2NUFA

Crystal structure of rnase iii from aquifex aeolicus complexed with ds-rna at 2.5-angstrom resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
219
structure length
219
Chain Sequence
b'KMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 28-MER
publication title A stepwise model for double-stranded RNA processing by ribonuclease III.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
total genus 77
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 2nufA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2nufA02
2LUPB 4X65E 1HNXE 2LRSA 4DR3E 5LMUE 1QU6A 2LUQA 1N36E 5BR8E 1STUA 1RC5A 4X64E 4AQYE 4JI5E 4JV5E 3O2RA 4X62E 1YYOA 3C4BA 1J5EE 4LF9E 4OUNA 2E5LE 1HNWE 2RS6A 3ADLA 2MDRA 2JVAA 2DB2A 1UHZA 3VYXA 1YYWA 4X8WA 4LF7E 4DV0E 4DV2E 1X47A 2RSMA 4OX9E 4DV5E 4LFCE 2GSLA 4OOGC 4DR7E 3N3WA 2EZ6A 2LTRA 4WYQB 1XNRE 3HTXA 2A11A 4KHPE 1XMOE 1FJGE 2ZM6E 1GQEA 4NXNE 1DI2A 1RQ0A 4YY3E 1X49A 2UXCE 2L2KB 2UUBE 3O2RB 2B3TB 5CFFE 4JI1E 2UUAE 4M30A 1N32E 1N34E 4DR5E 4JI2E 1WHQA 1FKAE 4B3SE 1T4OA 2RTXA 4LFAE 4LF8E 1EKZA 1I4SA 1X48A 2FFLA 2N3HA 2NA2A 3C4TA 2L3CA 2YT4A 4DUYE 1IBLE 4GKKE 2IHR1 3OTOE 4DR2E 1WHNA 1JFZA 4K0KE 4B3RE 5LMNE 4JYAE 1YZ9A 2L3JA 3T1HE 4X66E 1I94E 3ADGA 2NUFA 4JI6E 1O0WA 2KHXA 4YHHE 2JY9A 4B3ME 1T4LB 4DV7E 4LF6E 2LTSA 3T1YE 2RS7A 1RC7A 2UU9E 2L33A 4JI8E 3P1XA 4DR6E 4JI7E 4DV1E 1PKPA 2VQEE 1ZBTA 2L2NA 2F4VE 4M2ZA 1IBKE 1T4NA 2LJHA 2B7VA 4DUZE 4DKKA 4DR1E 2DIXA 1UILA 2EB1A 2DMYA 1HNZE 4WFTA 1J26A 2UUCE 1HR0E 2LBSB 4DR4E 2B7TA 2VQFE 1XNQE 4LFBE 3J7Yp 4GKJE 3LLHA 4JI3E 3RV1A 1IBME 4JI0E 2UXBE 3RV0A 2L2MA 2HHHE 2CPNA 2N3GA 4DV6E 4JI4E 2NUGA 5IWAE 3ADIA 1XMQE 4NXME 3VYYA 4DV3E 4LF5E 1N33E 3ADJA 4DV4E 1U61A 2UXDE 2QVWA 2NUEA 4B3TE 4LF4E 1YYKA
chains in the Genus database with same CATH superfamily
4ZYGA 2EOMA 2LRSA 2NABA 5BR8E 1WRJA 2V87A 3BF2A 3MHSC 4JV5E 1J5EE 4OUNA 5A6BA 2RS6A 2EMWA 1EH7A 2EM4A 2EPZA 1ZAAC 2M1SA 2EOHA 2EM8A 5F3WA 1X6EA 1X47A 2RSMA 4LU9A 4OX9E 4LFCE 1XNRE 1NCSA 4WSGA 3EPHA 4BS9A 1YUJA 2YTEA 1X49A 2L2KB 3JU0A 3O2RB 2EPUA 4DR5E 1NEIA 2EMLA 1FKAE 1T4OA 2MC6A 3QG5C 2RPCA 4LF8E 1X48A 4DUYE 2EM2A 2FV4B 2EJ4A 4Q28A 4DR2E 1WHNA 2ENCA 1T39A 2V88A 5LLQA 2NUFA 4JI6E 3BBGA 3AUZA 5AE2A 1EH8A 4M9VC 