2NUFA

Crystal structure of rnase iii from aquifex aeolicus complexed with ds-rna at 2.5-angstrom resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
219
structure length
219
Chain Sequence
KMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A stepwise model for double-stranded RNA processing by ribonuclease III.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
molecule keywords 28-MER
total genus 77
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 2nufA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2nufA02
5LMUE 2CPNA 4JI1E 1JFZA 4B3RE 4DR1E 1DI2A 2L2MA 1HNZE 4YHHE 2LUPB 3N3WA 2L33A 2L3JA 2E5LE 4B3TE 1XNRE 3HTXA 4X8WA 5CFFE 3O2RA 4DV5E 1HR0E 1XMOE 1O0WA 4B3ME 4DR3E 4X66E 4JI3E 2RS7A 2GSLA 3OTOE 2N3HA 4DR6E 3ADIA 4JI5E 3VYXA 2EB1A 3ADLA 4DKKA 2MDRA 2EZ6A 3T1HE 4JI0E 1T4LB 1IBKE 1XMQE 2RS6A 1J26A 4DV1E 4LF4E 1FKAE 2KHXA 4DR5E 1N34E 4B3SE 4JI2E 4DV0E 2L2KB 1RC7A 1X47A 2DMYA 3J7Yp 4JI4E 4DV6E 2NA2A 4NXNE 2LUQA 4X64E 2NUEA 4X65E 3T1YE 2DIXA 4OOGC 2F4VE 2ZM6E 2JY9A 4LF9E 1X48A 1UILA 3ADGA 2B7TA 2YT4A 4JI7E 3C4TA 2UUCE 1GQEA 2VQFE 2UUAE 4LFAE 5IWAE 2RTXA 4LF6E 4LFCE 2VQEE 2NUGA 3C4BA 2FFLA 1HNWE 2LTRA 4KHPE 2B3TB 2LRSA 2N3GA 1U61A 5LMNE 1YYOA 4DR2E 2A11A 4DR4E 2NUFA 1IBME 1WHNA 4GKJE 5BR8E 1YYKA 4DV7E 4DV2E 1J5EE 4LF5E 2JVAA 4DV3E 4M2ZA 2QVWA 1YZ9A 4OX9E 2IHR1 2DB2A 1N32E 1N33E 4DV4E 1EKZA 4WYQB 1N36E 4LFBE 4GKKE 4M30A 4OUNA 2HHHE 2LJHA 1T4NA 1T4OA 3LLHA 1ZBTA 3ADJA 1IBLE 1XNQE 4JV5E 2UUBE 2UXBE 1RQ0A 4WFTA 3RV0A 2L3CA 4JI6E 2UXCE 4DR7E 1PKPA 1QU6A 4JYAE 4LF7E 4YY3E 2UXDE 4JI8E 4X62E 4LF8E 2L2NA 3O2RB 1WHQA 4DUZE 2UU9E 1I4SA 1UHZA 1X49A 2LBSB 4DUYE 3P1XA 4NXME 1STUA 3RV1A 1I94E 1YYWA 2B7VA 1HNXE 1RC5A 4AQYE 4K0KE 2LTSA 2RSMA 3VYYA 1FJGE
chains in the Genus database with same CATH superfamily
2YTIA 4DR1E 1QNTA 3ZOQB 1AAYA 2EMKA 2MC5A 4R2CA 1HNZE 2LUPB 1PJSA 4MLQA 2E72A 3C6MA 1T38A 1UN6B 2YU5A 1PJQA 4DV5E 4BHBA 2EN6A 3UK3C 4IJDA 4R03A 4Q28A 3AV0A 3OTOE 3LMLA 2EM9A 4WSGA 4F6NA 4DR6E 4JI5E 3VYXA 2YPNA 2EB1A 4F2JC 4DKKA 4M9VC 3J7AG 1P47A 4JI0E 2YTQA 1XMQE 2ODRD 2RS6A 5KL3A 5F3WA 1X6EA 1A1FA 2LE2A 4B3SE 4DV0E 2V87A 2EPKX 2DMYA 3BIDA 2DIXA 2LT7A 4ZYDA 3C4TA 2EN8A 2R1FA 5LL6R 1GQEA 5IWAE 4BS9A 2RPCA 2RTXA 2H36X 