1YYKA

Crystal structure of rnase iii from aquifex aeolicus complexed with double-stranded rna at 2.5-angstrom resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
221
structure length
221
Chain Sequence
MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords 5'-R(*CP*GP*CP*GP*AP*AP*UP*UP*CP*GP*CP*G)-3'
publication title Intermediate states of ribonuclease III in complex with double-stranded RNA
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 65
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2005-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 1yykA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1yykA02
1DI2A 1J5EE 2IHR1 2DIXA 4LF7E 2FFLA 3P1XA 2CPNA 4LF5E 4LF9E 4B3ME 2UUCE 1N34E 1IBLE 4JI5E 4JYAE 4DV4E 4JI1E 4JV5E 3RV0A 2ZM6E 5LMUE 3O2RA 2DMYA 5LMNE 4JI2E 1T4LB 2MDRA 1XMOE 2LUPB 2F4VE 1HNXE 4M30A 2EB1A 1N33E 4X62E 1PKPA 4X66E 3VYXA 5BR8E 4DR4E 3ADLA 2B3TB 1X47A 1RC5A 3ADJA 1YYWA 2L3CA 1IBKE 1QU6A 1XMQE 1FJGE 3O2RB 4JI7E 4DV0E 4DR6E 2GSLA 1STUA 4JI4E 4YHHE 4LF6E 1XNQE 4DKKA 2L3JA 2UUBE 3RV1A 2LUQA 4YY3E 1EKZA 2NA2A 1WHNA 1I4SA 4NXNE 5CFFE 4X64E 4WYQB 2N3HA 1YZ9A 1HNZE 1ZBTA 4AQYE 2LBSB 2KHXA 3C4BA 1GQEA 4JI0E 4DV7E 2LTSA 1N36E 2NUGA 1N32E 2NUFA 3ADGA 4DR3E 4JI6E 2NUEA 4LFBE 1I94E 1X49A 3J7Yp 1T4OA 2JVAA 1JFZA 4M2ZA 2JY9A 4GKKE 4K0KE 4DV2E 2E5LE 4KHPE 2LRSA 1XNRE 3VYYA 2UXCE 2RS7A 4DV3E 3C4TA 4LF4E 3N3WA 2YT4A 1U61A 3T1HE 4DR5E 4JI3E 4LFAE 4GKJE 2L2KB 4LF8E 4B3TE 4OUNA 3T1YE 2UUAE 1T4NA 1UILA 1FKAE 2UXBE 2N3GA 2L2MA 4DV1E 2RTXA 2VQEE 4DUYE 4DV5E 4DV6E 2B7TA 2B7VA 2L2NA 2RS6A 1O0WA 2UU9E 1RC7A 4DR7E 2A11A 3LLHA 2LTRA 3ADIA 3HTXA 4LFCE 2EZ6A 4OOGC 2HHHE 2VQFE 1IBME 3OTOE 4OX9E 2RSMA 1J26A 1YYKA 4DUZE 1X48A 4B3RE 1YYOA 2L33A 4B3SE 4DR1E 1RQ0A 4X65E 4DR2E 2LJHA 4WFTA 5IWAE 4X8WA 2DB2A 2QVWA 1UHZA 4JI8E 2UXDE 1WHQA 4NXME 1HR0E 1HNWE
chains in the Genus database with same CATH superfamily
1DI2A 2EOZA 4ZYEA 1YUIA 2DMIA 2EPPA 2EMKA 2YZTA 3P1XA 2CPNA 1IQOA 1GZ6A 1N34E 4JYAE 4JI5E 3VK6A 4DV4E 3J80C 2EQ3A 2EOJA 5A69A 1IMUA 2MDRA 2YTFA 2F4VE 2YTOA 2JPAA 1TF6A 1PKPA 2DLKA 2EJ4A 4R2AA 2R76A 1YFHA 3VYXA 5BR8E 4DR4E 2ADRA 2ODRD 2JOBA 3IWDA 2G7HA 1BBOA 1X47A 2L8TA 4GZNC 5AC5A 4RHBB 2HGHA 3O2RB 4JI7E 1LLMC 2EWLA 2L3JA 