4M2ZA

Crystal structure of rnase iii complexed with double-stranded rna and cmp (type ii cleavage)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
220
structure length
220
Chain Sequence
KMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Ribonuclease 3
publication title RNase III: Genetics and Function; Structure and Mechanism.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 71
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 4m2zA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4m2zA02
4X64E 3C4BA 4OUNA 2CPNA 4JI0E 4LF6E 4DV5E 2YT4A 3ADGA 2F4VE 2L33A 3J7Yp 4GKKE 4B3ME 3O2RA 4OOGC 2UXDE 1J5EE 4DUZE 3LLHA 4X66E 1HNWE 2RTXA 2EZ6A 2L2NA 2L2MA 4X62E 4B3TE 1XNQE 2E5LE 2UXCE 2ZM6E 2LUQA 2N3GA 1HNZE 2FFLA 3ADLA 1UHZA 5LMNE 1N32E 4DR5E 3N3WA 4JI4E 1PKPA 1ZBTA 4M30A 1I4SA 2NUGA 2LRSA 2RS7A 4NXME 2N3HA 2LTRA 2RSMA 1X49A 2A11A 3VYXA 1RC7A 1X47A 1T4NA 4LF5E 4JYAE 3RV0A 3O2RB 4DKKA 2NA2A 4B3SE 4DV4E 1XMOE 1RQ0A 5LMUE 1XMQE 4WFTA 1YYOA 2UXBE 2L2KB 1GQEA 3ADJA 3RV1A 4JI5E 1JFZA 4K0KE 2DIXA 1QU6A 4DV6E 4LF7E 1WHNA 4YHHE 2LJHA 3T1HE 2DB2A 2NUEA 4X65E 1FJGE 2L3CA 4LFBE 2EB1A 2UUBE 2RS6A 1T4LB 1XNRE 2NUFA 4JI2E 4DV7E 2JVAA 2MDRA 1N34E 2B7TA 2LUPB 2LBSB 2UU9E 1IBME 4LF4E 1IBLE 1WHQA 5IWAE 4DR4E 1O0WA 2B3TB 4JI7E 1YYKA 1X48A 1RC5A 5CFFE 4OX9E 1EKZA 4KHPE 1N33E 4DR6E 1HNXE 3VYYA 4DR2E 1FKAE 4DR3E 4JI8E 3T1YE 3C4TA 3HTXA 2VQEE 4DV2E 1U61A 2QVWA 1UILA 4LF8E 2LTSA 5BR8E 4DR1E 3ADIA 4DV0E 2UUCE 4WYQB 1I94E 2B7VA 4M2ZA 4YY3E 2DMYA 1HR0E 1DI2A 2VQFE 3P1XA 4JI3E 4DR7E 2KHXA 1J26A 4DUYE 1IBKE 4LFCE 1N36E 2GSLA 4DV3E 4JI1E 4NXNE 1T4OA 2UUAE 4LFAE 4DV1E 4GKJE 2IHR1 1STUA 4B3RE 2JY9A 1YYWA 1YZ9A 2L3JA 4X8WA 4AQYE 2HHHE 4JI6E 3OTOE 4LF9E 4JV5E
chains in the Genus database with same CATH superfamily
2NABA 4X64E 4OUNA 4MLQA 4DV5E 1PJTA 3C6MA 4R2AA 4F6NA 2MKNA 3IWCA 2L33A 2YPNA 3LMLA 4OOGC 4DUZE 4X66E 2E5LE 5AC4A 2FFLA 5KL3A 3H09A 4R2EA 4M0VA 3VK6A 1B69A 2K7IA 1A1IA 2HC5A 2HJJA 2LRSA 1A1JA 2N3HA 2LTRA 3HPSA 1X47A 1Z1BA 2EMKA 5A6BA 4ZYDA 2MC5A 3O2RB 4DKKA 3F6GA 3THNA 1YPNA 4DV4E 1A1HA 2RQLA 4X9JA 2DLQA 2M1SA 4WFTA 2G7HA 3HXLA 2EM5A 2YTPA 5A6KA 4JI5E 2EM2A 1QU6A 4DV6E 4LF7E 3IWDA 2DB2A 1X6FA 2UUBE 2NUFA 4JI2E 2EPCA 2WBSA 4DV7E 2JVAA 