2NUFA

Crystal structure of rnase iii from aquifex aeolicus complexed with ds-rna at 2.5-angstrom resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
219
structure length
219
Chain Sequence
KMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 28-MER
publication title A stepwise model for double-stranded RNA processing by ribonuclease III.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
total genus 77
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 2nufA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2nufA02
3ADIA 2L2NA 4DR5E 1T4LB 3RV0A 1IBME 4JI5E 1XMOE 1HR0E 1WHNA 5BR8E 3J7Yp 4DV7E 2UUBE 1JFZA 4M2ZA 4X66E 4DV1E 2UXCE 2DB2A 1I4SA 1X48A 2CPNA 2N3GA 2NUGA 2NUEA 1T4OA 4DV3E 2GSLA 3VYYA 2VQEE 4KHPE 3O2RB 1STUA 4LF7E 2F4VE 4DV4E 2LTSA 2LJHA 2A11A 1N33E 1FKAE 3N3WA 3VYXA 2EZ6A 4DV5E 2L3CA 5CFFE 1X47A 1YYWA 2YT4A 4DR1E 4JI4E 2RS7A 4LF4E 2DMYA 4OOGC 4DR4E 4X8WA 3T1HE 1X49A 2HHHE 4JI8E 2JY9A 2RTXA 1GQEA 4AQYE 4LFCE 2LRSA 3RV1A 2L3JA 3ADJA 2LBSB 5LMNE 3P1XA 4JI7E 2L2KB 4JI0E 1T4NA 4LF5E 1I94E 3T1YE 4B3TE 4DR2E 2E5LE 2JVAA 3ADLA 1XNQE 2LUQA 4JI2E 4DR6E 4DKKA 4YY3E 4X62E 1XMQE 1HNZE 1N34E 3LLHA 4LF6E 1ZBTA 4LF8E 2UXDE 2NUFA 1QU6A 1N32E 2LUPB 1N36E 4DR7E 2RS6A 2DIXA 1YZ9A 2UU9E 5LMUE 4JV5E 4OUNA 1IBLE 1RC5A 3HTXA 1WHQA 2VQFE 1XNRE 1RQ0A 1YYKA 2B7VA 2MDRA 4LF9E 2EB1A 1J26A 4B3RE 5IWAE 2B7TA 1EKZA 2UXBE 4DV6E 4OX9E 2QVWA 1FJGE 4JI1E 1HNWE 4M30A 2L2MA 3ADGA 2UUAE 4GKKE 1O0WA 3O2RA 4B3ME 2L33A 1UHZA 2UUCE 1IBKE 1UILA 2FFLA 2ZM6E 4DR3E 2NA2A 4JI3E 4GKJE 1PKPA 4NXNE 2LTRA 4LFAE 4WFTA 3C4TA 4X65E 2KHXA 4LFBE 1U61A 4K0KE 4JYAE 4JI6E 4DV2E 4WYQB 1J5EE 1YYOA 1RC7A 2IHR1 4DUYE 4DUZE 2B3TB 4B3SE 3C4BA 4DV0E 2N3HA 4YHHE 2RSMA 4X64E 3OTOE 1HNXE 4NXME 1DI2A
chains in the Genus database with same CATH superfamily
2V8QB 3ADIA 2L2NA 3RV0A 4MLVA 4JI5E 5ADZA 1WHNA 2FTXB 4DV7E 2VE7C 3VK6A 4X66E 2ODRD 2DB2A 5A6BA 1L4SA 1IQSA 5KL6A 2NUGA 1EH8A 2WBSA 4DV3E 5IXMB 2EPKX 1ZTDA 2VQEE 4KHPE 1STUA 2EN7A 5A2QC 1A1JA 4F9AB 2N8XA 2L3CA 5CFFE 1X47A 3LMLA 2YT4A 3MSWA 2EMXA 5A6BD 1TF6A 4X8WA 1YUIA 2E72A 1X49A 2EOXA 4JI8E 4AQYE 2MKDA 2L3JA 2GHFA 2ADRA 2LBSB 3C6KA 4BCAA 2EPZA 2EPLX 2LCEA 3AV0A 4JI7E 2L2KB 4JI0E 4LF5E 2F8BA 2EOEA 3K6QA 4DKKA 4YY3E 