2NUGA

Crystal structure of rnase iii from aquifex aeolicus complexed with ds-rna at 1.7-angstrom resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
216
structure length
216
Chain Sequence
MLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(P*AP*AP*GP*GP*UP*CP*AP*UP*UP*CP*G)-3'
publication title A stepwise model for double-stranded RNA processing by ribonuclease III.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
total genus 75
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 2nugA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2nugA02
1QU6A 4DV7E 2RSMA 2KHXA 2EZ6A 2LTSA 4LFCE 2L3CA 2UXBE 3ADLA 1IBLE 1HR0E 3T1YE 2UUBE 1N36E 2NA2A 2L2MA 1YYOA 5BR8E 1I94E 2LTRA 2HHHE 1HNZE 1YYWA 2DIXA 2UXDE 4DR6E 5IWAE 4LF9E 3RV0A 5LMUE 4DV5E 3VYYA 1O0WA 3O2RB 4OOGC 4K0KE 1RC5A 1STUA 2N3HA 4GKKE 2QVWA 4LF5E 4DV4E 4JYAE 4DV3E 4X62E 5LMNE 4DV0E 4X8WA 1IBME 2JY9A 2DB2A 4DR3E 4GKJE 1T4LB 2EB1A 4DKKA 3OTOE 3ADGA 2YT4A 1J5EE 1XNRE 3VYXA 2ZM6E 1T4NA 1N32E 2B3TB 3C4TA 1WHQA 4DR5E 2NUGA 4B3ME 1UILA 4DUZE 3J7Yp 4JI1E 2VQEE 4DV6E 3T1HE 3P1XA 4B3RE 3N3WA 4NXME 2JVAA 1HNXE 4JI2E 4LF4E 4LF6E 4JI4E 4JI8E 2CPNA 4LF8E 1XNQE 2L3JA 1JFZA 4DUYE 1PKPA 4JI6E 4KHPE 2UXCE 1WHNA 1U61A 2DMYA 1X47A 4DR7E 4JI5E 2UUCE 2E5LE 2L2KB 2IHR1 2L33A 2UU9E 1N34E 3LLHA 5CFFE 1HNWE 1EKZA 2B7VA 4YHHE 1GQEA 3HTXA 1RQ0A 4OX9E 2GSLA 1FJGE 1XMQE 4WYQB 2RS7A 1X49A 2LUQA 4X64E 1J26A 4X65E 4LF7E 2LRSA 2A11A 3C4BA 2RS6A 1IBKE 3ADJA 1FKAE 1DI2A 4OUNA 4WFTA 4X66E 2NUEA 4NXNE 4YY3E 2VQFE 1T4OA 2N3GA 1N33E 4B3TE 2F4VE 4M30A 2RTXA 4DV1E 4DR1E 4AQYE 1I4SA 4LFBE 3ADIA 2LJHA 1YYKA 4B3SE 4JI0E 2NUFA 2L2NA 1ZBTA 4JI3E 4M2ZA 4JI7E 3O2RA 2MDRA 4DR2E 4JV5E 4DV2E 1XMOE 4DR4E 4LFAE 1X48A 1YZ9A 1RC7A 2B7TA 2LBSB 2UUAE 1UHZA 2LUPB 2FFLA 3RV1A
chains in the Genus database with same CATH superfamily
2KHXA 2DRPA 2JR1A 3ADLA 1HR0E 2EMYA 2R1FA 2UUBE 5LLQA 3J7AG 4I8OA 5BR8E 2V89A 4LU9A 3TQMA 4R2PA 1QNTA 2L92A 2HGHA 2UXDE 2LO3A 5LMUE 2ENCA 3AUZA 1A1FA 2EMLA 3VYYA 1O0WA 3O2RB 4IS1C 1A1IA 2EPCA 2QVWA 2EJ4A 2WZOA 4O24A 2MKNA 5AE3A 2CTDA 2EM6A 4R2AA 4DR3E 3JTZA 1XNRE 2EWLA 2YU5A 1N32E 4RHBB 1PDAA 2NUGA 4B3ME 4DUZE 1MGTA 4DV6E 4GZNC 5KL7A 2JP9A 2R76A 2EM7A 3N3WA 4NXME 1HNXE 4JI2E 1BB8A 4JI4E 