2NUGA

Crystal structure of rnase iii from aquifex aeolicus complexed with ds-rna at 1.7-angstrom resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
216
structure length
216
Chain Sequence
MLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A stepwise model for double-stranded RNA processing by ribonuclease III.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
molecule keywords 5'-R(P*AP*AP*GP*GP*UP*CP*AP*UP*UP*CP*G)-3'
total genus 75
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 2nugA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2nugA02
4YY3E 2YT4A 4B3RE 1IBME 4DV6E 1U61A 1X47A 3VYYA 2IHR1 2UU9E 4JI6E 2L3JA 2FFLA 2B7TA 3T1YE 2UUAE 2L3CA 1YZ9A 4JI5E 4DR1E 4JI2E 2N3GA 2VQEE 2LTSA 4M30A 2EZ6A 2LUPB 2A11A 1HR0E 1ZBTA 1XNRE 2LTRA 1J26A 4LFCE 4OX9E 4DV5E 4WYQB 4JI0E 4X66E 2N3HA 2UXCE 4JYAE 2LRSA 3N3WA 2L2MA 1T4OA 3ADLA 5LMNE 1I94E 4DR5E 1XMQE 4KHPE 1STUA 2LUQA 1XNQE 2RS6A 2B3TB 4DV4E 4DR3E 1JFZA 2LBSB 2NA2A 2F4VE 4JI7E 1HNXE 1HNZE 4WFTA 3RV0A 4DV7E 4NXNE 4LF5E 2HHHE 4DR4E 4DUZE 1IBLE 2UXBE 1YYWA 2E5LE 2VQFE 2UXDE 1WHQA 4B3ME 4B3TE 1O0WA 2RS7A 4LFBE 2EB1A 1GQEA 1UILA 4K0KE 3OTOE 4DR2E 4LF7E 1T4LB 3LLHA 2B7VA 1X49A 1FJGE 3O2RB 3ADIA 4JI3E 4LF8E 4B3SE 4M2ZA 2L2KB 3T1HE 3RV1A 3P1XA 1UHZA 2NUEA 4DV1E 4OOGC 2DIXA 1YYOA 2UUCE 4NXME 4GKJE 4JV5E 4JI4E 2RTXA 1I4SA 4LF4E 2CPNA 5CFFE 3C4TA 1PKPA 2GSLA 1XMOE 4DV2E 2LJHA 1WHNA 1X48A 3ADGA 4X8WA 4JI1E 4LF9E 3VYXA 1N36E 4DKKA 1RC5A 2QVWA 4GKKE 1RQ0A 2L2NA 5IWAE 1QU6A 4LFAE 4DR7E 1YYKA 1T4NA 2DB2A 4YHHE 3HTXA 1FKAE 4JI8E 4X62E 2JY9A 2ZM6E 4X65E 3O2RA 2NUFA 1IBKE 4X64E 1RC7A 1HNWE 5BR8E 4DV3E 3J7Yp 4OUNA 5LMUE 4LF6E 1N32E 4DR6E 3C4BA 2DMYA 2L33A 1N34E 4DV0E 2UUBE 2RSMA 3ADJA 1DI2A 2KHXA 2NUGA 4DUYE 1EKZA 2MDRA 1J5EE 4AQYE 1N33E 2JVAA
chains in the Genus database with same CATH superfamily