3JAMC 4X62E 1P47A 5A6KA 5LL6R 3EPJA 1N34E 1A1FA 5A69A 2RSIA 2HJJA 2EOQA 1QU6A 4WXDA 2LUPB 1N32E 2YRMA 4NHRA 3FIGA 2EOSA 3BF2A 2YTGA 2EMGA 2K7IA 4WPYA 3UK3C 1A1LA 2LT7A 2JP9A 4BHCA 2EMCA 5AE2A 2WCC3 2VQFE 2B7VA 1YYKA 2EN2A 4LTYA 2L6MA 4ZYGA 4F54A 4WX9A 2GLIA 2B7TA 2V89A 2LO3A 4ZYEA 4R8OA 2EM8A 2QVWA 5LLQA 4JI1E 2EQ0A 2EM3A 2L2MA 3ADGA 4B3ME 2HC5A 1A1GA 1IQOA 4P78A 1IMUA 4WXCA 2LE2A 2L8TA 4ZYHA 4IS1C 4NXNE 1PJQA 3THOB 1X5WA 4LFBE 2EMHA 4JI6E 3VHTB 3IWDA 1J5EE 4I8OA 4BHBA 2YSOA 1ZBQA 2CSHA 2EWLA 4R2QA 2Q8UA 2EQ1A 2V83A 2YTQA 4HTGA 2VRDA 2EN6A 3HPZA 3H09A 4X64E 3OTOE 2EL4A 1T4LB 3F6GA 3EPKA 5IV8B 2RQLA 1XMOE 2YU8A 4R2DA 1SR9A 2UUBE 2JYAA 2YU5A 1YFHA 2UXCE 1I4SA 1RMDA 2CPNA 2JPAA 4DMIA 2EOOA 2K4VA 3O2RB 2V86A 2F4VE 3HXLA 1N33E 2EPRA 3VYXA 2EZ6A 1G2DC 4LF4E 5FLXC 5IT9C 2DMYA 5AC4A 5KL5A 4OOGC 1LLMC 2EMYA 2ENCA 1AAYA 2V85A 1GTKA 2LJUA 2EPXA 2BBGA 2ELYA 2YPNA 2LRSA 2EOJA 3ADJA 1MGTA 2EOZA 1T39A 2DRPA 2YTNA 1I94E 2E5LE 1EH6A 2EPPA 3HQ1A 3KZZA 4LF8E 2NABA 2UXDE 4BS9A 2NUFA 2CTDA 2MC5A 3TQMA 2EM2A 2EN8A 1TN9A 4DR7E 2RS6A 2DIXA 4Q28A 2YTIA 5LMUE 2UU9E 4JV5E 1RC5A 3F6HA 2MC6A 5KL2A 1YSAC 2WBUA 4GEQB 2M4IA 2MDRA 4LF9E 4B3RE 3IWBA 2DGCA 1FJGE 1WJPA 1HNWE 2EPNA 5AASA 2UUAE 4GKKE 1O0WA 3O2RA 3ECRA 4ZYDA 2L33A 1UHZA 5TSEA 1UILA 2FFLA 5KL3A 2PRTA 4JI3E 2WZOA 2EJ4A 4GKJE 1PKPA 4WFTA 2ODRC 2I13A 1U61A 4BC7A 4F9BB 2ELZA 4FK5C 4WYQB 3J80C 1WRJA 1YYOA 4DUZE 4MLQA 3OMLA 4DV0E 2N3HA 4YHHE 4R2PA 2MKNA 1HNXE 1DI2A 2EN3A 2DMIA 5AC5A 3MHSC 4DR5E 2BB8A 1HR0E 1BBOA 5BR8E 2EPOA 4M2ZA 4DV1E 1YUJA 2EM6A 4R2CA 2FGGA 5A6AA 1NCSA 2EOHA 3VYYA 2V87A 3THNA 4X9JA 4LF7E 4DV4E 2A11A 2EM0A 4DV5E 1AH5A 2EL5A 2YWQA 3J7AG 1YYWA 2LMZA 3DF6A 4JI4E 4BC9A 2M1SA 2EM4A 4R03A 2I9IA 2RTXA 1UN6B 3BBGA 4TUIA 1N3GA 2V88A 5AE1A 5LMNE 1YPNA 4J8ZA 4KWYA 3P1XA 2HGHA 1F2IG 4M9VC 1T4NA 4B3TE 4DR2E 2R76A 4JI2E 1XMQE 2JWOA 1HNZE 2EQ3A 4LF6E 4BBYA 3AUZA 4Q35B 1SFEA 2M7QA 2YTPA 4L5NC 1A1KA 4R2SA 4N4RB 1XNRE 2EMZA 1RQ0A 1WXRA 2EB1A 1J26A 3DJWA 1PJSA 2KONA 1KJKA 2ENAA 1EKZA 3QG5C 2UXBE 2EPCA 4OX9E 1T38A 4HEIA 2G7HA 1BB8A 2LVHA 4P7DA 2UUCE 1B69A 2MDGA 3EQ1A 4DR3E 2NA2A 3BIDA 3ZOQB 1A1IA 4LFAE 2EL6A 2EMAA 2EPAA 2EMKA 2B9DA 2EM7A 1MEYC 4K0KE 4JYAE 2EPMX 2LV2A 3HPSA 2YTEA 2L92A 1X6HA 2EN4A 