2YTNA 5ADZA 2EOSA 2B9DA 1A1KA 1L4SA 2EMFA 3J7AG 1A1FA 2M4IA 2L2NA 4WSPA 2F4VE 3ECRA 2EORA 2EOEA 4DUZE 2I9IA 2EB1A 2EQ0A 2EM7A 2YWQA 1AAYA 2UUCE 2LBSB 1JK1A 3KZYA 5A6JA 2YTIA 4R2RA 2EMYA 3LLHA 4RH8A 4HEIA 2HGHA 2YRKA 2GLIA 2CPNA 2N3GA 4JI4E 5IWAE 1UBDC 1KYQA 2JOBA 1DQ3A 1IQSA 2NUEA 3L00A 2GHFA 4BCAA 2LMZA 2EPKX 1IQOA 2LUPB 2DMIA 2YTPA 4L5NC 1A1LA 2HJJA 2EP3A 2EPMX 2YZTA 2EN2A 3IWBA 4AQYE 4JI5E 1A1IA 3O2RA 2YRMA 4X62E 1YYOA 2ENHA 4LF9E 2A25A 2DLQA 2R1FA 4MLVA 3ADLA 3BIDA 2MDRA 2JVAA 4BHCA 1UHZA 3JAMC 4I8OA 2EPNA 2EL4A 4X8WA 2EPXA 5TSEA 4LF7E 2DGCA 4DMIA 4DV0E 2RQLA 4R2DA 2EPLX 2WZOA 4O24A 1X6FA 3HTXA 3DJWA 2FGGA 3EPLA 1FJGE 5A2QC 1GQEA 1ZBQA 2BB8A 4R2PA 4NXNE 1RQ0A 4HTGA 4J8ZA 2YU8A 3ZOQB 4O4KA 4JI1E 2UUAE 3HQ1A 2V85A 1WHQA 2YU5A 2F8BA 4F9AB 4KWYA 1GTKA 1IMUA 1I4SA 2EPOA 2EL6A 2L3CA 2NA2A 1EH6A 2YT4A 4GKKE 2I13A 4B3RE 5LMNE 4JYAE 2DSYA 1YZ9A 2L3JA 3T1HE 5KL5A 1AH5A 1PDAA 1I94E 2KHXA 2JPAA 4F9BB 2DLKA 3IWDA 4B3ME 2EM0A 5AC5A 4LTYA 3FIGA 2RS7A 2D9HA 2MKDA 4JI8E 2EM6A 2JOXA 4GZNC 3RMPA 4DR6E 4DV1E 3AV0A 2VQEE 4FK5C 2EM3A 4BC7A 1ZBTA 2YTFA 2EM9A 1IBKE 2V89A 1T4NA 2LT7A 2B7VA 2LJUA 4DR1E 2DRPA 2GPIA 1HNZE 3C6MA 5AASA 1A1HA 1T38A 4DR4E 2YTJA 4LFBE 4TUIA 4NHRA 1PJSA 3THNA 2MDGA 2EE8A 2YTOA 3EPJA 2WBTA 3RV1A 3KWRA 2ENAA 3RV0A 2R76A 2L2MA 2HHHE 2G7HA 2EOZA 2NUGA 4R2QA 4F6MA 1X3CA 1X5WA 4TUGA 2VE7C 4NXME 3VYYA 3JTZA 4F6NA 1PJTA 1DGCA 2EMCA 1WXRA 2UXDE 4Q35B 2MC5A 2EPPA 1YYKA 4DR3E 4KZSA 4X65E 1YFHA 1HNXE 1QU6A 1GZ6A 1STUA 4WXCA 2JR1A 2EOXA 2EOOA 4IJDA 4ZYEA 4R2AA 2JP9A 3C4BA 2YSOA 2E5LE 2DB2A 3VYXA 1A1JA 1MGTA 2EN3A 5IXMB 2LVHA 4DV5E 4DR7E 3N3WA 2V8QB 2EZ6A 4P7DA 1XMOE 1B69A 2KOUA 2VF1A 2PRTA 3VHTB 4YY3E 4IS1C 1BBGA 2EOJA 2UXCE 3F6GA 2UUBE 5CFFE 4M30A 1N34E 2EN6A 2EMHA 2EQ3A 2JYAA 3LMLA 5A6KA 2EOIA 2EOFA 5AC4A 1EKZA 2N3HA 1IBLE 2YTDA 1ZR9A 3UK3C 3TQMA 4GEQB 2E72A 4X66E 3ADGA 2EMBA 4WX9A 2HC5A 2JY9A 1QNTA 1T4LB 2EMZA 4DV7E 4ZYHA 2ODRD 2LTSA 3MSWA 3KZZA 3T1YE 1G2DC 3OMLA 2L92A 1RC7A 2UU9E 3P1XA 2ADRA 1PKPA 2H36X 3C6KA 2YTGA 1Z1BA 3F6HA 3J80C 2YTQA 2E1MA 3HXLA 4M2ZA 2J7JA 2CTDA 5AE3A 3M99B 4DKKA 2DIXA 1UILA 3HPSA 1YSAC 4WFTA 3VK6A 2EN4A 2B7TA 2CT1A 2EWLA 3J7Yp 4GKJE 4O43A 2M7QA 1X6HA 1IBME 1N3GA 4BHBA 5IV8B 5LL6R 2L6MA 2YSPA 3EQ1A 3HPZA 