4M2ZA

Crystal structure of rnase iii complexed with double-stranded rna and cmp (type ii cleavage)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
220
structure length
220
Chain Sequence
KMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNase III: Genetics and Function; Structure and Mechanism.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
molecule keywords Ribonuclease 3
total genus 71
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 4m2zA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4m2zA02
1EKZA 4DV5E 1X49A 1WHQA 2JY9A 2UU9E 4JI1E 3RV0A 4DV1E 2VQEE 2CPNA 4DR5E 1HR0E 4LF6E 2UUAE 4YHHE 2E5LE 1YYOA 1O0WA 2DB2A 1X47A 2LTSA 2EZ6A 1STUA 4DKKA 5LMNE 4DV7E 4JV5E 1N33E 2LJHA 1UILA 4JI4E 1XMQE 1YYWA 2YT4A 3ADJA 2HHHE 2L2KB 4DR2E 4LF5E 4AQYE 4DUYE 2NUGA 3O2RA 2LBSB 1N34E 4LFCE 2FFLA 4NXME 3N3WA 2N3HA 2IHR1 2DMYA 4X62E 2UUCE 4X8WA 1XNRE 2NUEA 3C4TA 4X65E 1FJGE 3ADIA 1T4OA 2VQFE 4DV0E 3VYXA 1X48A 4JI3E 4JYAE 1RC5A 3O2RB 3OTOE 4OOGC 4DUZE 1ZBTA 2JVAA 4GKJE 1GQEA 2L33A 2GSLA 3LLHA 4WFTA 4DV6E 2L2NA 3HTXA 4DR6E 3RV1A 1RQ0A 5BR8E 4LF4E 2LTRA 1I94E 4DR7E 2NUFA 2LUQA 1RC7A 4DR3E 1IBME 4B3SE 4M2ZA 4DV3E 3T1HE 1HNWE 1QU6A 2RTXA 3ADLA 4KHPE 2UXCE 1YYKA 1PKPA 5CFFE 2LRSA 1IBKE 4B3ME 4JI7E 1J5EE 2LUPB 4WYQB 3C4BA 1IBLE 2F4VE 4DR1E 2UUBE 2B7TA 4GKKE 1DI2A 2B7VA 2QVWA 1WHNA 4JI0E 4LFAE 1T4NA 3P1XA 4NXNE 4LF7E 4OX9E 4DV2E 2UXDE 2EB1A 2RS7A 1T4LB 4LF8E 1HNXE 2ZM6E 2DIXA 3VYYA 3J7Yp 1XMOE 1I4SA 2L2MA 4M30A 1YZ9A 1N36E 4B3TE 3ADGA 2N3GA 1UHZA 2KHXA 4LF9E 2A11A 4K0KE 5IWAE 1U61A 2NA2A 4YY3E 4X64E 4JI2E 4DR4E 4OUNA 4JI8E 2L3CA 4LFBE 1XNQE 2RSMA 5LMUE 2L3JA 4JI6E 1FKAE 4X66E 2MDRA 2B3TB 1HNZE 4DV4E 3T1YE 2UXBE 1JFZA 1N32E 4B3RE 4JI5E 1J26A 2RS6A
chains in the Genus database with same CATH superfamily
2EPKX 4BHBA 1TN9A 3H09A 2EMKA 4JI1E 5AASA 2YU5A 4DV1E 1HR0E 4DR5E 4F9BB 1SR9A 2EQ1A 2LTSA 1X47A 2M4IA 2YTOA 1STUA 4DKKA 4JV5E 3KWRA 5AE3A 2VRDA 3HPZA 2JOBA 1QNTA 4F2JC 3DF6A 2HHHE 2EWLA 2EOSA 2EMIA 2EOQA 2E1MA 1X3CA 2LO3A 3AUZA 5LLQA 4DUYE 2EMCA 2V86A 1N34E 3HXLA 2ELYA 4NXME 2N3HA 3JU0A 2EOOA 2DMYA 5KL6A 2EMLA 2NUEA 4DV0E 3VYXA 2EOYA 2JOXA 2N8XA 5ADZA 1PJSA 1RC5A 3O2RB 3DJWA 1ZBTA 2EN1A 5IV8B 1PJQA 2YRKA 2EMAA 1GQEA 3LLHA 