2NUGA

Crystal structure of rnase iii from aquifex aeolicus complexed with ds-rna at 1.7-angstrom resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
216
structure length
216
Chain Sequence
MLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(P*AP*AP*GP*GP*UP*CP*AP*UP*UP*CP*G)-3'
publication title A stepwise model for double-stranded RNA processing by ribonuclease III.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
total genus 75
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 2nugA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2nugA02
4B3ME 3HTXA 4LF4E 4X66E 2NUGA 4K0KE 2L3CA 5LMUE 2KHXA 1X49A 4DV0E 4B3SE 4M2ZA 1HNWE 4LFCE 2B7TA 3OTOE 3LLHA 2UXDE 2RS6A 4JV5E 3RV1A 1IBLE 4WYQB 1IBKE 1N33E 2L2NA 2NA2A 1I94E 2UXBE 3VYYA 1HNZE 2LJHA 4DV3E 4JI0E 4LF8E 4DR2E 3J7Yp 4DUZE 2RSMA 1XMQE 1FKAE 1N34E 1HNXE 4X62E 4DR3E 4LFBE 5BR8E 1J5EE 1GQEA 2CPNA 2EB1A 1QU6A 4X65E 4DV2E 3ADLA 1X47A 4JI4E 1PKPA 4DR7E 4LF5E 2L2KB 3VYXA 2LRSA 4YY3E 2UUCE 1DI2A 1O0WA 2UUAE 2RS7A 3C4TA 1T4NA 4YHHE 2F4VE 2LTRA 2QVWA 4JI2E 5CFFE 1T4LB 1YZ9A 2DMYA 1STUA 2LBSB 4LF6E 2JY9A 2MDRA 2JVAA 3RV0A 4DV6E 1UILA 1I4SA 4JI8E 4OX9E 4JYAE 2E5LE 4GKJE 1RC7A 1U61A 2DB2A 3ADGA 2YT4A 1N36E 4DKKA 2GSLA 2DIXA 5LMNE 4DV1E 2B7VA 1FJGE 1IBME 4KHPE 4DUYE 1T4OA 2L2MA 1XNRE 1J26A 4JI6E 2IHR1 2LTSA 4DV7E 3N3WA 5IWAE 4B3RE 2NUFA 4X64E 2HHHE 3O2RB 1YYOA 1ZBTA 4DR6E 3ADIA 2FFLA 2A11A 3C4BA 2L33A 1X48A 4DR4E 1YYWA 1JFZA 1XMOE 4AQYE 3ADJA 2VQEE 2NUEA 1WHQA 1EKZA 4OUNA 4LF9E 1HR0E 3O2RA 2B3TB 4X8WA 2ZM6E 4DV5E 4JI5E 2UU9E 2VQFE 4NXNE 2N3HA 4DV4E 4JI3E 1N32E 4WFTA 4NXME 4DR5E 3T1HE 4B3TE 2LUQA 4LF7E 1UHZA 4LFAE 1YYKA 1XNQE 1RQ0A 2UXCE 3T1YE 2N3GA 2L3JA 4DR1E 4JI1E 4OOGC 2RTXA 4JI7E 1WHNA 2LUPB 2UUBE 1RC5A 2EZ6A 4M30A 3P1XA 4GKKE
chains in the Genus database with same CATH superfamily
2EMFA 3MHSC 2YRHA 4LF4E 1EH8A 4X66E 1WRJA 4K0KE 2LCEA 2EOIA 2L3CA 5LMUE 2K7IA 4B3SE 4M2ZA 1HNWE 1WJPA 2LJUA 2B7TA 5AE2A 2UXDE 1IBLE 2YTFA 1A1IA 3JU0A 2BBGA 2MKDA 2V86A 2UXBE 1T38A 3AV0A 1SR9A 2EJ4A 4HEIA 4DV3E 4ZYHA 2GLIA 2RSMA 1XMQE 1FKAE 4X62E 4Q28A 4LFBE 1KYQA 2YTJA 1J5EE 1YFHA 4NZVA 1GQEA 2CPNA 2L6MA 4P7DA 3F6GA 1PJSA 3EQ1A 4F9AB 4DR7E 2EOOA 1DI2A 2UUCE 1O0WA 4R2AA 2UUAE 2RS7A 4YHHE 