4DV6E 4P78A 4BMJA 4X9JA 1XMQE 2EMKA 3BGHA 1N33E 5A6BD 4WPYA 2V83A 4M0VA 3DF6A 2LV2A 3J81C 2WBUA 4N4RB 1A1GA 3MHHC 1N36E 5LMUE 2LUQA 4NZVA 4MLQA 4R03A 1RC5A 5T6JA 2V86A 4X64E 2ODRC 1SR9A 5A6AA 1HNWE 2JWOA 2EMAA 1YUIA 1ZU1A 1WJPA 2EPCA 1YYWA 4R2SA 4L8NA 4R8OA 4DV2E 1TN9A 2GSLA 4OOGC 1P47A 2LO3A 2LTRA 4WYQB 2K7IA 4KHPE 2A11A 3THOB 2EPRA 1TF3A 2ZM6E 1DI2A 1UN6B 2M9AA 5FLXC 2EN1A 5KL6A 2EL5A 2YRHA 2B3TB 2N8XA 1YPNA 1N32E 4JI2E 4B3SE 4LFAE 2RTXA 2EMXA 2EN7A 4BBYA 4RHBB 2FFLA 3C4TA 1BBOA 2WCC3 2IHR1 3OTOE 2BBGA 2EMIA 5KL7A 1JFZA 4K0KE 1JK2A 3K6QA 2EOYA 2EPAA 1O0WA 1F2IG 4YHHE 2Q8UA 5A69A 2LE2A 4LF6E 2EM5A 1PJQA 5KL4A 4O5GA 4ZYDA 1G2FC 2L33A 5KL2A 2VRDA 4BC9A 5IT9C 4JI7E 4F2JC 2KONA 2K4VA 2CSHA 1TF6A 2EOQA 1MEYC 2ELZA 2EQ1A 2LJHA 2RSIA 2DMYA 2EN8A 1J26A 1HR0E 5DNYA 2LCEA 2VQFE 1XNQE 5KL3A 2ELYA 4R2EA 4JI3E 4JI0E 4F9CB 2UXBE 5AE1A 3H09A 2L8TA 4R2CA 1RMDA 4WXDA 1BB8A 2EMGA 3ADIA 1ZTDA 3EPKA 2MKNA 3IWCA 1LLMC 2JXPA 4DV3E 2WBSA 4LF5E 1KJKA 1SFEA 3ADJA 4DV4E 2YPNA 1U61A 2QVWA 4B3TE 4F54A 4LF4E 2FTXB
chains in the Genus database with same CATH topology
2LUPB 4KZSA 4L5NC 4X65E 1HNXE 2LRSA 4DR3E 5LMUE 1QU6A 2LUQA 1N36E 1GZ6A 4R03A 1STUA 1RC5A 2V87A 5T6JA 5BR8E 2YZTA 2JR1A 2V86A 3IWBA 4X64E 4AQYE 2ODRC 1SR9A 4JI5E 4JV5E 3O2RA 4X62E 1YYOA 3C4BA 1J5EE 4LF9E 4OUNA 2E5LE 1HNWE 2RS6A 2JWOA 3ADLA 2MDRA 2JVAA 2DB2A 1UHZA 3JAMC 1YYWA 3VYXA 4I8OA 2M1SA 4X8WA 4LF7E 4L8NA 4DMIA 4R8OA 5F3WA 4DV0E 4DV2E 1X47A 2RSMA 4LU9A 4DV5E 4LFCE 4OX9E 2GSLA 4OOGC 2WZOA 4DR7E 3N3WA 2V8QB 2EZ6A 2LTRA 4WYQB 1XNRE 3HTXA 2A11A 4KHPE 4P7DA 1XMOE 3DJWA 2KOUA 2FGGA 1FJGE 2VF1A 5A2QC 2ZM6E 1GQEA 1ZBQA 4BS9A 4NXNE 1DI2A 1RQ0A 4YY3E 1X49A 5FLXC 4J8ZA 2UXCE 2L2KB 3JU0A 3F6GA 3O2RB 3ZOQB 2B3TB 5CFFE 2UUBE 4JI1E 2UUAE 4M30A 1N32E 1N34E 3HQ1A 2V85A 4DR5E 4JI2E 1WHQA 1FKAE 4B3SE 1T4OA 2F8BA 2MC6A 2RTXA 3LMLA 4F9AB 4LFAE 4BBYA 4LF8E 1EKZA 1I4SA 1X48A 2FFLA 2N3HA 2NA2A 3C4TA 2L3CA 2YT4A 4DUYE 1IBLE 2FV4B 4GKKE 2IHR1 4Q28A 3OTOE 4DR2E 1WHNA 1JFZA 4GEQB 4K0KE 4B3RE 5LMNE 4JYAE 2DSYA 1YZ9A 3K6QA 2L3JA 2V88A 4X66E 3T1HE 2NUFA 3ADGA 1I94E 4JI6E 1O0WA 2KHXA 4F9BB 4YHHE 2JY9A 3AUZA 5AE2A 3IWDA 4B3ME 1T4LB 2LE2A 4DV7E 2ODRD 4LF6E 2LTSA 3MSWA 4LTYA 3T1YE 3FIGA 2RS7A 2L92A 3OMLA 5ADZA 