2EOZA 1N34E 2B7TA 2EPMX 3MHHC 2R76A 2EOYA 4LF4E 1IBLE 1YSAC 1ZAAC 1WHQA 5IWAE 2EMFA 1EH7A 4JI7E 1YYKA 2EPAA 2CT1A 4OX9E 4BMJA 4DR6E 2V8QB 2EOQA 2ODRC 2YTNA 3JU0A 2VQEE 4BS9A 3FIGA 2QVWA 4LF8E 3F6HA 2UUCE 1DQ3A 1YUIA 2RPCA 2ODRD 1ZTDA 4KZSA 1SFEA 2MC6A 5AASA 3P1XA 3BIDA 2EMGA 4O24A 4DUYE 2LT7A 1IBKE 4LFCE 4BC9A 1A1FA 2JOBA 2GSLA 4BBYA 2EOEA 2YTQA 1DGCA 4NXNE 2EM4A 2IHR1 1ZBQA 2EMAA 2EPRA 4HEIA 4NHRA 2EM6A 4AQYE 4L8NA 3OTOE 2MDGA 5AE1A 4F9AB 2V85A 2EPZA 2EOJA 1P47A 4F2JC 2EL6A 3ADGA 3J7Yp 3DF6A 3O2RA 2UXDE 2EMLA 1EH6A 5LL6R 2EZ6A 2L2MA 4B3TE 2ELZA 2EMBA 1UHZA 4R2RA 1N32E 2JOXA 2ENHA 2Q8UA 4JI4E 3EPKA 1KYQA 1ZBTA 2A25A 2YTOA 2NUGA 3EPJA 4Q28A 3THOB 4NXME 1X49A 2A11A 1WRJA 2JP9A 3M99B 1RC7A 5KL6A 2D9HA 3TQMA 1T4NA 4P78A 4LF5E 3J7AG 4JYAE 2NA2A 4B3SE 2GPIA 4JV5E 2VF1A 2N8XA 2K4VA 4KWYA 4R2DA 1XMQE 2LVHA 4BC7A 2YTFA 2L2KB 3ADJA 3RV1A 2M7QA 4O5GA 1WHNA 3T1HE 2LJHA 4WPYA 4X65E 2FTXB 1SR9A 4LFBE 2EB1A 1T4LB 2ADRA 3C6KA 2EN8A 2MDRA 1IQOA 2H36X 2E72A 2EPNA 1UBDC 1N3GA 1O0WA 2EM3A 2YRMA 3KZYA 4WX9A 2KOUA 4KHPE 1N33E 2EMIA 3IWBA 3VYYA 4DR2E 4DR3E 2ENCA 4JI8E 3C4TA 2EOIA 2EPLX 4DV2E 2EPXA 2RSIA 2EL5A 4RH8A 2EWLA 4R2PA 3J81C 2EMWA 2EN7A 2EN6A 4DR7E 2KHXA 2EOMA 1J26A 5KL7A 2JYAA 2EMCA 2VE7C 4JI1E 1AH5A 1X6HA 1MEYC 2LV2A 2LJUA 2V88A 2V87A 4Q35B 2KONA 1YYWA 1YZ9A 3MSWA 4X8WA 2HHHE 2GHFA 2EOFA 4GZNC 1ZU1A 3C4BA 3KWRA 5F3WA 4JI0E 5AE3A 2YT4A 5A6BD 1PDAA 2F4VE 4ZYGA 5AC5A 4B3ME 4NZVA 4R2SA 3QG5C 4HTGA 3LLHA 5A6JA 4X62E 1XNQE 2EN1A 2L92A 2N3GA 3ADLA 3J80C 3N3WA 1G2DC 2DSYA 4TUGA 4F9BB 2EN4A 4DMIA 1A1GA 4WXCA 1GTKA 2RS7A 5AE2A 1PJQA 2EOHA 2RSMA 4R03A 3VYXA 1IQSA 1RMDA 2YTEA 2CTDA 2EPOA 2EN3A 2YTDA 1BBGA 1A1KA 2L6MA 2JPAA 3BBGA 2J7JA 2YSOA 4P7DA 2DRPA 2DLKA 1PJSA 2PRTA 1QNTA 2UXBE 1GQEA 3BF2A 2DIXA 4YHHE 2NUEA 2EP3A 2L3CA 2EM7A 2RS6A 1XNRE 1YUJA 2EOXA 2YTJA 2YRKA 3DJWA 4MLVA 2LUPB 2EPPA 2UU9E 1IBME 2F8BA 1YFHA 2R1FA 2BBGA 2B3TB 5IV8B 2DMIA 2WBTA 1EKZA 4IJDA 2EM9A 3OMLA 1NCSA 1FKAE 2ELYA 3T1YE 3EPHA 1U61A 1UILA 5BR8E 1X6EA 5DNYA 3MHSC 1TN9A 2YTIA 4DR1E 2DGCA 4ZYHA 4WYQB 4M2ZA 2DMYA 2BB8A 5TSEA 5KL4A 3JAMC 1GZ6A 5FLXC 1LLMC 2V86A 4WSPA 2UUAE 2M9AA 4LFAE 4DV1E 5KL5A 4B3RE 2JY9A 5A2QC 2EN2A 4F9CB 1UN6B 2EM8A 3AUZA 3AV0A 2L3JA 4JI6E 2YRHA 