1RMDA 2NABA 4F54A 2YPNA 5IXMB 2EMAA 5IT9C 1A1JA 1BB8A 4AQYE 2EQ0A 2V85A 2JR1A 2LTSA 3H09A 2NUGA 1PDAA 3BF2A 1B69A 4JI6E 4BHCA 2DSYA 1ZR9A 4LTYA 3EQ1A 2YTNA 2YRMA 4DV2E 2EL4A 2LRSA 2EM8A 4R2DA 2UXCE 2JOXA 2EM6A 4WXDA 2CSHA 2EMGA 2KOUA 5AE3A 4DR5E 4LFAE 4GKJE 4BS9A 2EN6A 4OUNA 3T1YE 4KZSA 3HPSA 3HQ1A 2EM7A 4NHRA 4MLVA 2VQEE 4DUYE 1KJKA 2CT1A 2RS6A 2LTRA 2EOQA 3ADIA 2B9DA 2EL5A 5A6BA 4Q35B 1IBME 2RSMA 3F6GA 1YYKA 2Q8UA 5KL7A 4DUZE 3VHTB 2EOXA 2HC5A 4DR1E 4WXCA 2JXPA 2QVWA 2EMZA 2UXDE 2EN2A 1G2DC 5DNYA 2VE7C 2LVHA 2FTXB 2IHR1 4LF7E 2EPOA 4TUGA 4LF5E 2DRPA 2UUCE 1IBLE 2EMIA 3THOB 1T39A 2VRDA 3RV0A 3DJWA 2E72A 4N4RB 1T4LB 1JK2A 1A1KA 5LL6R 1XMOE 1NCSA 5A6KA 2FV4B 4ZYHA 2V8QB 2EB1A 2M9AA 1N33E 4X66E 2K7IA 4IS1C 3AV0A 4P78A 1MGTA 1SR9A 1DGCA 3ECRA 1WRJA 2PRTA 2M1SA 1RC5A 1YYWA 2I13A 2L3CA 2EM0A 2I9IA 1QU6A 1XMQE 1IBKE 1FJGE 2FGGA 2YU8A 4J8ZA 1STUA 4LU9A 2EPAA 4JI4E 4YHHE 2YSPA 2DLQA 2K4VA 1X6EA 1GTKA 4O43A 4YY3E 1EKZA 2NA2A 1TN9A 1WHNA 1I4SA 5CFFE 2EPCA 2EP3A 3MHHC 3C6MA 1HNZE 2EMYA 2V88A 3K6QA 3J81C 2BB8A 1GQEA 1N36E 2YSOA 5AC4A 2GLIA 3HXLA 5A6BD 3C6KA 5IV8B 2EPNA 3ADGA 2EMWA 2YTEA 2NUEA 1ZBQA 2MC6A 3KZYA 1T4OA 1X6HA 4M2ZA 2ELYA 2JVAA 4GKKE 5T6JA 1KYQA 1XNRE 2RS7A 2BBGA 4DV3E 5A6JA 3N3WA 4WX9A 1U61A 3IWCA 3T1HE 2WBSA 4L5NC 2UUAE 3IWBA 2LCEA 1UILA 1Z1BA 4M0VA 1P47A 2L2MA 4DV1E 2RTXA 5KL3A 4DV6E 1A1LA 4R2EA 4BC7A 2EPRA 2R1FA 2EN8A 2EORA 1O0WA 2MDGA 3LLHA 3HTXA 2EPLX 3RMPA 4OOGC 2HHHE 2EPMX 2LMZA 1J26A 2EOYA 2H36X 2EM3A 1X5WA 5LLQA 1YYOA 4B3RE 3F6HA 1A1IA 4O4KA 1RQ0A 2LJHA 4GEQB 4X8WA 1A1HA 4R8OA 1UHZA 2ODRC 1WHQA 1HR0E 2J7JA 3EPKA 4BCAA 2MC5A 2RSIA 5TSEA 2DIXA 2JP9A 2FFLA 1N3GA 2EN7A 4LF9E 4B3ME 2EOMA 2WBUA 2MKNA 2RQLA 4M9VC 2LT7A 1UBDC 2HJJA 3O2RA 4I8OA 2EOIA 5KL5A 1HNXE 2ENAA 5AE2A 2EM9A 2N8XA 2M7QA 1PJSA 2ENHA 2EMXA 5KL4A 3ADLA 2B3TB 2EL6A 2GPIA 1X3CA 3ADJA 1EH8A 2EOSA 2YRKA 4O24A 2YU5A 1EH6A 4DV0E 2GSLA 3M99B 1PJTA 2EOHA 1G2FC 4F6MA 4L8NA 3RV1A 2MKDA 3UK3C 1QNTA 1YUJA 2N3HA 1ZBTA 4WSPA 2LBSB 2D9HA 3C4BA 4BBYA 1MEYC 5ADZA 1N32E 3L00A 2EOEA 3HPZA 4DR3E 1F2IG 1PJQA 2LJUA 4WPYA 2EMFA 2V86A 3J7Yp 4RH8A 2V89A 1JFZA 4MLQA 4K0KE 4KHPE 2E5LE 2EE8A 2EPXA 3BGHA 3J7AG 3QG5C 4HEIA 3C4TA 4F9AB 2GHFA 5KL2A 2YT4A 2EPZA 2L2KB 4FK5C 2EPKX 2EN1A 5FLXC 1T4NA 