2EM2A 2YT4A 1EH7A 4WPYA 3EPJA 1X47A 4O4KA 2PRTA 4JI6E 2V85A 4KZSA 2FFLA 2B7TA 2UUAE 4JI5E 2VQEE 2EM3A 5A2QC 4M30A 2EOMA 2EZ6A 2LUPB 2JOBA 5A6JA 2LT7A 2EMGA 4DV5E 1IQOA 4WYQB 4ZYGA 4RH8A 1ZR9A 3N3WA 2L2MA 5LL6R 4L5NC 4N4RB 5LMNE 4KHPE 4RHBB 1X5WA 2HC5A 2RS6A 1GZ6A 4DV4E 1JFZA 4R2RA 2V8QB 3DF6A 1ZTDA 4GEQB 4JI7E 4WFTA 2EMBA 3HQ1A 4LF5E 1WHQA 5T6JA 2YRKA 5KL3A 4LFBE 1UILA 2JP9A 2YTOA 4LF7E 1WRJA 1T4LB 3K6QA 3ADIA 4JI3E 1PJQA 2M9AA 4LF8E 4FK5C 4B3SE 4WSPA 4ZYHA 1BBGA 4NZVA 3P1XA 2YTPA 1KJKA 2EOEA 2MKDA 1I4SA 4LF4E 2EN6A 2CPNA 1PKPA 2B9DA 1PJSA 2EM4A 1WXRA 1XMOE 2EPCA 1WHNA 1N36E 2EMWA 2FV4B 1QU6A 3EPKA 4DR7E 1YYKA 5A6AA 4JI8E 3EPLA 2YU5A 1JK1A 4X64E 1HNWE 2EN2A 5AE2A 3KZYA 5KL6A 2RQLA 2V83A 4R2QA 5AC4A 2HJJA 5LMUE 4LF6E 3KZZA 3JU0A 5AC5A 5A6BD 2FGGA 4ZYDA 3BF2A 2EOHA 1BBOA 2N8XA 4KWYA 2EN8A 2EPPA 2WCC3 1DI2A 2DSYA 5KL4A 4R2SA 2RPCA 4TUIA 1EKZA 1Z1BA 1ZU1A 2V88A 1N33E 4BMJA 2ODRC 4B3RE 4DV6E 3J80C 2EMXA 4R03A 5TSEA 1TN9A 2NABA 2L3CA 2E72A 3HPZA 4DR1E 5A6BA 5A69A 1A1FA 1EH8A 2EJ4A 2N3GA 2ODRD 2WBUA 5DNYA 4P7DA 5AE3A 2JOXA 1HR0E 1ZBTA 2EMLA 2EMFA 4LFCE 4OX9E 4O43A 2DMIA 2EL6A 2ELZA 4DMIA 4JI0E 2EPXA 2N3HA 1RMDA 2ENCA 3THOB 2LE2A 1XMQE 1STUA 2LUQA 1XNQE 5KL7A 2LBSB 2EL5A 1IQSA 1LLMC 5ADZA 1HNZE 4F9CB 3RV0A 1YFHA 1SFEA 1A1HA 2J7JA 3IWDA 4DUZE 1IBLE 1MGTA 1YYWA 2UXDE 4F2JC 1GQEA 1A1JA 4ZYEA 4DR2E 1X49A 3O2RB 3BGHA 2EOXA 3VK6A 3TQMA 1IMUA 4GZNC 2V86A 2HGHA 2YSOA 4IJDA 1KYQA 4M2ZA 3RV1A 2LVHA 2NUEA 4OOGC 2EOQA 2Q8UA 1YYOA 4NXME 1TF3A 3OMLA 1T38A 1A1GA 3AUZA 2EL4A 1GTKA 1YUIA 2YTGA 4DV2E 2KOUA 3J7AG 2LJHA 3EQ1A 3ADGA 4JI1E 3HPSA 1RC5A 4GKKE 2EOYA 5IWAE 4LFAE 4F54A 2EWLA 2VE7C 3JAMC 2DB2A 4F9BB 4YHHE 4BBYA 4X62E 2YTDA 2ZM6E 2NUFA 2EMKA 4Q28A 4TUGA 4BC7A 1G2DC 5BR8E 4LU9A 1X3CA 2L92A 3LMLA 2WZOA 4DV3E 4Q35B 2I9IA 4DR6E 3C4BA 4R8OA 3UK3C 1N34E 2M7QA 4DV0E 3BBGA 1ZAAC 2EMZA 2RSMA 3VHTB 2WBTA 2MC5A 2EMIA 