2GSLA 2VF1A 3HQ1A 3RV1A 2F8BA 4R2CA 4LF4E 4BHCA 1I94E 4FK5C 4DR7E 4DR3E 2WBUA 2EN6A 2EM9A 5A6JA 3FIGA 1QU6A 2BBGA 4HTGA 4KHPE 2UXCE 1UN6B 3HPSA 2HC5A 1PKPA 2LUPB 1A1LA 4WYQB 3C4BA 4R2PA 3F6GA 4ZYDA 2EOZA 2B7VA 2EN3A 1GZ6A 1PDAA 2EL4A 2EPCA 2LE2A 2EOFA 2EPXA 2RPCA 4X9JA 5AC5A 4GZNC 2PRTA 2EOJA 2LJUA 2JWOA 2ZM6E 1A1GA 2GPIA 2YTJA 4RH8A 3BBGA 1G2FC 1YZ9A 1N36E 4B3TE 1MEYC 5T6JA 3ADGA 2YRMA 4K0KE 1U61A 2L3CA 4LFBE 3ECRA 3EQ1A 2CSHA 2DRPA 1BB8A 2B3TB 2EN7A 4O24A 3MHHC 2FV4B 3QG5C 1KJKA 2JPAA 2EMHA 2EMWA 2JY9A 4F6MA 5A6BA 2EPPA 2EOMA 2YTPA 2E72A 2YTGA 4ZYGA 2UUAE 2E5LE 1YYOA 1O0WA 2DB2A 4R03A 2EZ6A 5LMNE 4DV7E 2M9AA 1N33E 2R76A 3J81C 1BBOA 2L92A 2Q8UA 3JTZA 4JI4E 1YYWA 2EPMX 4RHBB 3ADJA 2EMYA 2EMGA 2EJ4A 1X5WA 2IHR1 4WX9A 1IQSA 2EL6A 1ZTDA 4DMIA 2EOEA 3C6KA 2YWQA 2VQFE 1X48A 4JI3E 1IMUA 3IWDA 3J80C 2V8QB 5AC4A 1JK1A 1WRJA 1RQ0A 5BR8E 2LTRA 2EPNA 1RC7A 2LUQA 4J8ZA 1IBME 3M99B 4B3SE 1HNWE 4R2DA 2EMZA 1UBDC 1TF3A 1YYKA 1NCSA 5CFFE 2EPZA 2GHFA 1J5EE 1L4SA 2DLQA 1IBLE 2K7IA 4DR1E 1ZR9A 1A1IA 1T4NA 2L8TA 4NXNE 4WXDA 5AE2A 2WBSA 4KZSA 4LF7E 3TQMA 5KL7A 1X6EA 2EB1A 4P78A 3UK3C 2EM7A 2I9IA 2JXPA 4BBYA 2YTDA 2YZTA 1XMOE 2EN8A 2YTEA 1TF6A 5KL3A 4N4RB 2NA2A 4X64E 4YY3E 4IJDA 4IS1C 2RSMA 5LMUE 2YTQA 4X66E 2MDRA 5IT9C 4F9AB 5TSEA 2EORA 5IXMB 3T1YE 2LV2A 1JFZA 2EPLX 4B3RE 2ODRC 4MLQA 2V89A 4TUGA 2MC6A 4O4KA 2DMIA 4LF6E 4DV5E 1X49A 1WHQA 2UU9E 1WJPA 3EPLA 2MKNA 2CPNA 3J7AG 3BGHA 4YHHE 1A1KA 2EL5A 3IWCA 2B9DA 4M0VA 1N3GA 2ENHA 5AE1A 4Q28A 1DGCA 4NZVA 2EQ3A 2YT4A 4R2QA 4R2RA 4TUIA 2M7QA 2V85A 4AQYE 2YTIA 2ENAA 2EPAA 4ZYHA 2L6MA 3K6QA 2LBSB 4LFCE 2FFLA 2V88A 3N3WA 2YSPA 3MSWA 4R2EA 2MDGA 5KL4A 5LL6R 3KZYA 4X8WA 2EOXA 1EH7A 1XNRE 3C4TA 3ADIA 2EQ0A 1AH5A 1YUJA 2LMZA 2YPNA 1KYQA 2EN4A 2I13A 1YPNA 2EM5A 3OTOE 4DUZE 4OOGC 5DNYA 2FTXB 2JVAA 4GKJE 2WZOA 4WFTA 2EM2A 2L2NA 3HTXA 4DR6E 3OMLA 2KOUA 2J7JA 1ZAAC 2NUFA 3JAMC 4M2ZA 2H36X 4F9CB 2LT7A 2RTXA 1X6HA 3THNA 4BS9A 1ZU1A 1RMDA 2F4VE 5A6BD 2V87A 2B7TA 3AV0A 4GKKE 1DI2A 2QVWA 2M1SA 3THOB 5A6KA 4BCAA 4WSPA 4OX9E 2LCEA 4DV2E 1Z1BA 2UXDE 1MGTA 2RS7A 5F3WA 4O43A 4LF8E 2D9HA 1YUIA 2DIXA 1WXRA 1EH8A 1B69A 2KHXA 4LF9E 1A1JA 5KL2A 4WSGA 4DR4E 5A6AA 2ADRA 1T39A 3KZZA 1XNQE 1LLMC 2LVHA 3VHTB 4ZYEA 4R2SA 2CT1A 