3MHSC 1FKAE 1TF3A 2EN4A 3TQMA 2N3GA 5A6AA 2B7TA 2RPCA 1RC7A 1A1FA 2JYAA 2V83A 5KL6A 3OTOE 3DF6A 4OX9E 4BHBA 2YRHA 1JK1A 2ENCA 3FIGA 2YTDA 4KWYA 2LE2A 2KONA 4F9CB 3EPJA 5AE1A 4DR2E 4WFTA 5IWAE 1EH7A 4F2JC 2ELZA 2DGCA 2DB2A 4IJDA 4JI8E 2JWOA 1HNWE 1DQ3A 3KZZA 1J5EE 2EMCA 2YWQA 2F8BA 4R2CA 2L92A 3KWRA 1AH5A 4JI1E 3MSWA 2EOOA 4JV5E 3JAMC 2ZM6E 5LMUE 2DMYA 5LMNE 4JI2E 4X9JA 2EMBA 4ZYGA 4R2SA 1BBGA 2LUPB 2YTPA 4BC9A 4M30A 4X62E 5AASA 2YTJA 1ZTDA 1SFEA 1T38A 4R2RA 3THNA 4F9BB 1ZU1A 2WBTA 4F6NA 4O5GA 2YTQA 4DR6E 1A1GA 4Q28A 4LF6E 1XNQE 4DKKA 2UUBE 2LUQA 2V87A 4NXNE 4X64E 4R03A 4WYQB 1YZ9A 1X6FA 4TUIA 1UN6B 2KHXA 1L4SA 4JI0E 2EM2A 2EPUA 4DV7E 1ZAAC 3ZOQB 2YTGA 2NUFA 3LMLA 3EPHA 1YSAC 4LFBE 1I94E 1X49A 2EMLA 4NZVA 2JY9A 1IQSA 5F3WA 2M4IA 1WJPA 1WXRA 3VYYA 2EMHA 4LF4E 3JTZA 1NEIA 4JI3E 4BMJA 4LF8E 4B3TE 2UXBE 5A2QC 4DV5E 3EPLA 1YPNA 2B7VA 4R2QA 4P7DA 3AUZA 2L2NA 2VF1A 3BIDA 2UU9E 2EOFA 2LO3A 2EN3A 4DR7E 2A11A 2LV2A 4LFCE 2EZ6A 2WZOA 2E1MA 2VQFE 4DMIA 2L6MA 2YTIA 1AAYA 1X48A 2EM4A 2L33A 4WSGA 4B3SE 2EM5A 2WCC3 4X65E 2EQ1A 3OMLA 3BBGA 2A25A 4R2PA 4ZYDA 2CTDA 4NXME 3JU0A 4HTGA
chains in the Genus database with same CATH topology
2MC5A 1DI2A 2FTXB 1J5EE 2IHR1 2DIXA 4LF7E 2FFLA 2YZTA 3P1XA 2CPNA 4TUGA 2F8BA 4LF5E 4LF9E 1GZ6A 4B3ME 2UUCE 2L92A 1N34E 1IBLE 3VK6A 4JI5E 3KWRA 4JYAE 4DV4E 4JI1E 3MSWA 3J80C 4JV5E 3JAMC 3RV0A 3DJWA 2ZM6E 3O2RA 2DMYA 5LMNE 5LMUE 4I8OA 4JI2E 1T4LB 5LL6R 2MDRA 1XMOE 2LUPB 2F4VE 4BC9A 2FV4B 1HNXE 4M30A 2V8QB 2EB1A 1N33E 4X62E 1PKPA 5AE2A 4X66E 2M7QA 3VYXA 5AASA 5BR8E 3AV0A 4DR4E 2ODRD 4P78A 3ADLA 1SR9A 2JOBA 2B3TB 3IWDA 2G7HA 1X47A 2L8TA 2M1SA 1RC5A 3ADJA 4F9BB 1YYWA 2L3CA 1IBKE 1QU6A 1XMQE 1FJGE 2FGGA 3O2RB 4JI7E 4DV0E 4DR6E 2GSLA 4J8ZA 1STUA 4LU9A 4Q28A 4JI4E 4YHHE 2EWLA 4LF6E 4DKKA 2L3JA 1XNQE 2UUBE 2K4VA 4L8NA 3RV1A 2LUQA 2V87A 4F54A 2NA2A 4YY3E 1WHNA 1I4SA 1EKZA 4NXNE 5CFFE 4X64E 5IT9C 4R03A 4WYQB 2N3HA 1YZ9A 4TUIA 1ZBTA 1HNZE 4WSPA 2V88A 4AQYE 2LBSB 3K6QA 3J81C 2KHXA 3C4BA 4BBYA 1GQEA 2V85A 4JI0E 2JR1A 4DV7E 2LTSA 3H09A 2NUGA 3ZOQB 5ADZA 1N36E 1N32E 3HXLA 2NUFA 3LMLA 3ADGA 3HPZA 4DR3E 4JI6E 2DSYA 4LTYA 4WPYA 2NUEA 1ZBQA 2MC6A 1X49A 2V86A 3J7Yp 1I94E 4LFBE 1T4OA 2JVAA 1JFZA 4M2ZA 2JY9A 2V89A 5F3WA 2M4IA 4GKKE 5T6JA 4DV2E 