2VRDA 2JXPA 5A6AA 1WXRA 2CPNA 2YTGA 4LF6E 1BBOA 4GEQB 2I13A 4I8OA 4GKKE 3EPLA 2YU5A 2YWQA 2M4IA 5LLQA 1MGTA 2YSPA 1G2FC 1J5EE 4F54A 1HNWE 2RTXA 1JK2A 2L2NA 1AAYA 2EMHA 3KZZA 2ZM6E 2UXCE 4IS1C 2LUQA 1HNZE 2JWOA 2E1MA 5LMNE 4DR5E 5T6JA 1WJPA 1PKPA 4M9VC 2EORA 1IMUA 4M30A 1I4SA 1ZR9A 1T39A 2L8TA 4R2CA 1T38A 4F6MA 2EMXA 2EQ0A 3RV0A 4R8OA 3RMPA 2EPKX 1XMOE 4WSGA 4BCAA 4N4RB 1NEIA 1RQ0A 5LMUE 4LU9A 2JR1A 3BGHA 1YYOA 1JFZA 4K0KE 1BB8A 3K6QA 1A1LA 1TF6A 2YZTA 1FJGE 3VHTB 3HPZA 5ADZA 2EOOA 2HGHA 5IT9C 1L4SA 2EMYA 2CSHA 5IXMB 2LBSB 2EL4A 2FV4B 4L5NC 1EH8A 2YU8A 4DR4E 2EM0A 4LTYA 2LMZA 2WBUA 1X48A 2EJ4A 1RC5A 2FGGA 2LCEA 5CFFE 4ZYEA 1HNXE 2EOSA 5A69A 4WXDA 2LO3A 3HTXA 2WZOA 1X5WA 4J8ZA 1X3CA 3L00A 2LTSA 4FK5C 2LE2A 3ADIA 3ZOQB 4DV0E 2EQ1A 1I94E 5KL2A 2B7VA 4TUIA 2WCC3 2B9DA 2EE8A 4YY3E 3EQ1A 1HR0E 1DI2A 3JTZA 2VQFE 4JI3E 1F2IG 2I9IA 1TF3A 2ENAA 1N36E 4DV3E 4O4KA 1T4OA 2EMZA 2MKDA 4RHBB 4BHCA 3ECRA 4GKJE 1STUA 4BHBA 1JK1A 4O43A 2EQ3A 2GLIA 3HQ1A 1KJKA 3UK3C 2V83A 2V89A 4LF9E 2EPUA 4R2QA
chains in the Genus database with same CATH topology
1WXRA 4X64E 5AE1A 4F9AB 3C4BA 4OUNA 2CPNA 3KWRA 5F3WA 4JI0E 2V85A 5AE3A 4LF6E 4DV5E 2YT4A 4GEQB 3IWCA 3ADGA 2F4VE 2L33A 3J7Yp 3DF6A 4I8OA 4GKKE 4B3ME 3O2RA 2M4IA 3LMLA 4OOGC 4YHHE 2UXDE 1J5EE 4DUZE 3LLHA 4F54A 4X66E 1HNWE 2RTXA 2EZ6A 5LL6R 2L2NA 2L2MA 4X62E 4B3TE 1XNQE 2E5LE 2UXCE 2ZM6E 2LUQA 2L92A 2N3GA 1HNZE 2JWOA 2FFLA 2E1MA 3ADLA 1UHZA 3J80C 5LMNE 1N32E 2JOXA 4DR5E 3N3WA 3H09A 4M0VA 5T6JA 3VK6A 2DSYA 4TUGA 4F9BB 4JI4E 1PKPA 1ZBTA 4DMIA 4M30A 1I4SA 2NUGA 2LRSA 4Q28A 2RS7A 5AE2A 4NXME 2N3HA 2LTRA 2RSMA 1X49A 3HPSA 2A11A 4R03A 3VYXA 2L8TA 1RC7A 1X47A 1T4NA 4P78A 4LF5E 3J7AG 2MC5A 4JYAE 3RV0A 3O2RB 2L6MA 3F6GA 2NA2A 4R8OA 4DKKA 4DV4E 3RMPA 4B3SE 1XMOE 2VF1A 4P7DA 4BCAA 1RQ0A 2K4VA 5LMUE 4LU9A 1XMQE 2JR1A 2M1SA 4WFTA 2G7HA 3HXLA 1YYOA 4BC7A 2UXBE 2L2KB 1GQEA 3ADJA 3RV1A 4JI5E 2M7QA 1JFZA 4K0KE 2DIXA 1QU6A 3K6QA 4DV6E 4LF7E 1WHNA 3IWDA 2LJHA 4WPYA 2DB2A 2NUEA 2YZTA 2FTXB 4X65E 1SR9A 2L3CA 1FJGE 2EB1A 4LFBE 2UUBE 2RS6A 3HPZA 5ADZA 1T4LB 1XNRE 2NUFA 4JI2E 4DV7E 2JVAA 2MDRA 5IT9C 1N34E 2B7TA 3DJWA 2H36X 2LUPB 2LBSB 2FV4B 4L5NC 2UU9E 1IBME 4LF4E 1IBLE 2F8BA 1WHQA 5IWAE 4DR4E 1O0WA 2B3TB 4JI7E 1YYKA 4LTYA 