4Q35B 2WCC3 5A2QC 1IQOA 2EE8A 3BIDA 1N32E 4JI5E 1J26A 2EPOA 1G2DC 2YSOA 2RS6A 1EKZA 2EM4A 1AAYA 2EP3A 2EOHA 3RV0A 3IWBA 3EPJA 2VQEE 2EM6A 3ZOQB 2V83A 3EPHA 3BF2A 2EPRA 3C6MA 1SFEA 1F2IG 4LTYA 4LU9A 2LJHA 1UILA 1XMQE 1ZBQA 5FLXC 4WPYA 2RSIA 2L2KB 4DR2E 4LF5E 2YU8A 2HGHA 2NUGA 3O2RA 2YTFA 2HJJA 2JR1A 2EMFA 2ODRD 2YTNA 2G7HA 4BC7A 4X62E 2UUCE 1A1FA 1T38A 4X65E 1FJGE 1T4OA 4P7DA 4HEIA 2FGGA 4JYAE 4KWYA 2L33A 4DV6E 2K4VA 2JP9A 4GEQB 3L00A 2BB8A 1GTKA 2EOIA 1BBGA 4NHRA 1P47A 4DV3E 3RMPA 3T1HE 3F6HA 3LMLA 2VE7C 4I8OA 2ENCA 2DGCA 2CTDA 2RQLA 4L5NC 2EM8A 3ADLA 2EMBA 1IBKE 2LRSA 4B3ME 4JI7E 4WXCA 2DSYA 1NEIA 2KONA 2UUBE 2EMXA 4MLVA 2YRHA 1WHNA 4JI0E 4LFAE 4BMJA 3P1XA 3EPKA 4R2AA 3MHSC 4BC9A 1X6FA 1T4LB 2ELZA 1HNXE 2R1FA 3VYYA 1PJTA 1YFHA 3J7Yp 5KL5A 1I4SA 2L2MA 4M30A 4F54A 2EPUA 2N3GA 2DLKA 1UHZA 4L8NA 2MC5A 2A11A 2WBTA 5IWAE 4M9VC 4JI2E 2EN2A 1JK2A 1A1HA 2MKDA 4OUNA 4JI8E 2NABA 4F6NA 1DQ3A 2L3JA 2EM3A 1FKAE 4JI6E 5A69A 2EM0A 3VK6A 4R8OA 2JYAA 1HNZE 4DV4E 2A25A 1YSAC 2GLIA 2UXBE 4O5GA 1EH6A
chains in the Genus database with same CATH topology
1EKZA 4DV5E 1X49A 3H09A 1WHQA 2JY9A 2UU9E 4JI1E 5AASA 3RV0A 3IWBA 2VQEE 2CPNA 4DV1E 4DR5E 1HR0E 4LF6E 4F9BB 3J7AG 3ZOQB 1SR9A 2UUAE 4YHHE 2E5LE 2V83A 1YYOA 1O0WA 3IWCA 2B9DA 4M0VA 2DB2A 1X47A 2LTSA 2EZ6A 1STUA 2M4IA 4R03A 4DKKA 5AE1A 5LMNE 4DV7E 3KWRA 4Q28A 4JV5E 1N33E 4LTYA 4LU9A 3J81C 2L92A 4B3TE 2LJHA 1UILA 3JTZA 5AE3A 3HPZA 1YYWA 2JOBA 1XMQE 4JI4E 1ZBQA 2YT4A 5FLXC 3ADJA 4WPYA 3DF6A 2HHHE 2EWLA 4TUIA 2M7QA 2V85A 2L2KB 4DR2E 4LF5E 4AQYE 2E1MA 4DUYE 2L6MA 3AUZA 3K6QA 2NUGA 3O2RA 2V86A 2LBSB 1N34E 3HXLA 2JR1A 2FFLA 2V88A 4LFCE 4NXME 3N3WA 2ODRD 3MSWA 2N3HA 3JU0A 2G7HA 2IHR1 4BC7A 2DMYA 4X62E 5LL6R 2UUCE 4X8WA 4DMIA 1XNRE 2NUEA 3C4TA 4X65E 1FJGE 3ADIA 1T4OA 2VQFE 4P7DA 4DV0E 3VYXA 2JOXA 1X48A 2LMZA 4JI3E 2FGGA 5ADZA 4JYAE 1RC5A 3O2RB 3DJWA 4OOGC 5DNYA 3OTOE 1ZBTA 2FTXB 2JVAA 4DUZE 2WZOA 3IWDA 3J80C 4GKJE 1GQEA 2L33A 2GSLA 2V8QB 3LLHA 2K4VA 2VF1A 2L2NA 4WFTA 4DV6E 3HTXA 4DR6E 3HQ1A 3OMLA 4GEQB 2KOUA 3RV1A 2F8BA 1RQ0A 5BR8E 4LF4E 2LTRA 1I94E 4DR7E 2NUFA 1RC7A 2LUQA 4J8ZA 4DR3E 1IBME 4B3SE 3JAMC 4M2ZA 2H36X 4F9CB 4DV3E 3RMPA 3FIGA 3F6HA 3LMLA 2VE7C 3T1HE 1QU6A 4I8OA 1HNWE 2RTXA 4L5NC 3ADLA 