1YYKA

Crystal structure of rnase iii from aquifex aeolicus complexed with double-stranded rna at 2.5-angstrom resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
221
structure length
221
Chain Sequence
MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*CP*GP*CP*GP*AP*AP*UP*UP*CP*GP*CP*G)-3'
publication title Intermediate states of ribonuclease III in complex with double-stranded RNA
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
total genus 65
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2005-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 1yykA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1yykA02
1J26A 3T1HE 4DUYE 2L33A 2VQFE 3ADJA 1GQEA 2RTXA 4KHPE 4GKKE 1HNXE 1I4SA 1N36E 1RC5A 2UUBE 2JY9A 4LF9E 1YYOA 4JV5E 2L3CA 4LFAE 2L3JA 3O2RB 2LRSA 4DV1E 4JI5E 2LUPB 1DI2A 2RS6A 1N34E 1IBLE 2L2KB 4GKJE 3N3WA 4DV0E 4DR3E 2VQEE 3J7Yp 2QVWA 3ADLA 1QU6A 2LBSB 1WHQA 4M30A 4JI7E 2B7TA 1J5EE 2UXDE 5LMNE 2L2MA 1UILA 1WHNA 4X66E 4DR4E 4AQYE 3ADGA 1XNQE 2LJHA 1I94E 4B3TE 2NUFA 2ZM6E 1O0WA 1FKAE 1N32E 1T4LB 1JFZA 2UXBE 4DV6E 4DV2E 1XMOE 2EB1A 4WFTA 4LF8E 2YT4A 1PKPA 4LF7E 4DV7E 2A11A 2DB2A 1EKZA 2HHHE 4NXNE 1U61A 1YYWA 4OOGC 4M2ZA 4X8WA 4OUNA 5CFFE 4JYAE 4X65E 1YZ9A 1RC7A 4DR1E 1RQ0A 4DUZE 2L2NA 2KHXA 2MDRA 1X48A 4LF6E 4DV5E 2UXCE 2RS7A 1T4OA 2FFLA 4JI2E 2DMYA 1HNWE 3C4BA 1X49A 3LLHA 5LMUE 4WYQB 4DR2E 1UHZA 3RV0A 4B3RE 1IBKE 2RSMA 2B3TB 3O2RA 2LTRA 1STUA 3VYYA 4DKKA 4JI1E 1XMQE 4DV4E 4X62E 2IHR1 2NUGA 2CPNA 4DR5E 4JI0E 2JVAA 1XNRE 2DIXA 2NA2A 4K0KE 1FJGE 2LUQA 2UU9E 4LFCE 4JI8E 2UUAE 2N3HA 5IWAE 4YHHE 4LF4E 2F4VE 3VYXA 3HTXA 3P1XA 4LF5E 1HNZE 1YYKA 4LFBE 2N3GA 3T1YE 4B3SE 4JI3E 4B3ME 2E5LE 4OX9E 2LTSA 1N33E 1HR0E 4NXME 1X47A 4DV3E 4DR6E 4JI4E 4JI6E 2GSLA 3RV1A 2EZ6A 2NUEA 1ZBTA 3C4TA 1T4NA 5BR8E 4X64E 4YY3E 3OTOE 1IBME 2UUCE 3ADIA 4DR7E 2B7VA
chains in the Genus database with same CATH superfamily
