4M2ZA

Crystal structure of rnase iii complexed with double-stranded rna and cmp (type ii cleavage)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
220
structure length
220
Chain Sequence
KMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease 3
publication title RNase III: Genetics and Function; Structure and Mechanism.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
total genus 71
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 4m2zA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4m2zA02
2RTXA 1GQEA 2A11A 1J5EE 2L2MA 4B3TE 4DV2E 4JI3E 1I4SA 4OUNA 4DKKA 4DR5E 1T4LB 1XMOE 4LF7E 2L2NA 4B3ME 5IWAE 2N3HA 1FKAE 3T1YE 2B3TB 1JFZA 1FJGE 1XNQE 1RC7A 4DUZE 4AQYE 1RC5A 2QVWA 4X66E 4DR6E 4JYAE 2EZ6A 4X8WA 2UXCE 3C4TA 2CPNA 1N34E 4B3SE 3HTXA 4X65E 2LUPB 2F4VE 1STUA 2VQFE 2DB2A 4LF5E 2DMYA 4NXME 4X62E 4YY3E 2RS6A 5CFFE 4DV0E 4DUYE 1YYKA 2B7TA 1YYWA 4GKJE 4LFCE 2UUBE 4KHPE 1O0WA 2B7VA 1RQ0A 2RSMA 1PKPA 4DR4E 5LMNE 3ADJA 4DV4E 2UUCE 2L2KB 3LLHA 1HNWE 2GSLA 4DV1E 4DV7E 2L33A 2NUFA 4DR2E 2LTSA 4DR3E 4LF6E 3P1XA 2KHXA 1N36E 2NA2A 1XMQE 4OX9E 3T1HE 3VYXA 4DV5E 2LJHA 2LTRA 1YZ9A 1X47A 2LBSB 2UXDE 1U61A 2NUEA 5LMUE 3ADIA 1X48A 4WYQB 2DIXA 4DR7E 2L3CA 1UILA 3RV0A 3ADLA 2NUGA 2JY9A 4JI0E 4DV6E 4WFTA 1HNZE 1HR0E 4JI4E 1IBKE 2UU9E 4JI6E 1QU6A 4GKKE 4NXNE 3O2RA 1EKZA 4OOGC 1WHQA 3N3WA 4JI2E 4LF8E 2MDRA 1T4NA 4JI1E 3ADGA 4LFAE 3J7Yp 4M30A 4X64E 4B3RE 5BR8E 1T4OA 2N3GA 1IBLE 4JI5E 1I94E 4JV5E 1N32E 4LFBE 2LUQA 4YHHE 3O2RB 1YYOA 4DV3E 2UXBE 2L3JA 3RV1A 1N33E 3C4BA 1X49A 3VYYA 3OTOE 2VQEE 1IBME 1XNRE 4DR1E 1HNXE 1ZBTA 4M2ZA 2RS7A 2EB1A 2IHR1 4JI8E 1J26A 2FFLA 2LRSA 4JI7E 2UUAE 2YT4A 4K0KE 4LF9E 2HHHE 1UHZA 2ZM6E 2E5LE 2JVAA 1WHNA 1DI2A 4LF4E
chains in the Genus database with same CATH superfamily
2E72A 1J5EE 2EOIA 5A6BD 2HJJA 2YTPA 4DKKA 2FV4B 2JOXA 4KZSA 3EQ1A 2B3TB 1FJGE 1XNQE 1AH5A 2DLQA 4M9VC 2QVWA 2J7JA 3C4TA 4X65E 2LUPB 1STUA 2VQFE 2EM2A 4LF5E 2EM0A 2EPPA 1YSAC 3J81C 4BMJA 4DUYE 1G2FC 2EPAA 2B7TA 5LLQA 4LFCE 2RSMA 1RQ0A 4DR4E 5LMNE 2YWQA 2VE7C 4WSGA 2WCC3 1LLMC 2YTGA 2EJ4A 1A1JA 5AE1A 2LTSA 4BS9A 2YZTA 1JK2A 2EE8A 4F54A 2EMGA 1L4SA 1ZTDA 4R2AA 2EN7A 3ADIA 2YTFA 4NHRA 1WRJA 4WYQB 1QNTA 4DR7E 2L3CA 2EMKA 5A2QC 3AUZA 