4KHPE 2UXCE 1YYKA 3HPSA 1PKPA 5CFFE 2LRSA 1IBKE 4B3ME 4JI7E 4BS9A 1J5EE 2DSYA 2LUPB 2KONA 4WYQB 3C4BA 1IBLE 3F6GA 2F4VE 4DR1E 2V87A 2B7TA 3AV0A 2UUBE 4GKKE 1DI2A 2B7VA 2QVWA 1WHNA 2M1SA 1GZ6A 4JI0E 1T4NA 4BMJA 4LFAE 2L8TA 3P1XA 4NXNE 4LF7E 5AE2A 4KZSA 4BCAA 2LE2A 4WSPA 4OX9E 4DV2E 2UXDE 4BC9A 2EB1A 2RS7A 4P78A 5F3WA 1T4LB 2JWOA 4LF8E 4BBYA 1HNXE 2ZM6E 2DIXA 3VYYA 3J7Yp 2YZTA 1I4SA 2L2MA 4M30A 1YZ9A 4F54A 1WXRA 1XMOE 5T6JA 1N36E 3ADGA 2N3GA 1UHZA 2KHXA 4L8NA 2MC5A 2A11A 4LF9E 5IWAE 4K0KE 1U61A 2NA2A 4YY3E 4X64E 4JI2E 4DR4E 4OUNA 4JI8E 2L3CA 4LFBE 1XNQE 2RSMA 1DQ3A 2L3JA 5LMUE 1FKAE 4JI6E 4X66E 3VK6A 2MDRA 5IT9C 4R8OA 4F9AB 2B3TB 1HNZE 4DV4E 5A2QC 3T1YE 2UXBE 1JFZA 1N32E 2FV4B 4B3RE 4JI5E 1J26A 2ODRC 4TUGA 2V89A 2MC6A 2RS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EKZ A;  4DV5 E;  1X49 A;  1WHQ A;  2JY9 A;  2UU9 E;  4JI1 E;  3RV0 A;  4DV1 E;  2VQE E;  2CPN A;  4DR5 E;  1HR0 E;  4LF6 E;  2UUA E;  4YHH E;  2E5L E;  1YYO A;  1O0W A;  2DB2 A;  1X47 A;  2LTS A;  2EZ6 A;  1STU A;  4DKK A;  5LMN E;  4DV7 E;  4JV5 E;  1N33 E;  2LJH A;  1UIL A;  4JI4 E;  1XMQ E;  1YYW A;  2YT4 A;  3ADJ A;  2HHH E;  2L2K B;  4DR2 E;  4LF5 E;  4AQY E;  4DUY E;  2NUG A;  3O2R A;  2LBS B;  1N34 E;  4LFC E;  2FFL A;  4NXM E;  3N3W A;  2N3H A;  2IHR 1;  2DMY A;  4X62 E;  2UUC E;  4X8W A;  1XNR E;  2NUE A;  3C4T A;  4X65 E;  1FJG E;  3ADI A;  1T4O A;  2VQF E;  4DV0 E;  3VYX A;  1X48 A;  4JI3 E;  4JYA E;  1RC5 A;  3O2R B;  3OTO E;  4OOG C;  4DUZ E;  1ZBT A;  2JVA A;  4GKJ E;  1GQE A;  2L33 A;  2GSL A;  3LLH A;  4WFT A;  4DV6 E;  2L2N A;  3HTX A;  4DR6 E;  3RV1 A;  1RQ0 A;  5BR8 E;  4LF4 E;  2LTR A;  1I94 E;  4DR7 E;  2NUF A;  2LUQ A;  1RC7 A;  4DR3 E;  1IBM E;  4B3S E;  4M2Z A;  4DV3 E;  3T1H E;  1HNW E;  1QU6 A;  2RTX A;  3ADL A;  4KHP E;  2UXC E;  1YYK A;  1PKP A;  5CFF E;  2LRS A;  1IBK E;  4B3M E;  4JI7 E;  1J5E E;  2LUP B;  4WYQ B;  3C4B A;  1IBL E;  2F4V E;  4DR1 E;  2UUB E;  2B7T A;  4GKK E;  1DI2 A;  2B7V A;  2QVW A;  1WHN A;  4JI0 E;  4LFA E;  1T4N A;  3P1X A;  4NXN E;  4LF7 E;  4OX9 E;  4DV2 E;  2UXD E;  2EB1 A;  2RS7 A;  1T4L B;  4LF8 E;  1HNX E;  2ZM6 E;  2DIX A;  3VYY A;  3J7Y p;  1XMO E;  1I4S A;  2L2M A;  4M30 A;  1YZ9 A;  1N36 E;  