2DSYA 3HXLA 1A1KA 3ECRA 2L8TA 2EMXA 4R2EA 5T6JA 2DLQA 1AAYA 4FK5C 1X6FA 1I4SA 2EMLA 4WPYA 4JV5E 2WBTA 3L00A 4LFAE 1KYQA 2EMFA 2LUPB 2F8BA 1N34E 1IBLE 2KONA 3HQ1A 2VE7C 3N3WA 1JK2A 1G2DC 3KZZA 4GKJE 3UK3C 1PJTA 2QVWA 2LT7A 4M30A 2ODRC 4N4RB 2MC6A 2HC5A 2L2MA 2EMZA 2RPCA 1WHNA 2EL5A 2DGCA 2LJHA 2NABA 2V83A 3C6MA 2EM9A 2B7VA 2EM8A 2B9DA 2EN3A 3BF2A 4P78A 4DV2E 2HGHA 2K4VA 2EOSA 2YU5A 2EOMA 1PKPA 3THOB 4Q28A 3MSWA 1BBOA 1WRJA 1EKZA 1LLMC 2EN8A 1YYWA 2DLKA 2V88A 4OUNA 2V86A 2WZOA 1YSAC 2L2NA 4ZYDA 1X48A 2I13A 4LF6E 1T4OA 4R2SA 4JI2E 2YTFA 2WBUA 5IV8B 1UHZA 4R2RA 1SFEA 5ADZA 3O2RA 2V89A 2EWLA 3MHSC 2ODRD 3VYYA 4JI1E 4WSGA 1QNTA 2EMAA 2MDGA 2CPNA 5A6BA 2EPPA 2ADRA 2JVAA 2EN7A 1X5WA 5AC5A 1GTKA 4LFCE 2JP9A 2GPIA 4J8ZA 3VK6A 4F2JC 4JI3E 4OX9E 2JOXA 1HR0E 4NXME 1EH8A 1IMUA 1ZTDA 4LTYA 2GSLA 3BIDA 4X64E 2V85A 5LLQA 2LMZA 3F6HA 5KL6A 1PJSA 2MKDA 2N8XA 4BBYA 2WCC3 2BB8A 1TF6A 4DUYE 2EOZA 1J26A 2FV4B 2L33A 1X3CA 4R2DA 2EM4A 5DNYA 3M99B 1UN6B 4ZYEA 2EL4A 2EN2A 2EPZA 1P47A 2JR1A 2JOBA 2JY9A 1YYOA 2DMIA 2L3CA 2EM3A 2L3JA 3O2RB 4F9AB 3QG5C 1DI2A 4RHBB 2RS6A 4DV0E 4WX9A 2EMIA 5A2QC 3J7Yp 1QU6A 4BC9A 4JI7E 1J5EE 2K7IA 1EH6A 1UILA 2EN4A 2EOJA 1A1GA 4DR4E 1XNQE 2EMHA 1O0WA 4WSPA 2JPAA 3EPLA 3IWCA 2GHFA 1BB8A 4Q35B 4L5NC 2I9IA 4LF7E 2A11A 2EPMX 2H36X 1U61A 5IXMB 4BS9A 4X8WA 2YTNA 2EM0A 4X65E 2YTDA 4KZSA 1YZ9A 2EQ0A 1RC7A 1BBGA 1N3GA 4DV5E 2RS7A 2ELYA 3C4BA 1X49A 2EPCA 5LMUE 5KL2A 3RV0A 1A1JA 1T38A 2EMKA 2LTRA 1STUA 2ENAA 5A6JA 3F6GA 4DKKA 5TSEA 5A69A 2JWOA 2IHR1 2J7JA 3VHTB 2EOOA 4R2AA 4DR5E 2YTEA 2E72A 2KOUA 3AV0A 2YTGA 4K0KE 2YZTA 2EPUA 1SR9A 4LF4E 2F4VE 2MC5A 3VYXA 3P1XA 4LF5E 2EM5A 2N3GA 4LU9A 2EM2A 2EPKX 5LL6R 2EMWA 5KL3A 1X47A 2YTIA 4WXCA 4JI6E 2CT1A 2M1SA 5BR8E 3OTOE 1T4NA 2EMGA 2YTJA 2EMYA 2LE2A 2V8QB 2VQFE 2YSPA 4F6NA 2CSHA 1A1FA 1IQOA 1Z1BA 4WXDA 1N36E 4BC7A 4ZYHA 3EPHA 1PJQA 4LF9E 2M9AA 2LRSA 2YU8A 4DV1E 2EP3A 2EOYA 2JXPA 2WBSA 4I8OA 5A6AA 2VQEE 4F9BB 4DR3E 3ADLA 2YPNA 2UXDE 2Q8UA 2ENCA 3MHHC 2EPXA 4HTGA 4AQYE 2NUFA 2ZM6E 2ELZA 4O5GA 1FKAE 3DJWA 1NEIA 1T4LB 4F54A 1JFZA 2V87A 2UXBE 5AE3A 4DV6E 1XMOE 5AE2A 3JU0A 1A1HA 4X9JA 4LF8E 2YT4A 1WXRA 3J81C 2EN1A 2YWQA 5KL7A 1EH7A 4OOGC 5CFFE 1YFHA 4JYAE 5AC4A 4DR1E 1RQ0A 2EPRA 2EPLX 4DUZE 2KHXA 1MEYC 2MDRA 2VRDA 3TQMA 2UXCE 2FFLA 4O4KA 1TN9A 5KL4A 5KL5A 3RMPA 1TF3A 1MGTA 2PRTA 2EMCA 1L4SA 2EPNA 4BHBA 1IBKE 4R2PA 2RSMA 2B3TB 1X6HA 3IWBA 3HPSA 2EE8A 2EOHA 5AASA 1XMQE 1X6EA 4DV4E 4X62E 2YTPA 3K6QA 2LCEA 2A25A 3H09A 1JK1A 2YRHA 1WJPA 2YTOA 4IS1C 1DGCA 3KWRA 1XNRE 1A1IA 4F6MA 2R1FA 2E1MA 2NA2A 1KJKA 2YRKA 1FJGE 5IT9C 2LUQA 2UU9E 