2RQLA 1A1IA 3ADLA 3EPLA 2LCEA 2EMXA 1HNZE 1A1LA 4Q35B 5TSEA 1WJPA 2YSPA 1QU6A 4BHBA 2EPUA 3FIGA 2HGHA 4NXNE 4BC9A 1EKZA 1WHQA 2MDRA 4LFAE 3EPKA 3ADGA 2EL4A 2EOSA 1DQ3A 5A69A 4X64E 2LT7A 2M4IA 5A6BA 1DGCA 2WZOA 4P78A 2EN8A 1YPNA 3KZYA 4YHHE 2EWLA 2L3JA 2WBSA 2EQ0A 5KL7A 4GZNC 3C4BA 1IBME 2VQEE 1XNRE 4M2ZA 2EB1A 1X5WA 2EOYA 2FFLA 4JI7E 4TUGA 2UUAE 2JOBA 2YT4A 3ECRA 4K0KE 4LF9E 1MGTA 4BHCA 1A1KA 1UN6B 3F6HA 1DI2A 4LF4E 2MKNA 1BBOA 3BGHA 2EOJA 4BC7A 4DR5E 3H09A 1ZU1A 2EPNA 2ODRD 1TN9A 4ZYEA 1SR9A 1X6FA 2YRKA 2YTOA 4DUZE 2EP3A 1IQOA 4X66E 2UXCE 3ZOQB 3HTXA 2FTXB 3IWCA 4IS1C 1PDAA 4BCAA 5CFFE 4DV0E 1G2DC 5KL6A 1YYKA 5AE3A 4GKJE 2JXPA 2MDGA 1O0WA 2DLKA 1ZAAC 2GPIA 2FGGA 2VRDA 4DV4E 4R2SA 3LLHA 1X6EA 2EQ1A 3VK6A 2V8QB 2BBGA 2V85A 4DR3E 2K7IA 4WPYA 1N36E 1PJQA 4OX9E 1IMUA 3LMLA 4DV5E 5KL3A 4HEIA 5DNYA 1T39A 1BB8A 1YZ9A 1X47A 2LBSB 2UXDE 4LU9A 3JTZA 2V86A 5LMUE 2MKDA 2EPRA 2EOHA 1X48A 2VF1A 2ENCA 3J7AG 3RV0A 5LL6R 2EL6A 2JY9A 1P47A 3DJWA 2HC5A 4I8OA 2EM9A 1IBKE 2EMHA 2E1MA 3TQMA 3C6KA 2EN4A 2CSHA 2EM5A 3N3WA 4JI2E 1X3CA 4LF8E 4JI1E 3QG5C 4MLQA 3J7Yp 4M30A 3BIDA 4MLVA 2PRTA 5BR8E 1T4OA 1JK1A 2N3GA 1RMDA 4JI5E 2EOMA 3IWDA 1N32E 3O2RB 3L00A 3F6GA 2I9IA 2V87A 3RV1A 1X49A 1BBGA 5KL4A 2RPCA 1HNXE 1ZBTA 2YPNA 2V88A 2D9HA 2DGCA 2JWOA 4O24A 4JI8E 2LRSA 1J26A 2I13A 4DMIA 3K6QA 3DF6A 1EH7A 2K4VA 1UHZA 2EMBA 2R76A 2E5LE 2JVAA 2YTJA 2DSYA 1ZR9A 3HPZA 1GTKA 2EMYA 4HTGA 4F9CB 2A11A 4JI3E 5AC5A 2EMZA 4LF7E 2CT1A 5IT9C 1FKAE 2M1SA 3T1YE 2JR1A 4ZYDA 2LE2A 1RC7A 4AQYE 1RC5A 2YTDA 1PJTA 4DR6E 2MC6A 3HQ1A 2EZ6A 4X8WA 1N34E 4B3SE 4R03A 2DB2A 4NXME 3MHSC 4F6MA 2LJUA 4ZYHA 3THNA 1YUIA 1YYWA 1B69A 2UUBE 2L92A 4KHPE 5AC4A 2B7VA 2EPCA 1PKPA 3M99B 2EM8A 3KWRA 3HXLA 3ADJA 3BF2A 2UUCE 5A6KA 2M7QA 1Z1BA 2GSLA 1YFHA 2EMAA 4DV1E 2GHFA 2GLIA 2L33A 2NUFA 3P1XA 2KHXA 2EMIA 1XMQE 5F3WA 3T1HE 1SFEA 3RMPA 1IQSA 3AV0A 2LJHA 2B9DA 2ODRC 1A1GA 2LTRA 2WBTA 2NUEA 3THOB 4X9JA 2DIXA 1UILA 2NUGA 4JI0E 2L8TA 3EPJA 5A6JA 2EOOA 3OMLA 4F6NA 2RSIA 2M9AA 1HR0E 4JI4E 2EPLX 5AASA 2UU9E 4JI6E 5KL2A 1WXRA 2R1FA 1MEYC 2YRMA 3O2RA 2CTDA 3UK3C 2EN6A 4OOGC 1EH6A 1EH8A 1T4NA 1YUJA 4R2EA 2EMWA 4B3RE 4R2PA 4JV5E 4NZVA 5T6JA 2LUQA 1T38A 2ELZA 4DV3E 2EL5A 2YU8A 2YRHA 1UBDC 3VYYA 2EPKX 3OTOE 