1J5EE 4AQYE 1T39A 2EOZA 4YY3E 2EMCA 1U61A 1NCSA 3VYYA 2M1SA 1EH6A 3AV0A 2L3JA 4O24A 3T1YE 2RSIA 2E1MA 1YZ9A 4JI2E 3ECRA 2A25A 1X6EA 2LO3A 1A1KA 2V87A 1XNRE 1AAYA 2MKNA 2EM6A 1X6HA 4M9VC 2BB8A 2EMHA 4WSGA 4X66E 4BS9A 5AE1A 2LRSA 1T4OA 3ADLA 2EPKX 1PJTA 2EM9A 4BHBA 3BIDA 3HXLA 2EORA 2F4VE 4P78A 2YTIA 4DV7E 4NXNE 1WJPA 5A6KA 2EM8A 2HHHE 2DLQA 4IS1C 2UXBE 2E5LE 4B3ME 4B3TE 1O0WA 2VRDA 2EPUA 4MLVA 2YPNA 3DJWA 3LLHA 2K4VA 2R1FA 1FJGE 3THNA 3MSWA 4MLQA 4R2AA 4BC9A 3M99B 2L8TA 3MHSC 4DV1E 1UHZA 2DGCA 2DIXA 2UUCE 4GKJE 2YSPA 1BB8A 2JPAA 2RTXA 2EQ1A 4J8ZA 2EOFA 2EOSA 3FIGA 5AASA 5KL2A 2ENHA 2FTXB 4X8WA 4LF9E 4R2PA 2LV2A 2DRPA 3HTXA 3J81C 1FKAE 1TF6A 2GPIA 4LTYA 3O2RA 1IBKE 2EPAA 3F6HA 2EN7A 2EM7A 2YRMA 2EM0A 2I13A 1N3GA 4F6MA 3C6MA 2JYAA 4OUNA 1X6FA 2EM5A 1DQ3A 2VF1A 2L33A 2YTFA 3ZOQB 3C6KA 2GLIA 2UUBE 3ADJA 5IXMB 2KHXA 2EE8A 2NUGA 4DUYE 4R2DA 2EPZA 5IT9C 2ADRA 4F6NA 2EOJA 2CSHA 1IBME 4X9JA 2YTEA 4WXCA 2YRHA 2EN3A 2IHR1 2UU9E 2YTQA 2BBGA 2LTSA 3KWRA 2A11A 1MEYC 1DGCA 2LTRA 1B69A 1J26A 2EPRA 1P47A 3QG5C 2L6MA 2EOOA 3RMPA 1F2IG 1UN6B 2UXCE 4JYAE 1YUJA 2YTNA 2DLKA 2KONA 2LCEA 1I94E 4DR5E 4WX9A 4WXDA 2CT1A 2B3TB 1UBDC 2EMYA 4DR3E 2NA2A 1QNTA 1HNXE 5FLXC 4DR4E 1JK2A 2JXPA 2MC6A 2VQFE 2LMZA 3MHHC 2EPLX 4L8NA 2G7HA 2RS7A 2YWQA 2EB1A 2R76A 4K0KE 2EQ0A 3OTOE 1YPNA 3EPHA 2GHFA 5KL5A 2B7VA 4NHRA 2EP3A 2YTJA 3F6GA 1NEIA 2M4IA 2L2KB 2D9HA 2EPNA 2EPOA 3T1HE 1YSAC 5IV8B 2JWOA 3H09A 4JV5E 2V89A 4JI4E 2CTDA 4R2EA 5CFFE 3C4TA 1A1IA 2GSLA 2H36X 2YU8A 4BCAA 1X48A 1PDAA 2YZTA 2JR1A 2MDGA 3VYXA 2EN4A 4DKKA 2QVWA 1ZBQA 1RQ0A 2L2NA 2LJUA 3IWBA 3L00A 4M0VA 1T4NA 1AH5A 1A1LA 4R2CA 5LLQA 2JY9A 2ENAA 2F8BA 4X65E 2EQ3A 2EN1A 4BHCA 4I8OA 2K7IA 4O5GA 4HEIA 2ELYA 1RC7A 2EPMX 1G2FC 1L4SA 3JTZA 3J7Yp 4HTGA 1N32E 3IWCA 2DMYA 2EMAA 2EOIA 4F9AB 5F3WA 2WBSA 1SR9A 2MDRA 2JVAA
chains in the Genus database with same CATH topology