4O43A 3JTZA 2EMBA 2N3HA 2EM6A 3C6KA 1F2IG 1NCSA 1HNZE 1A1LA 4B3SE 2LVHA 2LTSA 3AUZA 2RSIA 1N33E 2JYAA 3LMLA 4O24A 3EPKA 2YSOA 1UBDC 2G7HA 2NUEA 1ZBTA 4RH8A 1IBME 2EQ1A 4DR7E 2EN6A 2R76A 2EORA 1RMDA 4BHCA 3T1HE 4M0VA 4MLVA 4IJDA 3ADJA 1GQEA 4ZYGA 2EPOA 1DQ3A 2RTXA 4KHPE 4GKKE 1HNXE 5A6KA 1RC5A 5F3WA 2UUBE 1GZ6A 3J80C 2D9HA 3FIGA 4KWYA 4R8OA 4JI5E 1IQSA 4NZVA 2BBGA 2L2KB 1YUIA 2EQ3A 2FTXB 2ENHA 2RQLA 3IWDA 4NHRA 3KZYA 2LBSB 1PDAA 1WHQA 4R2CA 3OMLA 2B7TA 5LMNE 2L6MA 4P7DA 4X66E 1AH5A 3ADGA 4B3TE 1I94E 1N32E 4HEIA 2EB1A 4WFTA 3JAMC 2LV2A 1YPNA 1G2FC 3DF6A 4DV7E 4GZNC 4F9CB 2DB2A 3EQ1A 2HHHE 4NXNE 2MKNA 4M2ZA 4TUGA 2EM7A 4DMIA 2LJUA 4L8NA 2LO3A 2CTDA 2DMYA 1HNWE 3LLHA 3HPZA 4WYQB 4DR2E 2FGGA 5A6BD 2EL6A 5AE1A 4B3RE 2M7QA 2HJJA 4M9VC 3EPJA 3BGHA 3ZOQB 5FLXC 1T39A 2YTQA 2DRPA 2EJ4A 2NUGA 1ZAAC 1YUJA 4TUIA 4JI0E 3THNA 4R03A 2DIXA 3BBGA 3J7AG 1ZU1A 2EOQA 1ZR9A 2EPAA 4JI8E 4MLQA 2UUAE 5IWAE 4YHHE 4BMJA 3HTXA 2YRMA 2EOEA 1YYKA 4LFBE 2M4IA 3T1YE 2EOXA 4B3ME 2E5LE 2EOIA 2EOFA 1B69A 1ZBQA 4GEQB 4DV3E 2GLIA 4DR6E 2L92A 4JI4E 3RV1A 2EZ6A 3C4TA 4R2QA 4YY3E 4BCAA 2UUCE 3ADIA 2VF1A
chains in the Genus database with same CATH topology
2DSYA 2LE2A 2V8QB 4BBYA 1J26A 3T1HE 4DUYE 2FV4B 2L33A 3HXLA 2VQFE 4M0VA 3VYXA 3ADJA 1GQEA 2L8TA 5DNYA 5T6JA 1DQ3A 2RTXA 4KHPE 4GKKE 1HNXE 1I4SA 1N36E 1RC5A 5F3WA 2JR1A 4BC7A 2UUBE 2JOBA 2JY9A 1GZ6A 1YYOA 4WPYA 4LF9E 4JV5E 2L3CA 4LFAE 3J80C 2L3JA 3O2RB 2LRSA 3FIGA 4R8OA 4F9AB 4DV1E 4JI5E 2LUPB 1DI2A 2RS6A 2F8BA 1N34E 1IBLE 2KONA 3HQ1A 2L2KB 2VE7C 3N3WA 4GKJE 4DV0E 5A2QC 4I8OA 2FTXB 2VQEE 4F9BB 3IWDA 2QVWA 5ADZA 3J7Yp 1QU6A 3VYYA 1WHQA 4BC9A 4M30A 3OMLA 2B7TA 2ODRC 4JI7E 4DR3E 1J5EE 2UXDE 2MC6A 5LMNE 2L2MA 1UILA 2L6MA 1WHNA 4P7DA 4X66E 4AQYE 3ADGA 1XNQE 4DR4E 2LJHA 1I94E 4B3TE 2NUFA 2ZM6E 1O0WA 2V83A 1FKAE 4WSPA 1N32E 3DJWA 1T4LB 4F54A 1JFZA 2V87A 3OTOE 2UXBE 2B9DA 5AE3A 4DV6E 3IWCA 4P78A 4DV2E 5AE2A 2LBSB 1XMOE 2EB1A 2K4VA 4WFTA 3JU0A 3JAMC 4LF8E 4L5NC 2YT4A 1PKPA 1WXRA 3DF6A 4Q28A 4LF7E 3MSWA 4DV7E 4F9CB 2A11A 2DB2A 1EKZA 3J81C 2HHHE 4NXNE 2H36X 1U61A 1YYWA 4BS9A 4OOGC 4M2ZA 4X8WA 4TUGA 2V88A 4OUNA 4DMIA 5CFFE 4X65E 4JYAE 4KZSA 1YZ9A 2V86A 4L8NA 1RC7A 2WZOA 1RQ0A 4DR1E 4DUZE 2L2NA 2KHXA 2MDRA 1X48A 4LF6E 4DV5E 2UXCE 