4DR1E 1NCSA 2EORA 2L6MA 4O43A 4BBYA 2EN2A 2Q8UA 1KYQA 2IHR1 4RHBB 3MHHC 1F2IG 2EMLA 4J8ZA 5IXMB 4WXDA 2KOUA 2EM7A 2YU5A 2MC5A 4ZYGA 2LV2A 2NABA 2HHHE 2WBUA 2EQ3A 2RTXA 1GQEA 3C6MA 2L2MA 4B3TE 4DV2E 3KZZA 1I4SA 2ENHA 4OUNA 1T4LB 1XMOE 2EPZA 1TF6A 2L2NA 4F9BB 5IWAE 4B3ME 2N3HA 2JYAA 4LTYA 1JFZA 4R2DA 4F9AB 4KWYA 4JYAE 2CPNA 5A6AA 2V89A 2F4VE 5AE2A 2DMYA 1NEIA 4Q28A 4YY3E 5IV8B 4WX9A 2RS6A 4X62E 2LO3A 3JAMC 4TUIA 2N8XA 2A25A 2YSOA 1AAYA 4WXCA 3EPHA 2YTEA 3IWBA 2ENAA 2YTQA 2EM4A 2L2KB 1HNWE 3BBGA 2JPAA 2ELYA 4DV7E 4M0VA 4N4RB 2EPOA 4DR2E 4RH8A 4LF6E 2NA2A 2EMCA 1PJSA 2EN3A 3VYXA 4O4KA 2H36X 1KJKA 2EPMX 1U61A 1GZ6A 4WSPA 2BB8A 4F2JC 3HPSA 4O5GA 1N3GA 4DV6E 4WFTA 4GEQB 2JP9A 4P7DA 5ADZA 2V83A 2EOQA 1ZBQA 4GKKE 2EN1A 4R2RA 2EOZA 3MSWA 2DRPA 1A1HA 3JU0A 1TF3A 4R2QA 2YTNA 1IBLE 2EM6A 1I94E 1A1FA 2F8BA 2YTIA 4LFBE 4L8NA 2LMZA 4IJDA 2UXBE 1YYOA 2ADRA 2KONA 3J80C 1N33E 4R2CA 2EMFA 2RS7A 2LVHA 1X6HA 4FK5C 5KL5A 2DMIA 5FLXC 4L5NC 2EM3A 2G7HA 2EOEA 2ZM6E 2EOXA 3VHTB 2EOFA 1WHNA 2EPXA 4R8OA
chains in the Genus database with same CATH topology
2RTXA 1GQEA 4F9CB 2A11A 1J5EE 2L2MA 4B3TE 4DV2E 4JI3E 1I4SA 4BC7A 4OUNA 4DKKA 2FV4B 4DR5E 1XMOE 3H09A 1T4LB 4LF7E 2JOXA 2ODRD 5IT9C 2L2NA 4KZSA 4F9BB 5IWAE 2N3HA 2M1SA 1FKAE 4B3ME 3T1YE 4LTYA 2JR1A 1SR9A 2B3TB 1JFZA 1FJGE 2LE2A 1XNQE 1RC7A 4DUZE 4AQYE 1RC5A 4F9AB 2QVWA 2MC6A 3HQ1A 4X66E 2EZ6A 4X8WA 4DR6E 3C4TA 2CPNA 1N34E 3ZOQB 2UXCE 4B3SE 2FTXB 4R03A 3IWCA 4X65E 2V89A 3HTXA 2LUPB 2F4VE 1STUA 2VQFE 2DB2A 4LF5E 2UXBE 4BCAA 5AE2A 2DMYA 4NXME 4Q28A 4YY3E 4X62E 2RS6A 3JAMC 5CFFE 4DV0E 3J81C 4TUIA 4BMJA 4DUYE 1YYKA 2B7TA 1YYWA 5AE3A 4GKJE 4LFCE 2UUBE 2L92A 4KHPE 1O0WA 2B7VA 1RQ0A 2RSMA 1PKPA 3KWRA 3HXLA 4DR4E 2FGGA 5LMNE 3ADJA 3IWBA 4DV4E 2UUCE 2VE7C 2L2KB 3LLHA 2M7QA 1HNWE 2GSLA 4DV1E 4DV7E 4M0VA 3VK6A 2L33A 2NUFA 2V8QB 4DR2E 5AE1A 2LTSA 2V85A 4DR3E 4LF6E 3P1XA 2KHXA 4BS9A 4WPYA 2YZTA 1N36E 2NA2A 4F54A 1XMQE 5F3WA 4OX9E 3T1HE 3LMLA 3VYXA 4DV5E 3RMPA 3AV0A 5DNYA 2LJHA 2B9DA 2ODRC 2H36X 2LTRA 1YZ9A 1X47A 2LBSB 4JYAE 4LU9A 1U61A 2NUEA 3JTZA 1GZ6A 2V86A 5LMUE 3ADIA 4WSPA 1X48A 4WYQB 2VF1A 2DIXA 3HPSA 3J7AG 4DR7E 2L3CA 5A2QC 1UILA 3RV0A 3AUZA 3ADLA 2NUGA 2JY9A 2L8TA 5LL6R 4JI0E 4DV6E 3DJWA 4WFTA 3OMLA 