2F4VE 2JPAA 2GPIA 3J81C 1X6EA 4LF6E 2JY9A 2EPAA 3MHHC 5IXMB 3AUZA 2FGGA 2V8QB 3OMLA 2N8XA 2EN2A 4WSPA 1RC7A 2GHFA 3ADGA 2YT4A 2EPOA 1PJTA 4RH8A 2EM3A 4KHPE 4DUYE 2L2MA 2EMLA 2EOEA 2JXPA 5A6JA 2IHR1 2LTSA 5A6BA 4X64E 2HHHE 3HPSA 3O2RB 2YTOA 1F2IG 4DR6E 2J7JA 2LO3A 5T6JA 3LMLA 3ADIA 2FFLA 2JP9A 5KL7A 2EMHA 3C6MA 2EOQA 2EOFA 3C6KA 4DR4E 2DGCA 4AQYE 2EOMA 3ADJA 2VQEE 4OUNA 3O2RA 2B3TB 4J8ZA 4DV5E 1JK1A 2M1SA 2N3HA 4JI3E 1N32E 3T1HE 2EOXA 3KZYA 1A1KA 4KWYA 5LLQA 4F6MA 5IV8B 2EPMX 1RQ0A 4GEQB 4JI1E 4ZYDA 4JI7E 2EQ0A 1WHNA 2CSHA 2EZ6A 4WX9A 4DV6E 4TUIA 1A1FA 2M9AA 5AE3A 3HTXA 4BMJA 2RSIA 3HPZA 5KL5A 2KHXA 1X49A 2NABA 2CTDA 3OTOE 1TN9A 4O5GA 4JV5E 2EM2A 4WYQB 1IBKE 2L8TA 2NA2A 1ZBQA 2WBTA 2WBSA 3VYYA 2HJJA 1T39A 2ODRC 3J7Yp 1SFEA 2ODRD 4BC7A 2R76A 2ENAA 2YTQA 2EM8A 2DSYA 5BR8E 4BCAA 2EN8A 2YTIA 3K6QA 1QU6A 2V87A 4X65E 4DV2E 3ADLA 2I9IA 4F9BB 2DLQA 1L4SA 2YTPA 2V85A 2EMAA 2WZOA 3C4TA 2LTRA 4JI2E 1T4LB 3UK3C 3EPHA 2MDRA 3HQ1A 2EOZA 2ADRA 2D9HA 1I4SA 4OX9E 1YPNA 1X5WA 2CT1A 2EMXA 2G7HA 5LL6R 2DB2A 1KJKA 3H09A 4DKKA 2DIXA 2YU8A 2EN7A 1MEYC 2ELZA 2EPXA 1J26A 2YSOA 5FLXC 3N3WA 1B69A 3HXLA 2EORA 4BHBA 1YUJA 2YWQA 2EMBA 3DJWA 4M9VC 2EL6A 2A11A 1G2DC 2EPRA 2EN4A 5KL3A 4R03A 2EOHA 2MKNA 1X48A 1YYWA 4R2EA 1EKZA 1X3CA 1HR0E 4NHRA 2YPNA 4L8NA 2EMYA 4LTYA 3EPJA 4WFTA 1UN6B 1X6FA 2JR1A 4LFAE 3BGHA 2I13A 2LT7A 1XNQE 3IWBA 4IS1C 3BIDA 4ZYGA 2N3GA 2LE2A 4DR1E 4OOGC 2RTXA 2EMIA 1A1GA 2LUPB 1RC5A 4Q35B 2EPZA 4M30A 3L00A 3ECRA 2EPLX 4O43A 5AASA 1TF3A 2EE8A 2EPKX 4R2CA 2LV2A 2LVHA 1P47A 4DV0E 2EN3A 1WXRA 2ENHA 1Z1BA 3VHTB 3LLHA 3RV1A 2E72A 1A1JA 2RQLA 1N33E 2L2NA 3ZOQB 2MC5A 1AAYA 1AH5A 4M0VA 2EMZA 2EPCA 2LJHA 4DUZE 3TQMA 5A6BD 1N34E 1N3GA 1HNXE 4F54A 4DR3E 2YU5A 4X9JA 3BF2A 5A6KA 2EB1A 1RMDA 2EMGA 2KOUA 1X6HA 1X47A 4F9CB 1PKPA 3FIGA 4LF5E 2EN1A 2EWLA 4R2DA 4YY3E 1IQOA 3KZZA 1T4NA 2WBUA 5AC4A 2JVAA 3RV0A 4P78A 1IMUA 2YSPA 1UILA 2F8BA 2ENCA 5AE1A 2E5LE 1PJQA 1U61A 2R1FA 1N36E 2EQ1A 3IWDA 2GSLA 4KZSA 5LMNE 2EOJA 1NCSA 5IT9C 3J80C 1A1HA 2NUFA 4R2RA 4BBYA 2YTDA 3MSWA 1ZR9A 4DMIA 1ZBTA 1EH7A 3RMPA 2EM6A 2YTGA 2K4VA 5A69A 2EM0A 2EM7A 2L33A 2EMWA 1BB8A 3BBGA 5A2QC 1GZ6A 5TSEA 2YTEA 2EL5A 2VRDA 1XMOE 2B9DA 1EH6A 1BBGA 1WHQA 2JOBA 4R2QA 1NEIA 1A1LA 4JI5E 4GKJE 