4B3T E;  3ADG A;  2N3G A;  1UHZ A;  2KHX A;  4LF9 E;  2A11 A;  4K0K E;  5IWA E;  1U61 A;  2NA2 A;  4YY3 E;  4X64 E;  4JI2 E;  4DR4 E;  4OUN A;  4JI8 E;  2L3C A;  4LFB E;  1XNQ E;  2RSM A;  5LMU E;  2L3J A;  4JI6 E;  1FKA E;  4X66 E;  2MDR A;  2B3T B;  1HNZ E;  4DV4 E;  3T1Y E;  2UXB E;  1JFZ A;  1N32 E;  4B3R E;  4JI5 E;  1J26 A;  2RS6 A; 
#chains in the Genus database with same CATH topology
 2EPK X;  4BHB A;  1TN9 A;  3H09 A;  2EMK A;  4JI1 E;  5AAS A;  2YU5 A;  4DV1 E;  1HR0 E;  4DR5 E;  4F9B B;  1SR9 A;  2EQ1 A;  2LTS A;  1X47 A;  2M4I A;  2YTO A;  1STU A;  4DKK A;  4JV5 E;  3KWR A;  5AE3 A;  2VRD A;  3HPZ A;  2JOB A;  1QNT A;  4F2J C;  3DF6 A;  2HHH E;  2EWL A;  2EOS A;  2EMI A;  2EOQ A;  2E1M A;  1X3C A;  2LO3 A;  3AUZ A;  5LLQ A;  4DUY E;  2EMC A;  2V86 A;  1N34 E;  3HXL A;  2ELY A;  4NXM E;  2N3H A;  3JU0 A;  2EOO A;  2DMY A;  5KL6 A;  2EML A;  2NUE A;  4DV0 E;  3VYX A;  2EOY A;  2JOX A;  2N8X A;  5ADZ A;  1PJS A;  1RC5 A;  3O2R B;  3DJW A;  1ZBT A;  2EN1 A;  5IV8 B;  1PJQ A;  2YRK A;  2EMA A;  1GQE A;  3LLH A;  2GSL A;  2VF1 A;  3HQ1 A;  3RV1 A;  2F8B A;  4R2C A;  4LF4 E;  4BHC A;  1I94 E;  4FK5 C;  4DR7 E;  4DR3 E;  2WBU A;  2EN6 A;  2EM9 A;  5A6J A;  3FIG A;  1QU6 A;  2BBG A;  4HTG A;  4KHP E;  2UXC E;  1UN6 B;  3HPS A;  2HC5 A;  1PKP A;  2LUP B;  1A1L A;  4WYQ B;  3C4B A;  4R2P A;  3F6G A;  4ZYD A;  2EOZ A;  2B7V A;  2EN3 A;  1GZ6 A;  1PDA A;  2EL4 A;  2EPC A;  2LE2 A;  2EOF A;  2EPX A;  2RPC A;  4X9J A;  5AC5 A;  4GZN C;  2PRT A;  2EOJ A;  2LJU A;  2JWO A;  2ZM6 E;  1A1G A;  2GPI A;  2YTJ A;  4RH8 A;  3BBG A;  1G2F C;  1YZ9 A;  1N36 E;  4B3T E;  1MEY C;  5T6J A;  3ADG A;  2YRM A;  4K0K E;  1U61 A;  2L3C A;  4LFB E;  3ECR A;  3EQ1 A;  2CSH A;  2DRP A;  1BB8 A;  2B3T B;  2EN7 A;  4O24 A;  3MHH C;  2FV4 B;  3QG5 C;  1KJK A;  2JPA A;  2EMH A;  2EMW A;  2JY9 A;  4F6M A;  5A6B A;  2EPP A;  2EOM A;  2YTP A;  2E72 A;  2YTG A;  4ZYG A;  2UUA E;  2E5L E;  1YYO A;  1O0W A;  2DB2 A;  4R03 A;  2EZ6 A;  5LMN E;  4DV7 E;  2M9A A;  1N33 E;  2R76 A;  3J81 C;  1BBO A;  2L92 A;  2Q8U A;  3JTZ A;  4JI4 E;  1YYW A;  2EPM X;  4RHB B;  3ADJ A;  2EMY A;  2EMG A;  2EJ4 A;  1X5W A;  2IHR 1;  4WX9 A;  1IQS A;  2EL6 A;  1ZTD A;  4DMI