2NUFA

Crystal structure of rnase iii from aquifex aeolicus complexed with ds-rna at 2.5-angstrom resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
219
structure length
219
Chain Sequence
KMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords 28-MER
publication title A stepwise model for double-stranded RNA processing by ribonuclease III.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 77
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 2nufA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2nufA02
2YT4A 2VQFE 1JFZA 2L33A 2LJHA 2FFLA 2L2NA 4DR7E 2LBSB 4NXNE 5BR8E 1WHNA 2DB2A 4DUYE 1J26A 1EKZA 2NUGA 4DV7E 4DV6E 4DR5E 1O0WA 2A11A 2UUCE 2NA2A 2CPNA 2LTSA 5CFFE 4M2ZA 2DIXA 2LTRA 4WYQB 1RC7A 3T1YE 4GKKE 1X48A 4DR6E 1RC5A 2B7VA 4YY3E 1YYWA 4JI6E 1RQ0A 3ADLA 2L3CA 4DR3E 1XNRE 1IBKE 3RV0A 4DV5E 3ADGA 1PKPA 4X64E 2IHR1 2NUFA 4X66E 2L3JA 1IBME 1HNZE 4K0KE 1YYKA 3C4BA 2L2KB 3HTXA 1FKAE 4YHHE 4JV5E 1X47A 3OTOE 1YYOA 3J7Yp 4JYAE 3LLHA 1X49A 4WFTA 2B7TA 3ADJA 4KHPE 4JI0E 4DV3E 4JI3E 1DI2A 5LMUE 1UHZA 4AQYE 4LF7E 1ZBTA 1N33E 4DR1E 5LMNE 4JI8E 4DV4E 2UUAE 1STUA 4X8WA 1YZ9A 1T4OA 1GQEA 2VQEE 4B3RE 3VYXA 3VYYA 5IWAE 2UXCE 3ADIA 1QU6A 4DV1E 1T4NA 3O2RB 4DKKA 2MDRA 1T4LB 4LF4E 1U61A 2EB1A 4JI1E 4LF9E 2UXDE 4LFBE 1I4SA 4DR4E 4DV2E 4JI7E 4GKJE 4JI5E 2UXBE 2KHXA 1UILA 4OOGC 2RS7A 4M30A 2HHHE 4LFAE 1FJGE 4OUNA 1HR0E 2N3HA 1XNQE 4NXME 3N3WA 4DV0E 4LF6E 1HNXE 1IBLE 2LUQA 2L2MA 4DUZE 2E5LE 4JI2E 2JY9A 2ZM6E 2UUBE 2QVWA 1N34E 4LF8E 2N3GA 3P1XA 4DR2E 4OX9E 1N36E 2UU9E 4B3SE 4X65E 2LRSA 3T1HE 3O2RA 2RTXA 4LF5E 1I94E 3RV1A 2NUEA 4B3TE 1HNWE 2DMYA 2F4VE 3C4TA 2LUPB 1J5EE 1XMQE 2RS6A 2JVAA 4B3ME 4LFCE 1N32E 2EZ6A 1XMOE 4X62E 2B3TB 1WHQA 4JI4E 2RSMA 2GSLA
chains in the Genus database with same CATH superfamily
1T39A 4R2SA 1X6FA 2LBSB 5BR8E 3C6MA 2EPLX 1UN6B 2WBSA 3IWCA 3J81C 2DIXA 2LTRA 1RC7A 4R2CA 2EOEA 3T1YE 3JU0A 1RC5A 2L92A 4IJDA 4L8NA 2B7VA 3BGHA 1NEIA 4BHCA 4YY3E 3MSWA 4BCAA 2ADRA 1TN9A 2ENAA 3ADGA 3BBGA 2EN3A 1PKPA 2JWOA 2BB8A 2N8XA 1JK2A 1GTKA 3HPZA 4X64E 2DGCA 1IBME 2NUFA 1YYKA 3C4BA 2I13A 1FKAE 4JV5E 3OTOE 2EN8A 4JYAE 5IT9C 1LLMC 1P47A 1DI2A 5LMUE 5T6JA 4LF7E 1ZBTA 4DR1E 2M9AA 1YPNA 2UUAE 4F9AB 5ADZA 1SFEA 2DMIA 1T4OA 