1GTKA 2KOUA 5IXMB 2DRPA 2MDGA 1HNWE 5A6BA 4KHPE 2M9AA 4R2RA 1U61A 4DR2E 2A11A 2FTXB 3ECRA 4BC9A 2RQLA 2JOBA 3BBGA 2EQ1A 2GLIA 4LF5E 2L6MA 4BC7A 2YWQA 4FK5C 1YZ9A 4OX9E 1A1IA 2EN2A 1N33E 3F6HA 4L8NA 4LFBE 4LTYA 2HHHE 4F9CB 3K6QA 1T4NA 2J7JA 1XNQE 2UXBE 5A6KA 5TSEA 2V8QB 1QU6A 2EMBA 1G2FC 2FGGA 2EQ3A 2VRDA 4JI8E 4O5GA 4X62E 3EPLA 1JK1A 3O2RB 2NABA 1WHQA 1EH7A 1PJTA 5AASA 1I4SA 1NEIA 5A69A 1UHZA 1X49A 4DMIA 2LCEA 3RV1A 5IT9C 2I13A 1YYWA 1RC5A 2EPOA 4NZVA 1X5WA 4B3RE 5AC5A 1DGCA 1WRJA 5CFFE 4LU9A 4L5NC 2JXPA 2M4IA 1HR0E 1WJPA 4ZYGA 1O0WA 3KZZA 2EL4A 2EOZA 2EMIA 2JOXA 2WBUA 4R2DA 1LLMC 2N3HA 3ADIA 2EMZA 1PDAA 2DLQA 2EMFA 1TF6A 2EP3A 5FLXC 2V83A 1IBKE 2CSHA 4HTGA 2FV4B 2MKDA 5AE3A 4DV1E 2EMGA 5DNYA 2R76A 1FKAE 3QG5C 4RHBB 4ZYEA 1YSAC 4F6MA 2L2KB 1X47A 1A1HA 3HQ1A 4O43A 2NA2A 2EN1A 2LUQA 4J8ZA 2YSPA 4WSPA 1X48A 1UILA 2B7TA 2YT4A 2EM0A 4GEQB 2JR1A 2WBSA 2EJ4A 4R2AA 2CT1A 4LF6E 2VQEE 3IWCA 2NUGA 2FFLA 2EORA 2LJUA 3BGHA 5LMNE 3VHTB 3FIGA 1WHNA 2EL6A 2EOIA 3EQ1A 2EM8A 1JK2A 3KZYA 2EN4A 2N8XA 4DV4E 3HPZA 4WYQB 1F2IG 5A6BD 4TUGA 2L92A 4M30A 1ZR9A 5A6AA 1B69A 4JV5E 3LLHA 3ADJA 1IBLE 1WXRA 1RQ0A 2UXCE 2YTJA 1PKPA 4R8OA 1TN9A 2EMCA 2M1SA 1T39A 3VK6A 2LO3A 2MKNA 3M99B 2L2NA 1ZBQA 1EH6A 2UU9E 4O24A 3HPSA 2K7IA 1BBGA 2EMAA 4DUYE 2EN7A 5AE2A 4NXME 2EM5A 1ZAAC 1I94E 2B7VA 1HNXE 1L4SA 2RSMA 4MLVA 2YSOA 4ZYHA 5T6JA 5LMUE 2LVHA 2EMWA 2I9IA 2BB8A 1DI2A 1SFEA 5ADZA 1ZU1A 4YHHE 2EM3A 2L3JA 2E5LE 4B3TE 1XNRE 4X8WA 3IWBA 1IQOA 2EPLX 2B9DA 4X66E 4JI3E 2GSLA 4GZNC 2YTFA 1IMUA 3RMPA 2ENAA 2VE7C 2YRMA 2M7QA 2MC6A 2MDRA 2EZ6A 4Q35B 2ENCA 2G7HA 2EM6A 2YTPA 2EWLA 2KHXA 4DR5E 1N34E 2GPIA 1GZ6A 5KL6A 1N3GA 3J7Yp 2GHFA 2ODRC 3KWRA 2JPAA 2DMIA 2YTNA 4NXNE 4X64E 2NUEA 2A25A 1NCSA 3T1YE 4OOGC 2Q8UA 2JY9A 4LF9E 5LLQA 2EPZA 1EH8A 3ADGA 2LMZA 5IV8B 2EPCA 2UUCE 2V86A 2EN3A 2UUAE 3AUZA 2EMHA 2KONA 4NHRA 4IS1C 3EPHA 2HGHA 2LTRA 1A1KA 4RH8A 2B3TB 2YU8A 2N3GA 4DR4E 2WZOA 1IBME 2EE8A 4DV7E 4BBYA 4DV2E 3TQMA 1G2DC 1J5EE 1X6HA 2HJJA 2YRKA 4O4KA 2JVAA 4F9AB 4DV3E 4M2ZA 2EPPA 5AE1A 2EOOA 1N32E 1EKZA 4HEIA 2YTGA 5KL2A 1RMDA 1YPNA 4GKKE 2EPAA 4OUNA 3DJWA 1T4OA 4P78A 4JI6E 4JYAE 4LF7E 4BHCA 5KL5A 5A2QC 2JP9A 3DF6A 1BBOA 4I8OA 5AC4A 5KL4A 4WXDA 2LBSB 4R2QA 3THOB 2EOSA 1STUA 