2HJJA 5AE2A 1TF6A 1A1JA 4LF8E 1XNQE 1JFZA 4M9VC 2EMWA 1PKPA 1WHNA 2EMHA 2YTOA 2DMYA 4DR7E 2D9HA 3THOB 2E5LE 2L2KB 2IHR1 1HNWE 1N34E 3LLHA 5A6JA 4L8NA 2EM2A 3QG5C 1GQEA 2V88A 1RQ0A 3KZYA 4WYQB 2EMXA 2LVHA 4X65E 3AV0A 4HTGA 2WCC3 4WFTA 3HXLA 4P78A 2VQFE 2V87A 4MLVA 5AE1A 5A2QC 1I4SA 2LJHA 2WBSA 5IXMB 2NUFA 2EL6A 2L2NA 1WRJA 2RPCA 2YTEA 4X9JA 2L8TA 2MDRA 2EQ0A 2V85A 1YZ9A 2EPPA 2EPRA 1SFEA 2VF1A 2JOBA 2EMFA 1QU6A 3UK3C 1BBOA 2RSMA 1B69A 2EZ6A 2CSHA 2DSYA 2GHFA 1A1KA 4LFCE 1GZ6A 2EE8A 2EOIA 1KJKA 2G7HA 1EH6A 2EPZA 1IBLE 4Q35B 2E72A 3T1YE 2Q8UA 1NEIA 1N36E 5LL6R 1P47A 2EN2A 2EN1A 1I94E 4F9AB 5KL5A 2LTRA 3THNA 1HNZE 2HHHE 2DIXA 2LCEA 4Q28A 5DNYA 2FGGA 4F9CB 4DV5E 2YTFA 4K0KE 1RC5A 2EN3A 4GKKE 1YFHA 2EPUA 2EOMA 2EMZA 2NABA 2I13A 2LMZA 4R2RA 4DV3E 1T38A 4X8WA 1PJQA 4DKKA 2YRKA 2EM3A 2ZM6E 4R8OA 3BIDA 2YTNA 5T6JA 1UILA 2ENHA 3C6MA 2DMIA 2VQEE 4R2QA 3T1HE 2EPXA 4B3RE 2EMGA 2V8QB 2YWQA 4JI8E 3BGHA 1ZU1A 2L3JA 4DUYE 2EPOA 2EORA 2GLIA 1A1LA 2LV2A 1U61A 1X47A 5A69A 3J80C 3KWRA 2M7QA 2UU9E 4WPYA 2L33A 5CFFE 2LJUA 3RMPA 1EKZA 2YTDA 4TUIA 2EP3A 4HEIA 2I9IA 3RV1A 1L4SA 1X49A 2LT7A 4BCAA 2EN8A 1PJTA 2RS6A 1IBKE 4F54A 1FKAE 4N4RB 1ZR9A 2NUEA 4NXNE 2PRTA 2M4IA 2A25A 2CT1A 2JPAA 5A6KA 2EPNA 4B3TE 2EQ1A 2GPIA 4M30A 1LLMC 2YPNA 4AQYE 3VHTB 4O43A 1AAYA 1NCSA 3OMLA 4F9BB 1ZBTA 5KL4A 4JI7E 2V83A 4GEQB 4WXDA 1DQ3A 2L6MA 4DV2E 1XMOE 1X5WA 4DR4E 1X48A 1ZBQA 2B7TA 2ELYA 2LBSB 2UUAE 1UHZA 5TSEA 2FFLA 4DV7E 2ODRD 4NHRA 2EMIA 2MC6A 2YTPA 2L3CA 4ZYGA 5A6BA 2YZTA 2YRHA 2DLQA 2WBTA 1YUIA 1TN9A 2YTQA 2NA2A 2L2MA 1UN6B 4M0VA 2RSIA 1WJPA 2JYAA 2YTGA 4KZSA 3MHHC 5IWAE 2EPMX 3RV0A 2YU8A 3MHSC 2EN6A 2N3HA 2BB8A 2MKDA 4ZYEA 4X62E 4GKJE 2EMKA 5ADZA 2DB2A 1T4LB 1YSAC 2EMCA 5KL6A 2EB1A 2EPAA 3OTOE 3ADGA 4R2DA 2M1SA 2YT4A 3EQ1A 2WBUA 1J5EE 2B3TB 2BBGA 3C4TA 1WHQA 2EM5A 2EOYA 4KWYA 3J7Yp 4JI1E 1WXRA 1EH8A 4BC9A 3EPLA 3JAMC 2EOJA 2EN7A 2JVAA 4LF4E 4P7DA 4LF6E 1UBDC 2EL4A 1TF3A 2EOFA 1A1HA 4ZYHA 3J81C 2CPNA 1X3CA 3KZZA 3BBGA 4BHBA 4O4KA 2UXCE 1KYQA 2YSOA 2LE2A 2V86A 1AH5A 2EOHA 3BF2A 4R2SA 2B7VA 2RQLA 4YHHE 1N3GA 4BS9A 3FIGA 1FJGE 1F2IG 2LUQA 5AC5A 2HC5A 1G2DC 2K4VA 2A11A 2K7IA 5AASA 1JK2A 1JK1A 4OUNA 1MEYC 4X66E 3F6GA 3IWCA 1RMDA 1SR9A 2ELZA 2YTJA 4R2EA 1BBGA 4RH8A 3EPHA 