2UU9E 4FK5C 4DR5E 1GTKA 2EL4A 4R2SA 1ZU1A 2EN6A 5DNYA 2UXCE 2MC6A 3T1YE 3M99B 3EPKA 2PRTA 4BC9A 2UUBE 2E1MA 2HC5A 2M4IA 3JAMC 2JWOA 4MLQA 4ZYEA 4B3ME 2Q8UA 3VK6A 2NUGA 2M7QA 4F6NA 4LFCE 2DLKA 1ZAAC 2RS6A 3F6HA 2KONA 1YUIA 4IJDA 2MDGA 1I94E 2EPPA 3THNA 2A25A 2DMIA 1HNZE 2VE7C 4JI0E 4LF8E 5KL4A 4DR2E 2YZTA 1BBOA 1MGTA 2EP3A 5KL6A 3EPLA 2LMZA 5KL2A 4JI4E 3DF6A 4WXCA 1JK2A 3IWCA 2L2KB 2JYAA 3VYXA 2LRSA 4TUGA 2BB8A 2EMCA 2QVWA 5CFFE 1YZ9A 2DMYA 1STUA 4BS9A 2LBSB 3JTZA 4LU9A 1DQ3A 2FV4B 4RHBB 2RPCA 2DRPA 2EPUA 1ZTDA 4WPYA 5F3WA 4JI8E 4JYAE 3J7AG 2EM5A 2EPNA 2V83A 4N4RB 2FTXB 2V89A 4BHCA 1YSAC 4DV1E 2B7VA 1FJGE 1LLMC 1IBME 1TF6A 1DGCA 1T4OA 4WSGA 1XNRE 1UBDC 4R8OA 4F2JC 4JI6E 4DV7E 5IWAE 4B3RE 4L5NC 3THOB 1YYOA 5AC5A 2V88A 2ELYA 3QG5C 1IQSA 2WCC3 2YRKA 1PDAA 3C4BA 4O24A 2EM4A 1G2FC 2YTNA 1JFZA 2EOSA 2EOYA 4I8OA 2NUEA 2VF1A 4LF9E 2YRMA 2L92A 2HGHA 4GZNC 4X8WA 2ZM6E 4HTGA 4WXDA 2VQFE 4DV4E 4NXNE 4O4KA 4NXME 2H36X 4B3TE 5A6AA 2LUQA 4LF7E 1UHZA 5ADZA 1YYKA 2JOXA 4R2PA 4MLVA 2L3JA 3KWRA 1QNTA 2EM9A 2EMKA 2EQ3A 3P1XA 4GKKE
chains in the Genus database with same CATH topology
4TUIA 5AE3A 2JWOA 4B3ME 3HTXA 3VK6A 4BMJA 5AASA 4LF4E 3HPZA 2NUGA 4X66E 2M7QA 4K0KE 2L3CA 5LMUE 2KHXA 1X49A 4DV0E 4B3SE 1WXRA 4M2ZA 1HNWE 4LFCE 2B7TA 3OTOE 3LLHA 5AE2A 2UXDE 2RS6A 4JV5E 3F6HA 3RV1A 2KONA 4WYQB 1IBLE 1IBKE 2L8TA 1N33E 2L2NA 2NA2A 3JU0A 2MC5A 3ZOQB 1I94E 2V86A 1DI2A 2UXBE 1ZBQA 4M0VA 3AV0A 3VYYA 1SR9A 1HNZE 2LJHA 2VE7C 4DV3E 4JI0E 4LF8E 4DR2E 2ODRC 3J7Yp 4DUZE 2RSMA 1XMQE 4GKKE 1FKAE 2ODRD 2YZTA 4BC7A 1N34E 1HNXE 4F54A 4X62E 4DR3E 4Q28A 4LFBE 2DSYA 5BR8E 4BCAA 1J5EE 2LMZA 1GQEA 2CPNA 3K6QA 2EB1A 1QU6A 2KOUA 2L6MA 2V87A 3F6GA 4P7DA 4X65E 4DV2E 3ADLA 1X47A 4F9CB 4JI4E 1PKPA 3DF6A 3FIGA 4F9AB 4F9BB 4LF5E 3IWCA 2L2KB 2EWLA 3VYXA 2LRSA 2V85A 4YY3E 2UUCE 1O0WA 4TUGA 2UUAE 2WZOA 3C4TA 2RS7A 1T4NA 4YHHE 3J81C 2F4VE 2LTRA 2QVWA 4JI2E 5CFFE 1T4LB 1YZ9A 2DMYA 1STUA 4BS9A 2LBSB 4LF6E 2JY9A 3JTZA 4LU9A 1DQ3A 2FV4B 3AUZA 2MDRA 2FGGA 3HQ1A 4DR7E 2V8QB 2JVAA 3RV0A 4P78A 3OMLA 4WPYA 4DV6E 5F3WA 1UILA 2F8BA 1I4SA 4JI8E 4OX9E 4JYAE 3J7AG 5AE1A 2E5LE 4WSPA 4GKJE 2G7HA 1RC7A 5LL6R 1U61A 2V83A 2DB2A 3ADGA 2YT4A 2FTXB 1N36E 2V89A 3H09A 4DKKA 3IWDA 2GSLA 4KZSA 2DIXA 5LMNE 