2ODRC 2YT4A 4YY3E 4B3RE 4WPYA 1IBME 4DV6E 1U61A 1X47A 3J80C 3VYYA 2M1SA 2IHR1 2UU9E 4R03A 2V85A 3AV0A 2L3JA 4JI6E 4KZSA 2FFLA 2B7TA 3T1YE 2UUAE 2L3CA 3HTXA 2E1MA 1YZ9A 3HPZA 4JI5E 4DR1E 4JI2E 2F4VE 2N3GA 2ODRD 2VQEE 2LTSA 5A2QC 4M30A 5DNYA 4P7DA 5AE3A 2EZ6A 2JOXA 3KWRA 2LUPB 2A11A 2JOBA 2V87A 1HR0E 1ZBTA 1XNRE 2LTRA 1J26A 4LFCE 4OX9E 4DV5E 4WYQB 4DMIA 4JI0E 2L6MA 3RMPA 4X66E 4BS9A 5AE1A 2N3HA 2UXCE 4JYAE 2LRSA 3N3WA 2L2MA 1T4OA 5LL6R 4L5NC 2LE2A 3ADLA 5LMNE 2KONA 1I94E 4DR5E 1XMQE 4KHPE 1STUA 2LUQA 1XNQE 3HXLA 2RS6A 1GZ6A 2B3TB 4DV4E 1JFZA 4DR3E 2LBSB 2NA2A 5ADZA 2V8QB 3DF6A 4GEQB 4P78A 4JI7E 4F9CB 1HNXE 4WFTA 1HNZE 3RV0A 4DV7E 4NXNE 3HQ1A 4LF5E 2HHHE 5FLXC 4DR4E 3IWDA 4DUZE 1IBLE 2UXBE 2MC6A 1YYWA 2E5LE 2VQFE 2UXDE 1WHQA 2LMZA 4B3TE 1O0WA 2G7HA 2RS7A 4L8NA 5T6JA 2EB1A 4B3ME 1GQEA 4LFBE 1UILA 4K0KE 3OTOE 4DR2E 4LF7E 1T4LB 3DJWA 3LLHA 3K6QA 2K4VA 2B7VA 1X49A 1FJGE 3O2RB 3ADIA 4DR6E 3VK6A 4JI3E 3F6GA 4LF8E 3MSWA 4B3SE 4WSPA 2V86A 4BC9A 2M4IA 4M2ZA 2L2KB 2L8TA 3T1HE 3RV1A 3P1XA 1UHZA 2NUEA 4DV1E 4OOGC 2JWOA 2DIXA 1YYOA 3H09A 2UUCE 4NXME 4GKJE 4JV5E 3OMLA 2V89A 4JI4E 2RTXA 1I4SA 4LF4E 3AUZA 2CPNA 5CFFE 3C4TA 1PKPA 2B9DA 4J8ZA 1WXRA 2GSLA 1XMOE 2H36X 2KOUA 4DV2E 3J7AG 3FIGA 5AASA 2LJHA 1WHNA 4BCAA 1X48A 2YZTA 2FTXB 2JR1A 3ADGA 3HPSA 4X8WA 4JI1E 4LF9E 3VYXA 1N36E 4DKKA 1RC5A 2QVWA 1ZBQA 1RQ0A 2FV4B 2L2NA 4GKKE 3IWBA 5IWAE 1QU6A 4LFAE 4F54A 4DR7E 2EWLA 2VE7C 1YYKA 4M0VA 1T4NA 2DB2A 4F9BB 3JAMC 4BBYA 4YHHE 4JI8E 4X62E 3J81C 2JY9A 4LTYA 2F8BA 2ZM6E 1FKAE 4X65E 3O2RA 2NUFA 1IBKE 4I8OA 4Q28A 4X64E 4TUGA 1RC7A 3F6HA 5BR8E 4BC7A 1HNWE 5AE2A 4LU9A 2L92A 3LMLA 2WZOA 4DV3E 3JTZA 2V83A 3J7Yp 4OUNA 5LMUE 4LF6E 3IWCA 1N32E 3C4BA 3JU0A 2DMYA 1DQ3A 2FGGA 4R8OA 2VF1A 2L33A 1N34E 2M7QA 3ZOQB 4DV0E 2UUBE 2RSMA 3ADJA 1DI2A 2KHXA 2NUGA 2DSYA 4F9AB 4DUYE 5IT9C 5F3WA 1SR9A 