2N3GA 4BMJA 2ADRA 2RTXA 3IWBA 4DR1E 3DF6A 1IQSA 4LFBE 3ADIA 5IT9C 1YPNA 1YYKA 1X6HA 4BBYA 4JI0E 5AC4A 4M2ZA 2J7JA 2YTIA 2JXPA 4DR2E 3EPKA 2EPKX 4WXCA 2EQ3A 2EM8A 2DLKA 2LUPB 4DV1E 1ZAAC 1T39A 2LTSA 2YSPA 1PJSA 3IWDA 4ZYDA 2UXBE 5A6AA 3H09A 2EPLX 3HQ1A 5IV8B 4NZVA 5FLXC 1YYOA 2EM0A 3ZOQB 3EPJA 1YYWA 3MSWA 4DR6E 4LF9E 2EMBA 3K6QA 2VE7C 2E1MA 4F6NA 4OOGC 2B9DA 1STUA 2DGCA 2YRMA 2M9AA 4F2JC 4DV4E 4LF5E 4JYAE 5LMNE 4DV0E 1YUJA 1IBME 2JY9A 2EOSA 4WX9A 1G2FC 3HPSA 3VYXA 2JOXA 2KOUA 1T4NA 3F6HA 4TUGA 2ENAA 4DR5E 4MLQA 3L00A 2EM4A 2N8XA 4WSGA 2ODRC 1EH7A 3P1XA 1GTKA 4R2CA 1IMUA 4LTYA 1IQOA 4O5GA 2VRDA 5F3WA 4FK5C 4IJDA 2EOQA 4KHPE 4JI6E 4L5NC 4WSPA 3DJWA 4JI5E 2UUCE 2EN4A 2MC5A 3HTXA 4OX9E 2GSLA 1XMQE 3ECRA 2RS7A 3LMLA 4X64E 2JWOA 1J26A 5A6BD 4LF7E 2LRSA 5KL2A 3C4BA 1Z1BA 3ADJA 1DI2A 3M99B 1A1GA 3HPZA 2EOXA 4F6MA 2EMAA 4BC7A 4YY3E 1T4OA 1X6EA 2EL5A 2FTXB 3C6KA 5KL3A 4R03A 1N33E 2EOOA 2F4VE 3VK6A 2EOEA 2MDGA 4B3SE 4BHCA 1ZTDA 4DMIA 4JI3E 2EOZA 3JU0A 3O2RA 4J8ZA 4JV5E 2F8BA 2KONA 4LFAE 2EM9A 1DGCA 1RC7A 1X6FA 2H36X 2FV4B
chains in the Genus database with same CATH topology
1QU6A 4DV7E 2ODRD 2RSMA 2KHXA 2MC6A 2EZ6A 2DSYA 2LTSA 3IWDA 2L3CA 1GZ6A 2JR1A 4LFCE 2G7HA 2YZTA 2UXBE 3ADLA 1IBLE 1HR0E 3T1YE 3H09A 2UUBE 3HQ1A 1N36E 2NA2A 2L2MA 3J7AG 4I8OA 5FLXC 4M0VA 5LL6R 1YYOA 5BR8E 1I94E 2V89A 4LU9A 4F9AB 2LTRA 3ZOQB 1HNZE 2HHHE 1YYWA 2L92A 2DIXA 4KZSA 2UXDE 4Q28A 3MSWA 5DNYA 4DR6E 5IWAE 2FGGA 4LF9E 3RV0A 5LMUE 3AUZA 4F9CB 4DV5E 3VYYA 1O0WA 3K6QA 3O2RB 2VE7C 2E1MA 4OOGC 2B9DA 4K0KE 1RC5A 1STUA 2N3HA 4GKKE 2QVWA 4LF5E 4DV4E 2WZOA 4JYAE 5AE3A 2LMZA 4X62E 5LMNE 4DV0E 4X8WA 4DV3E 2JY9A 2DB2A 5ADZA 4DR3E 1IBME 4GKJE 1T4LB 3HPSA 2EB1A 4DKKA 3OTOE 3ADGA 3JTZA 2M1SA 2YT4A 2EWLA 2JOXA 2KOUA 1T4NA 4R8OA 2B3TB 3F6HA 4TUGA 2ZM6E 3C4TA 1WHQA 4DR5E 2NUGA 4JV5E 4B3ME 5T6JA 1UILA 4DUZE 3J7Yp 4JI1E 2VQEE 4DV6E 3T1HE 1WXRA 4BC9A 3JAMC 2ODRC 3P1XA 4B3RE 3N3WA 4NXME 2JVAA 1HNXE 4JI2E 2V8QB 4P7DA 4JI4E 4JI8E 4LF4E 4LF6E 5AE2A 4LTYA 3J81C 2CPNA 4LF8E 1XNQE 5F3WA 2L3JA 1JFZA 4DUYE 1PKPA 4JI6E 4L5NC 4KHPE 1WHNA 2UXCE 1U61A 2DMYA 1X47A 4WSPA 3DJWA 4DR7E 3J80C 3KWRA 2LE2A 2M7QA 2V86A 2UUCE 4JI5E 2E5LE 2L2KB 2IHR1 2L33A 4WPYA 1N34E 3LLHA 5CFFE 2UU9E 1HNWE 4L8NA 3RMPA 