4GEQB 4P7DA 4I8OA 5ADZA 2V83A 1HNZE 1HR0E 4JI4E 5AASA 1IBKE 2UU9E 1QU6A 4JI6E 3FIGA 1ZBQA 1WXRA 4GKKE 4NXNE 3O2RA 2E1MA 4BC9A 2UXDE 1EKZA 3MSWA 4OOGC 1WHQA 3N3WA 4JI2E 4LF8E 2MDRA 1T4NA 4JI1E 3ADGA 4LFAE 3JU0A 3J7Yp 1DQ3A 4M30A 4X64E 4B3RE 5BR8E 1T4OA 2M4IA 2N3GA 2WZOA 4P78A 1IBLE 4JI5E 1I94E 2F8BA 3IWDA 1N32E 4LFBE 4L8NA 2LMZA 5T6JA 2LUQA 4JV5E 4YHHE 3O2RB 1YYOA 2EWLA 2KONA 4DV3E 2V87A 3F6GA 3J80C 2L3JA 3RV1A 1N33E 3C4BA 1X49A 3VYYA 3OTOE 2VQEE 1IBME 1XNRE 4DR1E 1HNXE 1ZBTA 4M2ZA 2L6MA 2V88A 2RS7A 4BBYA 2EB1A 2IHR1 2JWOA 4JI8E 1J26A 2FFLA 2LRSA 4JI7E 5FLXC 4TUGA 2UUAE 4J8ZA 2JOBA 2YT4A 2KOUA 4L5NC 2MC5A 4DMIA 3K6QA 3DF6A 4K0KE 4LF9E 2K4VA 2HHHE 1UHZA 2G7HA 2ZM6E 2E5LE 4LF4E 2JVAA 1WHNA 2DSYA 3F6HA 1DI2A 4R8OA 3HPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RTX A;  1GQE A;  2A11 A;  1J5E E;  2L2M A;  4B3T E;  4DV2 E;  4JI3 E;  1I4S A;  4OUN A;  4DKK A;  4DR5 E;  1T4L B;  1XMO E;  4LF7 E;  2L2N A;  4B3M E;  5IWA E;  2N3H A;  1FKA E;  3T1Y E;  2B3T B;  1JFZ A;  1FJG E;  1XNQ E;  1RC7 A;  4DUZ E;  4AQY E;  1RC5 A;  2QVW A;  4X66 E;  4DR6 E;  4JYA E;  2EZ6 A;  4X8W A;  2UXC E;  3C4T A;  2CPN A;  1N34 E;  4B3S E;  3HTX A;  4X65 E;  2LUP B;  2F4V E;  1STU A;  2VQF E;  2DB2 A;  4LF5 E;  2DMY A;  4NXM E;  4X62 E;  4YY3 E;  2RS6 A;  5CFF E;  4DV0 E;  4DUY E;  1YYK A;  2B7T A;  1YYW A;  4GKJ E;  4LFC E;  2UUB E;  4KHP E;  1O0W A;  2B7V A;  1RQ0 A;  2RSM A;  1PKP A;  4DR4 E;  5LMN E;  3ADJ A;  4DV4 E;  2UUC E;  2L2K B;  3LLH A;  1HNW E;  2GSL A;  4DV1 E;  4DV7 E;  2L33 A;  2NUF A;  4DR2 E;  2LTS A;  4DR3 E;  4LF6 E;  3P1X A;  2KHX A;  1N36 E;  2NA2 A;  1XMQ E;  4OX9 E;  3T1H E;  3VYX A;  4DV5 E;  2LJH A;  2LTR A;  1YZ9 A;  1X47 A;  2LBS B;  2UXD E;  1U61 A;  2NUE A;  5LMU E;  3ADI A;  1X48 A;  4WYQ B;  2DIX A;  4DR7 E;  2L3C A;  1UIL A;  3RV0 A;  3ADL A;  2NUG A;  2JY9 A;  4JI0 E;  4DV6 E;  4WFT A;  1HNZ E;  1HR0 E;  4JI4 E;  1IBK E;  2UU9 E;  4JI6 E;  1QU6 A;  4GKK E;  4NXN E;  3O2R A;  1EKZ A;  4OOG C;  1WHQ A;  3N3W A;  4JI2 E;  4LF8 E;  2MDR A;  1T4N A;  4JI1 E;  3ADG A;  4LFA E;  3J7Y p;  4M30 A;  4X64 E;  4B3R E;  5BR8 E;  1T4O A;  2N3G A;  1IBL E;  4JI5 E;  1I94 E;  4JV5 E;  1N32 E;  4LFB E;  2LUQ A;  4YHH E;  3O2R