2M7QA 2E72A 2RPCA 2LO3A 4LTYA 4HEIA 2V88A 5AC4A 4ZYHA 2YSOA 2YTFA 4J8ZA 5A6KA 1WRJA 4DKKA 1F2IG 4LF4E 4JI1E 2EQ3A 4LF9E 2UXDE 4R2RA 4LFBE 1I4SA 4JI5E 1UILA 3J7AG 2RS7A 2ELYA 1A1FA 2RSIA 1A1LA 3N3WA 1NCSA 4MLQA 3JTZA 1IBLE 2L2MA 1Z1BA 2ZM6E 2EPPA 2V83A 3AUZA 5AC5A 4R2QA 2EPKX 1N34E 2DLKA 2N3GA 2EOZA 4HTGA 4OX9E 1N36E 4LU9A 4X65E 3T1HE 4R2AA 1BB8A 4WXDA 3JAMC 2EJ4A 2YTIA 2LVHA 2LMZA 2NUEA 1WXRA 1B69A 2V86A 4BC9A 2I9IA 2EMAA 1SR9A 4BS9A 2EOYA 4LFCE 2K4VA 2RS6A 1XMQE 4B3ME 2YU8A 1XMOE 2B3TB 4WSGA 2YTEA 2YTOA 2EN4A 2V89A 1KYQA 2YU5A 1JFZA 2L33A 2LJHA 4IS1C 4NXNE 2R76A 1EKZA 2MDGA 2FV4B 4O24A 1ZBQA 1A1JA 2V8QB 1QNTA 2LTSA 2EM6A 2ODRD 4M2ZA 1TF3A 2EMBA 4WYQB 4RH8A 3FIGA 4Q28A 1ZAAC 2JXPA 4GKKE 4DR6E 1YUJA 1A1HA 5KL6A 2NABA 2HJJA 1G2FC 2EM2A 2EMLA 4JI6E 4WSPA 5KL3A 3ADLA 2LE2A 2ELZA 2YSPA 2EMZA 2L3CA 2EPXA 2LJUA 1IBKE 1L4SA 4DV5E 2LT7A 3F6HA 2BBGA 4YHHE 2G7HA 4R2DA 1YUIA 1X49A 3ADJA 4KHPE 3LMLA 1PJSA 4N4RB 4DV3E 2EL5A 4L5NC 4ZYEA 5LMNE 4DV4E 1UBDC 1STUA 1WJPA 4R8OA 1YZ9A 5FLXC 2KONA 4B3RE 3VYYA 2EE8A 2EN7A 4KZSA 4WXCA 1T38A 3ADIA 4DV1E 4BC7A 5AE3A 4ZYDA 3THNA 2JPAA 1X3CA 2MDRA 1IMUA 3EPJA 2ENHA 2J7JA 2EM9A 2EPNA 5AE2A 2EWLA 4DV2E 4JI7E 2WZOA 2UXBE 2FTXB 2EOSA 3VK6A 5A6BA 3EPLA 5F3WA 2HHHE 5KL7A 2YTQA 3EPKA 2N3HA 2D9HA 4NXME 1EH8A 1A1KA 2LUQA 4R2EA 2EPAA 4JI2E 2L6MA 2EPOA 1DGCA 3P1XA 4TUIA 2EPZA 2LCEA 2B9DA 2YRHA 4F6MA 2EOJA 2EOOA 1AAYA 2HC5A 5A6AA 4R2PA 1YFHA 1N32E 2EOQA 2YZTA 1N3GA 2EMKA 1BBOA 3ECRA 2E1MA 2RSMA 2GLIA 1X6HA 2ODRC 2YWQA 3DJWA 3MHSC 2VQFE 3OMLA 3ZOQB 2FFLA 2EMWA 2EPUA 5AASA 1X5WA 5LL6R 1WHNA 1X6EA 2YPNA 2DRPA 4DV7E 4DV6E 1O0WA 2A11A 2UUCE 2CPNA 5CFFE 4F9BB 2EMHA 2V85A 1IQSA 4Q35B 2CT1A 2DSYA 1PJQA 2H36X 3IWDA 2VE7C 4GEQB 1YYWA 2CSHA 3EQ1A 1RQ0A 4P7DA 2EM4A 2VRDA 3RV0A 2YRMA 5A6JA 2IHR1 2L3JA 4X66E 1HNZE 4K0KE 2EL4A 2EN6A 3THOB 3HTXA 1X47A 3VHTB 3J7Yp 2B7TA 2YTJA 4JI0E 3BIDA 4F54A 4WX9A 2EOIA 1UHZA 4AQYE 5KL2A 5IXMB 4ZYGA 2MKDA 1GZ6A 3QG5C 1RMDA 2VQEE 2K7IA 3VYXA 5IWAE 4MLVA 2UXCE 3DF6A 1QU6A 3IWBA 1T4NA 3O2RB 4BBYA 4NHRA 2YRKA 4OOGC 2A25A 1PJTA 3C6KA 2V87A 2KOUA 2LV2A 3BF2A 4LFAE 2WBUA 1HR0E 2EMIA 4I8OA 4LF6E 2YTDA 1HNXE 2Q8UA 2EM3A 2JY9A 3MHHC 2UUBE 5A6BD 2EL6A 3KZZA 4M0VA 4LF8E 2EPCA 2UU9E 4DMIA 4B3SE 4F6NA 