3EPKA 4BCAA 4WX9A 2EQ0A 2V85A 2HC5A 2LTSA 2LV2A 2EPUA 4TUIA 3VYYA 2V89A 4JI1E 2CPNA 1X6FA 1JFZA 2JYAA 2PRTA 2L2MA 1Z1BA 2DLKA 2EM7A 3N3WA 2L33A 3HTXA 1A1JA 2EOYA 3O2RA 2YZTA 2WBTA 2EM2A 4M0VA 3J81C 3EPJA 1XMOE 1UBDC 4B3ME 2ELZA 4DR3E 2EOJA 2RS7A 2VF1A 2EMYA 5KL7A 1KJKA 2EL5A 2EOFA 2EM4A 4WPYA 3ADLA 2EPNA 2D9HA 3T1HE 2JWOA 2EOQA 1T4LB 2EOXA 4X9JA 2YTOA 1J26A 2K4VA 4LF4E 4R2PA 2YRHA 1BB8A 4JI2E 3J80C 2EPRA 2ADRA 2EOHA 1RC7A 2EOEA 4R2EA 2WCC3 1YUIA 4JI4E 4DV6E 4KZSA 1MGTA 4X65E 2F4VE 3BF2A 3MSWA 2ZM6E 4JI7E 2F8BA 2ENHA 3THNA 2BBGA 2VQFE 3JAMC 4LFAE 3H09A 3HXLA 4LFCE 2EPMX 2E1MA 3C4BA 4WXCA 1ZTDA 2YTEA 4R2SA 2LRSA 2DGCA 4N4RB 3MHHC 1YYOA 3L00A 4GKJE 2NUFA 5BR8E 1YYKA 4F54A 1KYQA 2EMLA 1A1LA 4F9BB 1TF3A 1YUJA 4P7DA 2QVWA 2EPXA 2IHR1 1YFHA 2DB2A 1N36E 2V88A 3F6GA 2RSIA 2LJHA 1ZBTA 2UUBE 4WFTA 3RV0A 3MHSC 2L3CA 4DR7E 1X3CA 4YY3E 2UXDE 3IWDA 3C6KA 1MEYC 4LF8E 2CTDA 4DUZE 2EOMA 1AH5A 3OMLA 1DQ3A 1IQSA 3JTZA 2YTDA 3P1XA 2L8TA 4KWYA 5A6JA 2DSYA 2ELYA 1SR9A 4AQYE 2EMXA 3JU0A 4BMJA 4K0KE 1A1GA 1FJGE
chains in the Genus database with same CATH topology
5LMUE 2CPNA 4JI1E 1JFZA 4B3RE 4DR1E 3ZOQB 1DI2A 2MC5A 2L2MA 5ADZA 1HNZE 4YHHE 2LUPB 3N3WA 2L33A 2L3JA 2E5LE 4B3TE 1XNRE 3HTXA 4X8WA 3IWBA 5CFFE 3O2RA 2YZTA 4L5NC 4LU9A 4DV5E 2M4IA 1HR0E 4M0VA 3J81C 1XMOE 1O0WA 4B3ME 4R03A 4Q28A 2B9DA 4DR3E 4X66E 4JI3E 2RS7A 2GSLA 2JOXA 2VF1A 3AV0A 3OTOE 3LMLA 3RMPA 2N3HA 4DR6E 3ADIA 4WPYA 4JI5E 3VYXA 4DR4E 2EB1A 3ADLA 2VE7C 4DKKA 2M7QA 2MC6A 2MDRA 2EZ6A 3J7AG 5FLXC 3T1HE 4JI0E 2JWOA 1T4LB 2V83A 1IBKE 1XMQE 2ODRD 2RS6A 2FV4B 1J26A 5AE3A 4DV1E 2G7HA 5F3WA 2K4VA 2LE2A 5DNYA 2EWLA 1FKAE 2KHXA 4DR5E 1N34E 4LF4E 4B3SE 4JI2E 4DV0E 2V87A 1GZ6A 3J80C 2L2KB 1RC7A 1X47A 2DMYA 3HQ1A 3J7Yp 2ODRC 4DV6E 4JI4E 3KWRA 2NA2A 4KZSA 4NXNE 2LUQA 4X64E 2NUEA 4X65E 3T1YE 2DIXA 4OOGC 2F4VE 4J8ZA 2ZM6E 3MSWA 2JY9A 4LF9E 4WSPA 1X48A 1UILA 3ADGA 2B7TA 2YT4A 4JI7E 2F8BA 4GEQB 3C4TA 2JR1A 2LMZA 2UUCE 2V86A 5LL6R 1GQEA 2VQFE 3JAMC 2UUAE 3AUZA 5IWAE 4BS9A 2RTXA 4LFAE 2H36X 2KONA 2KOUA 3H09A 4JV5E 3HXLA 4LF6E 4LFCE 2VQEE 2NUGA 3C4BA 2FFLA 2E1MA 3IWCA 1HNWE 2LTRA 4KHPE 2B3TB 2LRSA 2N3GA 1U61A 5LMNE 1YYOA 3FIGA 2A11A 4DR2E 2NUFA 2WZOA 1WHNA 2FTXB 1IBME 4GKJE 4BC9A 5BR8E 1YYKA 4DV7E 2JOBA 