2E5LE 4K0KE 4KHPE 2LRSA 1WXRA 3VYYA 1XNRE 4GKJE 3J7AG 2JOXA 2RS7A 2UXCE 4DV3E 3C4TA 4LF4E 4F9AB 3N3WA 3JTZA 2KOUA 2YT4A 1U61A 3IWCA 5AE3A 4DR5E 3T1HE 4BMJA 4JI3E 4LFAE 4BS9A 2L2KB 4B3TE 4LF8E 4OUNA 5FLXC 3T1YE 4L5NC 4KZSA 1T4NA 3HPSA 2UUAE 3IWBA 3HQ1A 1UILA 1FKAE 2UXBE 4M0VA 2N3GA 2L2MA 4DV1E 2RTXA 5A2QC 2VQEE 4DUYE 4DV5E 4DV6E 2B7TA 4BC7A 2B7VA 4P7DA 3AUZA 2L2NA 2RS6A 1O0WA 2VF1A 2UU9E 1RC7A 4DR7E 2A11A 3LLHA 2LTRA 3ADIA 3HTXA 2B9DA 3RMPA 4LFCE 2EZ6A 2WZOA 4OOGC 2HHHE 2V83A 2E1MA 2VQFE 1IBME 3OTOE 3DF6A 4OX9E 2LMZA 2RSMA 3F6GA 1YYKA 4DMIA 1J26A 2L6MA 2H36X 4DUZE 1X48A 4B3RE 1YYOA 3FIGA 3F6HA 2L33A 4B3SE 4DR1E 2LE2A 2KONA 4F9CB 5AE1A 1RQ0A 4X65E 4DR2E 2LJHA 3OMLA 4GEQB 4WFTA 5IWAE 4X8WA 2DB2A 2QVWA 4R8OA 1UHZA 4JI8E 2ODRC 2UXDE 1WHQA 2JWOA 3JU0A 1HR0E 4NXME 1DQ3A 1HNWE 4BCAA 5DNYA 2VE7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DI2 A;  1J5E E;  2IHR 1;  2DIX A;  4LF7 E;  2FFL A;  3P1X A;  2CPN A;  4LF5 E;  4LF9 E;  4B3M E;  2UUC E;  1N34 E;  1IBL E;  4JI5 E;  4JYA E;  4DV4 E;  4JI1 E;  4JV5 E;  3RV0 A;  2ZM6 E;  5LMU E;  3O2R A;  2DMY A;  5LMN E;  4JI2 E;  1T4L B;  2MDR A;  1XMO E;  2LUP B;  2F4V E;  1HNX E;  4M30 A;  2EB1 A;  1N33 E;  4X62 E;  1PKP A;  4X66 E;  3VYX A;  5BR8 E;  4DR4 E;  3ADL A;  2B3T B;  1X47 A;  1RC5 A;  3ADJ A;  1YYW A;  2L3C A;  1IBK E;  1QU6 A;  1XMQ E;  1FJG E;  3O2R B;  4JI7 E;  4DV0 E;  4DR6 E;  2GSL A;  1STU A;  4JI4 E;  4YHH E;  4LF6 E;  1XNQ E;  4DKK A;  2L3J A;  2UUB E;  3RV1 A;  2LUQ A;  4YY3 E;  1EKZ A;  2NA2 A;  1WHN A;  1I4S A;  4NXN E;  5CFF E;  4X64 E;  4WYQ B;  2N3H A;  1YZ9 A;  1HNZ E;  1ZBT A;  4AQY E;  2LBS B;  2KHX A;  3C4B A;  1GQE A;  4JI0 E;  4DV7 E;  2LTS A;  1N36 E;  2NUG A;  1N32 E;  2NUF A;  3ADG A;  4DR3 E;  4JI6 E;  2NUE A;  4LFB E;  1I94 E;  1X49 A;  3J7Y p;  1T4O A;  2JVA A;  1JFZ A;  4M2Z A;  2JY9 A;  4GKK E;  4K0K E;  4DV2 E;  2E5L E;  4KHP E;  2LRS A;  1XNR E;  3VYY A;  2UXC E;  2RS7 A;  4DV3 E;  3C4T A;  4LF4 E;  3N3W A;  2YT4 A;  1U61 A;  3T1H E;  4DR5 E;  4JI3 E;  4LFA E;  4GKJ E;  2L2K B;  4LF8 E;  4B3T E;  4OUN A;  3T1Y E;  2UUA E;  1T4N A;  1UIL A;  1FKA E;  2UXB E;  2N3G A;  2L2M A;  4DV1 E;  2RTX A;  2VQE E;  4DUY E;  4DV5 E;  4DV6 E;  2B7T A;  2B7V A;  2L2N