B;  1YYO A;  4DV3 E;  2UXB E;  2L3J A;  3RV1 A;  1N33 E;  3C4B A;  1X49 A;  3VYY A;  3OTO E;  2VQE E;  1IBM E;  1XNR E;  4DR1 E;  1HNX E;  1ZBT A;  4M2Z A;  2RS7 A;  2EB1 A;  2IHR 1;  4JI8 E;  1J26 A;  2FFL A;  2LRS A;  4JI7 E;  2UUA E;  2YT4 A;  4K0K E;  4LF9 E;  2HHH E;  1UHZ A;  2ZM6 E;  2E5L E;  2JVA A;  1WHN A;  1DI2 A;  4LF4 E; 
#chains in the Genus database with same CATH topology
 2E72 A;  1J5E E;  2EOI A;  5A6B D;  2HJJ A;  2YTP A;  4DKK A;  2FV4 B;  2JOX A;  4KZS A;  3EQ1 A;  2B3T B;  1FJG E;  1XNQ E;  1AH5 A;  2DLQ A;  4M9V C;  2QVW A;  2J7J A;  3C4T A;  4X65 E;  2LUP B;  1STU A;  2VQF E;  2EM2 A;  4LF5 E;  2EM0 A;  2EPP A;  1YSA C;  3J81 C;  4BMJ A;  4DUY E;  1G2F C;  2EPA A;  2B7T A;  5LLQ A;  4LFC E;  2RSM A;  1RQ0 A;  4DR4 E;  5LMN E;  2YWQ A;  2VE7 C;  4WSG A;  2WCC 3;  1LLM C;  2YTG A;  2EJ4 A;  1A1J A;  5AE1 A;  2LTS A;  4BS9 A;  2YZT A;  1JK2 A;  2EE8 A;  4F54 A;  2EMG A;  1L4S A;  1ZTD A;  4R2A A;  2EN7 A;  3ADI A;  2YTF A;  4NHR A;  1WRJ A;  4WYQ B;  1QNT A;  4DR7 E;  2L3C A;  2EMK A;  5A2Q C;  3AUZ A;  2RQL A;  1A1I A;  3ADL A;  3EPL A;  2LCE A;  2EMX A;  1HNZ E;  1A1L A;  4Q35 B;  5TSE A;  1WJP A;  2YSP A;  1QU6 A;  4BHB A;  2EPU A;  3FIG A;  2HGH A;  4NXN E;  4BC9 A;  1EKZ A;  1WHQ A;  2MDR A;  4LFA E;  3EPK A;  3ADG A;  2EL4 A;  2EOS A;  1DQ3 A;  5A69 A;  4X64 E;  2LT7 A;  2M4I A;  5A6B A;  1DGC A;  2WZO A;  4P78 A;  2EN8 A;  1YPN A;  3KZY A;  4YHH E;  2EWL A;  2L3J A;  2WBS A;  2EQ0 A;  5KL7 A;  4GZN C;  3C4B A;  1IBM E;  2VQE E;  1XNR E;  4M2Z A;  2EB1 A;  1X5W A;  2EOY A;  2FFL A;  4JI7 E;  4TUG A;  2UUA E;  2JOB A;  2YT4 A;  3ECR A;  4K0K E;  4LF9 E;  1MGT A;  4BHC A;  1A1K A;  1UN6 B;  3F6H A;  1DI2 A;  4LF4 E;  2MKN A;  1BBO A;  3BGH A;  2EOJ A;  4BC7 A;  4DR5 E;  3H09 A;  1ZU1 A;  2EPN A;  2ODR D;  1TN9 A;  4ZYE A;  1SR9 A;  1X6F A;  2YRK A;  2YTO A;  4DUZ E;  2EP3 A;  1IQO A;  4X66 E;  2UXC E;  3ZOQ B;  3HTX A;  2FTX B;  3IWC A;  4IS1 C;  1PDA A;  4BCA A;  5CFF E;  4DV0 E;  1G2D C;  5KL6 A;  1YYK A;  5AE3 A;  4GKJ E;  2JXP A;  2MDG A;  1O0W A;  2DLK A;  1ZAA C;  2GPI A;  2FGG A;  2VRD A;  4DV4 E;  4R2S A;  3LLH A;  1X6E A;  2EQ1 A;  3VK6 A;  2V8Q B;  2BBG A;  2V85 A;  4DR3 E;  2K7I