1RC7A 2UU9E 2L33A 2B9DA 5IT9C 4BC9A 4JI8E 3P1XA 2JOXA 3RMPA 4DR6E 4JI7E 4DV1E 3AV0A 1PKPA 2VQEE 2H36X 4BC7A 3J7AG 2M4IA 3F6HA 3J80C 2KONA 1ZBTA 2L2NA 4WSPA 2K4VA 2E1MA 2F4VE 3HXLA 4M2ZA 1IBKE 2V89A 1T4NA 2LJHA 2B7VA 5AE3A 4DUZE 4DKKA 4DR1E 2DIXA 1UILA 2EB1A 2DMYA 3HPSA 1HNZE 4WFTA 5AASA 1J26A 2UUCE 3VK6A 1HR0E 2LBSB 4DR4E 2B7TA 5DNYA 2VQFE 1XNQE 4LFBE 4TUIA 2EWLA 3J7Yp 4GKJE 3LLHA 2M7QA 4JI3E 3RV1A 3KWRA 4F9CB 1IBME 5AE1A 4JI0E 3H09A 2L8TA 3RV0A 2UXBE 5LL6R 2L2MA 2HHHE 2G7HA 2CPNA 2L6MA 2N3GA 3HPZA 4DV6E 2NUGA 4JI4E 4P78A 5IWAE 4BMJA 3ADIA 1XMQE 4TUGA 3IWCA 2VE7C 2JOBA 4NXME 3VYYA 3JTZA 4DV3E 1DQ3A 4LF5E 1N33E 3ADJA 4DV4E 1U61A 1WXRA 2QVWA 2NUEA 4WPYA 2MC5A 4F54A 4B3TE 2UXDE 2V83A 4LF4E 4M0VA 4BCAA 3DF6A 3J81C 1YYKA 2FTXB 2LMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUP B;  4X65 E;  1HNX E;  2LRS A;  4DR3 E;  5LMU E;  1QU6 A;  2LUQ A;  1N36 E;  5BR8 E;  1STU A;  1RC5 A;  4X64 E;  4AQY E;  4JI5 E;  4JV5 E;  3O2R A;  4X62 E;  1YYO A;  3C4B A;  1J5E E;  4LF9 E;  4OUN A;  2E5L E;  1HNW E;  2RS6 A;  3ADL A;  2MDR A;  2JVA A;  2DB2 A;  1UHZ A;  3VYX A;  1YYW A;  4X8W A;  4LF7 E;  4DV0 E;  4DV2 E;  1X47 A;  2RSM A;  4OX9 E;  4DV5 E;  4LFC E;  2GSL A;  4OOG C;  4DR7 E;  3N3W A;  2EZ6 A;  2LTR A;  4WYQ B;  1XNR E;  3HTX A;  2A11 A;  4KHP E;  1XMO E;  1FJG E;  2ZM6 E;  1GQE A;  4NXN E;  1DI2 A;  1RQ0 A;  4YY3 E;  1X49 A;  2UXC E;  2L2K B;  2UUB E;  3O2R B;  2B3T B;  5CFF E;  4JI1 E;  2UUA E;  4M30 A;  1N32 E;  1N34 E;  4DR5 E;  4JI2 E;  1WHQ A;  1FKA E;  4B3S E;  1T4O A;  2RTX A;  4LFA E;  4LF8 E;  1EKZ A;  1I4S A;  1X48 A;  2FFL A;  2N3H A;  2NA2 A;  3C4T A;  2L3C A;  2YT4 A;  4DUY E;  1IBL E;  4GKK E;  2IHR 1;  3OTO E;  4DR2 E;  1WHN A;  1JFZ A;  4K0K E;  4B3R E;  5LMN E;  4JYA E;  1YZ9 A;  2L3J A;  3T1H E;  4X66 E;  1I94 E;  3ADG A;  2NUF A;  4JI6 E;  1O0W A;  2KHX A;  4YHH E;  2JY9 A;  4B3M E;  1T4L B;  4DV7 E;  4LF6 E;  2LTS A;  3T1Y E;  2RS7 A;  1RC7 A;  2UU9 E;  2L33 A;  4JI8 E;  3P1X A;  4DR6 E;  4JI7 E;  4DV1 E;  1PKP A;  2VQE E;  1ZBT A;  2L2N A;  2F4V E;  4M2Z A;  1IBK E;  1T4N A;  2LJH A;  2B7V A;  4DUZ E;  4DKK A;  4DR1 E;  2DIX A;  1UIL A;  2EB1 A;  2DMY A;  1HNZ E;  4WFT A;  1J26 A;  2UUC E;  1HR0 E;  2LBS