2RS7A 1T4OA 2FFLA 4JI2E 2DMYA 1HNWE 3C4BA 1X49A 3HPZA 3LLHA 4WYQB 5LMUE 4DR2E 3RMPA 1UHZA 2FGGA 3RV0A 5AE1A 4B3RE 2M7QA 1IBKE 2RSMA 2B3TB 3O2RA 2EWLA 1STUA 2LTRA 2ODRD 2V89A 3HPSA 3F6GA 3IWBA 4DKKA 1XMQE 5AASA 4JI1E 3ZOQB 2JWOA 5FLXC 4DV4E 4X62E 2IHR1 3K6QA 2NUGA 2CPNA 3H09A 4DR5E 4TUIA 4JI0E 2JVAA 3KWRA 1XNRE 2KOUA 2DIXA 4R03A 3J7AG 2E1MA 2NA2A 3AV0A 1FJGE 4K0KE 5IT9C 2LUQA 2UU9E 2YZTA 3JTZA 4JI8E 2UUAE 4LFCE 2N3HA 1SR9A 5IWAE 4BMJA 2MC5A 4YHHE 4LF4E 3HTXA 2F4VE 3P1XA 4J8ZA 4LF5E 1HNZE 1YYKA 4LFBE 2N3GA 2M4IA 2VF1A 4LU9A 3T1YE 3VK6A 4B3SE 4JI3E 4B3ME 2E5LE 4OX9E 2JOXA 5LL6R 2LTSA 3AUZA 1N33E 1HR0E 4NXME 1ZBQA 1X47A 3LMLA 4GEQB 4DV3E 4DR6E 2L92A 4LTYA 4JI4E 4JI6E 2G7HA 2GSLA 3RV1A 2EZ6A 2NUEA 1ZBTA 3C4TA 1T4NA 2M1SA 5BR8E 4YY3E 2V85A 4BCAA 4X64E 1IBME 3ADLA 2LMZA 2UUCE 3ADIA 4DR7E 3F6HA 2B7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J26 A;  3T1H E;  4DUY E;  2L33 A;  2VQF E;  3ADJ A;  1GQE A;  2RTX A;  4KHP E;  4GKK E;  1HNX E;  1I4S A;  1N36 E;  1RC5 A;  2UUB E;  2JY9 A;  4LF9 E;  1YYO A;  4JV5 E;  2L3C A;  4LFA E;  2L3J A;  3O2R B;  2LRS A;  4DV1 E;  4JI5 E;  2LUP B;  1DI2 A;  2RS6 A;  1N34 E;  1IBL E;  2L2K B;  4GKJ E;  3N3W A;  4DV0 E;  4DR3 E;  2VQE E;  3J7Y p;  2QVW A;  3ADL A;  1QU6 A;  2LBS B;  1WHQ A;  4M30 A;  4JI7 E;  2B7T A;  1J5E E;  2UXD E;  5LMN E;  2L2M A;  1UIL A;  1WHN A;  4X66 E;  4DR4 E;  4AQY E;  3ADG A;  1XNQ E;  2LJH A;  1I94 E;  4B3T E;  2NUF A;  2ZM6 E;  1O0W A;  1FKA E;  1N32 E;  1T4L B;  1JFZ A;  2UXB E;  4DV6 E;  4DV2 E;  1XMO E;  2EB1 A;  4WFT A;  4LF8 E;  2YT4 A;  1PKP A;  4LF7 E;  4DV7 E;  2A11 A;  2DB2 A;  1EKZ A;  2HHH E;  4NXN E;  1U61 A;  1YYW A;  4OOG C;  4M2Z A;  4X8W A;  4OUN A;  5CFF E;  4JYA E;  4X65 E;  1YZ9 A;  1RC7 A;  4DR1 E;  1RQ0 A;  4DUZ E;  2L2N A;  2KHX A;  2MDR A;  1X48 A;  4LF6 E;  4DV5 E;  2UXC E;  2RS7 A;  1T4O A;  2FFL A;  4JI2 E;  2DMY A;  1HNW E;  3C4B A;  1X49 A;  3LLH A;  5LMU E;  4WYQ B;  4DR2 E;  1UHZ A;  3RV0 A;  4B3R E;  1IBK E;  2RSM A;  2B3T B;  3O2R A;  2LTR A;  1STU A;  3VYY A;  4DKK A;  4JI1 E;  1XMQ E;  4DV4 E;  4X62 E;  2IHR 1;  2NUG A;  2CPN A;  4DR5 E;  4JI0 E;  2JVA A;  1XNR E;  2DIX A;  2NA2 A;  4K0K E;  1FJG E;  2LUQ A;  2UU9 E;  4LFC E;  4JI8 E;  2UUA