4DV1E 2B7VA 1FJGE 1IBME 4KHPE 4DUYE 1T4OA 2L2MA 1XNRE 5IT9C 4R8OA 3J80C 1J26A 4JI6E 2IHR1 2LTSA 4DV7E 5FLXC 3N3WA 5IWAE 4JI5E 2NUFA 4B3RE 3HXLA 4L5NC 4BBYA 4X64E 2HHHE 3HPSA 3O2RB 3MSWA 4DMIA 1YYOA 1ZBTA 4DR6E 2V88A 3DJWA 5T6JA 3LMLA 3RMPA 3ADIA 2FFLA 2K4VA 2A11A 3C4BA 2L33A 4R03A 1X48A 4DR4E 1YYWA 5A2QC 1GZ6A 1JFZA 1XMOE 2B9DA 4AQYE 3ADJA 2VQEE 4I8OA 2NUEA 1WHQA 2JOBA 4OUNA 2L92A 2VF1A 1EKZA 1HR0E 4LF9E 3O2RA 2B3TB 4J8ZA 4L8NA 4X8WA 2ZM6E 4DV5E 2M1SA 2VQFE 2N3HA 4DV4E 4LTYA 2UU9E 4WFTA 4JI3E 4NXNE 4NXME 4DR5E 1N32E 2H36X 2JR1A 3T1HE 4B3TE 2LUQA 4LF7E 1UHZA 5ADZA 1YYKA 2JOXA 5DNYA 4LFAE 1XNQE 3IWBA 1RQ0A 2UXCE 2MC6A 4GEQB 3T1YE 2N3GA 2LE2A 2L3JA 4DR1E 4JI1E 4OOGC 2RTXA 4JI7E 3KWRA 1WHNA 2LUPB 4BC9A 1RC5A 2UUBE 2EZ6A 2E1MA 2M4IA 4M30A 3P1XA 3JAMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M E;  3HTX A;  4LF4 E;  4X66 E;  2NUG A;  4K0K E;  2L3C A;  5LMU E;  2KHX A;  1X49 A;  4DV0 E;  4B3S E;  4M2Z A;  1HNW E;  4LFC E;  2B7T A;  3OTO E;  3LLH A;  2UXD E;  2RS6 A;  4JV5 E;  3RV1 A;  1IBL E;  4WYQ B;  1IBK E;  1N33 E;  2L2N A;  2NA2 A;  1I94 E;  2UXB E;  3VYY A;  1HNZ E;  2LJH A;  4DV3 E;  4JI0 E;  4LF8 E;  4DR2 E;  3J7Y p;  4DUZ E;  2RSM A;  1XMQ E;  1FKA E;  1N34 E;  1HNX E;  4X62 E;  4DR3 E;  4LFB E;  5BR8 E;  1J5E E;  1GQE A;  2CPN A;  2EB1 A;  1QU6 A;  4X65 E;  4DV2 E;  3ADL A;  1X47 A;  4JI4 E;  1PKP A;  4DR7 E;  4LF5 E;  2L2K B;  3VYX A;  2LRS A;  4YY3 E;  2UUC E;  1DI2 A;  1O0W A;  2UUA E;  2RS7 A;  3C4T A;  1T4N A;  4YHH E;  2F4V E;  2LTR A;  2QVW A;  4JI2 E;  5CFF E;  1T4L B;  1YZ9 A;  2DMY A;  1STU A;  2LBS B;  4LF6 E;  2JY9 A;  2MDR A;  2JVA A;  3RV0 A;  4DV6 E;  1UIL A;  1I4S A;  4JI8 E;  4OX9 E;  4JYA E;  2E5L E;  4GKJ E;  1RC7 A;  1U61 A;  2DB2 A;  3ADG A;  2YT4 A;  1N36 E;  4DKK A;  2GSL A;  2DIX A;  5LMN E;  4DV1 E;  2B7V A;  1FJG E;  1IBM E;  4KHP E;  4DUY E;  1T4O A;  2L2M A;  1XNR E;  1J26 A;  4JI6 E;  2IHR 1;  2LTS A;  4DV7 E;  3N3W A;  5IWA E;  4B3R E;  2NUF A;  4X64 E;  2HHH E;  3O2R B;  1YYO A;  1ZBT A;  4DR6 E;  3ADI A;  2FFL A;  2A11 A;  3C4B A;  2L33 A;  1X48 A;  4DR4 E;  1YYW A;  1JFZ A;  1XMO E;  4AQY E;  3ADJ A;  2VQE E;  2NUE A;  1WHQ A;  1EKZ A;  4OUN A;  4LF9 E;  1HR0 E;  3O2R A;  2B3T B;  