A;  2EOE A;  3C6K A;  2YWQ A;  2VQF E;  1X48 A;  4JI3 E;  1IMU A;  3IWD A;  3J80 C;  2V8Q B;  5AC4 A;  1JK1 A;  1WRJ A;  1RQ0 A;  5BR8 E;  2LTR A;  2EPN A;  1RC7 A;  2LUQ A;  4J8Z A;  1IBM E;  3M99 B;  4B3S E;  1HNW E;  4R2D A;  2EMZ A;  1UBD C;  1TF3 A;  1YYK A;  1NCS A;  5CFF E;  2EPZ A;  2GHF A;  1J5E E;  1L4S A;  2DLQ A;  1IBL E;  2K7I A;  4DR1 E;  1ZR9 A;  1A1I A;  1T4N A;  2L8T A;  4NXN E;  4WXD A;  5AE2 A;  2WBS A;  4KZS A;  4LF7 E;  3TQM A;  5KL7 A;  1X6E A;  2EB1 A;  4P78 A;  3UK3 C;  2EM7 A;  2I9I A;  2JXP A;  4BBY A;  2YTD A;  2YZT A;  1XMO E;  2EN8 A;  2YTE A;  1TF6 A;  5KL3 A;  4N4R B;  2NA2 A;  4X64 E;  4YY3 E;  4IJD A;  4IS1 C;  2RSM A;  5LMU E;  2YTQ A;  4X66 E;  2MDR A;  5IT9 C;  4F9A B;  5TSE A;  2EOR A;  5IXM B;  3T1Y E;  2LV2 A;  1JFZ A;  2EPL X;  4B3R E;  2ODR C;  4MLQ A;  2V89 A;  4TUG A;  2MC6 A;  4O4K A;  2DMI A;  4LF6 E;  4DV5 E;  1X49 A;  1WHQ A;  2UU9 E;  1WJP A;  3EPL A;  2MKN A;  2CPN A;  3J7A G;  3BGH A;  4YHH E;  1A1K A;  2EL5 A;  3IWC A;  2B9D A;  4M0V A;  1N3G A;  2ENH A;  5AE1 A;  4Q28 A;  1DGC A;  4NZV A;  2EQ3 A;  2YT4 A;  4R2Q A;  4R2R A;  4TUI A;  2M7Q A;  2V85 A;  4AQY E;  2YTI A;  2ENA A;  2EPA A;  4ZYH A;  2L6M A;  3K6Q A;  2LBS B;  4LFC E;  2FFL A;  2V88 A;  3N3W A;  2YSP A;  3MSW A;  4R2E A;  2MDG A;  5KL4 A;  5LL6 R;  3KZY A;  4X8W A;  2EOX A;  1EH7 A;  1XNR E;  3C4T A;  3ADI A;  2EQ0 A;  1AH5 A;  1YUJ A;  2LMZ A;  2YPN A;  1KYQ A;  2EN4 A;  2I13 A;  1YPN A;  2EM5 A;  3OTO E;  4DUZ E;  4OOG C;  5DNY A;  2FTX B;  2JVA A;  4GKJ E;  2WZO A;  4WFT A;  2EM2 A;  2L2N A;  3HTX A;  4DR6 E;  3OML A;  2KOU A;  2J7J A;  1ZAA C;  2NUF A;  3JAM C;  4M2Z A;  2H36 X;  4F9C B;  2LT7 A;  2RTX A;  1X6H A;  3THN A;  4BS9 A;  1ZU1 A;  1RMD A;  2F4V E;  5A6B D;  2V87 A;  2B7T A;  3AV0 A;  4GKK E;  1DI2 A;  2QVW A;  2M1S A;  3THO B;  5A6K A;  4BCA A;  4WSP A;  4OX9 E;  2LCE A;  4DV2 E;  1Z1B A;  2UXD E;  1MGT A;  2RS7 A;  5F3W A;  4O43 A;  4LF8 E;  2D9H A;  1YUI A;  2DIX A;  1WXR A;  1EH8 A;  1B69 A;  2KHX A;  4LF9 E;  1A1J A;  5KL2 A;  4WSG A;  4DR4 E;  5A6A A;  2ADR A;  1T39 A;  3KZZ A;  1XNQ E;  1LLM C;  2LVH A;  3VHT B;  4ZYE A;  4R2S A;  2CT1 A;  4Q35 B;  2WCC 3;  5A2Q C;  1IQO A;  2EE8 