E;  2N3H A;  5IWA E;  4YHH E;  4LF4 E;  2F4V E;  3VYX A;  3HTX A;  3P1X A;  4LF5 E;  1HNZ E;  1YYK A;  4LFB E;  2N3G A;  3T1Y E;  4B3S E;  4JI3 E;  4B3M E;  2E5L E;  4OX9 E;  2LTS A;  1N33 E;  1HR0 E;  4NXM E;  1X47 A;  4DV3 E;  4DR6 E;  4JI4 E;  4JI6 E;  2GSL A;  3RV1 A;  2EZ6 A;  2NUE A;  1ZBT A;  3C4T A;  1T4N A;  5BR8 E;  4X64 E;  4YY3 E;  3OTO E;  1IBM E;  2UUC E;  3ADI A;  4DR7 E;  2B7V A; 
#chains in the Genus database with same CATH topology
 2DSY A;  3HXL A;  1A1K A;  3ECR A;  2L8T A;  2EMX A;  4R2E A;  5T6J A;  2DLQ A;  1AAY A;  4FK5 C;  1X6F A;  1I4S A;  2EML A;  4WPY A;  4JV5 E;  2WBT A;  3L00 A;  4LFA E;  1KYQ A;  2EMF A;  2LUP B;  2F8B A;  1N34 E;  1IBL E;  2KON A;  3HQ1 A;  2VE7 C;  3N3W A;  1JK2 A;  1G2D C;  3KZZ A;  4GKJ E;  3UK3 C;  1PJT A;  2QVW A;  2LT7 A;  4M30 A;  2ODR C;  4N4R B;  2MC6 A;  2HC5 A;  2L2M A;  2EMZ A;  2RPC A;  1WHN A;  2EL5 A;  2DGC A;  2LJH A;  2NAB A;  2V83 A;  3C6M A;  2EM9 A;  2B7V A;  2EM8 A;  2B9D A;  2EN3 A;  3BF2 A;  4P78 A;  4DV2 E;  2HGH A;  2K4V A;  2EOS A;  2YU5 A;  2EOM A;  1PKP A;  3THO B;  4Q28 A;  3MSW A;  1BBO A;  1WRJ A;  1EKZ A;  1LLM C;  2EN8 A;  1YYW A;  2DLK A;  2V88 A;  4OUN A;  2V86 A;  2WZO A;  1YSA C;  2L2N A;  4ZYD A;  1X48 A;  2I13 A;  4LF6 E;  1T4O A;  4R2S A;  4JI2 E;  2YTF A;  2WBU A;  5IV8 B;  1UHZ A;  4R2R A;  1SFE A;  5ADZ A;  3O2R A;  2V89 A;  2EWL A;  3MHS C;  2ODR D;  3VYY A;  4JI1 E;  4WSG A;  1QNT A;  2EMA A;  2MDG A;  2CPN A;  5A6B A;  2EPP A;  2ADR A;  2JVA A;  2EN7 A;  1X5W A;  5AC5 A;  1GTK A;  4LFC E;  2JP9 A;  2GPI A;  4J8Z A;  3VK6 A;  4F2J C;  4JI3 E;  4OX9 E;  2JOX A;  1HR0 E;  4NXM E;  1EH8 A;  1IMU A;  1ZTD A;  4LTY A;  2GSL A;  3BID A;  4X64 E;  2V85 A;  5LLQ A;  2LMZ A;  3F6H A;  5KL6 A;  1PJS A;  2MKD A;  2N8X A;  4BBY A;  2WCC 3;  2BB8 A;  1TF6 A;  4DUY E;  2EOZ A;  1J26 A;  2FV4 B;  2L33 A;  1X3C A;  4R2D A;  2EM4 A;  5DNY A;  3M99 B;  1UN6 B;  4ZYE A;  2EL4 A;  2EN2 A;  2EPZ A;  1P47 A;  2JR1 A;  2JOB A;  2JY9 A;  1YYO A;  2DMI A;  2L3C A;  2EM3 A;  2L3J A;  3O2R B;  4F9A B;  3QG5 C;  1DI2 A;  4RHB B;  2RS6 A;  4DV0 E;  4WX9 A;  2EMI A;  5A2Q C;  3J7Y p;  1QU6 A;  4BC9 A;  4JI7 E;  1J5E E;  2K7I A;  1EH6 A;  1UIL A;  2EN4 A;  2EOJ A;  1A1G