4O5GA 2EN1A 1RC7A 2IHR1 4DUYE 2B3TB 2M9AA 1EH7A 2YRKA 4GZNC 4B3SE 2YTJA 2E1MA 2EOIA 2YTFA 4IJDA 1DGCA 2RSMA 2J7JA 4NXME 2JOXA 2EE8A 2JXPA 1UBDC 2EORA 2DSYA 1IBME 1PJTA 4O4KA 1TF3A 4O24A 1BBGA 2YZTA 3J7Yp 1JFZA 1A1HA 2FV4B 2H36X 1X48A 1QNTA 2N3GA 5AE3A 2NUEA 1T4OA 2GSLA 2LTSA 2LJHA 3C6MA 1FKAE 3N3WA 4R2EA 2EMFA 4DR1E 2EMIA 3JTZA 2RS7A 4F6NA 5DNYA 2YTOA 4L8NA 1JK1A 4DR4E 3M99B 3T1HE 2EMWA 2YSPA 1ZR9A 4LU9A 2HHHE 1X6EA 1KYQA 2JY9A 4F6MA 1GQEA 2EM9A 4LFCE 4RH8A 2DLKA 4WSGA 3RV1A 2EOYA 1NEIA 3JU0A 4F2JC 1ZU1A 4KZSA 2EOFA 4M0VA 3T1YE 2JVAA 3ADLA 1XNQE 2LUQA 2RPCA 4DR6E 1G2FC 2CT1A 4F9CB 3J81C 3LLHA 1ZBTA 2WBTA 1JK2A 2JR1A 2KOUA 3RMPA 4WSPA 2EM5A 1N36E 2D9HA 1YZ9A 2EMLA 2R1FA 1X3CA 2VF1A 4OUNA 1IBLE 3MHHC 3HTXA 4TUGA 1WHQA 5F3WA 5IWAE 4O43A 4DV6E 1GZ6A 4M30A 5A6JA 4R2RA 4NZVA 4R2AA 1IBKE 2EOMA 4RHBB 3KWRA 3IWCA 2ZM6E 1DQ3A 2GPIA 3EPHA 2LTRA 2JOBA 3C4TA 4X65E 2KHXA 2ENHA 5KL4A 2YRHA 2YTDA 4DV2E 5T6JA 1ZAAC 2DLQA 1X6FA 2EMBA 3BGHA 5KL7A 2EP3A 3EPLA 3C4BA 2EPUA 3KZYA 3L00A 1Z1BA 1PDAA 2A25A 4BMJA
chains in the Genus database with same CATH topology
2V8QB 3ADIA 2L2NA 4DR5E 3F6GA 3RV0A 2DSYA 1T4LB 1IBME 4JI5E 5ADZA 1XMOE 1HR0E 1WHNA 1SR9A 2FTXB 2YZTA 5BR8E 2VE7C 3VK6A 1JFZA 4M2ZA 4X66E 3J7Yp 4DV1E 2UXCE 2FV4B 2ODRD 2DB2A 1I4SA 2H36X 2FGGA 1X48A 2CPNA 2N3GA 4DMIA 2NUGA 2NUEA 5AE3A 1T4OA 4DV3E 2GSLA 2K4VA 2VQEE 3VYYA 4KHPE 2V87A 3O2RB 1STUA 4LF7E 2V86A 2F4VE 5A2QC 3HXLA 2LTSA 2LJHA 2A11A 4DV4E 1N33E 1FKAE 3N3WA 3VYXA 2EZ6A 4DV5E 4F9AB 2L3CA 5CFFE 3OTOE 1X47A 1YYWA 2LMZA 2YT4A 3DF6A 3JTZA 3LMLA 4DR1E 4JI4E 2RS7A 3MSWA 5DNYA 4BC9A 2M1SA 5FLXC 5IT9C 2DMYA 4LF4E 4OOGC 4L8NA 4X8WA 4DR4E 3T1HE 4LU9A 2V85A 1X49A 2HHHE 4JI8E 2JY9A 4R03A 2RTXA 1GQEA 4AQYE 4LFCE 2LRSA 4TUIA 3RV1A 2V88A 5AE1A 2L3JA 3ADJA 2LBSB 5LMNE 3JU0A 4J8ZA 4BCAA 3P1XA 3AV0A 4JI7E 2L2KB 4KZSA 4JI0E 1T4NA 4LF5E 4M0VA 1I94E 3T1YE 2F8BA 4DR2E 2E5LE 2JVAA 3K6QA 4B3TE 1XNQE 2LUQA 4JI2E 3ADLA 4DR6E 3HQ1A 4DKKA 4F9CB 3JAMC 4YY3E 4X62E 1XMQE 2JWOA 3J81C 1HNZE 5LL6R 1N34E 3LLHA 4LF6E 1ZBTA 4LF8E 4BBYA 3AUZA 2JR1A 2UXDE 4BS9A 2KOUA 3RMPA 2NUFA 1QU6A 4WSPA 2LUPB 1N36E 1N32E 2MC5A 4DR7E 3FIGA 2RS6A 2DIXA 1YZ9A 2M7QA 4Q28A 2UU9E 5LMUE 2VF1A 4JV5E 4OUNA 4L5NC 4WPYA 1IBLE 1RC5A 3F6HA 