A;  3BID A;  1N32 E;  4JI5 E;  1J26 A;  2EPO A;  1G2D C;  2YSO A;  2RS6 A;  1EKZ A;  2EM4 A;  1AAY A;  2EP3 A;  2EOH A;  3RV0 A;  3IWB A;  3EPJ A;  2VQE E;  2EM6 A;  3ZOQ B;  2V83 A;  3EPH A;  3BF2 A;  2EPR A;  3C6M A;  1SFE A;  1F2I G;  4LTY A;  4LU9 A;  2LJH A;  1UIL A;  1XMQ E;  1ZBQ A;  5FLX C;  4WPY A;  2RSI A;  2L2K B;  4DR2 E;  4LF5 E;  2YU8 A;  2HGH A;  2NUG A;  3O2R A;  2YTF A;  2HJJ A;  2JR1 A;  2EMF A;  2ODR D;  2YTN A;  2G7H A;  4BC7 A;  4X62 E;  2UUC E;  1A1F A;  1T38 A;  4X65 E;  1FJG E;  1T4O A;  4P7D A;  4HEI A;  2FGG A;  4JYA E;  4KWY A;  2L33 A;  4DV6 E;  2K4V A;  2JP9 A;  4GEQ B;  3L00 A;  2BB8 A;  1GTK A;  2EOI A;  1BBG A;  4NHR A;  1P47 A;  4DV3 E;  3RMP A;  3T1H E;  3F6H A;  3LML A;  2VE7 C;  4I8O A;  2ENC A;  2DGC A;  2CTD A;  2RQL A;  4L5N C;  2EM8 A;  3ADL A;  2EMB A;  1IBK E;  2LRS A;  4B3M E;  4JI7 E;  4WXC A;  2DSY A;  1NEI A;  2KON A;  2UUB E;  2EMX A;  4MLV A;  2YRH A;  1WHN A;  4JI0 E;  4LFA E;  4BMJ A;  3P1X A;  3EPK A;  4R2A A;  3MHS C;  4BC9 A;  1X6F A;  1T4L B;  2ELZ A;  1HNX E;  2R1F A;  3VYY A;  1PJT A;  1YFH A;  3J7Y p;  5KL5 A;  1I4S A;  2L2M A;  4M30 A;  4F54 A;  2EPU A;  2N3G A;  2DLK A;  1UHZ A;  4L8N A;  2MC5 A;  2A11 A;  2WBT A;  5IWA E;  4M9V C;  4JI2 E;  2EN2 A;  1JK2 A;  1A1H A;  2MKD A;  4OUN A;  4JI8 E;  2NAB A;  4F6N A;  1DQ3 A;  2L3J A;  2EM3 A;  1FKA E;  4JI6 E;  5A69 A;  2EM0 A;  3VK6 A;  4R8O A;  2JYA A;  1HNZ E;  4DV4 E;  2A25 A;  1YSA C;  2GLI A;  2UXB E;  4O5G A;  1EH6 A; 
#chains in the Genus database with same CATH homology
 1EKZ A;  4DV5 E;  1X49 A;  3H09 A;  1WHQ A;  2JY9 A;  2UU9 E;  4JI1 E;  5AAS A;  3RV0 A;  3IWB A;  2VQE E;  2CPN A;  4DV1 E;  4DR5 E;  1HR0 E;  4LF6 E;  4F9B B;  3J7A G;  3ZOQ B;  1SR9 A;  2UUA E;  4YHH E;  2E5L E;  2V83 A;  1YYO A;  1O0W A;  3IWC A;  2B9D A;  4M0V A;  2DB2 A;  1X47 A;  2LTS A;  2EZ6 A;  1STU A;  2M4I A;  4R03 A;  4DKK A;  5AE1 A;  5LMN E;  4DV7 E;  3KWR A;  4Q28 A;  4JV5 E;  1N33 E;  4LTY A;  4LU9 A;  3J81 C;  2L92 A;  4B3T E;  2LJH A;  1UIL A;  3JTZ A;  5AE3 A;  3HPZ A;  1YYW A;  2JOB A;  1XMQ E;  4JI4 E;  1ZBQ A;  2YT4 A;  5FLX C;  3ADJ A;  4WPY A;  3DF6 A;  2HHH E;  2EWL A;  4TUI A;  2M7Q A;  2V85 A;  2L2K B;  4DR2 E;  