3AV0A 3O2RA 2RTXA 4LF5E 5A2QC 2JOXA 2EOMA 2EM8A 2EMCA 2GHFA 4NZVA 2DLQA 2EM7A 1YSAC 2EM5A 2DMYA 2F4VE 3C4TA 2EZ6A 2R1FA 4O5GA 4X62E 1WHQA 4JI4E 2GSLA 2JOBA 2EN1A 1DQ3A 2YT4A 1G2DC 2FGGA 3RMPA 2L2NA 1ZTDA 4DR7E 2JR1A 5A69A 2EOFA 2DB2A 4DUYE 1J26A 2NUGA 5DNYA 1JK1A 4O4KA 4DR5E 4M9VC 2CTDA 3KWRA 4P78A 1MEYC 2YTNA 2NA2A 3K6QA 2WCC3 5AE1A 2VF1A 1X48A 2ENCA 2EMXA 2EQ0A 2EMYA 3M99B 4DR3E 2L8TA 1EH6A 1XNRE 1ZU1A 3KZYA 3HPSA 1BBGA 5KL5A 2EMFA 2GPIA 2L2KB 2M1SA 3F6GA 3H09A 1YYOA 1A1GA 1MGTA 3LLHA 4WFTA 5LLQA 2EQ1A 4BMJA 1TF6A 2MC5A 4O43A 4JI3E 3L00A 1N33E 5KL4A 4X9JA 4JI8E 4X8WA 2EPMX 1GQEA 4WPYA 2EPRA 2JP9A 1PDAA 4F2JC 3HQ1A 1EH7A 5TSEA 1ZR9A 1T4LB 2EORA 1U61A 2EB1A 2EOHA 4DR4E 4GKJE 2MKNA 4BHBA 2KHXA 2PRTA 5IV8B 4M30A 1FJGE 4OUNA 2EP3A 2JYAA 2YTPA 4FK5C 4TUGA 1XNQE 4DV0E 2F8BA 2MC6A 2YTGA 4F9CB 2E5LE 4DUZE 4R03A 3TQMA 3EPHA 2QVWA 2HGHA 2EM0A 2WBTA 2RQLA 2EOXA 2LRSA 1A1IA 2EN2A 2EMGA 1I94E 3HXLA 3RV1A 3UK3C 4KWYA 4B3TE 1KJKA 4GZNC 1HNWE 1IQOA 1J5EE 2LUPB 3J80C 2JVAA 4RHBB 2M4IA 1AH5A 4DR2E
chains in the Genus database with same CATH topology
2ODRC 3DJWA 1DQ3A 2YT4A 2VQFE 1JFZA 2FGGA 2L33A 2FFLA 2L2NA 2LJHA 3OMLA 3ZOQB 3RMPA 4DR7E 5AASA 2LBSB 4NXNE 2JR1A 5LL6R 5BR8E 1WHNA 2DB2A 4DUYE 1J26A 1EKZA 2NUGA 5DNYA 4DV7E 4DV6E 4DR5E 1O0WA 2FV4B 2A11A 3IWCA 3KWRA 4P78A 1ZBQA 3K6QA 2NA2A 2CPNA 2UUCE 3J81C 2V8QB 2LTSA 5CFFE 2ODRD 4M2ZA 5AE1A 4F9BB 2DIXA 2LTRA 4WYQB 1RC7A 2VF1A 2V85A 3FIGA 4Q28A 3T1YE 4GKKE 1X48A 3JU0A 4DR6E 1RC5A 2L92A 2DSYA 4L8NA 2B7VA 2H36X 3IWDA 4YY3E 2VE7C 3MSWA 4GEQB 1YYWA 4BCAA 4WSPA 4JI6E 1RQ0A 4P7DA 3ADLA 2LE2A 2L3CA 4DR3E 2L8TA 1XNRE 1IBKE 3RV0A 4DV5E 3ADGA 1PKPA 2JWOA 3HPZA 4X64E 2IHR1 2NUFA 3F6HA 4X66E 2L3JA 1HNZE 3HPSA 1IBME 4K0KE 1YYKA 3C4BA 2L2KB 3HTXA 1FKAE 2M1SA 3F6GA 1X47A 4YHHE 3H09A 3OTOE 4JV5E 2G7HA 1YYOA 3J7Yp 4JYAE 3LLHA 1X49A 4WFTA 2B7TA 5IT9C 3ADJA 4BMJA 4KHPE 3LMLA 4JI0E 4F54A 4DV3E 2MC5A 4JI3E 4L5NC 1DI2A 5LMUE 1UHZA 5T6JA 4AQYE 1ZBTA 4LF7E 1N33E 4DR1E 5LMNE 4JI8E 4DV4E 2UUAE 4F9AB 1STUA 1GZ6A 4R8OA 4X8WA 1YZ9A 5ADZA 5FLXC 1T4OA 1GQEA 2KONA 4LTYA 4WPYA 2M7QA 2VQEE 3VYXA 4B3RE 3VYYA 2V88A 5IWAE 4KZSA 2UXCE 3DF6A 3HQ1A 4J8ZA 3ADIA 1QU6A 3IWBA 4BC7A 4DV1E 5AE3A 1T4NA 3O2RB 4DKKA 2MDRA 1T4LB 4LF4E 