4BBYA 4F54A 4DV2E 1J5EE 4F9BB 4LF5E 2L6MA 4BC7A 4F9AB 2JVAA 4DV3E 4M2ZA 2QVWA 4P7DA 1YZ9A 4OX9E 5AE1A 2IHR1 2DB2A 1N32E 1N33E 4DV4E 1EKZA 3F6HA 3HPZA 4L8NA 4WYQB 1N36E 4LFBE 2V88A 4TUGA 3F6GA 2L92A 4GKKE 4M30A 4LTYA 4OUNA 2HHHE 3DJWA 4F9CB 3K6QA 2LJHA 1T4NA 1T4OA 1ZBTA 3ADJA 3LLHA 1IBLE 1XNQE 1WXRA 2UUBE 2UXBE 1RQ0A 4P78A 3RV0A 4WFTA 2V8QB 2L3CA 4JI6E 1PKPA 1QU6A 4DR7E 2UXCE 4JYAE 4R8OA 4LF7E 4YY3E 2M1SA 2UXDE 2FGGA 5A2QC 3DF6A 3IWDA 3VK6A 4JI8E 4X62E 4LF8E 2L2NA 3O2RB 1ZBQA 1WHQA 4DUZE 4I8OA 2UU9E 3HPSA 5AASA 1I4SA 3OMLA 1UHZA 1X49A 4DMIA 1DQ3A 2LBSB 4DUYE 3JTZA 3P1XA 5AE2A 4NXME 1STUA 2L8TA 3RV1A 4BCAA 5IT9C 1I94E 2DSYA 1YYWA 2B7VA 1HNXE 1RC5A 2V85A 1SR9A 4AQYE 4K0KE 3JU0A 2LTSA 2RSMA 4BMJA 4TUIA 3VYYA 5T6JA 1FJGE 2V89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU E;  2CPN A;  4JI1 E;  1JFZ A;  4B3R E;  4DR1 E;  1DI2 A;  2L2M A;  1HNZ E;  4YHH E;  2LUP B;  3N3W A;  2L33 A;  2L3J A;  2E5L E;  4B3T E;  1XNR E;  3HTX A;  4X8W A;  5CFF E;  3O2R A;  4DV5 E;  1HR0 E;  1XMO E;  1O0W A;  4B3M E;  4DR3 E;  4X66 E;  4JI3 E;  2RS7 A;  2GSL A;  3OTO E;  2N3H A;  4DR6 E;  3ADI A;  4JI5 E;  3VYX A;  2EB1 A;  3ADL A;  4DKK A;  2MDR A;  2EZ6 A;  3T1H E;  4JI0 E;  1T4L B;  1IBK E;  1XMQ E;  2RS6 A;  1J26 A;  4DV1 E;  4LF4 E;  1FKA E;  2KHX A;  4DR5 E;  1N34 E;  4B3S E;  4JI2 E;  4DV0 E;  2L2K B;  1RC7 A;  1X47 A;  2DMY A;  3J7Y p;  4JI4 E;  4DV6 E;  2NA2 A;  4NXN E;  2LUQ A;  4X64 E;  2NUE A;  4X65 E;  3T1Y E;  2DIX A;  4OOG C;  2F4V E;  2ZM6 E;  2JY9 A;  4LF9 E;  1X48 A;  1UIL A;  3ADG A;  2B7T A;  2YT4 A;  4JI7 E;  3C4T A;  2UUC E;  1GQE A;  2VQF E;  2UUA E;  4LFA E;  5IWA E;  2RTX A;  4LF6 E;  4LFC E;  2VQE E;  2NUG A;  3C4B A;  2FFL A;  1HNW E;  2LTR A;  4KHP E;  2B3T B;  2LRS A;  2N3G A;  1U61 A;  5LMN E;  1YYO A;  4DR2 E;  2A11 A;  4DR4 E;  2NUF A;  1IBM E;  1WHN A;  4GKJ E;  5BR8 E;  1YYK A;  4DV7 E;  4DV2 E;  1J5E E;  4LF5 E;  2JVA A;  4DV3 E;  4M2Z A;  2QVW A;  1YZ9 A;  4OX9 E;  2IHR 1;  2DB2 A;  1N32 E;  1N33 E;  4DV4 E;  1EKZ A;  4WYQ B;  1N36 E;  4LFB E;  4GKK E;  4M30 A;  4OUN A;  2HHH E;  2LJH A;  1T4N A;  1T4O A;  3LLH A;  1ZBT A;  3ADJ A;  1IBL E;  1XNQ E;  4JV5 E;  2UUB E;  2UXB E;  1RQ0 A;  4WFT A;  3RV0 