4X8W A;  2ZM6 E;  4DV5 E;  4JI5 E;  2UU9 E;  2VQF E;  4NXN E;  2N3H A;  4DV4 E;  4JI3 E;  1N32 E;  4WFT A;  4NXM E;  4DR5 E;  3T1H E;  4B3T E;  2LUQ A;  4LF7 E;  1UHZ A;  4LFA E;  1YYK A;  1XNQ E;  1RQ0 A;  2UXC E;  3T1Y E;  2N3G A;  2L3J A;  4DR1 E;  4JI1 E;  4OOG C;  2RTX A;  4JI7 E;  1WHN A;  2LUP B;  2UUB E;  1RC5 A;  2EZ6 A;  4M30 A;  3P1X A;  4GKK E; 
#chains in the Genus database with same CATH topology
 2EMF A;  3MHS C;  2YRH A;  4LF4 E;  1EH8 A;  4X66 E;  1WRJ A;  4K0K E;  2LCE A;  2EOI A;  2L3C A;  5LMU E;  2K7I A;  4B3S E;  4M2Z A;  1HNW E;  1WJP A;  2LJU A;  2B7T A;  5AE2 A;  2UXD E;  1IBL E;  2YTF A;  1A1I A;  3JU0 A;  2BBG A;  2MKD A;  2V86 A;  2UXB E;  1T38 A;  3AV0 A;  1SR9 A;  2EJ4 A;  4HEI A;  4DV3 E;  4ZYH A;  2GLI A;  2RSM A;  1XMQ E;  1FKA E;  4X62 E;  4Q28 A;  4LFB E;  1KYQ A;  2YTJ A;  1J5E E;  1YFH A;  4NZV A;  1GQE A;  2CPN A;  2L6M A;  4P7D A;  3F6G A;  1PJS A;  3EQ1 A;  4F9A B;  4DR7 E;  2EOO A;  1DI2 A;  2UUC E;  1O0W A;  4R2A A;  2UUA E;  2RS7 A;  4YHH E;  2F4V E;  2JPA A;  2GPI A;  3J81 C;  1X6E A;  4LF6 E;  2JY9 A;  2EPA A;  3MHH C;  5IXM B;  3AUZ A;  2FGG A;  2V8Q B;  3OML A;  2N8X A;  2EN2 A;  4WSP A;  1RC7 A;  2GHF A;  3ADG A;  2YT4 A;  2EPO A;  1PJT A;  4RH8 A;  2EM3 A;  4KHP E;  4DUY E;  2L2M A;  2EML A;  2EOE A;  2JXP A;  5A6J A;  2IHR 1;  2LTS A;  5A6B A;  4X64 E;  2HHH E;  3HPS A;  3O2R B;  2YTO A;  1F2I G;  4DR6 E;  2J7J A;  2LO3 A;  5T6J A;  3LML A;  3ADI A;  2FFL A;  2JP9 A;  5KL7 A;  2EMH A;  3C6M A;  2EOQ A;  2EOF A;  3C6K A;  4DR4 E;  2DGC A;  4AQY E;  2EOM A;  3ADJ A;  2VQE E;  4OUN A;  3O2R A;  2B3T B;  4J8Z A;  4DV5 E;  1JK1 A;  2M1S A;  2N3H A;  4JI3 E;  1N32 E;  3T1H E;  2EOX A;  3KZY A;  1A1K A;  4KWY A;  5LLQ A;  4F6M A;  5IV8 B;  2EPM X;  1RQ0 A;  4GEQ B;  4JI1 E;  4ZYD A;  4JI7 E;  2EQ0 A;  1WHN A;  2CSH A;  2EZ6 A;  4WX9 A;  4DV6 E;  4TUI A;  1A1F A;  2M9A A;  5AE3 A;  3HTX A;  4BMJ A;  2RSI A;  3HPZ A;  5KL5 A;  2KHX A;  1X49 A;  2NAB A;  2CTD A;  3OTO E;  1TN9 A;  4O5G A;  4JV5 E;  2EM2 A;  4WYQ B;  1IBK E;  2L8T A;  2NA2 A;  1ZBQ A;  2WBT A;  2WBS A;  3VYY A;  2HJJ A;  1T39 A;  2ODR C;  3J7Y p;  1SFE A;  2ODR D;  4BC7 A;  2R76 A;  2ENA A;  2YTQ A;  2EM8 A;  2DSY