1EKZA 2MC5A 4TUIA 2B7VA 4YHHE 1GQEA 3HTXA 2V88A 1RQ0A 4BS9A 2GSLA 3FIGA 4OX9E 3RV1A 1XMQE 1FJGE 4WYQB 2RS7A 1X49A 2LUQA 3LMLA 4BCAA 4X64E 2JWOA 1J26A 4X65E 2K4VA 4LF7E 2LRSA 2A11A 5AASA 3C4BA 2RS6A 1IBKE 3ADJA 4F54A 1FKAE 3AV0A 1DI2A 4OUNA 4WFTA 4X66E 3F6GA 3HXLA 1J5EE 2NUEA 3HPZA 4NXNE 3IWCA 2M4IA 1SR9A 4P78A 4BC7A 3VYXA 4YY3E 2VQFE 1T4OA 2N3GA 2V87A 2FTXB 1N33E 4R03A 4BMJA 1XNRE 4B3TE 5AE1A 2F4VE 3VK6A 4M30A 2RTXA 3IWBA 4DV1E 3DF6A 5A2QC 1I4SA 4DR1E 4AQYE 1N32E 3ADIA 4LFBE 2LJHA 5IT9C 1YYKA 4B3SE 4BBYA 3OMLA 4JI0E 2NUFA 2L2NA 4F9BB 1ZBTA 4DMIA 4JI3E 4M2ZA 4JI7E 2V83A 3O2RA 2L8TA 2MDRA 3JU0A 4GEQB 2F8BA 4J8ZA 1DQ3A 2L6MA 4DV2E 2KONA 4DR2E 1XMOE 2V85A 4LFAE 1X48A 4DR4E 1YZ9A 1ZBQA 1RC7A 2B7TA 2LBSB 2UUAE 1UHZA 2H36X 2LUPB 2FFLA 2VF1A 2JOBA 2FV4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QU6 A;  4DV7 E;  2RSM A;  2KHX A;  2EZ6 A;  2LTS A;  4LFC E;  2L3C A;  2UXB E;  3ADL A;  1IBL E;  1HR0 E;  3T1Y E;  2UUB E;  1N36 E;  2NA2 A;  2L2M A;  1YYO A;  5BR8 E;  1I94 E;  2LTR A;  2HHH E;  1HNZ E;  1YYW A;  2DIX A;  2UXD E;  4DR6 E;  5IWA E;  4LF9 E;  3RV0 A;  5LMU E;  4DV5 E;  3VYY A;  1O0W A;  3O2R B;  4OOG C;  4K0K E;  1RC5 A;  1STU A;  2N3H A;  4GKK E;  2QVW A;  4LF5 E;  4DV4 E;  4JYA E;  4DV3 E;  4X62 E;  5LMN E;  4DV0 E;  4X8W A;  1IBM E;  2JY9 A;  2DB2 A;  4DR3 E;  4GKJ E;  1T4L B;  2EB1 A;  4DKK A;  3OTO E;  3ADG A;  2YT4 A;  1J5E E;  1XNR E;  3VYX A;  2ZM6 E;  1T4N A;  1N32 E;  2B3T B;  3C4T A;  1WHQ A;  4DR5 E;  2NUG A;  4B3M E;  1UIL A;  4DUZ E;  3J7Y p;  4JI1 E;  2VQE E;  4DV6 E;  3T1H E;  3P1X A;  4B3R E;  3N3W A;  4NXM E;  2JVA A;  1HNX E;  4JI2 E;  4LF4 E;  4LF6 E;  4JI4 E;  4JI8 E;  2CPN A;  4LF8 E;  1XNQ E;  2L3J A;  1JFZ A;  4DUY E;  1PKP A;  4JI6 E;  4KHP E;  2UXC E;  1WHN A;  1U61 A;  2DMY A;  1X47 A;  4DR7 E;  4JI5 E;  2UUC E;  2E5L E;  2L2K B;  2IHR 1;  2L33 A;  2UU9 E;  1N34 E;  3LLH A;  5CFF E;  1HNW E;  1EKZ A;  2B7V A;  4YHH E;  1GQE A;  3HTX A;  1RQ0 A;  4OX9 E;  2GSL A;  1FJG E;  1XMQ E;  4WYQ B;  2RS7 A;  1X49 A;  2LUQ A;  4X64 E;  1J26 A;  4X65 E;  4LF7 E;  2LRS A;  2A11 A;  3C4B A;  2RS6 A;  1IBK E;  3ADJ A;  1FKA E;  1DI2 A;  4OUN A;  4WFT A;  4X66 E;  2NUE A;  4NXN E;  4YY3 E;  2VQF E;  1T4O