A;  4DR4 E;  1XNQ E;  2EMH A;  1O0W A;  4WSP A;  2JPA A;  3EPL A;  3IWC A;  2GHF A;  1BB8 A;  4Q35 B;  4L5N C;  2I9I A;  4LF7 E;  2A11 A;  2EPM X;  2H36 X;  1U61 A;  5IXM B;  4BS9 A;  4X8W A;  2YTN A;  2EM0 A;  4X65 E;  2YTD A;  4KZS A;  1YZ9 A;  2EQ0 A;  1RC7 A;  1BBG A;  1N3G A;  4DV5 E;  2RS7 A;  2ELY A;  3C4B A;  1X49 A;  2EPC A;  5LMU E;  5KL2 A;  3RV0 A;  1A1J A;  1T38 A;  2EMK A;  2LTR A;  1STU A;  2ENA A;  5A6J A;  3F6G A;  4DKK A;  5TSE A;  5A69 A;  2JWO A;  2IHR 1;  2J7J A;  3VHT B;  2EOO A;  4R2A A;  4DR5 E;  2YTE A;  2E72 A;  2KOU A;  3AV0 A;  2YTG A;  4K0K E;  2YZT A;  2EPU A;  1SR9 A;  4LF4 E;  2F4V E;  2MC5 A;  3VYX A;  3P1X A;  4LF5 E;  2EM5 A;  2N3G A;  4LU9 A;  2EM2 A;  2EPK X;  5LL6 R;  2EMW A;  5KL3 A;  1X47 A;  2YTI A;  4WXC A;  4JI6 E;  2CT1 A;  2M1S A;  5BR8 E;  3OTO E;  1T4N A;  2EMG A;  2YTJ A;  2EMY A;  2LE2 A;  2V8Q B;  2VQF E;  2YSP A;  4F6N A;  2CSH A;  1A1F A;  1IQO A;  1Z1B A;  4WXD A;  1N36 E;  4BC7 A;  4ZYH A;  3EPH A;  1PJQ A;  4LF9 E;  2M9A A;  2LRS A;  2YU8 A;  4DV1 E;  2EP3 A;  2EOY A;  2JXP A;  2WBS A;  4I8O A;  5A6A A;  2VQE E;  4F9B B;  4DR3 E;  3ADL A;  2YPN A;  2UXD E;  2Q8U A;  2ENC A;  3MHH C;  2EPX A;  4HTG A;  4AQY E;  2NUF A;  2ZM6 E;  2ELZ A;  4O5G A;  1FKA E;  3DJW A;  1NEI A;  1T4L B;  4F54 A;  1JFZ A;  2V87 A;  2UXB E;  5AE3 A;  4DV6 E;  1XMO E;  5AE2 A;  3JU0 A;  1A1H A;  4X9J A;  4LF8 E;  2YT4 A;  1WXR A;  3J81 C;  2EN1 A;  2YWQ A;  5KL7 A;  1EH7 A;  4OOG C;  5CFF E;  1YFH A;  4JYA E;  5AC4 A;  4DR1 E;  1RQ0 A;  2EPR A;  2EPL X;  4DUZ E;  2KHX A;  1MEY C;  2MDR A;  2VRD A;  3TQM A;  2UXC E;  2FFL A;  4O4K A;  1TN9 A;  5KL4 A;  5KL5 A;  3RMP A;  1TF3 A;  1MGT A;  2PRT A;  2EMC A;  1L4S A;  2EPN A;  4BHB A;  1IBK E;  4R2P A;  2RSM A;  2B3T B;  1X6H A;  3IWB A;  3HPS A;  2EE8 A;  2EOH A;  5AAS A;  1XMQ E;  1X6E A;  4DV4 E;  4X62 E;  2YTP A;  3K6Q A;  2LCE A;  2A25 A;  3H09 A;  1JK1 A;  2YRH A;  1WJP A;  2YTO A;  4IS1 C;  1DGC A;  3KWR A;  1XNR E;  1A1I A;  4F6M A;  2R1F A;  2E1M A;  2NA2 A;  1KJK A;  2YRK A;  1FJG E;  5IT9 C;  2LUQ A;  2UU9 E;  4O43 A;  3JTZ A;  2EMB A;  2N3H A;  2EM6 A;  3C6K A;  1F2I G;  1NCS A;  1HNZ E;  1A1L A;  4B3S E;  2LVH A;  2LTS A;  3AUZ A;  2RSI A;  1N33 