4TUIA 2MC5A 1EKZA 2V88A 2MDRA 1J5EE 4AQYE 1N33E 4BMJA 2JVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 E;  2YT4 A;  4B3R E;  1IBM E;  4DV6 E;  1U61 A;  1X47 A;  3VYY A;  2IHR 1;  2UU9 E;  4JI6 E;  2L3J A;  2FFL A;  2B7T A;  3T1Y E;  2UUA E;  2L3C A;  1YZ9 A;  4JI5 E;  4DR1 E;  4JI2 E;  2N3G A;  2VQE E;  2LTS A;  4M30 A;  2EZ6 A;  2LUP B;  2A11 A;  1HR0 E;  1ZBT A;  1XNR E;  2LTR A;  1J26 A;  4LFC E;  4OX9 E;  4DV5 E;  4WYQ B;  4JI0 E;  4X66 E;  2N3H A;  2UXC E;  4JYA E;  2LRS A;  3N3W A;  2L2M A;  1T4O A;  3ADL A;  5LMN E;  1I94 E;  4DR5 E;  1XMQ E;  4KHP E;  1STU A;  2LUQ A;  1XNQ E;  2RS6 A;  2B3T B;  4DV4 E;  4DR3 E;  1JFZ A;  2LBS B;  2NA2 A;  2F4V E;  4JI7 E;  1HNX E;  1HNZ E;  4WFT A;  3RV0 A;  4DV7 E;  4NXN E;  4LF5 E;  2HHH E;  4DR4 E;  4DUZ E;  1IBL E;  2UXB E;  1YYW A;  2E5L E;  2VQF E;  2UXD E;  1WHQ A;  4B3M E;  4B3T E;  1O0W A;  2RS7 A;  4LFB E;  2EB1 A;  1GQE A;  1UIL A;  4K0K E;  3OTO E;  4DR2 E;  4LF7 E;  1T4L B;  3LLH A;  2B7V A;  1X49 A;  1FJG E;  3O2R B;  3ADI A;  4JI3 E;  4LF8 E;  4B3S E;  4M2Z A;  2L2K B;  3T1H E;  3RV1 A;  3P1X A;  1UHZ A;  2NUE A;  4DV1 E;  4OOG C;  2DIX A;  1YYO A;  2UUC E;  4NXM E;  4GKJ E;  4JV5 E;  4JI4 E;  2RTX A;  1I4S A;  4LF4 E;  2CPN A;  5CFF E;  3C4T A;  1PKP A;  2GSL A;  1XMO E;  4DV2 E;  2LJH A;  1WHN A;  1X48 A;  3ADG A;  4X8W A;  4JI1 E;  4LF9 E;  3VYX A;  1N36 E;  4DKK A;  1RC5 A;  2QVW A;  4GKK E;  1RQ0 A;  2L2N A;  5IWA E;  1QU6 A;  4LFA E;  4DR7 E;  1YYK A;  1T4N A;  2DB2 A;  4YHH E;  3HTX A;  1FKA E;  4JI8 E;  4X62 E;  2JY9 A;  2ZM6 E;  4X65 E;  3O2R A;  2NUF A;  1IBK E;  4X64 E;  1RC7 A;  1HNW E;  5BR8 E;  4DV3 E;  3J7Y p;  4OUN A;  5LMU E;  4LF6 E;  1N32 E;  4DR6 E;  3C4B A;  2DMY A;  2L33 A;  1N34 E;  4DV0 E;  2UUB E;  2RSM A;  3ADJ A;  1DI2 A;  2KHX A;  2NUG A;  4DUY E;  1EKZ A;  2MDR A;  1J5E E;  4AQY E;  1N33 E;  2JVA A; 