3HTXA 2MC6A 4TUGA 1WHQA 5AE2A 2VQFE 4GEQB 1XNRE 1RQ0A 1YYKA 2B7VA 2M4IA 2MDRA 2L6MA 2EB1A 4LTYA 1WXRA 5F3WA 3DJWA 4F54A 4LF9E 2KONA 5IWAE 4B3RE 1J26A 2B7TA 1EKZA 2UXBE 4DV6E 3IWBA 1GZ6A 2V89A 4R8OA 4OX9E 2QVWA 1FJGE 4JI1E 1HNWE 4M30A 5AASA 2L2MA 3ADGA 2UUAE 4GKKE 1O0WA 3O2RA 4B3ME 2G7HA 2L33A 1UHZA 4P7DA 2UUCE 1IBKE 4P78A 1UILA 2FFLA 3KWRA 3IWCA 2ZM6E 1DQ3A 2NA2A 4DR3E 4JI3E 2WZOA 2LE2A 3ZOQB 2L8TA 4GKJE 1PKPA 4DV7E 2LTRA 4LFAE 2JOBA 4WFTA 3C4TA 2UUBE 4X65E 4NXNE 2ODRC 2KHXA 2B9DA 4LFBE 1U61A 4BC7A 4F9BB 4K0KE 4JYAE 4JI6E 4DV2E 4WYQB 3HPSA 3J80C 5T6JA 3IWDA 2L92A 4I8OA 1J5EE 1ZBQA 1YYOA 1RC7A 2EWLA 2IHR1 4DUYE 4DUZE 2B3TB 3J7AG 4B3SE 2V83A 3C4BA 2E1MA 3OMLA 4DV0E 2N3HA 4YHHE 3H09A 3HPZA 2RSMA 4BMJA 4X64E 1HNXE 4NXME 2JOXA 1DI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ADI A;  2L2N A;  4DR5 E;  1T4L B;  3RV0 A;  1IBM E;  4JI5 E;  1XMO E;  1HR0 E;  1WHN A;  5BR8 E;  3J7Y p;  4DV7 E;  2UUB E;  1JFZ A;  4M2Z A;  4X66 E;  4DV1 E;  2UXC E;  2DB2 A;  1I4S A;  1X48 A;  2CPN A;  2N3G A;  2NUG A;  2NUE A;  1T4O A;  4DV3 E;  2GSL A;  3VYY A;  2VQE E;  4KHP E;  3O2R B;  1STU A;  4LF7 E;  2F4V E;  4DV4 E;  2LTS A;  2LJH A;  2A11 A;  1N33 E;  1FKA E;  3N3W A;  3VYX A;  2EZ6 A;  4DV5 E;  2L3C A;  5CFF E;  1X47 A;  1YYW A;  2YT4 A;  4DR1 E;  4JI4 E;  2RS7 A;  4LF4 E;  2DMY A;  4OOG C;  4DR4 E;  4X8W A;  3T1H E;  1X49 A;  2HHH E;  4JI8 E;  2JY9 A;  2RTX A;  1GQE A;  4AQY E;  4LFC E;  2LRS A;  3RV1 A;  2L3J A;  3ADJ A;  2LBS B;  5LMN E;  3P1X A;  4JI7 E;  2L2K B;  4JI0 E;  1T4N A;  4LF5 E;  1I94 E;  3T1Y E;  4B3T E;  4DR2 E;  2E5L E;  2JVA A;  3ADL A;  1XNQ E;  2LUQ A;  4JI2 E;  4DR6 E;  4DKK A;  4YY3 E;  4X62 E;  1XMQ E;  1HNZ E;  1N34 E;  3LLH A;  4LF6 E;  1ZBT A;  4LF8 E;  2UXD E;  2NUF A;  1QU6 A;  1N32 E;  2LUP B;  1N36 E;  4DR7 E;  2RS6 A;  2DIX A;  1YZ9 A;  2UU9 E;  5LMU E;  4JV5 E;  4OUN A;  1IBL E;  1RC5 A;  3HTX A;  1WHQ A;  2VQF E;  1XNR E;  1RQ0 A;  1YYK A;  2B7V A;  2MDR A;  4LF9 E;  2EB1 A;  1J26 A;  4B3R E;  5IWA E;  2B7T A;  1EKZ A;  2UXB E;  4DV6 E;  4OX9 E;  2QVW A;  1FJG E;  4JI1 E;  1HNW E;  4M30 A;  2L2M A;  3ADG A;  2UUA E;  4GKK E;  1O0W A;  3O2R A;  4B3M E;  2L33 A;  1UHZ A;  2UUC E;  1IBK E;  1UIL A;  2FFL