E;  2JYA A;  3LML A;  4O24 A;  3EPK A;  2YSO A;  1UBD C;  2G7H A;  2NUE A;  1ZBT A;  4RH8 A;  1IBM E;  2EQ1 A;  4DR7 E;  2EN6 A;  2R76 A;  2EOR A;  1RMD A;  4BHC A;  3T1H E;  4M0V A;  4MLV A;  4IJD A;  3ADJ A;  1GQE A;  4ZYG A;  2EPO A;  1DQ3 A;  2RTX A;  4KHP E;  4GKK E;  1HNX E;  5A6K A;  1RC5 A;  5F3W A;  2UUB E;  1GZ6 A;  3J80 C;  2D9H A;  3FIG A;  4KWY A;  4R8O A;  4JI5 E;  1IQS A;  4NZV A;  2BBG A;  2L2K B;  1YUI A;  2EQ3 A;  2FTX B;  2ENH A;  2RQL A;  3IWD A;  4NHR A;  3KZY A;  2LBS B;  1PDA A;  1WHQ A;  4R2C A;  3OML A;  2B7T A;  5LMN E;  2L6M A;  4P7D A;  4X66 E;  1AH5 A;  3ADG A;  4B3T E;  1I94 E;  1N32 E;  4HEI A;  2EB1 A;  4WFT A;  3JAM C;  2LV2 A;  1YPN A;  1G2F C;  3DF6 A;  4DV7 E;  4GZN C;  4F9C B;  2DB2 A;  3EQ1 A;  2HHH E;  4NXN E;  2MKN A;  4M2Z A;  4TUG A;  2EM7 A;  4DMI A;  2LJU A;  4L8N A;  2LO3 A;  2CTD A;  2DMY A;  1HNW E;  3LLH A;  3HPZ A;  4WYQ B;  4DR2 E;  2FGG A;  5A6B D;  2EL6 A;  5AE1 A;  4B3R E;  2M7Q A;  2HJJ A;  4M9V C;  3EPJ A;  3BGH A;  3ZOQ B;  5FLX C;  1T39 A;  2YTQ A;  2DRP A;  2EJ4 A;  2NUG A;  1ZAA C;  1YUJ A;  4TUI A;  4JI0 E;  3THN A;  4R03 A;  2DIX A;  3BBG A;  3J7A G;  1ZU1 A;  2EOQ A;  1ZR9 A;  2EPA A;  4JI8 E;  4MLQ A;  2UUA E;  5IWA E;  4YHH E;  4BMJ A;  3HTX A;  2YRM A;  2EOE A;  1YYK A;  4LFB E;  2M4I A;  3T1Y E;  2EOX A;  4B3M E;  2E5L E;  2EOI A;  2EOF A;  1B69 A;  1ZBQ A;  4GEQ B;  4DV3 E;  2GLI A;  4DR6 E;  2L92 A;  4JI4 E;  3RV1 A;  2EZ6 A;  3C4T A;  4R2Q A;  4YY3 E;  4BCA A;  2UUC E;  3ADI A;  2VF1 A; 
#chains in the Genus database with same CATH homology
 2DSY A;  2LE2 A;  2V8Q B;  4BBY A;  1J26 A;  3T1H E;  4DUY E;  2FV4 B;  2L33 A;  3HXL A;  2VQF E;  4M0V A;  3VYX A;  3ADJ A;  1GQE A;  2L8T A;  5DNY A;  5T6J A;  1DQ3 A;  2RTX A;  4KHP E;  4GKK E;  1HNX E;  1I4S A;  1N36 E;  1RC5 A;  5F3W A;  2JR1 A;  4BC7 A;  2UUB E;  2JOB A;  2JY9 A;  1GZ6 A;  1YYO A;  4WPY A;  4LF9 E;  4JV5 E;  2L3C A;  4LFA E;  3J80 C;  2L3J A;  3O2R B;  2LRS A;  3FIG A;  4R8O A;  4F9A B;  4DV1 E;  4JI5 E;  2LUP B;  1DI2 A;  2RS6 A;  2F8B A;  1N34 E;  1IBL E;  2KON A;  3HQ1 A;  2L2K B;  2VE7 C;  3N3W A;  4GKJ E;  4DV0 E;  5A2Q C;  4I8O A;  2FTX B;  2VQE E;  4F9B B;  3IWD A;  2QVW A;  5ADZ A;  3J7Y p;  1QU6 