2LMZA 1X48A 1RC5A 2FGGA 5CFFE 4OX9E 1EKZA 2KOUA 4KHPE 4BMJA 1N33E 4DR6E 1HNXE 3IWBA 3VYYA 4DR2E 2V8QB 3OMLA 1FKAE 4DR3E 4JI8E 3T1YE 3C4TA 3HTXA 2WZOA 2ODRC 3JU0A 2VQEE 4BS9A 4DV2E 3FIGA 1U61A 2QVWA 1UILA 3F6HA 2LTSA 4J8ZA 5BR8E 5DNYA 4LF8E 2EWLA 2LE2A 4DR1E 3ZOQB 4DV0E 2UUCE 3ADIA 4WYQB 3J81C 1I94E 2B7VA 4M2ZA 1DQ3A 4TUIA 2B9DA 2ODRD 4YY3E 2DMYA 4KZSA 1HR0E 1DI2A 3JTZA 2MC6A 2VQFE 5AASA 3P1XA 4JI3E 4DR7E 2KHXA 1J26A 3JAMC 4DUYE 1IBKE 4LFCE 1GZ6A 4BC9A 1N36E 2JOBA 2GSLA 4BBYA 4DV3E 5FLXC 2V86A 2VE7C 4JI1E 4NXNE 1T4OA 4WSPA 2UUAE 4LFAE 4DV1E 4GKJE 2IHR1 1STUA 2V88A 2V87A 1ZBQA 2JY9A 5A2QC 4B3RE 2KONA 1YYWA 1YZ9A 4F9CB 3MSWA 3AV0A 3AUZA 3HQ1A 2L3JA 4X8WA 3T1HE 4AQYE 4L8NA 2V83A 2HHHE 4JI6E 2V89A 3OTOE 4LF9E 4JV5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 E;  3C4B A;  4OUN A;  2CPN A;  4JI0 E;  4LF6 E;  4DV5 E;  2YT4 A;  3ADG A;  2F4V E;  2L33 A;  3J7Y p;  4GKK E;  4B3M E;  3O2R A;  4OOG C;  2UXD E;  1J5E E;  4DUZ E;  3LLH A;  4X66 E;  1HNW E;  2RTX A;  2EZ6 A;  2L2N A;  2L2M A;  4X62 E;  4B3T E;  1XNQ E;  2E5L E;  2UXC E;  2ZM6 E;  2LUQ A;  2N3G A;  1HNZ E;  2FFL A;  3ADL A;  1UHZ A;  5LMN E;  1N32 E;  4DR5 E;  3N3W A;  4JI4 E;  1PKP A;  1ZBT A;  4M30 A;  1I4S A;  2NUG A;  2LRS A;  2RS7 A;  4NXM E;  2N3H A;  2LTR A;  2RSM A;  1X49 A;  2A11 A;  3VYX A;  1RC7 A;  1X47 A;  1T4N A;  4LF5 E;  4JYA E;  3RV0 A;  3O2R B;  4DKK A;  2NA2 A;  4B3S E;  4DV4 E;  1XMO E;  1RQ0 A;  5LMU E;  1XMQ E;  4WFT A;  1YYO A;  2UXB E;  2L2K B;  1GQE A;  3ADJ A;  3RV1 A;  4JI5 E;  1JFZ A;  4K0K E;  2DIX A;  1QU6 A;  4DV6 E;  4LF7 E;  1WHN A;  4YHH E;  2LJH A;  3T1H E;  2DB2 A;  2NUE A;  4X65 E;  1FJG E;  2L3C A;  4LFB E;  2EB1 A;  2UUB E;  2RS6 A;  1T4L B;  1XNR E;  2NUF A;  4JI2 E;  4DV7 E;  2JVA A;  2MDR A;  1N34 E;  2B7T A;  2LUP B;  2LBS B;  2UU9 E;  1IBM E;  4LF4 E;  1IBL E;  1WHQ A;  5IWA E;  4DR4 E;  1O0W A;  2B3T B;  4JI7 E;  1YYK A;  1X48 A;  1RC5 A;  5CFF E;  4OX9 E;  1EKZ A;  4KHP E;  1N33 E;  4DR6 E;  1HNX E;  3VYY A;  4DR2 E;  1FKA E;  4DR3 E;  4JI8 E;  3T1Y E;  3C4T A;  3HTX A;  2VQE E;  4DV2 E;  1U61 A;  2QVW A;  1UIL A;  4LF8 E;  2LTS A;  5BR8 E;  4DR1 E;  3ADI A;  4DV0 E;  2UUC E;  4WYQ B;  1I94 E;  2B7V A;  4M2Z