A;  2N3G A;  1N33 E;  4B3T E;  2F4V E;  4M30 A;  2RTX A;  4DV1 E;  4DR1 E;  4AQY E;  1I4S A;  4LFB E;  3ADI A;  2LJH A;  1YYK A;  4B3S E;  4JI0 E;  2NUF A;  2L2N A;  1ZBT A;  4JI3 E;  4M2Z A;  4JI7 E;  3O2R A;  2MDR A;  4DR2 E;  4JV5 E;  4DV2 E;  1XMO E;  4DR4 E;  4LFA E;  1X48 A;  1YZ9 A;  1RC7 A;  2B7T A;  2LBS B;  2UUA E;  1UHZ A;  2LUP B;  2FFL A;  3RV1 A; 
#chains in the Genus database with same CATH topology
 2KHX A;  2DRP A;  2JR1 A;  3ADL A;  1HR0 E;  2EMY A;  2R1F A;  2UUB E;  5LLQ A;  3J7A G;  4I8O A;  5BR8 E;  2V89 A;  4LU9 A;  3TQM A;  4R2P A;  1QNT A;  2L92 A;  2HGH A;  2UXD E;  2LO3 A;  5LMU E;  2ENC A;  3AUZ A;  1A1F A;  2EML A;  3VYY A;  1O0W A;  3O2R B;  4IS1 C;  1A1I A;  2EPC A;  2QVW A;  2EJ4 A;  2WZO A;  4O24 A;  2MKN A;  5AE3 A;  2CTD A;  2EM6 A;  4R2A A;  4DR3 E;  3JTZ A;  1XNR E;  2EWL A;  2YU5 A;  1N32 E;  4RHB B;  1PDA A;  2NUG A;  4B3M E;  4DUZ E;  1MGT A;  4DV6 E;  4GZN C;  5KL7 A;  2JP9 A;  2R76 A;  2EM7 A;  3N3W A;  4NXM E;  1HNX E;  4JI2 E;  1BB8 A;  4JI4 E;  2HJJ A;  5AE2 A;  1TF6 A;  1A1J A;  4LF8 E;  1XNQ E;  1JFZ A;  4M9V C;  2EMW A;  1PKP A;  1WHN A;  2EMH A;  2YTO A;  2DMY A;  4DR7 E;  2D9H A;  3THO B;  2E5L E;  2L2K B;  2IHR 1;  1HNW E;  1N34 E;  3LLH A;  5A6J A;  4L8N A;  2EM2 A;  3QG5 C;  1GQE A;  2V88 A;  1RQ0 A;  3KZY A;  4WYQ B;  2EMX A;  2LVH A;  4X65 E;  3AV0 A;  4HTG A;  2WCC 3;  4WFT A;  3HXL A;  4P78 A;  2VQF E;  2V87 A;  4MLV A;  5AE1 A;  5A2Q C;  1I4S A;  2LJH A;  2WBS A;  5IXM B;  2NUF A;  2EL6 A;  2L2N A;  1WRJ A;  2RPC A;  2YTE A;  4X9J A;  2L8T A;  2MDR A;  2EQ0 A;  2V85 A;  1YZ9 A;  2EPP A;  2EPR A;  1SFE A;  2VF1 A;  2JOB A;  2EMF A;  1QU6 A;  3UK3 C;  1BBO A;  2RSM A;  1B69 A;  2EZ6 A;  2CSH A;  2DSY A;  2GHF A;  1A1K A;  4LFC E;  1GZ6 A;  2EE8 A;  2EOI A;  1KJK A;  2G7H A;  1EH6 A;  2EPZ A;  1IBL E;  4Q35 B;  2E72 A;  3T1Y E;  2Q8U A;  1NEI A;  1N36 E;  5LL6 R;  1P47 A;  2EN2 A;  2EN1 A;  1I94 E;  4F9A B;  5KL5 A;  2LTR A;  3THN A;  1HNZ E;  2HHH E;  2DIX A;  2LCE A;  4Q28 A;  5DNY A;  2FGG A;  4F9C B;  4DV5 E;  2YTF A;  4K0K E;  1RC5 A;  2EN3 A;  4GKK E;  1YFH A;  2EPU A;  2EOM A;  2EMZ A;  2NAB A;  2I13 A;  2LMZ A;  4R2R A;  4DV3 E;  1T38 A;  4X8W A;  1PJQ A;  4DKK