A;  2ZM6 E;  4DR3 E;  2NA2 A;  4JI3 E;  4GKJ E;  1PKP A;  4NXN E;  2LTR A;  4LFA E;  4WFT A;  3C4T A;  4X65 E;  2KHX A;  4LFB E;  1U61 A;  4K0K E;  4JYA E;  4JI6 E;  4DV2 E;  4WYQ B;  1J5E E;  1YYO A;  1RC7 A;  2IHR 1;  4DUY E;  4DUZ E;  2B3T B;  4B3S E;  3C4B A;  4DV0 E;  2N3H A;  4YHH E;  2RSM A;  4X64 E;  3OTO E;  1HNX E;  4NXM E;  1DI2 A; 
#chains in the Genus database with same CATH topology
 2V8Q B;  3ADI A;  2L2N A;  3RV0 A;  4MLV A;  4JI5 E;  5ADZ A;  1WHN A;  2FTX B;  4DV7 E;  2VE7 C;  3VK6 A;  4X66 E;  2ODR D;  2DB2 A;  5A6B A;  1L4S A;  1IQS A;  5KL6 A;  2NUG A;  1EH8 A;  2WBS A;  4DV3 E;  5IXM B;  2EPK X;  1ZTD A;  2VQE E;  4KHP E;  1STU A;  2EN7 A;  5A2Q C;  1A1J A;  4F9A B;  2N8X A;  2L3C A;  5CFF E;  1X47 A;  3LML A;  2YT4 A;  3MSW A;  2EMX A;  5A6B D;  1TF6 A;  4X8W A;  1YUI A;  2E72 A;  1X49 A;  2EOX A;  4JI8 E;  4AQY E;  2MKD A;  2L3J A;  2GHF A;  2ADR A;  2LBS B;  3C6K A;  4BCA A;  2EPZ A;  2EPL X;  2LCE A;  3AV0 A;  4JI7 E;  2L2K B;  4JI0 E;  4LF5 E;  2F8B A;  2EOE A;  3K6Q A;  4DKK A;  4YY3 E;  3JAM C;  4X62 E;  1P47 A;  5A6K A;  5LL6 R;  3EPJ A;  1N34 E;  1A1F A;  5A69 A;  2RSI A;  2HJJ A;  2EOQ A;  1QU6 A;  4WXD A;  2LUP B;  1N32 E;  2YRM A;  4NHR A;  3FIG A;  2EOS A;  3BF2 A;  2YTG A;  2EMG A;  2K7I A;  4WPY A;  3UK3 C;  1A1L A;  2LT7 A;  2JP9 A;  4BHC A;  2EMC A;  5AE2 A;  2WCC 3;  2VQF E;  2B7V A;  1YYK A;  2EN2 A;  4LTY A;  2L6M A;  4ZYG A;  4F54 A;  4WX9 A;  2GLI A;  2B7T A;  2V89 A;  2LO3 A;  4ZYE A;  4R8O A;  2EM8 A;  2QVW A;  5LLQ A;  4JI1 E;  2EQ0 A;  2EM3 A;  2L2M A;  3ADG A;  4B3M E;  2HC5 A;  1A1G A;  1IQO A;  4P78 A;  1IMU A;  4WXC A;  2LE2 A;  2L8T A;  4ZYH A;  4IS1 C;  4NXN E;  1PJQ A;  3THO B;  1X5W A;  4LFB E;  2EMH A;  4JI6 E;  3VHT B;  3IWD A;  1J5E E;  4I8O A;  4BHB A;  2YSO A;  1ZBQ A;  2CSH A;  2EWL A;  4R2Q A;  2Q8U A;  2EQ1 A;  2V83 A;  2YTQ A;  4HTG A;  2VRD A;  2EN6 A;  3HPZ A;  3H09 A;  4X64 E;  3OTO E;  2EL4 A;  1T4L B;  3F6G A;  3EPK A;  5IV8 B;  2RQL A;  1XMO E;  2YU8 A;  4R2D A;  1SR9 A;  2UUB E;  2JYA A;  2YU5 A;  1YFH A;  2UXC E;  1I4S A;  1RMD A;  2CPN A;  2JPA A;  4DMI A;  2EOO A;  2K4V A;  3O2R B;  2V86 A;  2F4V E;  3HXL A;  1N33 E;  2EPR A;  3VYX A;  2EZ6 A;  