A;  4YY3 E;  2DMY A;  1HR0 E;  1DI2 A;  2VQF E;  3P1X A;  4JI3 E;  4DR7 E;  2KHX A;  1J26 A;  4DUY E;  1IBK E;  4LFC E;  1N36 E;  2GSL A;  4DV3 E;  4JI1 E;  4NXN E;  1T4O A;  2UUA E;  4LFA E;  4DV1 E;  4GKJ E;  2IHR 1;  1STU A;  4B3R E;  2JY9 A;  1YYW A;  1YZ9 A;  2L3J A;  4X8W A;  4AQY E;  2HHH E;  4JI6 E;  3OTO E;  4LF9 E;  4JV5 E; 
#chains in the Genus database with same CATH topology
 2NAB A;  4X64 E;  4OUN A;  4MLQ A;  4DV5 E;  1PJT A;  3C6M A;  4R2A A;  4F6N A;  2MKN A;  3IWC A;  2L33 A;  2YPN A;  3LML A;  4OOG C;  4DUZ E;  4X66 E;  2E5L E;  5AC4 A;  2FFL A;  5KL3 A;  3H09 A;  4R2E A;  4M0V A;  3VK6 A;  1B69 A;  2K7I A;  1A1I A;  2HC5 A;  2HJJ A;  2LRS A;  1A1J A;  2N3H A;  2LTR A;  3HPS A;  1X47 A;  1Z1B A;  2EMK A;  5A6B A;  4ZYD A;  2MC5 A;  3O2R B;  4DKK A;  3F6G A;  3THN A;  1YPN A;  4DV4 E;  1A1H A;  2RQL A;  4X9J A;  2DLQ A;  2M1S A;  4WFT A;  2G7H A;  3HXL A;  2EM5 A;  2YTP A;  5A6K A;  4JI5 E;  2EM2 A;  1QU6 A;  4DV6 E;  4LF7 E;  3IWD A;  2DB2 A;  1X6F A;  2UUB E;  2NUF A;  4JI2 E;  2EPC A;  2WBS A;  4DV7 E;  2JVA A;  2EOZ A;  1N34 E;  2B7T A;  2EPM X;  3MHH C;  2R76 A;  2EOY A;  4LF4 E;  1IBL E;  1YSA C;  1ZAA C;  1WHQ A;  5IWA E;  2EMF A;  1EH7 A;  4JI7 E;  1YYK A;  2EPA A;  2CT1 A;  4OX9 E;  4BMJ A;  4DR6 E;  2V8Q B;  2EOQ A;  2ODR C;  2YTN A;  3JU0 A;  2VQE E;  4BS9 A;  3FIG A;  2QVW A;  4LF8 E;  3F6H A;  2UUC E;  1DQ3 A;  1YUI A;  2RPC A;  2ODR D;  1ZTD A;  4KZS A;  1SFE A;  2MC6 A;  5AAS A;  3P1X A;  3BID A;  2EMG A;  4O24 A;  4DUY E;  2LT7 A;  1IBK E;  4LFC E;  4BC9 A;  1A1F A;  2JOB A;  2GSL A;  4BBY A;  2EOE A;  2YTQ A;  1DGC A;  4NXN E;  2EM4 A;  2IHR 1;  1ZBQ A;  2EMA A;  2EPR A;  4HEI A;  4NHR A;  2EM6 A;  4AQY E;  4L8N A;  3OTO E;  2MDG A;  5AE1 A;  4F9A B;  2V85 A;  2EPZ A;  2EOJ A;  1P47 A;  4F2J C;  2EL6 A;  3ADG A;  3J7Y p;  3DF6 A;  3O2R A;  2UXD E;  2EML A;  1EH6 A;  5LL6 R;  2EZ6 A;  2L2M A;  4B3T E;  2ELZ A;  2EMB A;  1UHZ A;  4R2R A;  1N32 E;  2JOX A;  2ENH A;  2Q8U A;  4JI4 E;  3EPK A;  1KYQ A;  1ZBT A;  2A25 A;  2YTO A;  2NUG A;  3EPJ A;  4Q28 A;  3THO B;  4NXM E;  1X49 A;  2A11 A;  1WRJ A;  2JP9 A;  3M99 B;  1RC7 A;  5KL6 A;  2D9H A;  3TQM A;  1T4N A;  4P78 A;  4LF5 E;  3J7A G;  