B;  4DR4 E;  2B7T A;  2VQF E;  1XNQ E;  4LFB E;  3J7Y p;  4GKJ E;  3LLH A;  4JI3 E;  3RV1 A;  1IBM E;  4JI0 E;  2UXB E;  3RV0 A;  2L2M A;  2HHH E;  2CPN A;  2N3G A;  4DV6 E;  4JI4 E;  2NUG A;  5IWA E;  3ADI A;  1XMQ E;  4NXM E;  3VYY A;  4DV3 E;  4LF5 E;  1N33 E;  3ADJ A;  4DV4 E;  1U61 A;  2UXD E;  2QVW A;  2NUE A;  4B3T E;  4LF4 E;  1YYK A; 
#chains in the Genus database with same CATH topology
 4ZYG A;  2EOM A;  2LRS A;  2NAB A;  5BR8 E;  1WRJ A;  2V87 A;  3BF2 A;  3MHS C;  4JV5 E;  1J5E E;  4OUN A;  5A6B A;  2RS6 A;  2EMW A;  1EH7 A;  2EM4 A;  2EPZ A;  1ZAA C;  2M1S A;  2EOH A;  2EM8 A;  5F3W A;  1X6E A;  1X47 A;  2RSM A;  4LU9 A;  4OX9 E;  4LFC E;  1XNR E;  1NCS A;  4WSG A;  3EPH A;  4BS9 A;  1YUJ A;  2YTE A;  1X49 A;  2L2K B;  3JU0 A;  3O2R B;  2EPU A;  4DR5 E;  1NEI A;  2EML A;  1FKA E;  1T4O A;  2MC6 A;  3QG5 C;  2RPC A;  4LF8 E;  1X48 A;  4DUY E;  2EM2 A;  2FV4 B;  2EJ4 A;  4Q28 A;  4DR2 E;  1WHN A;  2ENC A;  1T39 A;  2V88 A;  5LLQ A;  2NUF A;  4JI6 E;  3BBG A;  3AUZ A;  5AE2 A;  1EH8 A;  4M9V C;  2YTN A;  5ADZ A;  2EOS A;  2B9D A;  1A1K A;  1L4S A;  2EMF A;  3J7A G;  1A1F A;  2M4I A;  2L2N A;  4WSP A;  2F4V E;  3ECR A;  2EOR A;  2EOE A;  4DUZ E;  2I9I A;  2EB1 A;  2EQ0 A;  2EM7 A;  2YWQ A;  1AAY A;  2UUC E;  2LBS B;  1JK1 A;  3KZY A;  5A6J A;  2YTI A;  4R2R A;  2EMY A;  3LLH A;  4RH8 A;  4HEI A;  2HGH A;  2YRK A;  2GLI A;  2CPN A;  2N3G A;  4JI4 E;  5IWA E;  1UBD C;  1KYQ A;  2JOB A;  1DQ3 A;  1IQS A;  2NUE A;  3L00 A;  2GHF A;  4BCA A;  2LMZ A;  2EPK X;  1IQO A;  2LUP B;  2DMI A;  2YTP A;  4L5N C;  1A1L A;  2HJJ A;  2EP3 A;  2EPM X;  2YZT A;  2EN2 A;  3IWB A;  4AQY E;  4JI5 E;  1A1I A;  3O2R A;  2YRM A;  4X62 E;  1YYO A;  2ENH A;  4LF9 E;  2A25 A;  2DLQ A;  2R1F A;  4MLV A;  3ADL A;  3BID A;  2MDR A;  2JVA A;  4BHC A;  1UHZ A;  3JAM C;  4I8O A;  2EPN A;  2EL4 A;  4X8W A;  2EPX A;  5TSE A;  4LF7 E;  2DGC A;  4DMI A;  4DV0 E;  2RQL A;  4R2D A;  2EPL X;  2WZO A;  4O24 A;  1X6F A;  3HTX A;  3DJW A;  2FGG A;  3EPL A;  1FJG E;  5A2Q C;  1GQE A;  1ZBQ A;  2BB8 A;  4R2P A;  4NXN E;  1RQ0 A;  4HTG A;  4J8Z A;  2YU8 A;  3ZOQ B;  4O4K A;  4JI1 E;  2UUA E;  3HQ1 A;  2V85 A;  1WHQ A;  2YU5 A;  2F8B A;  4F9A B;  4KWY A;  