A;  2RS6 A;  1O0W A;  2UU9 E;  1RC7 A;  4DR7 E;  2A11 A;  3LLH A;  2LTR A;  3ADI A;  3HTX A;  4LFC E;  2EZ6 A;  4OOG C;  2HHH E;  2VQF E;  1IBM E;  3OTO E;  4OX9 E;  2RSM A;  1J26 A;  1YYK A;  4DUZ E;  1X48 A;  4B3R E;  1YYO A;  2L33 A;  4B3S E;  4DR1 E;  1RQ0 A;  4X65 E;  4DR2 E;  2LJH A;  4WFT A;  5IWA E;  4X8W A;  2DB2 A;  2QVW A;  1UHZ A;  4JI8 E;  2UXD E;  1WHQ A;  4NXM E;  1HR0 E;  1HNW E; 
#chains in the Genus database with same CATH topology
 1DI2 A;  2EOZ A;  4ZYE A;  1YUI A;  2DMI A;  2EPP A;  2EMK A;  2YZT A;  3P1X A;  2CPN A;  1IQO A;  1GZ6 A;  1N34 E;  4JYA E;  4JI5 E;  3VK6 A;  4DV4 E;  3J80 C;  2EQ3 A;  2EOJ A;  5A69 A;  1IMU A;  2MDR A;  2YTF A;  2F4V E;  2YTO A;  2JPA A;  1TF6 A;  1PKP A;  2DLK A;  2EJ4 A;  4R2A A;  2R76 A;  1YFH A;  3VYX A;  5BR8 E;  4DR4 E;  2ADR A;  2ODR D;  2JOB A;  3IWD A;  2G7H A;  1BBO A;  1X47 A;  2L8T A;  4GZN C;  5AC5 A;  4RHB B;  2HGH A;  3O2R B;  4JI7 E;  1LLM C;  2EWL A;  2L3J A;  1RMD A;  2NAB A;  4F54 A;  2YPN A;  5IXM B;  2EMA A;  5IT9 C;  1A1J A;  1BB8 A;  4AQY E;  2EQ0 A;  2V85 A;  2JR1 A;  2LTS A;  3H09 A;  2NUG A;  1PDA A;  3BF2 A;  1B69 A;  4JI6 E;  4BHC A;  2DSY A;  1ZR9 A;  4LTY A;  3EQ1 A;  2YTN A;  2YRM A;  4DV2 E;  2EL4 A;  2LRS A;  2EM8 A;  4R2D A;  2UXC E;  2JOX A;  2EM6 A;  4WXD A;  2CSH A;  2EMG A;  2KOU A;  5AE3 A;  4DR5 E;  4LFA E;  4GKJ E;  4BS9 A;  2EN6 A;  4OUN A;  3T1Y E;  4KZS A;  3HPS A;  3HQ1 A;  2EM7 A;  4NHR A;  4MLV A;  2VQE E;  4DUY E;  1KJK A;  2CT1 A;  2RS6 A;  2LTR A;  2EOQ A;  3ADI A;  2B9D A;  2EL5 A;  5A6B A;  4Q35 B;  1IBM E;  2RSM A;  3F6G A;  1YYK A;  2Q8U A;  5KL7 A;  4DUZ E;  3VHT B;  2EOX A;  2HC5 A;  4DR1 E;  4WXC A;  2JXP A;  2QVW A;  2EMZ A;  2UXD E;  2EN2 A;  1G2D C;  5DNY A;  2VE7 C;  2LVH A;  2FTX B;  2IHR 1;  4LF7 E;  2EPO A;  4TUG A;  4LF5 E;  2DRP A;  2UUC E;  1IBL E;  2EMI A;  3THO B;  1T39 A;  2VRD A;  3RV0 A;  3DJW A;  2E72 A;  4N4R B;  1T4L B;  1JK2 A;  1A1K A;  5LL6 R;  1XMO E;  1NCS A;  5A6K A;  2FV4 B;  4ZYH A;  2V8Q B;  2EB1 A;  2M9A A;  1N33 E;  4X66 E;  2K7I A;  4IS1 C;  3AV0 A;  4P78 A;  1MGT A;  1SR9 A;  1DGC A;  3ECR A;  1WRJ A;  2PRT A;  2M1S A;  1RC5 A;  1YYW A;  2I13 A;  2L3C A;  2EM0 A;  2I9I A;  1QU6 A;  1XMQ E;  1IBK