1U61A 2EB1A 4JI1E 4LF9E 2UXDE 5AE2A 4LFBE 2EWLA 1I4SA 4DR4E 4BBYA 4JI7E 4DV2E 4GKJE 2WZOA 4JI5E 2FTXB 2KHXA 2UXBE 1UILA 4OOGC 3J7AG 3VK6A 2V87A 2KOUA 4M30A 2RS7A 5F3WA 2HHHE 4OUNA 1HR0E 4LFAE 4TUGA 1FJGE 2N3HA 1XNQE 4NXME 3N3WA 4I8OA 2F8BA 4DV0E 1HNXE 4LF6E 2MC6A 3JTZA 4F9CB 2L2MA 2LUQA 4DUZE 1IBLE 4R03A 2JY9A 2ZM6E 2E5LE 2UUBE 2L6MA 4JI2E 2V83A 4M0VA 3AUZA 2QVWA 1N34E 4LF8E 2N3GA 3P1XA 4TUIA 4DR2E 4OX9E 1N36E 4DMIA 2UU9E 4B3SE 4LU9A 4X65E 2B9DA 2LRSA 3T1HE 3AV0A 3O2RA 2RTXA 3JAMC 4LF5E 1I94E 3RV1A 2LMZA 2NUEA 2JOXA 3HXLA 2V86A 4BC9A 1WXRA 5A2QC 1N32E 4B3TE 1SR9A 1HNWE 4BS9A 2DMYA 2F4VE 3C4TA 2LUPB 1J5EE 2K4VA 2RS6A 2JVAA 3J80C 1XMQE 4B3ME 2EZ6A 4LFCE 2YZTA 1XMOE 2M4IA 4X62E 2B3TB 1WHQA 4JI4E 2E1MA 2RSMA 2GSLA 2JOBA 2V89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YT4 A;  2VQF E;  1JFZ A;  2L33 A;  2LJH A;  2FFL A;  2L2N A;  4DR7 E;  2LBS B;  4NXN E;  5BR8 E;  1WHN A;  2DB2 A;  4DUY E;  1J26 A;  1EKZ A;  2NUG A;  4DV7 E;  4DV6 E;  4DR5 E;  1O0W A;  2A11 A;  2UUC E;  2NA2 A;  2CPN A;  2LTS A;  5CFF E;  4M2Z A;  2DIX A;  2LTR A;  4WYQ B;  1RC7 A;  3T1Y E;  4GKK E;  1X48 A;  4DR6 E;  1RC5 A;  2B7V A;  4YY3 E;  1YYW A;  4JI6 E;  1RQ0 A;  3ADL A;  2L3C A;  4DR3 E;  1XNR E;  1IBK E;  3RV0 A;  4DV5 E;  3ADG A;  1PKP A;  4X64 E;  2IHR 1;  2NUF A;  4X66 E;  2L3J A;  1IBM E;  1HNZ E;  4K0K E;  1YYK A;  3C4B A;  2L2K B;  3HTX A;  1FKA E;  4YHH E;  4JV5 E;  1X47 A;  3OTO E;  1YYO A;  3J7Y p;  4JYA E;  3LLH A;  1X49 A;  4WFT A;  2B7T A;  3ADJ A;  4KHP E;  4JI0 E;  4DV3 E;  4JI3 E;  1DI2 A;  5LMU E;  1UHZ A;  4AQY E;  4LF7 E;  1ZBT A;  1N33 E;  4DR1 E;  5LMN E;  4JI8 E;  4DV4 E;  2UUA E;  1STU A;  4X8W A;  1YZ9 A;  1T4O A;  1GQE A;  2VQE E;  4B3R E;  3VYX A;  3VYY A;  5IWA E;  2UXC E;  3ADI A;  1QU6 A;  4DV1 E;  1T4N A;  3O2R B;  4DKK A;  2MDR A;  1T4L B;  4LF4 E;  1U61 A;  2EB1 A;  4JI1 E;  4LF9 E;  2UXD E;  4LFB E;  1I4S A;  4DR4 E;  4DV2 E;  4JI7 E;  4GKJ E;  4JI5 E;  2UXB E;  2KHX A;  1UIL A;  4OOG C;  2RS7 A;  4M30 A;  2HHH E;  4LFA E;  1FJG E;  4OUN A;  1HR0 E;  2N3H A;  1XNQ E;  4NXM E;  3N3W A;  4DV0 E;  4LF6 E;  1HNX E;  1IBL E;  2LUQ A;  2L2M A;  4DUZ E;  2E5L E;  4JI2 E;  2JY9 A;  2ZM6 E;  2UUB E;  2QVW A;  1N34 E;  