A;  4WPY A;  1N36 E;  1PJQ A;  4OX9 E;  1IMU A;  3LML A;  4DV5 E;  5KL3 A;  4HEI A;  5DNY A;  1T39 A;  1BB8 A;  1YZ9 A;  1X47 A;  2LBS B;  2UXD E;  4LU9 A;  3JTZ A;  2V86 A;  5LMU E;  2MKD A;  2EPR A;  2EOH A;  1X48 A;  2VF1 A;  2ENC A;  3J7A G;  3RV0 A;  5LL6 R;  2EL6 A;  2JY9 A;  1P47 A;  3DJW A;  2HC5 A;  4I8O A;  2EM9 A;  1IBK E;  2EMH A;  2E1M A;  3TQM A;  3C6K A;  2EN4 A;  2CSH A;  2EM5 A;  3N3W A;  4JI2 E;  1X3C A;  4LF8 E;  4JI1 E;  3QG5 C;  4MLQ A;  3J7Y p;  4M30 A;  3BID A;  4MLV A;  2PRT A;  5BR8 E;  1T4O A;  1JK1 A;  2N3G A;  1RMD A;  4JI5 E;  2EOM A;  3IWD A;  1N32 E;  3O2R B;  3L00 A;  3F6G A;  2I9I A;  2V87 A;  3RV1 A;  1X49 A;  1BBG A;  5KL4 A;  2RPC A;  1HNX E;  1ZBT A;  2YPN A;  2V88 A;  2D9H A;  2DGC A;  2JWO A;  4O24 A;  4JI8 E;  2LRS A;  1J26 A;  2I13 A;  4DMI A;  3K6Q A;  3DF6 A;  1EH7 A;  2K4V A;  1UHZ A;  2EMB A;  2R76 A;  2E5L E;  2JVA A;  2YTJ A;  2DSY A;  1ZR9 A;  3HPZ A;  1GTK A;  2EMY A;  4HTG A;  4F9C B;  2A11 A;  4JI3 E;  5AC5 A;  2EMZ A;  4LF7 E;  2CT1 A;  5IT9 C;  1FKA E;  2M1S A;  3T1Y E;  2JR1 A;  4ZYD A;  2LE2 A;  1RC7 A;  4AQY E;  1RC5 A;  2YTD A;  1PJT A;  4DR6 E;  2MC6 A;  3HQ1 A;  2EZ6 A;  4X8W A;  1N34 E;  4B3S E;  4R03 A;  2DB2 A;  4NXM E;  3MHS C;  4F6M A;  2LJU A;  4ZYH A;  3THN A;  1YUI A;  1YYW A;  1B69 A;  2UUB E;  2L92 A;  4KHP E;  5AC4 A;  2B7V A;  2EPC A;  1PKP A;  3M99 B;  2EM8 A;  3KWR A;  3HXL A;  3ADJ A;  3BF2 A;  2UUC E;  5A6K A;  2M7Q A;  1Z1B A;  2GSL A;  1YFH A;  2EMA A;  4DV1 E;  2GHF A;  2GLI A;  2L33 A;  2NUF A;  3P1X A;  2KHX A;  2EMI A;  1XMQ E;  5F3W A;  3T1H E;  1SFE A;  3RMP A;  1IQS A;  3AV0 A;  2LJH A;  2B9D A;  2ODR C;  1A1G A;  2LTR A;  2WBT A;  2NUE A;  3THO B;  4X9J A;  2DIX A;  1UIL A;  2NUG A;  4JI0 E;  2L8T A;  3EPJ A;  5A6J A;  2EOO A;  3OML A;  4F6N A;  2RSI A;  2M9A A;  1HR0 E;  4JI4 E;  2EPL X;  5AAS A;  2UU9 E;  4JI6 E;  5KL2 A;  1WXR A;  2R1F A;  1MEY C;  2YRM A;  3O2R A;  2CTD A;  3UK3 C;  2EN6 A;  4OOG C;  1EH6 A;  1EH8 A;  1T4N A;  1YUJ A;  4R2E A;  2EMW A;  4B3R E;  4R2P A;  4JV5 E;  4NZV A;  5T6J A;  2LUQ A;  1T38 A;  2ELZ A;  4DV3 E;  2EL5 A;  2YU8 A;  2YRH A;  1UBD C;  3VYY A;  2EPK X;  3OTO E;  4DR1 E;  1NCS A;  2EOR A;  2L6M A;  