1GTK A;  1IMU A;  1I4S A;  2EPO A;  2EL6 A;  2L3C A;  2NA2 A;  1EH6 A;  2YT4 A;  4GKK E;  2I13 A;  4B3R E;  5LMN E;  4JYA E;  2DSY A;  1YZ9 A;  2L3J A;  3T1H E;  5KL5 A;  1AH5 A;  1PDA A;  1I94 E;  2KHX A;  2JPA A;  4F9B B;  2DLK A;  3IWD A;  4B3M E;  2EM0 A;  5AC5 A;  4LTY A;  3FIG A;  2RS7 A;  2D9H A;  2MKD A;  4JI8 E;  2EM6 A;  2JOX A;  4GZN C;  3RMP A;  4DR6 E;  4DV1 E;  3AV0 A;  2VQE E;  4FK5 C;  2EM3 A;  4BC7 A;  1ZBT A;  2YTF A;  2EM9 A;  1IBK E;  2V89 A;  1T4N A;  2LT7 A;  2B7V A;  2LJU A;  4DR1 E;  2DRP A;  2GPI A;  1HNZ E;  3C6M A;  5AAS A;  1A1H A;  1T38 A;  4DR4 E;  2YTJ A;  4LFB E;  4TUI A;  4NHR A;  1PJS A;  3THN A;  2MDG A;  2EE8 A;  2YTO A;  3EPJ A;  2WBT A;  3RV1 A;  3KWR A;  2ENA A;  3RV0 A;  2R76 A;  2L2M A;  2HHH E;  2G7H A;  2EOZ A;  2NUG A;  4R2Q A;  4F6M A;  1X3C A;  1X5W A;  4TUG A;  2VE7 C;  4NXM E;  3VYY A;  3JTZ A;  4F6N A;  1PJT A;  1DGC A;  2EMC A;  1WXR A;  2UXD E;  4Q35 B;  2MC5 A;  2EPP A;  1YYK A;  4DR3 E;  4KZS A;  4X65 E;  1YFH A;  1HNX E;  1QU6 A;  1GZ6 A;  1STU A;  4WXC A;  2JR1 A;  2EOX A;  2EOO A;  4IJD A;  4ZYE A;  4R2A A;  2JP9 A;  3C4B A;  2YSO A;  2E5L E;  2DB2 A;  3VYX A;  1A1J A;  1MGT A;  2EN3 A;  5IXM B;  2LVH A;  4DV5 E;  4DR7 E;  3N3W A;  2V8Q B;  2EZ6 A;  4P7D A;  1XMO E;  1B69 A;  2KOU A;  2VF1 A;  2PRT A;  3VHT B;  4YY3 E;  4IS1 C;  1BBG A;  2EOJ A;  2UXC E;  3F6G A;  2UUB E;  5CFF E;  4M30 A;  1N34 E;  2EN6 A;  2EMH A;  2EQ3 A;  2JYA A;  3LML A;  5A6K A;  2EOI A;  2EOF A;  5AC4 A;  1EKZ A;  2N3H A;  1IBL E;  2YTD A;  1ZR9 A;  3UK3 C;  3TQM A;  4GEQ B;  2E72 A;  4X66 E;  3ADG A;  2EMB A;  4WX9 A;  2HC5 A;  2JY9 A;  1QNT A;  1T4L B;  2EMZ A;  4DV7 E;  4ZYH A;  2ODR D;  2LTS A;  3MSW A;  3KZZ A;  3T1Y E;  1G2D C;  3OML A;  2L92 A;  1RC7 A;  2UU9 E;  3P1X A;  2ADR A;  1PKP A;  2H36 X;  3C6K A;  2YTG A;  1Z1B A;  3F6H A;  3J80 C;  2YTQ A;  2E1M A;  3HXL A;  4M2Z A;  2J7J A;  2CTD A;  5AE3 A;  3M99 B;  4DKK A;  2DIX A;  1UIL A;  3HPS A;  1YSA C;  4WFT A;  3VK6 A;  2EN4 A;  2B7T A;  2CT1 A;  2EWL A;  3J7Y p;  4GKJ E;  4O43 A;  2M7Q A;  1X6H A;  1IBM E;  1N3G A;  4BHB A;  5IV8 B;  5LL6 R;  2L6M A;  2YSP A;  3EQ1 A;  3HPZ A;  4DV6 E;  4P78 A;  4BMJ A;  4X9J A;  1XMQ E;  2EMK