A;  2YRK A;  2EM3 A;  2ZM6 E;  4R8O A;  3BID A;  2YTN A;  5T6J A;  1UIL A;  2ENH A;  3C6M A;  2DMI A;  2VQE E;  4R2Q A;  3T1H E;  2EPX A;  4B3R E;  2EMG A;  2V8Q B;  2YWQ A;  4JI8 E;  3BGH A;  1ZU1 A;  2L3J A;  4DUY E;  2EPO A;  2EOR A;  2GLI A;  1A1L A;  2LV2 A;  1U61 A;  1X47 A;  5A69 A;  3J80 C;  3KWR A;  2M7Q A;  2UU9 E;  4WPY A;  2L33 A;  5CFF E;  2LJU A;  3RMP A;  1EKZ A;  2YTD A;  4TUI A;  2EP3 A;  4HEI A;  2I9I A;  3RV1 A;  1L4S A;  1X49 A;  2LT7 A;  4BCA A;  2EN8 A;  1PJT A;  2RS6 A;  1IBK E;  4F54 A;  1FKA E;  4N4R B;  1ZR9 A;  2NUE A;  4NXN E;  2PRT A;  2M4I A;  2A25 A;  2CT1 A;  2JPA A;  5A6K A;  2EPN A;  4B3T E;  2EQ1 A;  2GPI A;  4M30 A;  1LLM C;  2YPN A;  4AQY E;  3VHT B;  4O43 A;  1AAY A;  1NCS A;  3OML A;  4F9B B;  1ZBT A;  5KL4 A;  4JI7 E;  2V83 A;  4GEQ B;  4WXD A;  1DQ3 A;  2L6M A;  4DV2 E;  1XMO E;  1X5W A;  4DR4 E;  1X48 A;  1ZBQ A;  2B7T A;  2ELY A;  2LBS B;  2UUA E;  1UHZ A;  5TSE A;  2FFL A;  4DV7 E;  2ODR D;  4NHR A;  2EMI A;  2MC6 A;  2YTP A;  2L3C A;  4ZYG A;  5A6B A;  2YZT A;  2YRH A;  2DLQ A;  2WBT A;  1YUI A;  1TN9 A;  2YTQ A;  2NA2 A;  2L2M A;  1UN6 B;  4M0V A;  2RSI A;  1WJP A;  2JYA A;  2YTG A;  4KZS A;  3MHH C;  5IWA E;  2EPM X;  3RV0 A;  2YU8 A;  3MHS C;  2EN6 A;  2N3H A;  2BB8 A;  2MKD A;  4ZYE A;  4X62 E;  4GKJ E;  2EMK A;  5ADZ A;  2DB2 A;  1T4L B;  1YSA C;  2EMC A;  5KL6 A;  2EB1 A;  2EPA A;  3OTO E;  3ADG A;  4R2D A;  2M1S A;  2YT4 A;  3EQ1 A;  2WBU A;  1J5E E;  2B3T B;  2BBG A;  3C4T A;  1WHQ A;  2EM5 A;  2EOY A;  4KWY A;  3J7Y p;  4JI1 E;  1WXR A;  1EH8 A;  4BC9 A;  3EPL A;  3JAM C;  2EOJ A;  2EN7 A;  2JVA A;  4LF4 E;  4P7D A;  4LF6 E;  1UBD C;  2EL4 A;  1TF3 A;  2EOF A;  1A1H A;  4ZYH A;  3J81 C;  2CPN A;  1X3C A;  3KZZ A;  3BBG A;  4BHB A;  4O4K A;  2UXC E;  1KYQ A;  2YSO A;  2LE2 A;  2V86 A;  1AH5 A;  2EOH A;  3BF2 A;  4R2S A;  2B7V A;  2RQL A;  4YHH E;  1N3G A;  4BS9 A;  3FIG A;  1FJG E;  1F2I G;  2LUQ A;  5AC5 A;  2HC5 A;  1G2D C;  2K4V A;  2A11 A;  2K7I A;  5AAS A;  1JK2 A;  1JK1 A;  4OUN A;  1MEY C;  4X66 E;  3F6G A;  3IWC A;  1RMD A;  1SR9 A;  2ELZ A;  2YTJ A;  4R2E A;  1BBG A;  4RH8 A;  3EPH A;  2N3G A;  4BMJ A;  2ADR A;  2RTX A;  3IWB A;  4DR1 E;  3DF6 A;  1IQS A;  4LFB