A;  2L3C A;  4JI6 E;  2UXC E;  4DR7 E;  1PKP A;  1QU6 A;  4JYA E;  4LF7 E;  4YY3 E;  2UXD E;  4JI8 E;  4X62 E;  4LF8 E;  2L2N A;  3O2R B;  1WHQ A;  4DUZ E;  2UU9 E;  1I4S A;  1UHZ A;  1X49 A;  2LBS B;  4DUY E;  3P1X A;  4NXM E;  1STU A;  3RV1 A;  1I94 E;  1YYW A;  2B7V A;  1HNX E;  1RC5 A;  4AQY E;  4K0K E;  2LTS A;  2RSM A;  3VYY A;  1FJG E; 
#chains in the Genus database with same CATH topology
 2YTI A;  4DR1 E;  1QNT A;  3ZOQ B;  1AAY A;  2EMK A;  2MC5 A;  4R2C A;  1HNZ E;  2LUP B;  1PJS A;  4MLQ A;  2E72 A;  3C6M A;  1T38 A;  1UN6 B;  2YU5 A;  1PJQ A;  4DV5 E;  4BHB A;  2EN6 A;  3UK3 C;  4IJD A;  4R03 A;  4Q28 A;  3AV0 A;  3OTO E;  3LML A;  2EM9 A;  4WSG A;  4F6N A;  4DR6 E;  4JI5 E;  3VYX A;  2YPN A;  2EB1 A;  4F2J C;  4DKK A;  4M9V C;  3J7A G;  1P47 A;  4JI0 E;  2YTQ A;  1XMQ E;  2ODR D;  2RS6 A;  5KL3 A;  5F3W A;  1X6E A;  1A1F A;  2LE2 A;  4B3S E;  4DV0 E;  2V87 A;  2EPK X;  2DMY A;  3BID A;  2DIX A;  2LT7 A;  4ZYD A;  3C4T A;  2EN8 A;  2R1F A;  5LL6 R;  1GQE A;  5IWA E;  4BS9 A;  2RPC A;  2RTX A;  2H36 X;  1GTK A;  2KOU A;  5IXM B;  2DRP A;  2MDG A;  1HNW E;  5A6B A;  4KHP E;  2M9A A;  4R2R A;  1U61 A;  4DR2 E;  2A11 A;  2FTX B;  3ECR A;  4BC9 A;  2RQL A;  2JOB A;  3BBG A;  2EQ1 A;  2GLI A;  4LF5 E;  2L6M A;  4BC7 A;  2YWQ A;  4FK5 C;  1YZ9 A;  4OX9 E;  1A1I A;  2EN2 A;  1N33 E;  3F6H A;  4L8N A;  4LFB E;  4LTY A;  2HHH E;  4F9C B;  3K6Q A;  1T4N A;  2J7J A;  1XNQ E;  2UXB E;  5A6K A;  5TSE A;  2V8Q B;  1QU6 A;  2EMB A;  1G2F C;  2FGG A;  2EQ3 A;  2VRD A;  4JI8 E;  4O5G A;  4X62 E;  3EPL A;  1JK1 A;  3O2R B;  2NAB A;  1WHQ A;  1EH7 A;  1PJT A;  5AAS A;  1I4S A;  1NEI A;  5A69 A;  1UHZ A;  1X49 A;  4DMI A;  2LCE A;  3RV1 A;  5IT9 C;  2I13 A;  1YYW A;  1RC5 A;  2EPO A;  4NZV A;  1X5W A;  4B3R E;  5AC5 A;  1DGC A;  1WRJ A;  5CFF E;  4LU9 A;  4L5N C;  2JXP A;  2M4I A;  1HR0 E;  1WJP A;  4ZYG A;  1O0W A;  3KZZ A;  2EL4 A;  2EOZ A;  2EMI A;  2JOX A;  2WBU A;  4R2D A;  1LLM C;  2N3H A;  3ADI A;  2EMZ A;  1PDA A;  2DLQ A;  2EMF A;  1TF6 A;  2EP3 A;  5FLX C;  2V83 A;  1IBK E;  2CSH A;  4HTG A;  2FV4 B;  2MKD A;  5AE3 A;  4DV1 E;  2EMG A;  5DNY A;  2R76 A;  1FKA E;  3QG5 C;  4RHB B;  4ZYE A;  1YSA C;  4F6M A;  2L2K B;  