A;  3BGH A;  1N33 E;  5A6B D;  4WPY A;  2V83 A;  4M0V A;  3DF6 A;  2LV2 A;  3J81 C;  2WBU A;  4N4R B;  1A1G A;  3MHH C;  1N36 E;  5LMU E;  2LUQ A;  4NZV A;  4MLQ A;  4R03 A;  1RC5 A;  5T6J A;  2V86 A;  4X64 E;  2ODR C;  1SR9 A;  5A6A A;  1HNW E;  2JWO A;  2EMA A;  1YUI A;  1ZU1 A;  1WJP A;  2EPC A;  1YYW A;  4R2S A;  4L8N A;  4R8O A;  4DV2 E;  1TN9 A;  2GSL A;  4OOG C;  1P47 A;  2LO3 A;  2LTR A;  4WYQ B;  2K7I A;  4KHP E;  2A11 A;  3THO B;  2EPR A;  1TF3 A;  2ZM6 E;  1DI2 A;  1UN6 B;  2M9A A;  5FLX C;  2EN1 A;  5KL6 A;  2EL5 A;  2YRH A;  2B3T B;  2N8X A;  1YPN A;  1N32 E;  4JI2 E;  4B3S E;  4LFA E;  2RTX A;  2EMX A;  2EN7 A;  4BBY A;  4RHB B;  2FFL A;  3C4T A;  1BBO A;  2WCC 3;  2IHR 1;  3OTO E;  2BBG A;  2EMI A;  5KL7 A;  1JFZ A;  4K0K E;  1JK2 A;  3K6Q A;  2EOY A;  2EPA A;  1O0W A;  1F2I G;  4YHH E;  2Q8U A;  5A69 A;  2LE2 A;  4LF6 E;  2EM5 A;  1PJQ A;  5KL4 A;  4O5G A;  4ZYD A;  1G2F C;  2L33 A;  5KL2 A;  2VRD A;  4BC9 A;  5IT9 C;  4JI7 E;  4F2J C;  2KON A;  2K4V A;  2CSH A;  1TF6 A;  2EOQ A;  1MEY C;  2ELZ A;  2EQ1 A;  2LJH A;  2RSI A;  2DMY A;  2EN8 A;  1J26 A;  1HR0 E;  5DNY A;  2LCE A;  2VQF E;  1XNQ E;  5KL3 A;  2ELY A;  4R2E A;  4JI3 E;  4JI0 E;  4F9C B;  2UXB E;  5AE1 A;  3H09 A;  2L8T A;  4R2C A;  1RMD A;  4WXD A;  1BB8 A;  2EMG A;  3ADI A;  1ZTD A;  3EPK A;  2MKN A;  3IWC A;  1LLM C;  2JXP A;  4DV3 E;  2WBS A;  4LF5 E;  1KJK A;  1SFE A;  3ADJ A;  4DV4 E;  2YPN A;  1U61 A;  2QVW A;  4B3T E;  4F54 A;  4LF4 E;  2FTX B; 
#chains in the Genus database with same CATH homology
 2LUP B;  4KZS A;  4L5N C;  4X65 E;  1HNX E;  2LRS A;  4DR3 E;  5LMU E;  1QU6 A;  2LUQ A;  1N36 E;  1GZ6 A;  4R03 A;  1STU A;  1RC5 A;  2V87 A;  5T6J A;  5BR8 E;  2YZT A;  2JR1 A;  2V86 A;  3IWB A;  4X64 E;  4AQY E;  2ODR C;  1SR9 A;  4JI5 E;  4JV5 E;  3O2R A;  4X62 E;  1YYO A;  3C4B A;  1J5E E;  4LF9 E;  4OUN A;  2E5L E;  1HNW E;  2RS6 A;  2JWO A;  3ADL A;  2MDR A;  2JVA A;  2DB2 A;  1UHZ A;  3JAM C;  1YYW A;  3VYX A;  4I8O A;  2M1S A;  4X8W A;  4LF7 E;  4L8N A;  4DMI A;  4R8O A;  5F3W A;  4DV0 E;  4DV2 E;  1X47 A;  2RSM A;  4LU9 A;  4DV5 E;  4LFC E;  4OX9 E;  2GSL A;  4OOG C;  2WZO A;  4DR7 E;  3N3W A;  2V8Q B;  2EZ6 A;  2LTR A;  4WYQ B;  