4LF8 E;  2N3G A;  3P1X A;  4DR2 E;  4OX9 E;  1N36 E;  2UU9 E;  4B3S E;  4X65 E;  2LRS A;  3T1H E;  3O2R A;  2RTX A;  4LF5 E;  1I94 E;  3RV1 A;  2NUE A;  4B3T E;  1HNW E;  2DMY A;  2F4V E;  3C4T A;  2LUP B;  1J5E E;  1XMQ E;  2RS6 A;  2JVA A;  4B3M E;  4LFC E;  1N32 E;  2EZ6 A;  1XMO E;  4X62 E;  2B3T B;  1WHQ A;  4JI4 E;  2RSM A;  2GSL A; 
#chains in the Genus database with same CATH topology
 1T39 A;  4R2S A;  1X6F A;  2LBS B;  5BR8 E;  3C6M A;  2EPL X;  1UN6 B;  2WBS A;  3IWC A;  3J81 C;  2DIX A;  2LTR A;  1RC7 A;  4R2C A;  2EOE A;  3T1Y E;  3JU0 A;  1RC5 A;  2L92 A;  4IJD A;  4L8N A;  2B7V A;  3BGH A;  1NEI A;  4BHC A;  4YY3 E;  3MSW A;  4BCA A;  2ADR A;  1TN9 A;  2ENA A;  3ADG A;  3BBG A;  2EN3 A;  1PKP A;  2JWO A;  2BB8 A;  2N8X A;  1JK2 A;  1GTK A;  3HPZ A;  4X64 E;  2DGC A;  1IBM E;  2NUF A;  1YYK A;  3C4B A;  2I13 A;  1FKA E;  4JV5 E;  3OTO E;  2EN8 A;  4JYA E;  5IT9 C;  1LLM C;  1P47 A;  1DI2 A;  5LMU E;  5T6J A;  4LF7 E;  1ZBT A;  4DR1 E;  2M9A A;  1YPN A;  2UUA E;  4F9A B;  5ADZ A;  1SFE A;  2DMI A;  1T4O A;  2M7Q A;  2E72 A;  2RPC A;  2LO3 A;  4LTY A;  4HEI A;  2V88 A;  5AC4 A;  4ZYH A;  2YSO A;  2YTF A;  4J8Z A;  5A6K A;  1WRJ A;  4DKK A;  1F2I G;  4LF4 E;  4JI1 E;  2EQ3 A;  4LF9 E;  2UXD E;  4R2R A;  4LFB E;  1I4S A;  4JI5 E;  1UIL A;  3J7A G;  2RS7 A;  2ELY A;  1A1F A;  2RSI A;  1A1L A;  3N3W A;  1NCS A;  4MLQ A;  3JTZ A;  1IBL E;  2L2M A;  1Z1B A;  2ZM6 E;  2EPP A;  2V83 A;  3AUZ A;  5AC5 A;  4R2Q A;  2EPK X;  1N34 E;  2DLK A;  2N3G A;  2EOZ A;  4HTG A;  4OX9 E;  1N36 E;  4LU9 A;  4X65 E;  3T1H E;  4R2A A;  1BB8 A;  4WXD A;  3JAM C;  2EJ4 A;  2YTI A;  2LVH A;  2LMZ A;  2NUE A;  1WXR A;  1B69 A;  2V86 A;  4BC9 A;  2I9I A;  2EMA A;  1SR9 A;  4BS9 A;  2EOY A;  4LFC E;  2K4V A;  2RS6 A;  1XMQ E;  4B3M E;  2YU8 A;  1XMO E;  2B3T B;  4WSG A;  2YTE A;  2YTO A;  2EN4 A;  2V89 A;  1KYQ A;  2YU5 A;  1JFZ A;  2L33 A;  2LJH A;  4IS1 C;  4NXN E;  2R76 A;  1EKZ A;  2MDG A;  2FV4 B;  4O24 A;  1ZBQ A;  1A1J A;  2V8Q B;  1QNT A;  2LTS A;  2EM6 A;  2ODR D;  4M2Z A;  1TF3 A;  2EMB A;  4WYQ B;  4RH8 A;  3FIG A;  4Q28 A;  1ZAA C;  2JXP A;  4GKK E;  4DR6 E;  1YUJ A;  1A1H A;  5KL6 A;  2NAB A;  2HJJ A;  1G2F C;  2EM2 A;  