A;  5BR8 E;  4BCA A;  2EN8 A;  2YTI A;  3K6Q A;  1QU6 A;  2V87 A;  4X65 E;  4DV2 E;  3ADL A;  2I9I A;  4F9B B;  2DLQ A;  1L4S A;  2YTP A;  2V85 A;  2EMA A;  2WZO A;  3C4T A;  2LTR A;  4JI2 E;  1T4L B;  3UK3 C;  3EPH A;  2MDR A;  3HQ1 A;  2EOZ A;  2ADR A;  2D9H A;  1I4S A;  4OX9 E;  1YPN A;  1X5W A;  2CT1 A;  2EMX A;  2G7H A;  5LL6 R;  2DB2 A;  1KJK A;  3H09 A;  4DKK A;  2DIX A;  2YU8 A;  2EN7 A;  1MEY C;  2ELZ A;  2EPX A;  1J26 A;  2YSO A;  5FLX C;  3N3W A;  1B69 A;  3HXL A;  2EOR A;  4BHB A;  1YUJ A;  2YWQ A;  2EMB A;  3DJW A;  4M9V C;  2EL6 A;  2A11 A;  1G2D C;  2EPR A;  2EN4 A;  5KL3 A;  4R03 A;  2EOH A;  2MKN A;  1X48 A;  1YYW A;  4R2E A;  1EKZ A;  1X3C A;  1HR0 E;  4NHR A;  2YPN A;  4L8N A;  2EMY A;  4LTY A;  3EPJ A;  4WFT A;  1UN6 B;  1X6F A;  2JR1 A;  4LFA E;  3BGH A;  2I13 A;  2LT7 A;  1XNQ E;  3IWB A;  4IS1 C;  3BID A;  4ZYG A;  2N3G A;  2LE2 A;  4DR1 E;  4OOG C;  2RTX A;  2EMI A;  1A1G A;  2LUP B;  1RC5 A;  4Q35 B;  2EPZ A;  4M30 A;  3L00 A;  3ECR A;  2EPL X;  4O43 A;  5AAS A;  1TF3 A;  2EE8 A;  2EPK X;  4R2C A;  2LV2 A;  2LVH A;  1P47 A;  4DV0 E;  2EN3 A;  1WXR A;  2ENH A;  1Z1B A;  3VHT B;  3LLH A;  3RV1 A;  2E72 A;  1A1J A;  2RQL A;  1N33 E;  2L2N A;  3ZOQ B;  2MC5 A;  1AAY A;  1AH5 A;  4M0V A;  2EMZ A;  2EPC A;  2LJH A;  4DUZ E;  3TQM A;  5A6B D;  1N34 E;  1N3G A;  1HNX E;  4F54 A;  4DR3 E;  2YU5 A;  4X9J A;  3BF2 A;  5A6K A;  2EB1 A;  1RMD A;  2EMG A;  2KOU A;  1X6H A;  1X47 A;  4F9C B;  1PKP A;  3FIG A;  4LF5 E;  2EN1 A;  2EWL A;  4R2D A;  4YY3 E;  1IQO A;  3KZZ A;  1T4N A;  2WBU A;  5AC4 A;  2JVA A;  3RV0 A;  4P78 A;  1IMU A;  2YSP A;  1UIL A;  2F8B A;  2ENC A;  5AE1 A;  2E5L E;  1PJQ A;  1U61 A;  2R1F A;  1N36 E;  2EQ1 A;  3IWD A;  2GSL A;  4KZS A;  5LMN E;  2EOJ A;  1NCS A;  5IT9 C;  3J80 C;  1A1H A;  2NUF A;  4R2R A;  4BBY A;  2YTD A;  3MSW A;  1ZR9 A;  4DMI A;  1ZBT A;  1EH7 A;  3RMP A;  2EM6 A;  2YTG A;  2K4V A;  5A69 A;  2EM0 A;  2EM7 A;  2L33 A;  2EMW A;  1BB8 A;  3BBG A;  5A2Q C;  1GZ6 A;  5TSE A;  2YTE A;  2EL5 A;  2VRD A;  1XMO E;  2B9D A;  1EH6 A;  1BBG A;  1WHQ A;  2JOB A;  4R2Q A;  1NEI A;  1A1L A;  4JI5 E;  4GKJ E;  2UU9 E;  4FK5 C;  4DR5 E;  1GTK A;  2EL4 A;  4R2S A;  1ZU1 A;  2EN6 A;  5DNY