1X47 A;  1A1H A;  3HQ1 A;  4O43 A;  2NA2 A;  2EN1 A;  2LUQ A;  4J8Z A;  2YSP A;  4WSP A;  1X48 A;  1UIL A;  2B7T A;  2YT4 A;  2EM0 A;  4GEQ B;  2JR1 A;  2WBS A;  2EJ4 A;  4R2A A;  2CT1 A;  4LF6 E;  2VQE E;  3IWC A;  2NUG A;  2FFL A;  2EOR A;  2LJU A;  3BGH A;  5LMN E;  3VHT B;  3FIG A;  1WHN A;  2EL6 A;  2EOI A;  3EQ1 A;  2EM8 A;  1JK2 A;  3KZY A;  2EN4 A;  2N8X A;  4DV4 E;  3HPZ A;  4WYQ B;  1F2I G;  5A6B D;  4TUG A;  2L92 A;  4M30 A;  1ZR9 A;  5A6A A;  1B69 A;  4JV5 E;  3LLH A;  3ADJ A;  1IBL E;  1WXR A;  1RQ0 A;  2UXC E;  2YTJ A;  1PKP A;  4R8O A;  1TN9 A;  2EMC A;  2M1S A;  1T39 A;  3VK6 A;  2LO3 A;  2MKN A;  3M99 B;  2L2N A;  1ZBQ A;  1EH6 A;  2UU9 E;  4O24 A;  3HPS A;  2K7I A;  1BBG A;  2EMA A;  4DUY E;  2EN7 A;  5AE2 A;  4NXM E;  2EM5 A;  1ZAA C;  1I94 E;  2B7V A;  1HNX E;  1L4S A;  2RSM A;  4MLV A;  2YSO A;  4ZYH A;  5T6J A;  5LMU E;  2LVH A;  2EMW A;  2I9I A;  2BB8 A;  1DI2 A;  1SFE A;  5ADZ A;  1ZU1 A;  4YHH E;  2EM3 A;  2L3J A;  2E5L E;  4B3T E;  1XNR E;  4X8W A;  3IWB A;  1IQO A;  2EPL X;  2B9D A;  4X66 E;  4JI3 E;  2GSL A;  4GZN C;  2YTF A;  1IMU A;  3RMP A;  2ENA A;  2VE7 C;  2YRM A;  2M7Q A;  2MC6 A;  2MDR A;  2EZ6 A;  4Q35 B;  2ENC A;  2G7H A;  2EM6 A;  2YTP A;  2EWL A;  2KHX A;  4DR5 E;  1N34 E;  2GPI A;  1GZ6 A;  5KL6 A;  1N3G A;  3J7Y p;  2GHF A;  2ODR C;  3KWR A;  2JPA A;  2DMI A;  2YTN A;  4NXN E;  4X64 E;  2NUE A;  2A25 A;  1NCS A;  3T1Y E;  4OOG C;  2Q8U A;  2JY9 A;  4LF9 E;  5LLQ A;  2EPZ A;  1EH8 A;  3ADG A;  2LMZ A;  5IV8 B;  2EPC A;  2UUC E;  2V86 A;  2EN3 A;  2UUA E;  3AUZ A;  2EMH A;  2KON A;  4NHR A;  4IS1 C;  3EPH A;  2HGH A;  2LTR A;  1A1K A;  4RH8 A;  2B3T B;  2YU8 A;  2N3G A;  4DR4 E;  2WZO A;  1IBM E;  2EE8 A;  4DV7 E;  4BBY A;  4DV2 E;  3TQM A;  1G2D C;  1J5E E;  1X6H A;  2HJJ A;  2YRK A;  4O4K A;  2JVA A;  4F9A B;  4DV3 E;  4M2Z A;  2EPP A;  5AE1 A;  2EOO A;  1N32 E;  1EKZ A;  4HEI A;  2YTG A;  5KL2 A;  1RMD A;  1YPN A;  4GKK E;  2EPA A;  4OUN A;  3DJW A;  1T4O A;  4P78 A;  4JI6 E;  4JYA E;  4LF7 E;  4BHC A;  5KL5 A;  5A2Q C;  2JP9 A;  3DF6 A;  1BBO A;  4I8O A;  5AC4 A;  5KL4 A;  4WXD A;  2LBS B;  4R2Q A;  3THO B;  2EOS A;  1STU A;  3EPK A;  4BCA A;  4WX9 A;  2EQ0 A;  2V85 A;  2HC5 