1XNR E;  3HTX A;  2A11 A;  4KHP E;  4P7D A;  1XMO E;  3DJW A;  2KOU A;  2FGG A;  1FJG E;  2VF1 A;  5A2Q C;  2ZM6 E;  1GQE A;  1ZBQ A;  4BS9 A;  4NXN E;  1DI2 A;  1RQ0 A;  4YY3 E;  1X49 A;  5FLX C;  4J8Z A;  2UXC E;  2L2K B;  3JU0 A;  3F6G A;  3O2R B;  3ZOQ B;  2B3T B;  5CFF E;  2UUB E;  4JI1 E;  2UUA E;  4M30 A;  1N32 E;  1N34 E;  3HQ1 A;  2V85 A;  4DR5 E;  4JI2 E;  1WHQ A;  1FKA E;  4B3S E;  1T4O A;  2F8B A;  2MC6 A;  2RTX A;  3LML A;  4F9A B;  4LFA E;  4BBY A;  4LF8 E;  1EKZ A;  1I4S A;  1X48 A;  2FFL A;  2N3H A;  2NA2 A;  3C4T A;  2L3C A;  2YT4 A;  4DUY E;  1IBL E;  2FV4 B;  4GKK E;  2IHR 1;  4Q28 A;  3OTO E;  4DR2 E;  1WHN A;  1JFZ A;  4GEQ B;  4K0K E;  4B3R E;  5LMN E;  4JYA E;  2DSY A;  1YZ9 A;  3K6Q A;  2L3J A;  2V88 A;  4X66 E;  3T1H E;  2NUF A;  3ADG A;  1I94 E;  4JI6 E;  1O0W A;  2KHX A;  4F9B B;  4YHH E;  2JY9 A;  3AUZ A;  5AE2 A;  3IWD A;  4B3M E;  1T4L B;  2LE2 A;  4DV7 E;  2ODR D;  4LF6 E;  2LTS A;  3MSW A;  4LTY A;  3T1Y E;  3FIG A;  2RS7 A;  2L92 A;  3OML A;  5ADZ A;  1RC7 A;  2UU9 E;  2L33 A;  2B9D A;  5IT9 C;  4BC9 A;  4JI8 E;  3P1X A;  2JOX A;  3RMP A;  4DR6 E;  4JI7 E;  4DV1 E;  3AV0 A;  1PKP A;  2VQE E;  2H36 X;  4BC7 A;  3J7A G;  2M4I A;  3F6H A;  3J80 C;  2KON A;  1ZBT A;  2L2N A;  4WSP A;  2K4V A;  2E1M A;  2F4V E;  3HXL A;  4M2Z A;  1IBK E;  2V89 A;  1T4N A;  2LJH A;  2B7V A;  5AE3 A;  4DUZ E;  4DKK A;  4DR1 E;  2DIX A;  1UIL A;  2EB1 A;  2DMY A;  3HPS A;  1HNZ E;  4WFT A;  5AAS A;  1J26 A;  2UUC E;  3VK6 A;  1HR0 E;  2LBS B;  4DR4 E;  2B7T A;  5DNY A;  2VQF E;  1XNQ E;  4LFB E;  4TUI A;  2EWL A;  3J7Y p;  4GKJ E;  3LLH A;  2M7Q A;  4JI3 E;  3RV1 A;  3KWR A;  4F9C B;  1IBM E;  5AE1 A;  4JI0 E;  3H09 A;  2L8T A;  3RV0 A;  2UXB E;  5LL6 R;  2L2M A;  2HHH E;  2G7H A;  2CPN A;  2L6M A;  2N3G A;  3HPZ A;  4DV6 E;  2NUG A;  4JI4 E;  4P78 A;  5IWA E;  4BMJ A;  3ADI A;  1XMQ E;  4TUG A;  3IWC A;  2VE7 C;  2JOB A;  4NXM E;  3VYY A;  3JTZ A;  4DV3 E;  1DQ3 A;  4LF5 E;  1N33 E;  3ADJ A;  4DV4 E;  1U61 A;  1WXR A;  2QVW A;  2NUE A;  4WPY A;  2MC5 A;  4F54 A;  4B3T E;  2UXD E;  2V83 A;  4LF4 E;  4M0V A;  4BCA A;  3DF6 A;  3J81 C;  1YYK A;  2FTX B;  2LMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...