2EML A;  4JI6 E;  4WSP A;  5KL3 A;  3ADL A;  2LE2 A;  2ELZ A;  2YSP A;  2EMZ A;  2L3C A;  2EPX A;  2LJU A;  1IBK E;  1L4S A;  4DV5 E;  2LT7 A;  3F6H A;  2BBG A;  4YHH E;  2G7H A;  4R2D A;  1YUI A;  1X49 A;  3ADJ A;  4KHP E;  3LML A;  1PJS A;  4N4R B;  4DV3 E;  2EL5 A;  4L5N C;  4ZYE A;  5LMN E;  4DV4 E;  1UBD C;  1STU A;  1WJP A;  4R8O A;  1YZ9 A;  5FLX C;  2KON A;  4B3R E;  3VYY A;  2EE8 A;  2EN7 A;  4KZS A;  4WXC A;  1T38 A;  3ADI A;  4DV1 E;  4BC7 A;  5AE3 A;  4ZYD A;  3THN A;  2JPA A;  1X3C A;  2MDR A;  1IMU A;  3EPJ A;  2ENH A;  2J7J A;  2EM9 A;  2EPN A;  5AE2 A;  2EWL A;  4DV2 E;  4JI7 E;  2WZO A;  2UXB E;  2FTX B;  2EOS A;  3VK6 A;  5A6B A;  3EPL A;  5F3W A;  2HHH E;  5KL7 A;  2YTQ A;  3EPK A;  2N3H A;  2D9H A;  4NXM E;  1EH8 A;  1A1K A;  2LUQ A;  4R2E A;  2EPA A;  4JI2 E;  2L6M A;  2EPO A;  1DGC A;  3P1X A;  4TUI A;  2EPZ A;  2LCE A;  2B9D A;  2YRH A;  4F6M A;  2EOJ A;  2EOO A;  1AAY A;  2HC5 A;  5A6A A;  4R2P A;  1YFH A;  1N32 E;  2EOQ A;  2YZT A;  1N3G A;  2EMK A;  1BBO A;  3ECR A;  2E1M A;  2RSM A;  2GLI A;  1X6H A;  2ODR C;  2YWQ A;  3DJW A;  3MHS C;  2VQF E;  3OML A;  3ZOQ B;  2FFL A;  2EMW A;  2EPU A;  5AAS A;  1X5W A;  5LL6 R;  1WHN A;  1X6E A;  2YPN A;  2DRP A;  4DV7 E;  4DV6 E;  1O0W A;  2A11 A;  2UUC E;  2CPN A;  5CFF E;  4F9B B;  2EMH A;  2V85 A;  1IQS A;  4Q35 B;  2CT1 A;  2DSY A;  1PJQ A;  2H36 X;  3IWD A;  2VE7 C;  4GEQ B;  1YYW A;  2CSH A;  3EQ1 A;  1RQ0 A;  4P7D A;  2EM4 A;  2VRD A;  3RV0 A;  2YRM A;  5A6J A;  2IHR 1;  2L3J A;  4X66 E;  1HNZ E;  4K0K E;  2EL4 A;  2EN6 A;  3THO B;  3HTX A;  1X47 A;  3VHT B;  3J7Y p;  2B7T A;  2YTJ A;  4JI0 E;  3BID A;  4F54 A;  4WX9 A;  2EOI A;  1UHZ A;  4AQY E;  5KL2 A;  5IXM B;  4ZYG A;  2MKD A;  1GZ6 A;  3QG5 C;  1RMD A;  2VQE E;  2K7I A;  3VYX A;  5IWA E;  4MLV A;  2UXC E;  3DF6 A;  1QU6 A;  3IWB A;  1T4N A;  3O2R B;  4BBY A;  4NHR A;  2YRK A;  4OOG C;  2A25 A;  1PJT A;  3C6K A;  2V87 A;  2KOU A;  2LV2 A;  3BF2 A;  4LFA E;  2WBU A;  1HR0 E;  2EMI A;  4I8O A;  4LF6 E;  2YTD A;  1HNX E;  2Q8U A;  2EM3 A;  2JY9 A;  3MHH C;  2UUB E;  5A6B D;  2EL6 A;  3KZZ A;  4M0V A;  4LF8 E;  2EPC A;  2UU9 E;  4DMI A;  4B3S E;  4F6N A;  3AV0 A;  3O2R A;  2RTX A;  4LF5 E;  5A2Q