1G2D C;  4LF4 E;  5FLX C;  5IT9 C;  2DMY A;  5AC4 A;  5KL5 A;  4OOG C;  1LLM C;  2EMY A;  2ENC A;  1AAY A;  2V85 A;  1GTK A;  2LJU A;  2EPX A;  2BBG A;  2ELY A;  2YPN A;  2LRS A;  2EOJ A;  3ADJ A;  1MGT A;  2EOZ A;  1T39 A;  2DRP A;  2YTN A;  1I94 E;  2E5L E;  1EH6 A;  2EPP A;  3HQ1 A;  3KZZ A;  4LF8 E;  2NAB A;  2UXD E;  4BS9 A;  2NUF A;  2CTD A;  2MC5 A;  3TQM A;  2EM2 A;  2EN8 A;  1TN9 A;  4DR7 E;  2RS6 A;  2DIX A;  4Q28 A;  2YTI A;  5LMU E;  2UU9 E;  4JV5 E;  1RC5 A;  3F6H A;  2MC6 A;  5KL2 A;  1YSA C;  2WBU A;  4GEQ B;  2M4I A;  2MDR A;  4LF9 E;  4B3R E;  3IWB A;  2DGC A;  1FJG E;  1WJP A;  1HNW E;  2EPN A;  5AAS A;  2UUA E;  4GKK E;  1O0W A;  3O2R A;  3ECR A;  4ZYD A;  2L33 A;  1UHZ A;  5TSE A;  1UIL A;  2FFL A;  5KL3 A;  2PRT A;  4JI3 E;  2WZO A;  2EJ4 A;  4GKJ E;  1PKP A;  4WFT A;  2ODR C;  2I13 A;  1U61 A;  4BC7 A;  4F9B B;  2ELZ A;  4FK5 C;  4WYQ B;  3J80 C;  1WRJ A;  1YYO A;  4DUZ E;  4MLQ A;  3OML A;  4DV0 E;  2N3H A;  4YHH E;  4R2P A;  2MKN A;  1HNX E;  1DI2 A;  2EN3 A;  2DMI A;  5AC5 A;  3MHS C;  4DR5 E;  2BB8 A;  1HR0 E;  1BBO A;  5BR8 E;  2EPO A;  4M2Z A;  4DV1 E;  1YUJ A;  2EM6 A;  4R2C A;  2FGG A;  5A6A A;  1NCS A;  2EOH A;  3VYY A;  2V87 A;  3THN A;  4X9J A;  4LF7 E;  4DV4 E;  2A11 A;  2EM0 A;  4DV5 E;  1AH5 A;  2EL5 A;  2YWQ A;  3J7A G;  1YYW A;  2LMZ A;  3DF6 A;  4JI4 E;  4BC9 A;  2M1S A;  2EM4 A;  4R03 A;  2I9I A;  2RTX A;  1UN6 B;  3BBG A;  4TUI A;  1N3G A;  2V88 A;  5AE1 A;  5LMN E;  1YPN A;  4J8Z A;  4KWY A;  3P1X A;  2HGH A;  1F2I G;  4M9V C;  1T4N A;  4B3T E;  4DR2 E;  2R76 A;  4JI2 E;  1XMQ E;  2JWO A;  1HNZ E;  2EQ3 A;  4LF6 E;  4BBY A;  3AUZ A;  4Q35 B;  1SFE A;  2M7Q A;  2YTP A;  4L5N C;  1A1K A;  4R2S A;  4N4R B;  1XNR E;  2EMZ A;  1RQ0 A;  1WXR A;  2EB1 A;  1J26 A;  3DJW A;  1PJS A;  2KON A;  1KJK A;  2ENA A;  1EKZ A;  3QG5 C;  2UXB E;  2EPC A;  4OX9 E;  1T38 A;  4HEI A;  2G7H A;  1BB8 A;  2LVH A;  4P7D A;  2UUC E;  1B69 A;  2MDG A;  3EQ1 A;  4DR3 E;  2NA2 A;  3BID A;  3ZOQ B;  1A1I A;  4LFA E;  2EL6 A;  2EMA A;  2EPA A;  2EMK A;  2B9D A;  2EM7 A;  1MEY C;  4K0K E;  4JYA E;  2EPM X;  2LV2 A;  3HPS A;  2YTE A;  2L92 A;  1X6H A;  2EN4 A;  4O5G A;  2EN1 A;  1RC7 A;  2IHR 1;  4DUY E;  2B3T