E;  3ADI A;  5IT9 C;  1YPN A;  1YYK A;  1X6H A;  4BBY A;  4JI0 E;  5AC4 A;  4M2Z A;  2J7J A;  2YTI A;  2JXP A;  4DR2 E;  3EPK A;  2EPK X;  4WXC A;  2EQ3 A;  2EM8 A;  2DLK A;  2LUP B;  4DV1 E;  1ZAA C;  1T39 A;  2LTS A;  2YSP A;  1PJS A;  3IWD A;  4ZYD A;  2UXB E;  5A6A A;  3H09 A;  2EPL X;  3HQ1 A;  5IV8 B;  4NZV A;  5FLX C;  1YYO A;  2EM0 A;  3ZOQ B;  3EPJ A;  1YYW A;  3MSW A;  4DR6 E;  4LF9 E;  2EMB A;  3K6Q A;  2VE7 C;  2E1M A;  4F6N A;  4OOG C;  2B9D A;  1STU A;  2DGC A;  2YRM A;  2M9A A;  4F2J C;  4DV4 E;  4LF5 E;  4JYA E;  5LMN E;  4DV0 E;  1YUJ A;  1IBM E;  2JY9 A;  2EOS A;  4WX9 A;  1G2F C;  3HPS A;  3VYX A;  2JOX A;  2KOU A;  1T4N A;  3F6H A;  4TUG A;  2ENA A;  4DR5 E;  4MLQ A;  3L00 A;  2EM4 A;  2N8X A;  4WSG A;  2ODR C;  1EH7 A;  3P1X A;  1GTK A;  4R2C A;  1IMU A;  4LTY A;  1IQO A;  4O5G A;  2VRD A;  5F3W A;  4FK5 C;  4IJD A;  2EOQ A;  4KHP E;  4JI6 E;  4L5N C;  4WSP A;  3DJW A;  4JI5 E;  2UUC E;  2EN4 A;  2MC5 A;  3HTX A;  4OX9 E;  2GSL A;  1XMQ E;  3ECR A;  2RS7 A;  3LML A;  4X64 E;  2JWO A;  1J26 A;  5A6B D;  4LF7 E;  2LRS A;  5KL2 A;  3C4B A;  1Z1B A;  3ADJ A;  1DI2 A;  3M99 B;  1A1G A;  3HPZ A;  2EOX A;  4F6M A;  2EMA A;  4BC7 A;  4YY3 E;  1T4O A;  1X6E A;  2EL5 A;  2FTX B;  3C6K A;  5KL3 A;  4R03 A;  1N33 E;  2EOO A;  2F4V E;  3VK6 A;  2EOE A;  2MDG A;  4B3S E;  4BHC A;  1ZTD A;  4DMI A;  4JI3 E;  2EOZ A;  3JU0 A;  3O2R A;  4J8Z A;  4JV5 E;  2F8B A;  2KON A;  4LFA E;  2EM9 A;  1DGC A;  1RC7 A;  1X6F A;  2H36 X;  2FV4 B; 
#chains in the Genus database with same CATH homology
 1QU6 A;  4DV7 E;  2ODR D;  2RSM A;  2KHX A;  2MC6 A;  2EZ6 A;  2DSY A;  2LTS A;  3IWD A;  2L3C A;  1GZ6 A;  2JR1 A;  4LFC E;  2G7H A;  2YZT A;  2UXB E;  3ADL A;  1IBL E;  1HR0 E;  3T1Y E;  3H09 A;  2UUB E;  3HQ1 A;  1N36 E;  2NA2 A;  2L2M A;  3J7A G;  4I8O A;  5FLX C;  4M0V A;  5LL6 R;  1YYO A;  5BR8 E;  1I94 E;  2V89 A;  4LU9 A;  4F9A B;  2LTR A;  3ZOQ B;  1HNZ E;  2HHH E;  1YYW A;  2L92 A;  2DIX A;  4KZS A;  2UXD E;  4Q28 A;  3MSW A;  5DNY A;  4DR6 E;  5IWA E;  2FGG A;  4LF9 E;  3RV0 A;  5LMU E;  3AUZ A;  4F9C B;  4DV5 E;  3VYY A;  1O0W A;  3K6Q A;  3O2R B;  2VE7 C;  2E1M A;  4OOG C;  2B9D A;  4K0K E;  1RC5 A;  1STU A;  2N3H A;  4GKK