E;  1FJG E;  2FGG A;  2YU8 A;  4J8Z A;  1STU A;  4LU9 A;  2EPA A;  4JI4 E;  4YHH E;  2YSP A;  2DLQ A;  2K4V A;  1X6E A;  1GTK A;  4O43 A;  4YY3 E;  1EKZ A;  2NA2 A;  1TN9 A;  1WHN A;  1I4S A;  5CFF E;  2EPC A;  2EP3 A;  3MHH C;  3C6M A;  1HNZ E;  2EMY A;  2V88 A;  3K6Q A;  3J81 C;  2BB8 A;  1GQE A;  1N36 E;  2YSO A;  5AC4 A;  2GLI A;  3HXL A;  5A6B D;  3C6K A;  5IV8 B;  2EPN A;  3ADG A;  2EMW A;  2YTE A;  2NUE A;  1ZBQ A;  2MC6 A;  3KZY A;  1T4O A;  1X6H A;  4M2Z A;  2ELY A;  2JVA A;  4GKK E;  5T6J A;  1KYQ A;  1XNR E;  2RS7 A;  2BBG A;  4DV3 E;  5A6J A;  3N3W A;  4WX9 A;  1U61 A;  3IWC A;  3T1H E;  2WBS A;  4L5N C;  2UUA E;  3IWB A;  2LCE A;  1UIL A;  1Z1B A;  4M0V A;  1P47 A;  2L2M A;  4DV1 E;  2RTX A;  5KL3 A;  4DV6 E;  1A1L A;  4R2E A;  4BC7 A;  2EPR A;  2R1F A;  2EN8 A;  2EOR A;  1O0W A;  2MDG A;  3LLH A;  3HTX A;  2EPL X;  3RMP A;  4OOG C;  2HHH E;  2EPM X;  2LMZ A;  1J26 A;  2EOY A;  2H36 X;  2EM3 A;  1X5W A;  5LLQ A;  1YYO A;  4B3R E;  3F6H A;  1A1I A;  4O4K A;  1RQ0 A;  2LJH A;  4GEQ B;  4X8W A;  1A1H A;  4R8O A;  1UHZ A;  2ODR C;  1WHQ A;  1HR0 E;  2J7J A;  3EPK A;  4BCA A;  2MC5 A;  2RSI A;  5TSE A;  2DIX A;  2JP9 A;  2FFL A;  1N3G A;  2EN7 A;  4LF9 E;  4B3M E;  2EOM A;  2WBU A;  2MKN A;  2RQL A;  4M9V C;  2LT7 A;  1UBD C;  2HJJ A;  3O2R A;  4I8O A;  2EOI A;  5KL5 A;  1HNX E;  2ENA A;  5AE2 A;  2EM9 A;  2N8X A;  2M7Q A;  1PJS A;  2ENH A;  2EMX A;  5KL4 A;  3ADL A;  2B3T B;  2EL6 A;  2GPI A;  1X3C A;  3ADJ A;  1EH8 A;  2EOS A;  2YRK A;  4O24 A;  2YU5 A;  1EH6 A;  4DV0 E;  2GSL A;  3M99 B;  1PJT A;  2EOH A;  1G2F C;  4F6M A;  4L8N A;  3RV1 A;  2MKD A;  3UK3 C;  1QNT A;  1YUJ A;  2N3H A;  1ZBT A;  4WSP A;  2LBS B;  2D9H A;  3C4B A;  4BBY A;  1MEY C;  5ADZ A;  1N32 E;  3L00 A;  2EOE A;  3HPZ A;  4DR3 E;  1F2I G;  1PJQ A;  2LJU A;  4WPY A;  2EMF A;  2V86 A;  3J7Y p;  4RH8 A;  2V89 A;  1JFZ A;  4MLQ A;  4K0K E;  4KHP E;  2E5L E;  2EE8 A;  2EPX A;  3BGH A;  3J7A G;  3QG5 C;  4HEI A;  3C4T A;  4F9A B;  2GHF A;  5KL2 A;  2YT4 A;  2EPZ A;  2L2K B;  4FK5 C;  2EPK X;  2EN1 A;  5FLX C;  1T4N A;  3MHS C;  1FKA E;  1TF3 A;  2EN4 A;  3TQM A;  2N3G A;  5A6A A;  2B7T A;  2RPC A;  1RC7 A;  1A1F A;  2JYA A;  2V83 A;  5KL6 A;  3OTO E;  3DF6 