B;  2M9A A;  1EH7 A;  2YRK A;  4GZN C;  4B3S E;  2YTJ A;  2E1M A;  2EOI A;  2YTF A;  4IJD A;  1DGC A;  2RSM A;  2J7J A;  4NXM E;  2JOX A;  2EE8 A;  2JXP A;  1UBD C;  2EOR A;  2DSY A;  1IBM E;  1PJT A;  4O4K A;  1TF3 A;  4O24 A;  1BBG A;  2YZT A;  3J7Y p;  1JFZ A;  1A1H A;  2FV4 B;  2H36 X;  1X48 A;  1QNT A;  2N3G A;  5AE3 A;  2NUE A;  1T4O A;  2GSL A;  2LTS A;  2LJH A;  3C6M A;  1FKA E;  3N3W A;  4R2E A;  2EMF A;  4DR1 E;  2EMI A;  3JTZ A;  2RS7 A;  4F6N A;  5DNY A;  2YTO A;  4L8N A;  1JK1 A;  4DR4 E;  3M99 B;  3T1H E;  2EMW A;  2YSP A;  1ZR9 A;  4LU9 A;  2HHH E;  1X6E A;  1KYQ A;  2JY9 A;  4F6M A;  1GQE A;  2EM9 A;  4LFC E;  4RH8 A;  2DLK A;  4WSG A;  3RV1 A;  2EOY A;  1NEI A;  3JU0 A;  4F2J C;  1ZU1 A;  4KZS A;  2EOF A;  4M0V A;  3T1Y E;  2JVA A;  3ADL A;  1XNQ E;  2LUQ A;  2RPC A;  4DR6 E;  1G2F C;  2CT1 A;  4F9C B;  3J81 C;  3LLH A;  1ZBT A;  2WBT A;  1JK2 A;  2JR1 A;  2KOU A;  3RMP A;  4WSP A;  2EM5 A;  1N36 E;  2D9H A;  1YZ9 A;  2EML A;  2R1F A;  1X3C A;  2VF1 A;  4OUN A;  1IBL E;  3MHH C;  3HTX A;  4TUG A;  1WHQ A;  5F3W A;  5IWA E;  4O43 A;  4DV6 E;  1GZ6 A;  4M30 A;  5A6J A;  4R2R A;  4NZV A;  4R2A A;  1IBK E;  2EOM A;  4RHB B;  3KWR A;  3IWC A;  2ZM6 E;  1DQ3 A;  2GPI A;  3EPH A;  2LTR A;  2JOB A;  3C4T A;  4X65 E;  2KHX A;  2ENH A;  5KL4 A;  2YRH A;  2YTD A;  4DV2 E;  5T6J A;  1ZAA C;  2DLQ A;  1X6F A;  2EMB A;  3BGH A;  5KL7 A;  2EP3 A;  3EPL A;  3C4B A;  2EPU A;  3KZY A;  3L00 A;  1Z1B A;  1PDA A;  2A25 A;  4BMJ A; 
#chains in the Genus database with same CATH homology
 2V8Q B;  3ADI A;  2L2N A;  4DR5 E;  3F6G A;  3RV0 A;  2DSY A;  1T4L B;  1IBM E;  4JI5 E;  5ADZ A;  1XMO E;  1HR0 E;  1WHN A;  1SR9 A;  2FTX B;  2YZT A;  5BR8 E;  2VE7 C;  3VK6 A;  1JFZ A;  4M2Z A;  4X66 E;  3J7Y p;  4DV1 E;  2UXC E;  2FV4 B;  2ODR D;  2DB2 A;  1I4S A;  2H36 X;  2FGG A;  1X48 A;  2CPN A;  2N3G A;  4DMI A;  2NUG A;  2NUE A;  5AE3 A;  1T4O A;  4DV3 E;  2GSL A;  2K4V A;  2VQE E;  3VYY A;  4KHP E;  2V87 A;  3O2R B;  1STU A;  4LF7 E;  2V86 A;  2F4V E;  5A2Q C;  3HXL A;  2LTS A;  2LJH A;  2A11 A;  4DV4 E;  1N33 E;  1FKA E;  3N3W A;  3VYX A;  2EZ6 A;  4DV5 E;  4F9A B;  2L3C A;  5CFF E;  3OTO E;  1X47 A;  1YYW A;  2LMZ A;  2YT4 A;  