4JYA E;  2NA2 A;  4B3S E;  2GPI A;  4JV5 E;  2VF1 A;  2N8X A;  2K4V A;  4KWY A;  4R2D A;  1XMQ E;  2LVH A;  4BC7 A;  2YTF A;  2L2K B;  3ADJ A;  3RV1 A;  2M7Q A;  4O5G A;  1WHN A;  3T1H E;  2LJH A;  4WPY A;  4X65 E;  2FTX B;  1SR9 A;  4LFB E;  2EB1 A;  1T4L B;  2ADR A;  3C6K A;  2EN8 A;  2MDR A;  1IQO A;  2H36 X;  2E72 A;  2EPN A;  1UBD C;  1N3G A;  1O0W A;  2EM3 A;  2YRM A;  3KZY A;  4WX9 A;  2KOU A;  4KHP E;  1N33 E;  2EMI A;  3IWB A;  3VYY A;  4DR2 E;  4DR3 E;  2ENC A;  4JI8 E;  3C4T A;  2EOI A;  2EPL X;  4DV2 E;  2EPX A;  2RSI A;  2EL5 A;  4RH8 A;  2EWL A;  4R2P A;  3J81 C;  2EMW A;  2EN7 A;  2EN6 A;  4DR7 E;  2KHX A;  2EOM A;  1J26 A;  5KL7 A;  2JYA A;  2EMC A;  2VE7 C;  4JI1 E;  1AH5 A;  1X6H A;  1MEY C;  2LV2 A;  2LJU A;  2V88 A;  2V87 A;  4Q35 B;  2KON A;  1YYW A;  1YZ9 A;  3MSW A;  4X8W A;  2HHH E;  2GHF A;  2EOF A;  4GZN C;  1ZU1 A;  3C4B A;  3KWR A;  5F3W A;  4JI0 E;  5AE3 A;  2YT4 A;  5A6B D;  1PDA A;  2F4V E;  4ZYG A;  5AC5 A;  4B3M E;  4NZV A;  4R2S A;  3QG5 C;  4HTG A;  3LLH A;  5A6J A;  4X62 E;  1XNQ E;  2EN1 A;  2L92 A;  2N3G A;  3ADL A;  3J80 C;  3N3W A;  1G2D C;  2DSY A;  4TUG A;  4F9B B;  2EN4 A;  4DMI A;  1A1G A;  4WXC A;  1GTK A;  2RS7 A;  5AE2 A;  1PJQ A;  2EOH A;  2RSM A;  4R03 A;  3VYX A;  1IQS A;  1RMD A;  2YTE A;  2CTD A;  2EPO A;  2EN3 A;  2YTD A;  1BBG A;  1A1K A;  2L6M A;  2JPA A;  3BBG A;  2J7J A;  2YSO A;  4P7D A;  2DRP A;  2DLK A;  1PJS A;  2PRT A;  1QNT A;  2UXB E;  1GQE A;  3BF2 A;  2DIX A;  4YHH E;  2NUE A;  2EP3 A;  2L3C A;  2EM7 A;  2RS6 A;  1XNR E;  1YUJ A;  2EOX A;  2YTJ A;  2YRK A;  3DJW A;  4MLV A;  2LUP B;  2EPP A;  2UU9 E;  1IBM E;  2F8B A;  1YFH A;  2R1F A;  2BBG A;  2B3T B;  5IV8 B;  2DMI A;  2WBT A;  1EKZ A;  4IJD A;  2EM9 A;  3OML A;  1NCS A;  1FKA E;  2ELY A;  3T1Y E;  3EPH A;  1U61 A;  1UIL A;  5BR8 E;  1X6E A;  5DNY A;  3MHS C;  1TN9 A;  2YTI A;  4DR1 E;  2DGC A;  4ZYH A;  4WYQ B;  4M2Z A;  2DMY A;  2BB8 A;  5TSE A;  5KL4 A;  3JAM C;  1GZ6 A;  5FLX C;  1LLM C;  2V86 A;  4WSP A;  2UUA E;  2M9A A;  4LFA E;  4DV1 E;  5KL5 A;  4B3R E;  2JY9 A;  5A2Q C;  2EN2 A;  4F9C B;  1UN6 B;  2EM8 A;  3AUZ A;  3AV0 A;  2L3J A;  4JI6 E;  2YRH A;  2VRD A;  2JXP A;  5A6A A;  1WXR A;  