A;  4OX9 E;  4BHB A;  2YRH A;  1JK1 A;  2ENC A;  3FIG A;  2YTD A;  4KWY A;  2LE2 A;  2KON A;  4F9C B;  3EPJ A;  5AE1 A;  4DR2 E;  4WFT A;  5IWA E;  1EH7 A;  4F2J C;  2ELZ A;  2DGC A;  2DB2 A;  4IJD A;  4JI8 E;  2JWO A;  1HNW E;  1DQ3 A;  3KZZ A;  1J5E E;  2EMC A;  2YWQ A;  2F8B A;  4R2C A;  2L92 A;  3KWR A;  1AH5 A;  4JI1 E;  3MSW A;  2EOO A;  4JV5 E;  3JAM C;  2ZM6 E;  5LMU E;  2DMY A;  5LMN E;  4JI2 E;  4X9J A;  2EMB A;  4ZYG A;  4R2S A;  1BBG A;  2LUP B;  2YTP A;  4BC9 A;  4M30 A;  4X62 E;  5AAS A;  2YTJ A;  1ZTD A;  1SFE A;  1T38 A;  4R2R A;  3THN A;  4F9B B;  1ZU1 A;  2WBT A;  4F6N A;  4O5G A;  2YTQ A;  4DR6 E;  1A1G A;  4Q28 A;  4LF6 E;  1XNQ E;  4DKK A;  2UUB E;  2LUQ A;  2V87 A;  4NXN E;  4X64 E;  4R03 A;  4WYQ B;  1YZ9 A;  1X6F A;  4TUI A;  1UN6 B;  2KHX A;  1L4S A;  4JI0 E;  2EM2 A;  2EPU A;  4DV7 E;  1ZAA C;  3ZOQ B;  2YTG A;  2NUF A;  3LML A;  3EPH A;  1YSA C;  4LFB E;  1I94 E;  1X49 A;  2EML A;  4NZV A;  2JY9 A;  1IQS A;  5F3W A;  2M4I A;  1WJP A;  1WXR A;  3VYY A;  2EMH A;  4LF4 E;  3JTZ A;  1NEI A;  4JI3 E;  4BMJ A;  4LF8 E;  4B3T E;  2UXB E;  5A2Q C;  4DV5 E;  3EPL A;  1YPN A;  2B7V A;  4R2Q A;  4P7D A;  3AUZ A;  2L2N A;  2VF1 A;  3BID A;  2UU9 E;  2EOF A;  2LO3 A;  2EN3 A;  4DR7 E;  2A11 A;  2LV2 A;  4LFC E;  2EZ6 A;  2WZO A;  2E1M A;  2VQF E;  4DMI A;  2L6M A;  2YTI A;  1AAY A;  1X48 A;  2EM4 A;  2L33 A;  4WSG A;  4B3S E;  2EM5 A;  2WCC 3;  4X65 E;  2EQ1 A;  3OML A;  3BBG A;  2A25 A;  4R2P A;  4ZYD A;  2CTD A;  4NXM E;  3JU0 A;  4HTG A; 
#chains in the Genus database with same CATH homology
 2MC5 A;  1DI2 A;  2FTX B;  1J5E E;  2IHR 1;  2DIX A;  4LF7 E;  2FFL A;  2YZT A;  3P1X A;  2CPN A;  4TUG A;  2F8B A;  4LF5 E;  4LF9 E;  1GZ6 A;  4B3M E;  2UUC E;  2L92 A;  1N34 E;  1IBL E;  3VK6 A;  4JI5 E;  3KWR A;  4JYA E;  4DV4 E;  4JI1 E;  3MSW A;  3J80 C;  4JV5 E;  3JAM C;  3RV0 A;  3DJW A;  2ZM6 E;  3O2R A;  2DMY A;  5LMN E;  5LMU E;  4I8O A;  4JI2 E;  1T4L B;  5LL6 R;  2MDR A;  1XMO E;  2LUP B;  2F4V E;  4BC9 A;  2FV4 B;  1HNX E;  4M30 A;  2V8Q B;  2EB1 A;  1N33 E;  4X62 E;  1PKP A;  5AE2 A;  4X66 E;  2M7Q A;  3VYX A;  5AAS A;  5BR8 E;  3AV0 A;  4DR4 E;  2ODR D;  4P78 A;  3ADL A;  1SR9 A;  2JOB A;  2B3T B;  3IWD A;  2G7H