#chains in the Genus database with same CATH topology
 2EM2 A;  2YT4 A;  1EH7 A;  4WPY A;  3EPJ A;  1X47 A;  4O4K A;  2PRT A;  4JI6 E;  2V85 A;  4KZS A;  2FFL A;  2B7T A;  2UUA E;  4JI5 E;  2VQE E;  2EM3 A;  5A2Q C;  4M30 A;  2EOM A;  2EZ6 A;  2LUP B;  2JOB A;  5A6J A;  2LT7 A;  2EMG A;  4DV5 E;  1IQO A;  4WYQ B;  4ZYG A;  4RH8 A;  1ZR9 A;  3N3W A;  2L2M A;  5LL6 R;  4L5N C;  4N4R B;  5LMN E;  4KHP E;  4RHB B;  1X5W A;  2HC5 A;  2RS6 A;  1GZ6 A;  4DV4 E;  1JFZ A;  4R2R A;  2V8Q B;  3DF6 A;  1ZTD A;  4GEQ B;  4JI7 E;  4WFT A;  2EMB A;  3HQ1 A;  4LF5 E;  1WHQ A;  5T6J A;  2YRK A;  5KL3 A;  4LFB E;  1UIL A;  2JP9 A;  2YTO A;  4LF7 E;  1WRJ A;  1T4L B;  3K6Q A;  3ADI A;  4JI3 E;  1PJQ A;  2M9A A;  4LF8 E;  4FK5 C;  4B3S E;  4WSP A;  4ZYH A;  1BBG A;  4NZV A;  3P1X A;  2YTP A;  1KJK A;  2EOE A;  2MKD A;  1I4S A;  4LF4 E;  2EN6 A;  2CPN A;  1PKP A;  2B9D A;  1PJS A;  2EM4 A;  1WXR A;  1XMO E;  2EPC A;  1WHN A;  1N36 E;  2EMW A;  2FV4 B;  1QU6 A;  3EPK A;  4DR7 E;  1YYK A;  5A6A A;  4JI8 E;  3EPL A;  2YU5 A;  1JK1 A;  4X64 E;  1HNW E;  2EN2 A;  5AE2 A;  3KZY A;  5KL6 A;  2RQL A;  2V83 A;  4R2Q A;  5AC4 A;  2HJJ A;  5LMU E;  4LF6 E;  3KZZ A;  3JU0 A;  5AC5 A;  5A6B D;  2FGG A;  4ZYD A;  3BF2 A;  2EOH A;  1BBO A;  2N8X A;  4KWY A;  2EN8 A;  2EPP A;  2WCC 3;  1DI2 A;  2DSY A;  5KL4 A;  4R2S A;  2RPC A;  4TUI A;  1EKZ A;  1Z1B A;  1ZU1 A;  2V88 A;  1N33 E;  4BMJ A;  2ODR C;  4B3R E;  4DV6 E;  3J80 C;  2EMX A;  4R03 A;  5TSE A;  1TN9 A;  2NAB A;  2L3C A;  2E72 A;  3HPZ A;  4DR1 E;  5A6B A;  5A69 A;  1A1F A;  1EH8 A;  2EJ4 A;  2N3G A;  2ODR D;  2WBU A;  5DNY A;  4P7D A;  5AE3 A;  2JOX A;  1HR0 E;  1ZBT A;  2EML A;  2EMF A;  4LFC E;  4OX9 E;  4O43 A;  2DMI A;  2EL6 A;  2ELZ A;  4DMI A;  4JI0 E;  2EPX A;  2N3H A;  1RMD A;  2ENC A;  3THO B;  2LE2 A;  