C;  2JOX A;  2EOM A;  2EM8 A;  2EMC A;  2GHF A;  4NZV A;  2DLQ A;  2EM7 A;  1YSA C;  2EM5 A;  2DMY A;  2F4V E;  3C4T A;  2EZ6 A;  2R1F A;  4O5G A;  4X62 E;  1WHQ A;  4JI4 E;  2GSL A;  2JOB A;  2EN1 A;  1DQ3 A;  2YT4 A;  1G2D C;  2FGG A;  3RMP A;  2L2N A;  1ZTD A;  4DR7 E;  2JR1 A;  5A69 A;  2EOF A;  2DB2 A;  4DUY E;  1J26 A;  2NUG A;  5DNY A;  1JK1 A;  4O4K A;  4DR5 E;  4M9V C;  2CTD A;  3KWR A;  4P78 A;  1MEY C;  2YTN A;  2NA2 A;  3K6Q A;  2WCC 3;  5AE1 A;  2VF1 A;  1X48 A;  2ENC A;  2EMX A;  2EQ0 A;  2EMY A;  3M99 B;  4DR3 E;  2L8T A;  1EH6 A;  1XNR E;  1ZU1 A;  3KZY A;  3HPS A;  1BBG A;  5KL5 A;  2EMF A;  2GPI A;  2L2K B;  2M1S A;  3F6G A;  3H09 A;  1YYO A;  1A1G A;  1MGT A;  3LLH A;  4WFT A;  5LLQ A;  2EQ1 A;  4BMJ A;  1TF6 A;  2MC5 A;  4O43 A;  4JI3 E;  3L00 A;  1N33 E;  5KL4 A;  4X9J A;  4JI8 E;  4X8W A;  2EPM X;  1GQE A;  4WPY A;  2EPR A;  2JP9 A;  1PDA A;  4F2J C;  3HQ1 A;  1EH7 A;  5TSE A;  1ZR9 A;  1T4L B;  2EOR A;  1U61 A;  2EB1 A;  2EOH A;  4DR4 E;  4GKJ E;  2MKN A;  4BHB A;  2KHX A;  2PRT A;  5IV8 B;  4M30 A;  1FJG E;  4OUN A;  2EP3 A;  2JYA A;  2YTP A;  4FK5 C;  4TUG A;  1XNQ E;  4DV0 E;  2F8B A;  2MC6 A;  2YTG A;  4F9C B;  2E5L E;  4DUZ E;  4R03 A;  3TQM A;  3EPH A;  2QVW A;  2HGH A;  2EM0 A;  2WBT A;  2RQL A;  2EOX A;  2LRS A;  1A1I A;  2EN2 A;  2EMG A;  1I94 E;  3HXL A;  3RV1 A;  3UK3 C;  4KWY A;  4B3T E;  1KJK A;  4GZN C;  1HNW E;  1IQO A;  1J5E E;  2LUP B;  3J80 C;  2JVA A;  4RHB B;  2M4I A;  1AH5 A;  4DR2 E; 
#chains in the Genus database with same CATH homology
 2ODR C;  3DJW A;  1DQ3 A;  2YT4 A;  2VQF E;  1JFZ A;  2FGG A;  2L33 A;  2FFL A;  2L2N A;  2LJH A;  3OML A;  3ZOQ B;  3RMP A;  4DR7 E;  5AAS A;  2LBS B;  4NXN E;  2JR1 A;  5LL6 R;  5BR8 E;  1WHN A;  2DB2 A;  4DUY E;  1J26 A;  1EKZ A;  2NUG A;  5DNY A;  4DV7 E;  4DV6 E;  4DR5 E;  1O0W A;  2FV4 B;  2A11 A;  3IWC A;  3KWR A;  4P78 A;  1ZBQ A;  3K6Q A;  2NA2 A;  2CPN A;  2UUC E;  3J81 C;  2V8Q B;  2LTS A;  5CFF E;  2ODR D;  4M2Z A;  5AE1 A;  4F9B B;  2DIX A;  2LTR A;  4WYQ B;  1RC7 A;  2VF1 A;  2V85 A;  3FIG A;  4Q28 A;  3T1Y E;  4GKK E;  1X48 A;  3JU0 A;  4DR6 E;  1RC5 A;  2L92 A;  2DSY A;  4L8N A;  2B7V A;  2H36 X;  3IWD A;  4YY3 E;  2VE7 C;  