A;  1X47 A;  2L8T A;  2M1S A;  1RC5 A;  3ADJ A;  4F9B B;  1YYW A;  2L3C A;  1IBK E;  1QU6 A;  1XMQ E;  1FJG E;  2FGG A;  3O2R B;  4JI7 E;  4DV0 E;  4DR6 E;  2GSL A;  4J8Z A;  1STU A;  4LU9 A;  4Q28 A;  4JI4 E;  4YHH E;  2EWL A;  4LF6 E;  4DKK A;  2L3J A;  1XNQ E;  2UUB E;  2K4V A;  4L8N A;  3RV1 A;  2LUQ A;  2V87 A;  4F54 A;  2NA2 A;  4YY3 E;  1WHN A;  1I4S A;  1EKZ A;  4NXN E;  5CFF E;  4X64 E;  5IT9 C;  4R03 A;  4WYQ B;  2N3H A;  1YZ9 A;  4TUI A;  1ZBT A;  1HNZ E;  4WSP A;  2V88 A;  4AQY E;  2LBS B;  3K6Q A;  3J81 C;  2KHX A;  3C4B A;  4BBY A;  1GQE A;  2V85 A;  4JI0 E;  2JR1 A;  4DV7 E;  2LTS A;  3H09 A;  2NUG A;  3ZOQ B;  5ADZ A;  1N36 E;  1N32 E;  3HXL A;  2NUF A;  3LML A;  3ADG A;  3HPZ A;  4DR3 E;  4JI6 E;  2DSY A;  4LTY A;  4WPY A;  2NUE A;  1ZBQ A;  2MC6 A;  1X49 A;  2V86 A;  3J7Y p;  1I94 E;  4LFB E;  1T4O A;  2JVA A;  1JFZ A;  4M2Z A;  2JY9 A;  2V89 A;  5F3W A;  2M4I A;  4GKK E;  5T6J A;  4DV2 E;  2E5L E;  4K0K E;  4KHP E;  2LRS A;  1WXR A;  3VYY A;  1XNR E;  4GKJ E;  3J7A G;  2JOX A;  2RS7 A;  2UXC E;  4DV3 E;  3C4T A;  4LF4 E;  4F9A B;  3N3W A;  3JTZ A;  2KOU A;  2YT4 A;  1U61 A;  3IWC A;  5AE3 A;  4DR5 E;  3T1H E;  4BMJ A;  4JI3 E;  4LFA E;  4BS9 A;  2L2K B;  4B3T E;  4LF8 E;  4OUN A;  5FLX C;  3T1Y E;  4L5N C;  4KZS A;  1T4N A;  3HPS A;  2UUA E;  3IWB A;  3HQ1 A;  1UIL A;  1FKA E;  2UXB E;  4M0V A;  2N3G A;  2L2M A;  4DV1 E;  2RTX A;  5A2Q C;  2VQE E;  4DUY E;  4DV5 E;  4DV6 E;  2B7T A;  4BC7 A;  2B7V A;  4P7D A;  3AUZ A;  2L2N A;  2RS6 A;  1O0W A;  2VF1 A;  2UU9 E;  1RC7 A;  4DR7 E;  2A11 A;  3LLH A;  2LTR A;  3ADI A;  3HTX A;  2B9D A;  3RMP A;  4LFC E;  2EZ6 A;  2WZO A;  4OOG C;  2HHH E;  2V83 A;  2E1M A;  2VQF E;  1IBM E;  3OTO E;  3DF6 A;  4OX9 E;  2LMZ A;  2RSM A;  3F6G A;  1YYK A;  4DMI A;  1J26 A;  2L6M A;  2H36 X;  4DUZ E;  1X48 A;  4B3R E;  1YYO A;  3FIG A;  3F6H A;  2L33 A;  4B3S E;  4DR1 E;  2LE2 A;  2KON A;  4F9C B;  5AE1 A;  1RQ0 A;  4X65 E;  4DR2 E;  2LJH A;  3OML A;  4GEQ B;  4WFT A;  5IWA E;  4X8W A;  2DB2 A;  2QVW A;  4R8O A;  1UHZ A;  4JI8 E;  2ODR C;  2UXD E;  1WHQ A;  2JWO A;  3JU0 A;  1HR0 E;  4NXM E;  1DQ3 A;  1HNW E;  4BCA A;  5DNY A;  2VE7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...