A;  3VYY A;  1WHQ A;  4BC9 A;  4M30 A;  3OML A;  2B7T A;  2ODR C;  4JI7 E;  4DR3 E;  1J5E E;  2UXD E;  2MC6 A;  5LMN E;  2L2M A;  1UIL A;  2L6M A;  1WHN A;  4P7D A;  4X66 E;  4AQY E;  3ADG A;  1XNQ E;  4DR4 E;  2LJH A;  1I94 E;  4B3T E;  2NUF A;  2ZM6 E;  1O0W A;  2V83 A;  1FKA E;  4WSP A;  1N32 E;  3DJW A;  1T4L B;  4F54 A;  1JFZ A;  2V87 A;  3OTO E;  2UXB E;  2B9D A;  5AE3 A;  4DV6 E;  3IWC A;  4P78 A;  4DV2 E;  5AE2 A;  2LBS B;  1XMO E;  2EB1 A;  2K4V A;  4WFT A;  3JU0 A;  3JAM C;  4LF8 E;  4L5N C;  2YT4 A;  1PKP A;  1WXR A;  3DF6 A;  4Q28 A;  4LF7 E;  3MSW A;  4DV7 E;  4F9C B;  2A11 A;  2DB2 A;  1EKZ A;  3J81 C;  2HHH E;  4NXN E;  2H36 X;  1U61 A;  1YYW A;  4BS9 A;  4OOG C;  4M2Z A;  4X8W A;  4TUG A;  2V88 A;  4OUN A;  4DMI A;  5CFF E;  4X65 E;  4JYA E;  4KZS A;  1YZ9 A;  2V86 A;  4L8N A;  1RC7 A;  2WZO A;  1RQ0 A;  4DR1 E;  4DUZ E;  2L2N A;  2KHX A;  2MDR A;  1X48 A;  4LF6 E;  4DV5 E;  2UXC E;  2RS7 A;  1T4O A;  2FFL A;  4JI2 E;  2DMY A;  1HNW E;  3C4B A;  1X49 A;  3HPZ A;  3LLH A;  4WYQ B;  5LMU E;  4DR2 E;  3RMP A;  1UHZ A;  2FGG A;  3RV0 A;  5AE1 A;  4B3R E;  2M7Q A;  1IBK E;  2RSM A;  2B3T B;  3O2R A;  2EWL A;  1STU A;  2LTR A;  2ODR D;  2V89 A;  3HPS A;  3F6G A;  3IWB A;  4DKK A;  1XMQ E;  5AAS A;  4JI1 E;  3ZOQ B;  2JWO A;  5FLX C;  4DV4 E;  4X62 E;  2IHR 1;  3K6Q A;  2NUG A;  2CPN A;  3H09 A;  4DR5 E;  4TUI A;  4JI0 E;  2JVA A;  3KWR A;  1XNR E;  2KOU A;  2DIX A;  4R03 A;  3J7A G;  2E1M A;  2NA2 A;  3AV0 A;  1FJG E;  4K0K E;  5IT9 C;  2LUQ A;  2UU9 E;  2YZT A;  3JTZ A;  4JI8 E;  2UUA E;  4LFC E;  2N3H A;  1SR9 A;  5IWA E;  4BMJ A;  2MC5 A;  4YHH E;  4LF4 E;  3HTX A;  2F4V E;  3P1X A;  4J8Z A;  4LF5 E;  1HNZ E;  1YYK A;  4LFB E;  2N3G A;  2M4I A;  2VF1 A;  4LU9 A;  3T1Y E;  3VK6 A;  4B3S E;  4JI3 E;  4B3M E;  2E5L E;  4OX9 E;  2JOX A;  5LL6 R;  2LTS A;  3AUZ A;  1N33 E;  1HR0 E;  4NXM E;  1ZBQ A;  1X47 A;  3LML A;  4GEQ B;  4DV3 E;  4DR6 E;  2L92 A;  4LTY A;  4JI4 E;  4JI6 E;  2G7H A;  2GSL A;  3RV1 A;  2EZ6 A;  2NUE A;  1ZBT A;  3C4T A;  1T4N A;  2M1S A;  5BR8 E;  4YY3 E;  2V85 A;  4BCA A;  4X64 E;  1IBM E;  3ADL A;  2LMZ A;  2UUC E;  3ADI A;  4DR7 E;  3F6H A;  2B7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...