A;  2UXC E;  2MC6 A;  3T1Y E;  3M99 B;  3EPK A;  2PRT A;  4BC9 A;  2UUB E;  2E1M A;  2HC5 A;  2M4I A;  3JAM C;  2JWO A;  4MLQ A;  4ZYE A;  4B3M E;  2Q8U A;  3VK6 A;  2NUG A;  2M7Q A;  4F6N A;  4LFC E;  2DLK A;  1ZAA C;  2RS6 A;  3F6H A;  2KON A;  1YUI A;  4IJD A;  2MDG A;  1I94 E;  2EPP A;  3THN A;  2A25 A;  2DMI A;  1HNZ E;  2VE7 C;  4JI0 E;  4LF8 E;  5KL4 A;  4DR2 E;  2YZT A;  1BBO A;  1MGT A;  2EP3 A;  5KL6 A;  3EPL A;  2LMZ A;  5KL2 A;  4JI4 E;  3DF6 A;  4WXC A;  1JK2 A;  3IWC A;  2L2K B;  2JYA A;  3VYX A;  2LRS A;  4TUG A;  2BB8 A;  2EMC A;  2QVW A;  5CFF E;  1YZ9 A;  2DMY A;  1STU A;  4BS9 A;  2LBS B;  3JTZ A;  4LU9 A;  1DQ3 A;  2FV4 B;  4RHB B;  2RPC A;  2DRP A;  2EPU A;  1ZTD A;  4WPY A;  5F3W A;  4JI8 E;  4JYA E;  3J7A G;  2EM5 A;  2EPN A;  2V83 A;  4N4R B;  2FTX B;  2V89 A;  4BHC A;  1YSA C;  4DV1 E;  2B7V A;  1FJG E;  1LLM C;  1IBM E;  1TF6 A;  1DGC A;  1T4O A;  4WSG A;  1XNR E;  1UBD C;  4R8O A;  4F2J C;  4JI6 E;  4DV7 E;  5IWA E;  4B3R E;  4L5N C;  3THO B;  1YYO A;  5AC5 A;  2V88 A;  2ELY A;  3QG5 C;  1IQS A;  2WCC 3;  2YRK A;  1PDA A;  3C4B A;  4O24 A;  2EM4 A;  1G2F C;  2YTN A;  1JFZ A;  2EOS A;  2EOY A;  4I8O A;  2NUE A;  2VF1 A;  4LF9 E;  2YRM A;  2L92 A;  2HGH A;  4GZN C;  4X8W A;  2ZM6 E;  4HTG A;  4WXD A;  2VQF E;  4DV4 E;  4NXN E;  4O4K A;  4NXM E;  2H36 X;  4B3T E;  5A6A A;  2LUQ A;  4LF7 E;  1UHZ A;  5ADZ A;  1YYK A;  2JOX A;  4R2P A;  4MLV A;  2L3J A;  3KWR A;  1QNT A;  2EM9 A;  2EMK A;  2EQ3 A;  3P1X A;  4GKK E; 
#chains in the Genus database with same CATH homology
 4TUI A;  5AE3 A;  2JWO A;  4B3M E;  3HTX A;  3VK6 A;  4BMJ A;  5AAS A;  4LF4 E;  3HPZ A;  2NUG A;  4X66 E;  2M7Q A;  4K0K E;  2L3C A;  5LMU E;  2KHX A;  1X49 A;  4DV0 E;  4B3S E;  1WXR A;  4M2Z A;  1HNW E;  4LFC E;  2B7T A;  3OTO E;  3LLH A;  5AE2 A;  2UXD E;  2RS6 A;  4JV5 E;  3F6H A;  3RV1 A;  2KON A;  4WYQ B;  1IBL E;  1IBK E;  2L8T A;  1N33 E;  2L2N A;  2NA2 A;  3JU0 A;  2MC5 A;  3ZOQ B;  1I94 E;  2V86 A;  1DI2 A;  2UXB E;  1ZBQ A;  4M0V A;  3AV0 A;  3VYY A;  1SR9 A;  1HNZ E;  2LJH A;  2VE7 C;  4DV3 E;  4JI0 E;  4LF8 E;  4DR2 E;  2ODR C;  3J7Y p;  4DUZ E;  2RSM A;  1XMQ E;  4GKK E;  1FKA E;  2ODR D;  2YZT A;  4BC7 A;  1N34 E;  1HNX