1XMQ E;  1STU A;  2LUQ A;  1XNQ E;  5KL7 A;  2LBS B;  2EL5 A;  1IQS A;  1LLM C;  5ADZ A;  1HNZ E;  4F9C B;  3RV0 A;  1YFH A;  1SFE A;  1A1H A;  2J7J A;  3IWD A;  4DUZ E;  1IBL E;  1MGT A;  1YYW A;  2UXD E;  4F2J C;  1GQE A;  1A1J A;  4ZYE A;  4DR2 E;  1X49 A;  3O2R B;  3BGH A;  2EOX A;  3VK6 A;  3TQM A;  1IMU A;  4GZN C;  2V86 A;  2HGH A;  2YSO A;  4IJD A;  1KYQ A;  4M2Z A;  3RV1 A;  2LVH A;  2NUE A;  4OOG C;  2EOQ A;  2Q8U A;  1YYO A;  4NXM E;  1TF3 A;  3OML A;  1T38 A;  1A1G A;  3AUZ A;  2EL4 A;  1GTK A;  1YUI A;  2YTG A;  4DV2 E;  2KOU A;  3J7A G;  2LJH A;  3EQ1 A;  3ADG A;  4JI1 E;  3HPS A;  1RC5 A;  4GKK E;  2EOY A;  5IWA E;  4LFA E;  4F54 A;  2EWL A;  2VE7 C;  3JAM C;  2DB2 A;  4F9B B;  4YHH E;  4BBY A;  4X62 E;  2YTD A;  2ZM6 E;  2NUF A;  2EMK A;  4Q28 A;  4TUG A;  4BC7 A;  1G2D C;  5BR8 E;  4LU9 A;  1X3C A;  2L92 A;  3LML A;  2WZO A;  4DV3 E;  4Q35 B;  2I9I A;  4DR6 E;  3C4B A;  4R8O A;  3UK3 C;  1N34 E;  2M7Q A;  4DV0 E;  3BBG A;  1ZAA C;  2EMZ A;  2RSM A;  3VHT B;  2WBT A;  2MC5 A;  2EMI A;  1J5E E;  4AQY E;  1T39 A;  2EOZ A;  4YY3 E;  2EMC A;  1U61 A;  1NCS A;  3VYY A;  2M1S A;  1EH6 A;  3AV0 A;  2L3J A;  4O24 A;  3T1Y E;  2RSI A;  2E1M A;  1YZ9 A;  4JI2 E;  3ECR A;  2A25 A;  1X6E A;  2LO3 A;  1A1K A;  2V87 A;  1XNR E;  1AAY A;  2MKN A;  2EM6 A;  1X6H A;  4M9V C;  2BB8 A;  2EMH A;  4WSG A;  4X66 E;  4BS9 A;  5AE1 A;  2LRS A;  1T4O A;  3ADL A;  2EPK X;  1PJT A;  2EM9 A;  4BHB A;  3BID A;  3HXL A;  2EOR A;  2F4V E;  4P78 A;  2YTI A;  4DV7 E;  4NXN E;  1WJP A;  5A6K A;  2EM8 A;  2HHH E;  2DLQ A;  4IS1 C;  2UXB E;  2E5L E;  4B3M E;  4B3T E;  1O0W A;  2VRD A;  2EPU A;  4MLV A;  2YPN A;  3DJW A;  3LLH A;  2K4V A;  2R1F A;  1FJG E;  3THN A;  3MSW A;  4MLQ A;  4R2A A;  4BC9 A;  3M99 B;  2L8T A;  3MHS C;  4DV1 E;  1UHZ A;  2DGC A;  2DIX A;  2UUC E;  4GKJ E;  2YSP