3MSW A;  4GEQ B;  1YYW A;  4BCA A;  4WSP A;  4JI6 E;  1RQ0 A;  4P7D A;  3ADL A;  2LE2 A;  2L3C A;  4DR3 E;  2L8T A;  1XNR E;  1IBK E;  3RV0 A;  4DV5 E;  3ADG A;  1PKP A;  2JWO A;  3HPZ A;  4X64 E;  2IHR 1;  2NUF A;  3F6H A;  4X66 E;  2L3J A;  1HNZ E;  3HPS A;  1IBM E;  4K0K E;  1YYK A;  3C4B A;  2L2K B;  3HTX A;  1FKA E;  2M1S A;  3F6G A;  1X47 A;  4YHH E;  3H09 A;  3OTO E;  4JV5 E;  2G7H A;  1YYO A;  3J7Y p;  4JYA E;  3LLH A;  1X49 A;  4WFT A;  2B7T A;  5IT9 C;  3ADJ A;  4BMJ A;  4KHP E;  3LML A;  4JI0 E;  4F54 A;  4DV3 E;  2MC5 A;  4JI3 E;  4L5N C;  1DI2 A;  5LMU E;  1UHZ A;  5T6J A;  4AQY E;  1ZBT A;  4LF7 E;  1N33 E;  4DR1 E;  5LMN E;  4JI8 E;  4DV4 E;  2UUA E;  4F9A B;  1STU A;  1GZ6 A;  4R8O A;  4X8W A;  1YZ9 A;  5ADZ A;  5FLX C;  1T4O A;  1GQE A;  2KON A;  4LTY A;  4WPY A;  2M7Q A;  2VQE E;  3VYX A;  4B3R E;  3VYY A;  2V88 A;  5IWA E;  4KZS A;  2UXC E;  3DF6 A;  3HQ1 A;  4J8Z A;  3ADI A;  1QU6 A;  3IWB A;  4BC7 A;  4DV1 E;  5AE3 A;  1T4N A;  3O2R B;  4DKK A;  2MDR A;  1T4L B;  4LF4 E;  1U61 A;  2EB1 A;  4JI1 E;  4LF9 E;  2UXD E;  5AE2 A;  4LFB E;  2EWL A;  1I4S A;  4DR4 E;  4BBY A;  4JI7 E;  4DV2 E;  4GKJ E;  2WZO A;  4JI5 E;  2FTX B;  2KHX A;  2UXB E;  1UIL A;  4OOG C;  3J7A G;  3VK6 A;  2V87 A;  2KOU A;  4M30 A;  2RS7 A;  5F3W A;  2HHH E;  4OUN A;  1HR0 E;  4LFA E;  4TUG A;  1FJG E;  2N3H A;  1XNQ E;  4NXM E;  3N3W A;  4I8O A;  2F8B A;  4DV0 E;  1HNX E;  4LF6 E;  2MC6 A;  3JTZ A;  4F9C B;  2L2M A;  2LUQ A;  4DUZ E;  1IBL E;  4R03 A;  2JY9 A;  2ZM6 E;  2E5L E;  2UUB E;  2L6M A;  4JI2 E;  2V83 A;  4M0V A;  3AUZ A;  2QVW A;  1N34 E;  4LF8 E;  2N3G A;  3P1X A;  4TUI A;  4DR2 E;  4OX9 E;  1N36 E;  4DMI A;  2UU9 E;  4B3S E;  4LU9 A;  4X65 E;  2B9D A;  2LRS A;  3T1H E;  3AV0 A;  3O2R A;  2RTX A;  3JAM C;  4LF5 E;  1I94 E;  3RV1 A;  2LMZ A;  2NUE A;  2JOX A;  3HXL A;  2V86 A;  4BC9 A;  1WXR A;  5A2Q C;  1N32 E;  4B3T E;  1SR9 A;  1HNW E;  4BS9 A;  2DMY A;  2F4V E;  3C4T A;  2LUP B;  1J5E E;  2K4V A;  2RS6 A;  2JVA A;  3J80 C;  1XMQ E;  4B3M E;  2EZ6 A;  4LFC E;  2YZT A;  1XMO E;  2M4I A;  4X62 E;  2B3T B;  1WHQ A;  4JI4 E;  2E1M A;  2RSM A;  2GSL A;  2JOB A;  2V89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...