E;  4F54 A;  4X62 E;  4DR3 E;  4Q28 A;  4LFB E;  2DSY A;  5BR8 E;  4BCA A;  1J5E E;  2LMZ A;  1GQE A;  2CPN A;  3K6Q A;  2EB1 A;  1QU6 A;  2KOU A;  2L6M A;  2V87 A;  3F6G A;  4P7D A;  4X65 E;  4DV2 E;  3ADL A;  1X47 A;  4F9C B;  4JI4 E;  1PKP A;  3DF6 A;  3FIG A;  4F9A B;  4F9B B;  4LF5 E;  3IWC A;  2L2K B;  2EWL A;  3VYX A;  2LRS A;  2V85 A;  4YY3 E;  2UUC E;  1O0W A;  4TUG A;  2UUA E;  2WZO A;  3C4T A;  2RS7 A;  1T4N A;  4YHH E;  3J81 C;  2F4V E;  2LTR A;  2QVW A;  4JI2 E;  5CFF E;  1T4L B;  1YZ9 A;  2DMY A;  1STU A;  4BS9 A;  2LBS B;  4LF6 E;  2JY9 A;  3JTZ A;  4LU9 A;  1DQ3 A;  2FV4 B;  3AUZ A;  2MDR A;  2FGG A;  3HQ1 A;  4DR7 E;  2V8Q B;  2JVA A;  3RV0 A;  4P78 A;  3OML A;  4WPY A;  4DV6 E;  5F3W A;  1UIL A;  2F8B A;  1I4S A;  4JI8 E;  4OX9 E;  4JYA E;  3J7A G;  5AE1 A;  2E5L E;  4WSP A;  4GKJ E;  2G7H A;  1RC7 A;  5LL6 R;  1U61 A;  2V83 A;  2DB2 A;  3ADG A;  2YT4 A;  2FTX B;  1N36 E;  2V89 A;  3H09 A;  4DKK A;  3IWD A;  2GSL A;  4KZS A;  2DIX A;  5LMN E;  4DV1 E;  2B7V A;  1FJG E;  1IBM E;  4KHP E;  4DUY E;  1T4O A;  2L2M A;  1XNR E;  5IT9 C;  4R8O A;  3J80 C;  1J26 A;  4JI6 E;  2IHR 1;  2LTS A;  4DV7 E;  5FLX C;  3N3W A;  5IWA E;  4JI5 E;  2NUF A;  4B3R E;  3HXL A;  4L5N C;  4BBY A;  4X64 E;  2HHH E;  3HPS A;  3O2R B;  3MSW A;  4DMI A;  1YYO A;  1ZBT A;  4DR6 E;  2V88 A;  3DJW A;  5T6J A;  3LML A;  3RMP A;  3ADI A;  2FFL A;  2K4V A;  2A11 A;  3C4B A;  2L33 A;  4R03 A;  1X48 A;  4DR4 E;  1YYW A;  5A2Q C;  1GZ6 A;  1JFZ A;  1XMO E;  2B9D A;  4AQY E;  3ADJ A;  2VQE E;  4I8O A;  2NUE A;  1WHQ A;  2JOB A;  4OUN A;  2L92 A;  2VF1 A;  1EKZ A;  1HR0 E;  4LF9 E;  3O2R A;  2B3T B;  4J8Z A;  4L8N A;  4X8W A;  2ZM6 E;  4DV5 E;  2M1S A;  2VQF E;  2N3H A;  4DV4 E;  4LTY A;  2UU9 E;  4WFT A;  4JI3 E;  4NXN E;  4NXM E;  4DR5 E;  1N32 E;  2H36 X;  2JR1 A;  3T1H E;  4B3T E;  2LUQ A;  4LF7 E;  1UHZ A;  5ADZ A;  1YYK A;  2JOX A;  5DNY A;  4LFA E;  1XNQ E;  3IWB A;  1RQ0 A;  2UXC E;  2MC6 A;  4GEQ B;  3T1Y E;  2N3G A;  2LE2 A;  2L3J A;  4DR1 E;  4JI1 E;  4OOG C;  2RTX A;  4JI7 E;  3KWR A;  1WHN A;  2LUP B;  4BC9 A;  1RC5 A;  2UUB E;  2EZ6 A;  2E1M A;  2M4I A;  4M30 A;  3P1X A;  3JAM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...