2CPN A;  2YTG A;  4LF6 E;  1BBO A;  4GEQ B;  2I13 A;  4I8O A;  4GKK E;  3EPL A;  2YU5 A;  2YWQ A;  2M4I A;  5LLQ A;  1MGT A;  2YSP A;  1G2F C;  1J5E E;  4F54 A;  1HNW E;  2RTX A;  1JK2 A;  2L2N A;  1AAY A;  2EMH A;  3KZZ A;  2ZM6 E;  2UXC E;  4IS1 C;  2LUQ A;  1HNZ E;  2JWO A;  2E1M A;  5LMN E;  4DR5 E;  5T6J A;  1WJP A;  1PKP A;  4M9V C;  2EOR A;  1IMU A;  4M30 A;  1I4S A;  1ZR9 A;  1T39 A;  2L8T A;  4R2C A;  1T38 A;  4F6M A;  2EMX A;  2EQ0 A;  3RV0 A;  4R8O A;  3RMP A;  2EPK X;  1XMO E;  4WSG A;  4BCA A;  4N4R B;  1NEI A;  1RQ0 A;  5LMU E;  4LU9 A;  2JR1 A;  3BGH A;  1YYO A;  1JFZ A;  4K0K E;  1BB8 A;  3K6Q A;  1A1L A;  1TF6 A;  2YZT A;  1FJG E;  3VHT B;  3HPZ A;  5ADZ A;  2EOO A;  2HGH A;  5IT9 C;  1L4S A;  2EMY A;  2CSH A;  5IXM B;  2LBS B;  2EL4 A;  2FV4 B;  4L5N C;  1EH8 A;  2YU8 A;  4DR4 E;  2EM0 A;  4LTY A;  2LMZ A;  2WBU A;  1X48 A;  2EJ4 A;  1RC5 A;  2FGG A;  2LCE A;  5CFF E;  4ZYE A;  1HNX E;  2EOS A;  5A69 A;  4WXD A;  2LO3 A;  3HTX A;  2WZO A;  1X5W A;  4J8Z A;  1X3C A;  3L00 A;  2LTS A;  4FK5 C;  2LE2 A;  3ADI A;  3ZOQ B;  4DV0 E;  2EQ1 A;  1I94 E;  5KL2 A;  2B7V A;  4TUI A;  2WCC 3;  2B9D A;  2EE8 A;  4YY3 E;  3EQ1 A;  1HR0 E;  1DI2 A;  3JTZ A;  2VQF E;  4JI3 E;  1F2I G;  2I9I A;  1TF3 A;  2ENA A;  1N36 E;  4DV3 E;  4O4K A;  1T4O A;  2EMZ A;  2MKD A;  4RHB B;  4BHC A;  3ECR A;  4GKJ E;  1STU A;  4BHB A;  1JK1 A;  4O43 A;  2EQ3 A;  2GLI A;  3HQ1 A;  1KJK A;  3UK3 C;  2V83 A;  2V89 A;  4LF9 E;  2EPU A;  4R2Q A; 
#chains in the Genus database with same CATH homology
 1WXR A;  4X64 E;  5AE1 A;  4F9A B;  3C4B A;  4OUN A;  2CPN A;  3KWR A;  5F3W A;  4JI0 E;  2V85 A;  5AE3 A;  4LF6 E;  4DV5 E;  2YT4 A;  4GEQ B;  3IWC A;  3ADG A;  2F4V E;  2L33 A;  3J7Y p;  3DF6 A;  4I8O A;  4GKK E;  4B3M E;  3O2R A;  2M4I A;  3LML A;  4OOG C;  4YHH E;  2UXD E;  1J5E E;  4DUZ E;  3LLH A;  4F54 A;  4X66 E;  1HNW E;  2RTX A;  2EZ6 A;  5LL6 R;  2L2N A;  2L2M A;  4X62 E;  4B3T E;  1XNQ E;  2E5L E;  2UXC E;  2ZM6 E;  2LUQ A;  2L92 A;  2N3G A;  1HNZ E;  2JWO A;  2FFL A;  2E1M A;  3ADL A;  1UHZ A;  3J80 C;  5LMN E;  1N32 E;  2JOX A;  4DR5 E;  3N3W A;  3H09 A;  4M0V A;  5T6J A;  3VK6 A;  2DSY A;  4TUG A;  4F9B B;  4JI4 E;  1PKP A;  1ZBT