A;  2LTS A;  2LV2 A;  2EPU A;  4TUI A;  3VYY A;  2V89 A;  4JI1 E;  2CPN A;  1X6F A;  1JFZ A;  2JYA A;  2PRT A;  2L2M A;  1Z1B A;  2DLK A;  2EM7 A;  3N3W A;  2L33 A;  3HTX A;  1A1J A;  2EOY A;  3O2R A;  2YZT A;  2WBT A;  2EM2 A;  4M0V A;  3J81 C;  3EPJ A;  1XMO E;  1UBD C;  4B3M E;  2ELZ A;  4DR3 E;  2EOJ A;  2RS7 A;  2VF1 A;  2EMY A;  5KL7 A;  1KJK A;  2EL5 A;  2EOF A;  2EM4 A;  4WPY A;  3ADL A;  2EPN A;  2D9H A;  3T1H E;  2JWO A;  2EOQ A;  1T4L B;  2EOX A;  4X9J A;  2YTO A;  1J26 A;  2K4V A;  4LF4 E;  4R2P A;  2YRH A;  1BB8 A;  4JI2 E;  3J80 C;  2EPR A;  2ADR A;  2EOH A;  1RC7 A;  2EOE A;  4R2E A;  2WCC 3;  1YUI A;  4JI4 E;  4DV6 E;  4KZS A;  1MGT A;  4X65 E;  2F4V E;  3BF2 A;  3MSW A;  2ZM6 E;  4JI7 E;  2F8B A;  2ENH A;  3THN A;  2BBG A;  2VQF E;  3JAM C;  4LFA E;  3H09 A;  3HXL A;  4LFC E;  2EPM X;  2E1M A;  3C4B A;  4WXC A;  1ZTD A;  2YTE A;  4R2S A;  2LRS A;  2DGC A;  4N4R B;  3MHH C;  1YYO A;  3L00 A;  4GKJ E;  2NUF A;  5BR8 E;  1YYK A;  4F54 A;  1KYQ A;  2EML A;  1A1L A;  4F9B B;  1TF3 A;  1YUJ A;  4P7D A;  2QVW A;  2EPX A;  2IHR 1;  1YFH A;  2DB2 A;  1N36 E;  2V88 A;  3F6G A;  2RSI A;  2LJH A;  1ZBT A;  2UUB E;  4WFT A;  3RV0 A;  3MHS C;  2L3C A;  4DR7 E;  1X3C A;  4YY3 E;  2UXD E;  3IWD A;  3C6K A;  1MEY C;  4LF8 E;  2CTD A;  4DUZ E;  2EOM A;  1AH5 A;  3OML A;  1DQ3 A;  1IQS A;  3JTZ A;  2YTD A;  3P1X A;  2L8T A;  4KWY A;  5A6J A;  2DSY A;  2ELY A;  1SR9 A;  4AQY E;  2EMX A;  3JU0 A;  4BMJ A;  4K0K E;  1A1G A;  1FJG E; 
#chains in the Genus database with same CATH homology
 5LMU E;  2CPN A;  4JI1 E;  1JFZ A;  4B3R E;  4DR1 E;  3ZOQ B;  1DI2 A;  2MC5 A;  2L2M A;  5ADZ A;  1HNZ E;  4YHH E;  2LUP B;  3N3W A;  2L33 A;  2L3J A;  2E5L E;  4B3T E;  1XNR E;  3HTX A;  4X8W A;  3IWB A;  5CFF E;  3O2R A;  2YZT A;  4L5N C;  4LU9 A;  4DV5 E;  2M4I A;  1HR0 E;  4M0V A;  3J81 C;  1XMO E;  1O0W A;  4B3M E;  4R03 A;  4Q28 A;  2B9D A;  4DR3 E;  4X66 E;  4JI3 E;  2RS7 A;  2GSL A;  2JOX A;  2VF1 A;  3AV0 A;  3OTO E;  3LML A;  3RMP A;  2N3H A;  4DR6 E;  3ADI A;  4WPY A;  4JI5 E;  3VYX A;  4DR4 E;  2EB1 A;  3ADL A;  2VE7 C;  4DKK A;  2M7Q A;  2MC6 A;  2MDR A;  2EZ6 A;  3J7A G;  5FLX C;  3T1H E;  4JI0 E;  2JWO A;  1T4L B;  2V83 A;  