4LF5 E;  4AQY E;  2E1M A;  4DUY E;  2L6M A;  3AUZ A;  3K6Q A;  2NUG A;  3O2R A;  2V86 A;  2LBS B;  1N34 E;  3HXL A;  2JR1 A;  2FFL A;  2V88 A;  4LFC E;  4NXM E;  3N3W A;  2ODR D;  3MSW A;  2N3H A;  3JU0 A;  2G7H A;  2IHR 1;  4BC7 A;  2DMY A;  4X62 E;  5LL6 R;  2UUC E;  4X8W A;  4DMI A;  1XNR E;  2NUE A;  3C4T A;  4X65 E;  1FJG E;  3ADI A;  1T4O A;  2VQF E;  4P7D A;  4DV0 E;  3VYX A;  2JOX A;  1X48 A;  2LMZ A;  4JI3 E;  2FGG A;  5ADZ A;  4JYA E;  1RC5 A;  3O2R B;  3DJW A;  4OOG C;  5DNY A;  3OTO E;  1ZBT A;  2FTX B;  2JVA A;  4DUZ E;  2WZO A;  3IWD A;  3J80 C;  4GKJ E;  1GQE A;  2L33 A;  2GSL A;  2V8Q B;  3LLH A;  2K4V A;  2VF1 A;  2L2N A;  4WFT A;  4DV6 E;  3HTX A;  4DR6 E;  3HQ1 A;  3OML A;  4GEQ B;  2KOU A;  3RV1 A;  2F8B A;  1RQ0 A;  5BR8 E;  4LF4 E;  2LTR A;  1I94 E;  4DR7 E;  2NUF A;  1RC7 A;  2LUQ A;  4J8Z A;  4DR3 E;  1IBM E;  4B3S E;  3JAM C;  4M2Z A;  2H36 X;  4F9C B;  4DV3 E;  3RMP A;  3FIG A;  3F6H A;  3LML A;  2VE7 C;  3T1H E;  1QU6 A;  4I8O A;  1HNW E;  2RTX A;  4L5N C;  3ADL A;  4KHP E;  2UXC E;  1YYK A;  3HPS A;  1PKP A;  5CFF E;  2LRS A;  1IBK E;  4B3M E;  4JI7 E;  4BS9 A;  1J5E E;  2DSY A;  2LUP B;  2KON A;  4WYQ B;  3C4B A;  1IBL E;  3F6G A;  2F4V E;  4DR1 E;  2V87 A;  2B7T A;  3AV0 A;  2UUB E;  4GKK E;  1DI2 A;  2B7V A;  2QVW A;  1WHN A;  2M1S A;  1GZ6 A;  4JI0 E;  1T4N A;  4BMJ A;  4LFA E;  2L8T A;  3P1X A;  4NXN E;  4LF7 E;  5AE2 A;  4KZS A;  4BCA A;  2LE2 A;  4WSP A;  4OX9 E;  4DV2 E;  2UXD E;  4BC9 A;  2EB1 A;  2RS7 A;  4P78 A;  5F3W A;  1T4L B;  2JWO A;  4LF8 E;  4BBY A;  1HNX E;  2ZM6 E;  2DIX A;  3VYY A;  3J7Y p;  2YZT A;  1I4S A;  2L2M A;  4M30 A;  1YZ9 A;  4F54 A;  1WXR A;  1XMO E;  5T6J A;  1N36 E;  3ADG A;  2N3G A;  1UHZ A;  2KHX A;  4L8N A;  2MC5 A;  2A11 A;  4LF9 E;  5IWA E;  4K0K E;  1U61 A;  2NA2 A;  4YY3 E;  4X64 E;  4JI2 E;  4DR4 E;  4OUN A;  4JI8 E;  2L3C A;  4LFB E;  1XNQ E;  2RSM A;  1DQ3 A;  2L3J A;  5LMU E;  1FKA E;  4JI6 E;  4X66 E;  3VK6 A;  2MDR A;  5IT9 C;  4R8O A;  4F9A B;  2B3T B;  1HNZ E;  4DV4 E;  5A2Q C;  3T1Y E;  2UXB E;  1JFZ A;  1N32 E;  2FV4 B;  4B3R E;  4JI5 E;  1J26 A;  2ODR C;  4TUG A;  2V89 A;  2MC6 A;  2RS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...