4O43 A;  4BBY A;  2EN2 A;  2Q8U A;  1KYQ A;  2IHR 1;  4RHB B;  3MHH C;  1F2I G;  2EML A;  4J8Z A;  5IXM B;  4WXD A;  2KOU A;  2EM7 A;  2YU5 A;  2MC5 A;  4ZYG A;  2LV2 A;  2NAB A;  2HHH E;  2WBU A;  2EQ3 A;  2RTX A;  1GQE A;  3C6M A;  2L2M A;  4B3T E;  4DV2 E;  3KZZ A;  1I4S A;  2ENH A;  4OUN A;  1T4L B;  1XMO E;  2EPZ A;  1TF6 A;  2L2N A;  4F9B B;  5IWA E;  4B3M E;  2N3H A;  2JYA A;  4LTY A;  1JFZ A;  4R2D A;  4F9A B;  4KWY A;  4JYA E;  2CPN A;  5A6A A;  2V89 A;  2F4V E;  5AE2 A;  2DMY A;  1NEI A;  4Q28 A;  4YY3 E;  5IV8 B;  4WX9 A;  2RS6 A;  4X62 E;  2LO3 A;  3JAM C;  4TUI A;  2N8X A;  2A25 A;  2YSO A;  1AAY A;  4WXC A;  3EPH A;  2YTE A;  3IWB A;  2ENA A;  2YTQ A;  2EM4 A;  2L2K B;  1HNW E;  3BBG A;  2JPA A;  2ELY A;  4DV7 E;  4M0V A;  4N4R B;  2EPO A;  4DR2 E;  4RH8 A;  4LF6 E;  2NA2 A;  2EMC A;  1PJS A;  2EN3 A;  3VYX A;  4O4K A;  2H36 X;  1KJK A;  2EPM X;  1U61 A;  1GZ6 A;  4WSP A;  2BB8 A;  4F2J C;  3HPS A;  4O5G A;  1N3G A;  4DV6 E;  4WFT A;  4GEQ B;  2JP9 A;  4P7D A;  5ADZ A;  2V83 A;  2EOQ A;  1ZBQ A;  4GKK E;  2EN1 A;  4R2R A;  2EOZ A;  3MSW A;  2DRP A;  1A1H A;  3JU0 A;  1TF3 A;  4R2Q A;  2YTN A;  1IBL E;  2EM6 A;  1I94 E;  1A1F A;  2F8B A;  2YTI A;  4LFB E;  4L8N A;  2LMZ A;  4IJD A;  2UXB E;  1YYO A;  2ADR A;  2KON A;  3J80 C;  1N33 E;  4R2C A;  2EMF A;  2RS7 A;  2LVH A;  1X6H A;  4FK5 C;  5KL5 A;  2DMI A;  5FLX C;  4L5N C;  2EM3 A;  2G7H A;  2EOE A;  2ZM6 E;  2EOX A;  3VHT B;  2EOF A;  1WHN A;  2EPX A;  4R8O A; 
#chains in the Genus database with same CATH homology
 2RTX A;  1GQE A;  4F9C B;  2A11 A;  1J5E E;  2L2M A;  4B3T E;  4DV2 E;  4JI3 E;  1I4S A;  4BC7 A;  4OUN A;  4DKK A;  2FV4 B;  4DR5 E;  1XMO E;  3H09 A;  1T4L B;  4LF7 E;  2JOX A;  2ODR D;  5IT9 C;  2L2N A;  4KZS A;  4F9B B;  5IWA E;  2N3H A;  2M1S A;  1FKA E;  4B3M E;  3T1Y E;  4LTY A;  2JR1 A;  1SR9 A;  2B3T B;  1JFZ A;  1FJG E;  2LE2 A;  1XNQ E;  1RC7 A;  4DUZ E;  4AQY E;  1RC5 A;  4F9A B;  2QVW A;  2MC6 A;  3HQ1 A;  4X66 E;  2EZ6 A;  4X8W A;  4DR6 E;  3C4T A;  2CPN A;  1N34 E;  3ZOQ B;  2UXC E;  4B3S E;  2FTX B;  4R03 A;  3IWC A;  4X65 E;  2V89 A;  3HTX A;  2LUP B;  2F4V E;  1STU A;  2VQF E;  2DB2 A;  4LF5 E;  2UXB E;  4BCA A;  5AE2 A;  