1IBK E;  1XMQ E;  2ODR D;  2RS6 A;  2FV4 B;  1J26 A;  5AE3 A;  4DV1 E;  2G7H A;  5F3W A;  2K4V A;  2LE2 A;  5DNY A;  2EWL A;  1FKA E;  2KHX A;  4DR5 E;  1N34 E;  4LF4 E;  4B3S E;  4JI2 E;  4DV0 E;  2V87 A;  1GZ6 A;  3J80 C;  2L2K B;  1RC7 A;  1X47 A;  2DMY A;  3HQ1 A;  3J7Y p;  2ODR C;  4DV6 E;  4JI4 E;  3KWR A;  2NA2 A;  4KZS A;  4NXN E;  2LUQ A;  4X64 E;  2NUE A;  4X65 E;  3T1Y E;  2DIX A;  4OOG C;  2F4V E;  4J8Z A;  2ZM6 E;  3MSW A;  2JY9 A;  4LF9 E;  4WSP A;  1X48 A;  1UIL A;  3ADG A;  2B7T A;  2YT4 A;  4JI7 E;  2F8B A;  4GEQ B;  3C4T A;  2JR1 A;  2LMZ A;  2UUC E;  2V86 A;  5LL6 R;  1GQE A;  2VQF E;  3JAM C;  2UUA E;  3AUZ A;  5IWA E;  4BS9 A;  2RTX A;  4LFA E;  2H36 X;  2KON A;  2KOU A;  3H09 A;  4JV5 E;  3HXL A;  4LF6 E;  4LFC E;  2VQE E;  2NUG A;  3C4B A;  2FFL A;  2E1M A;  3IWC A;  1HNW E;  2LTR A;  4KHP E;  2B3T B;  2LRS A;  2N3G A;  1U61 A;  5LMN E;  1YYO A;  3FIG A;  2A11 A;  4DR2 E;  2NUF A;  2WZO A;  1WHN A;  2FTX B;  1IBM E;  4GKJ E;  4BC9 A;  5BR8 E;  1YYK A;  4DV7 E;  2JOB A;  4BBY A;  4F54 A;  4DV2 E;  1J5E E;  4F9B B;  4LF5 E;  2L6M A;  4BC7 A;  4F9A B;  2JVA A;  4DV3 E;  4M2Z A;  2QVW A;  4P7D A;  1YZ9 A;  4OX9 E;  5AE1 A;  2IHR 1;  2DB2 A;  1N32 E;  1N33 E;  4DV4 E;  1EKZ A;  3F6H A;  3HPZ A;  4L8N A;  4WYQ B;  1N36 E;  4LFB E;  2V88 A;  4TUG A;  3F6G A;  2L92 A;  4GKK E;  4M30 A;  4LTY A;  4OUN A;  2HHH E;  3DJW A;  4F9C B;  3K6Q A;  2LJH A;  1T4N A;  1T4O A;  1ZBT A;  3ADJ A;  3LLH A;  1IBL E;  1XNQ E;  1WXR A;  2UUB E;  2UXB E;  1RQ0 A;  4P78 A;  3RV0 A;  4WFT A;  2V8Q B;  2L3C A;  4JI6 E;  1PKP A;  1QU6 A;  4DR7 E;  2UXC E;  4JYA E;  4R8O A;  4LF7 E;  4YY3 E;  2M1S A;  2UXD E;  2FGG A;  5A2Q C;  3DF6 A;  3IWD A;  3VK6 A;  4JI8 E;  4X62 E;  4LF8 E;  2L2N A;  3O2R B;  1ZBQ A;  1WHQ A;  4DUZ E;  4I8O A;  2UU9 E;  3HPS A;  5AAS A;  1I4S A;  3OML A;  1UHZ A;  1X49 A;  4DMI A;  1DQ3 A;  2LBS B;  4DUY E;  3JTZ A;  3P1X A;  5AE2 A;  4NXM E;  1STU A;  2L8T A;  3RV1 A;  4BCA A;  5IT9 C;  1I94 E;  2DSY A;  1YYW A;  2B7V A;  1HNX E;  1RC5 A;  2V85 A;  1SR9 A;  4AQY E;  4K0K E;  3JU0 A;  2LTS A;  2RSM A;  4BMJ A;  4TUI A;  3VYY A;  5T6J A;  1FJG E;  2V89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...