E;  2QVW A;  4LF5 E;  4DV4 E;  2WZO A;  4JYA E;  5AE3 A;  2LMZ A;  4X62 E;  5LMN E;  4DV0 E;  4X8W A;  4DV3 E;  2JY9 A;  2DB2 A;  5ADZ A;  4DR3 E;  1IBM E;  4GKJ E;  1T4L B;  3HPS A;  2EB1 A;  4DKK A;  3OTO E;  3ADG A;  3JTZ A;  2M1S A;  2YT4 A;  2EWL A;  2JOX A;  2KOU A;  1T4N A;  4R8O A;  2B3T B;  3F6H A;  4TUG A;  2ZM6 E;  3C4T A;  1WHQ A;  4DR5 E;  2NUG A;  4JV5 E;  4B3M E;  5T6J A;  1UIL A;  4DUZ E;  3J7Y p;  4JI1 E;  2VQE E;  4DV6 E;  3T1H E;  1WXR A;  4BC9 A;  3JAM C;  2ODR C;  3P1X A;  4B3R E;  3N3W A;  4NXM E;  2JVA A;  1HNX E;  4JI2 E;  2V8Q B;  4P7D A;  4JI4 E;  4JI8 E;  4LF4 E;  4LF6 E;  5AE2 A;  4LTY A;  3J81 C;  2CPN A;  4LF8 E;  1XNQ E;  5F3W A;  2L3J A;  1JFZ A;  4DUY E;  1PKP A;  4JI6 E;  4L5N C;  4KHP E;  1WHN A;  2UXC E;  1U61 A;  2DMY A;  1X47 A;  4WSP A;  3DJW A;  4DR7 E;  3J80 C;  3KWR A;  2LE2 A;  2M7Q A;  2V86 A;  2UUC E;  4JI5 E;  2E5L E;  2L2K B;  2IHR 1;  2L33 A;  4WPY A;  1N34 E;  3LLH A;  5CFF E;  2UU9 E;  1HNW E;  4L8N A;  3RMP A;  1EKZ A;  2MC5 A;  4TUI A;  2B7V A;  4YHH E;  1GQE A;  3HTX A;  2V88 A;  1RQ0 A;  4BS9 A;  2GSL A;  3FIG A;  4OX9 E;  3RV1 A;  1XMQ E;  1FJG E;  4WYQ B;  2RS7 A;  1X49 A;  2LUQ A;  3LML A;  4BCA A;  4X64 E;  2JWO A;  1J26 A;  4X65 E;  2K4V A;  4LF7 E;  2LRS A;  2A11 A;  5AAS A;  3C4B A;  2RS6 A;  1IBK E;  3ADJ A;  4F54 A;  1FKA E;  3AV0 A;  1DI2 A;  4OUN A;  4WFT A;  4X66 E;  3F6G A;  3HXL A;  1J5E E;  2NUE A;  3HPZ A;  4NXN E;  3IWC A;  2M4I A;  1SR9 A;  4P78 A;  4BC7 A;  3VYX A;  4YY3 E;  2VQF E;  1T4O A;  2N3G A;  2V87 A;  2FTX B;  1N33 E;  4R03 A;  4BMJ A;  1XNR E;  4B3T E;  5AE1 A;  2F4V E;  3VK6 A;  4M30 A;  2RTX A;  3IWB A;  4DV1 E;  3DF6 A;  5A2Q C;  1I4S A;  4DR1 E;  4AQY E;  1N32 E;  3ADI A;  4LFB E;  2LJH A;  5IT9 C;  1YYK A;  4B3S E;  4BBY A;  3OML A;  4JI0 E;  2NUF A;  2L2N A;  4F9B B;  1ZBT A;  4DMI A;  4JI3 E;  4M2Z A;  4JI7 E;  2V83 A;  3O2R A;  2L8T A;  2MDR A;  3JU0 A;  4GEQ B;  2F8B A;  4J8Z A;  1DQ3 A;  2L6M A;  4DV2 E;  2KON A;  4DR2 E;  1XMO E;  2V85 A;  4LFA E;  1X48 A;  4DR4 E;  1YZ9 A;  1ZBQ A;  1RC7 A;  2B7T A;  2LBS B;  2UUA E;  1UHZ A;  2H36 X;  2LUP B;  2FFL A;  2VF1 A;  2JOB A;  2FV4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...