2DMY A;  4NXM E;  4Q28 A;  4YY3 E;  4X62 E;  2RS6 A;  3JAM C;  5CFF E;  4DV0 E;  3J81 C;  4TUI A;  4BMJ A;  4DUY E;  1YYK A;  2B7T A;  1YYW A;  5AE3 A;  4GKJ E;  4LFC E;  2UUB E;  2L92 A;  4KHP E;  1O0W A;  2B7V A;  1RQ0 A;  2RSM A;  1PKP A;  3KWR A;  3HXL A;  4DR4 E;  2FGG A;  5LMN E;  3ADJ A;  3IWB A;  4DV4 E;  2UUC E;  2VE7 C;  2L2K B;  3LLH A;  2M7Q A;  1HNW E;  2GSL A;  4DV1 E;  4DV7 E;  4M0V A;  3VK6 A;  2L33 A;  2NUF A;  2V8Q B;  4DR2 E;  5AE1 A;  2LTS A;  2V85 A;  4DR3 E;  4LF6 E;  3P1X A;  2KHX A;  4BS9 A;  4WPY A;  2YZT A;  1N36 E;  2NA2 A;  4F54 A;  1XMQ E;  5F3W A;  4OX9 E;  3T1H E;  3LML A;  3VYX A;  4DV5 E;  3RMP A;  3AV0 A;  5DNY A;  2LJH A;  2B9D A;  2ODR C;  2H36 X;  2LTR A;  1YZ9 A;  1X47 A;  2LBS B;  4JYA E;  4LU9 A;  1U61 A;  2NUE A;  3JTZ A;  1GZ6 A;  2V86 A;  5LMU E;  3ADI A;  4WSP A;  1X48 A;  4WYQ B;  2VF1 A;  2DIX A;  3HPS A;  3J7A G;  4DR7 E;  2L3C A;  5A2Q C;  1UIL A;  3RV0 A;  3AUZ A;  3ADL A;  2NUG A;  2JY9 A;  2L8T A;  5LL6 R;  4JI0 E;  4DV6 E;  3DJW A;  4WFT A;  3OML A;  4GEQ B;  4P7D A;  4I8O A;  5ADZ A;  2V83 A;  1HNZ E;  1HR0 E;  4JI4 E;  5AAS A;  1IBK E;  2UU9 E;  1QU6 A;  4JI6 E;  3FIG A;  1ZBQ A;  1WXR A;  4GKK E;  4NXN E;  3O2R A;  2E1M A;  4BC9 A;  2UXD E;  1EKZ A;  3MSW A;  4OOG C;  1WHQ A;  3N3W A;  4JI2 E;  4LF8 E;  2MDR A;  1T4N A;  4JI1 E;  3ADG A;  4LFA E;  3JU0 A;  3J7Y p;  1DQ3 A;  4M30 A;  4X64 E;  4B3R E;  5BR8 E;  1T4O A;  2M4I A;  2N3G A;  2WZO A;  4P78 A;  1IBL E;  4JI5 E;  1I94 E;  2F8B A;  3IWD A;  1N32 E;  4LFB E;  4L8N A;  2LMZ A;  5T6J A;  2LUQ A;  4JV5 E;  4YHH E;  3O2R B;  1YYO A;  2EWL A;  2KON A;  4DV3 E;  2V87 A;  3F6G A;  3J80 C;  2L3J A;  3RV1 A;  1N33 E;  3C4B A;  1X49 A;  3VYY A;  3OTO E;  2VQE E;  1IBM E;  1XNR E;  4DR1 E;  1HNX E;  1ZBT A;  4M2Z A;  2L6M A;  2V88 A;  2RS7 A;  4BBY A;  2EB1 A;  2IHR 1;  2JWO A;  4JI8 E;  1J26 A;  2FFL A;  2LRS A;  4JI7 E;  5FLX C;  4TUG A;  2UUA E;  4J8Z A;  2JOB A;  2YT4 A;  2KOU A;  4L5N C;  2MC5 A;  4DMI A;  3K6Q A;  3DF6 A;  4K0K E;  4LF9 E;  2K4V A;  2HHH E;  1UHZ A;  2G7H A;  2ZM6 E;  2E5L E;  4LF4 E;  2JVA A;  1WHN A;  2DSY A;  3F6H A;  1DI2 A;  4R8O A;  3HPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...