A;  4DMI A;  4M30 A;  1I4S A;  2NUG A;  2LRS A;  4Q28 A;  2RS7 A;  5AE2 A;  4NXM E;  2N3H A;  2LTR A;  2RSM A;  1X49 A;  3HPS A;  2A11 A;  4R03 A;  3VYX A;  2L8T A;  1RC7 A;  1X47 A;  1T4N A;  4P78 A;  4LF5 E;  3J7A G;  2MC5 A;  4JYA E;  3RV0 A;  3O2R B;  2L6M A;  3F6G A;  2NA2 A;  4R8O A;  4DKK A;  4DV4 E;  3RMP A;  4B3S E;  1XMO E;  2VF1 A;  4P7D A;  4BCA A;  1RQ0 A;  2K4V A;  5LMU E;  4LU9 A;  1XMQ E;  2JR1 A;  2M1S A;  4WFT A;  2G7H A;  3HXL A;  1YYO A;  4BC7 A;  2UXB E;  2L2K B;  1GQE A;  3ADJ A;  3RV1 A;  4JI5 E;  2M7Q A;  1JFZ A;  4K0K E;  2DIX A;  1QU6 A;  3K6Q A;  4DV6 E;  4LF7 E;  1WHN A;  3IWD A;  2LJH A;  4WPY A;  2DB2 A;  2NUE A;  2YZT A;  2FTX B;  4X65 E;  1SR9 A;  2L3C A;  1FJG E;  2EB1 A;  4LFB E;  2UUB E;  2RS6 A;  3HPZ A;  5ADZ A;  1T4L B;  1XNR E;  2NUF A;  4JI2 E;  4DV7 E;  2JVA A;  2MDR A;  5IT9 C;  1N34 E;  2B7T A;  3DJW A;  2H36 X;  2LUP B;  2LBS B;  2FV4 B;  4L5N C;  2UU9 E;  1IBM E;  4LF4 E;  1IBL E;  2F8B A;  1WHQ A;  5IWA E;  4DR4 E;  1O0W A;  2B3T B;  4JI7 E;  1YYK A;  4LTY A;  2LMZ A;  1X48 A;  1RC5 A;  2FGG A;  5CFF E;  4OX9 E;  1EKZ A;  2KOU A;  4KHP E;  4BMJ A;  1N33 E;  4DR6 E;  1HNX E;  3IWB A;  3VYY A;  4DR2 E;  2V8Q B;  3OML A;  1FKA E;  4DR3 E;  4JI8 E;  3T1Y E;  3C4T A;  3HTX A;  2WZO A;  2ODR C;  3JU0 A;  2VQE E;  4BS9 A;  4DV2 E;  3FIG A;  1U61 A;  2QVW A;  1UIL A;  3F6H A;  2LTS A;  4J8Z A;  5BR8 E;  5DNY A;  4LF8 E;  2EWL A;  2LE2 A;  4DR1 E;  3ZOQ B;  4DV0 E;  2UUC E;  3ADI A;  4WYQ B;  3J81 C;  1I94 E;  2B7V A;  4M2Z A;  1DQ3 A;  4TUI A;  2B9D A;  2ODR D;  4YY3 E;  2DMY A;  4KZS A;  1HR0 E;  1DI2 A;  3JTZ A;  2MC6 A;  2VQF E;  5AAS A;  3P1X A;  4JI3 E;  4DR7 E;  2KHX A;  1J26 A;  3JAM C;  4DUY E;  1IBK E;  4LFC E;  1GZ6 A;  4BC9 A;  1N36 E;  2JOB A;  2GSL A;  4BBY A;  4DV3 E;  5FLX C;  2V86 A;  2VE7 C;  4JI1 E;  4NXN E;  1T4O A;  4WSP A;  2UUA E;  4LFA E;  4DV1 E;  4GKJ E;  2IHR 1;  1STU A;  2V88 A;  2V87 A;  1ZBQ A;  2JY9 A;  5A2Q C;  4B3R E;  2KON A;  1YYW A;  1YZ9 A;  4F9C B;  3MSW A;  3AV0 A;  3AUZ A;  3HQ1 A;  2L3J A;  4X8W A;  3T1H E;  4AQY E;  4L8N A;  2V83 A;  2HHH E;  4JI6 E;  2V89 A;  3OTO E;  4LF9 E;  4JV5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...