3DF6 A;  3JTZ A;  3LML A;  4DR1 E;  4JI4 E;  2RS7 A;  3MSW A;  5DNY A;  4BC9 A;  2M1S A;  5FLX C;  5IT9 C;  2DMY A;  4LF4 E;  4OOG C;  4L8N A;  4X8W A;  4DR4 E;  3T1H E;  4LU9 A;  2V85 A;  1X49 A;  2HHH E;  4JI8 E;  2JY9 A;  4R03 A;  2RTX A;  1GQE A;  4AQY E;  4LFC E;  2LRS A;  4TUI A;  3RV1 A;  2V88 A;  5AE1 A;  2L3J A;  3ADJ A;  2LBS B;  5LMN E;  3JU0 A;  4J8Z A;  4BCA A;  3P1X A;  3AV0 A;  4JI7 E;  2L2K B;  4KZS A;  4JI0 E;  1T4N A;  4LF5 E;  4M0V A;  1I94 E;  3T1Y E;  2F8B A;  4DR2 E;  2E5L E;  2JVA A;  3K6Q A;  4B3T E;  1XNQ E;  2LUQ A;  4JI2 E;  3ADL A;  4DR6 E;  3HQ1 A;  4DKK A;  4F9C B;  3JAM C;  4YY3 E;  4X62 E;  1XMQ E;  2JWO A;  3J81 C;  1HNZ E;  5LL6 R;  1N34 E;  3LLH A;  4LF6 E;  1ZBT A;  4LF8 E;  4BBY A;  3AUZ A;  2JR1 A;  2UXD E;  4BS9 A;  2KOU A;  3RMP A;  2NUF A;  1QU6 A;  4WSP A;  2LUP B;  1N36 E;  1N32 E;  2MC5 A;  4DR7 E;  3FIG A;  2RS6 A;  2DIX A;  1YZ9 A;  2M7Q A;  4Q28 A;  2UU9 E;  5LMU E;  2VF1 A;  4JV5 E;  4OUN A;  4L5N C;  4WPY A;  1IBL E;  1RC5 A;  3F6H A;  3HTX A;  2MC6 A;  4TUG A;  1WHQ A;  5AE2 A;  2VQF E;  4GEQ B;  1XNR E;  1RQ0 A;  1YYK A;  2B7V A;  2M4I A;  2MDR A;  2L6M A;  2EB1 A;  4LTY A;  1WXR A;  5F3W A;  3DJW A;  4F54 A;  4LF9 E;  2KON A;  5IWA E;  4B3R E;  1J26 A;  2B7T A;  1EKZ A;  2UXB E;  4DV6 E;  3IWB A;  1GZ6 A;  2V89 A;  4R8O A;  4OX9 E;  2QVW A;  1FJG E;  4JI1 E;  1HNW E;  4M30 A;  5AAS A;  2L2M A;  3ADG A;  2UUA E;  4GKK E;  1O0W A;  3O2R A;  4B3M E;  2G7H A;  2L33 A;  1UHZ A;  4P7D A;  2UUC E;  1IBK E;  4P78 A;  1UIL A;  2FFL A;  3KWR A;  3IWC A;  2ZM6 E;  1DQ3 A;  2NA2 A;  4DR3 E;  4JI3 E;  2WZO A;  2LE2 A;  3ZOQ B;  2L8T A;  4GKJ E;  1PKP A;  4DV7 E;  2LTR A;  4LFA E;  2JOB A;  4WFT A;  3C4T A;  2UUB E;  4X65 E;  4NXN E;  2ODR C;  2KHX A;  2B9D A;  4LFB E;  1U61 A;  4BC7 A;  4F9B B;  4K0K E;  4JYA E;  4JI6 E;  4DV2 E;  4WYQ B;  3HPS A;  3J80 C;  5T6J A;  3IWD A;  2L92 A;  4I8O A;  1J5E E;  1ZBQ A;  1YYO A;  1RC7 A;  2EWL A;  2IHR 1;  4DUY E;  4DUZ E;  2B3T B;  3J7A G;  4B3S E;  2V83 A;  3C4B A;  2E1M A;  3OML A;  4DV0 E;  2N3H A;  4YHH E;  3H09 A;  3HPZ A;  2RSM A;  4BMJ A;  4X64 E;  1HNX E;  4NXM E;  2JOX A;  1DI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...