB E;  3N3W A;  2E1M A;  4YY3 E;  4DR5 E;  1UIL A;  2KON A;  1N33 E;  4M30 A;  4DR2 E;  4JI0 E;  4OOG C;  2JVA A;  4KZS A;  4P7D A;  3P1X A;  4Q28 A;  4DV6 E;  4LTY A;  2EB1 A;  5F3W A;  1J26 A;  2L3J A;  5LL6 R;  2V86 A;  3JAM C;  5LMU E;  3IWD A;  4DMI A;  2ODR C;  2FGG A;  3KWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...