A;  1BB8 A;  2JPA A;  2RTX A;  2EQ1 A;  4J8Z A;  2EOF A;  2EOS A;  3FIG A;  5AAS A;  5KL2 A;  2ENH A;  2FTX B;  4X8W A;  4LF9 E;  4R2P A;  2LV2 A;  2DRP A;  3HTX A;  3J81 C;  1FKA E;  1TF6 A;  2GPI A;  4LTY A;  3O2R A;  1IBK E;  2EPA A;  3F6H A;  2EN7 A;  2EM7 A;  2YRM A;  2EM0 A;  2I13 A;  1N3G A;  4F6M A;  3C6M A;  2JYA A;  4OUN A;  1X6F A;  2EM5 A;  1DQ3 A;  2VF1 A;  2L33 A;  2YTF A;  3ZOQ B;  3C6K A;  2GLI A;  2UUB E;  3ADJ A;  5IXM B;  2KHX A;  2EE8 A;  2NUG A;  4DUY E;  4R2D A;  2EPZ A;  5IT9 C;  2ADR A;  4F6N A;  2EOJ A;  2CSH A;  1IBM E;  4X9J A;  2YTE A;  4WXC A;  2YRH A;  2EN3 A;  2IHR 1;  2UU9 E;  2YTQ A;  2BBG A;  2LTS A;  3KWR A;  2A11 A;  1MEY C;  1DGC A;  2LTR A;  1B69 A;  1J26 A;  2EPR A;  1P47 A;  3QG5 C;  2L6M A;  2EOO A;  3RMP A;  1F2I G;  1UN6 B;  2UXC E;  4JYA E;  1YUJ A;  2YTN A;  2DLK A;  2KON A;  2LCE A;  1I94 E;  4DR5 E;  4WX9 A;  4WXD A;  2CT1 A;  2B3T B;  1UBD C;  2EMY A;  4DR3 E;  2NA2 A;  1QNT A;  1HNX E;  5FLX C;  4DR4 E;  1JK2 A;  2JXP A;  2MC6 A;  2VQF E;  2LMZ A;  3MHH C;  2EPL X;  4L8N A;  2G7H A;  2RS7 A;  2YWQ A;  2EB1 A;  2R76 A;  4K0K E;  2EQ0 A;  3OTO E;  1YPN A;  3EPH A;  2GHF A;  5KL5 A;  2B7V A;  4NHR A;  2EP3 A;  2YTJ A;  3F6G A;  1NEI A;  2M4I A;  2L2K B;  2D9H A;  2EPN A;  2EPO A;  3T1H E;  1YSA C;  5IV8 B;  2JWO A;  3H09 A;  4JV5 E;  2V89 A;  4JI4 E;  2CTD A;  4R2E A;  5CFF E;  3C4T A;  1A1I A;  2GSL A;  2H36 X;  2YU8 A;  4BCA A;  1X48 A;  1PDA A;  2YZT A;  2JR1 A;  2MDG A;  3VYX A;  2EN4 A;  4DKK A;  2QVW A;  1ZBQ A;  1RQ0 A;  2L2N A;  2LJU A;  3IWB A;  3L00 A;  4M0V A;  1T4N A;  1AH5 A;  1A1L A;  4R2C A;  5LLQ A;  2JY9 A;  2ENA A;  2F8B A;  4X65 E;  2EQ3 A;  2EN1 A;  4BHC A;  4I8O A;  2K7I A;  4O5G A;  4HEI A;  2ELY A;  1RC7 A;  2EPM X;  1G2F C;  1L4S A;  3JTZ A;  3J7Y p;  4HTG A;  1N32 E;  3IWC A;  2DMY A;  2EMA A;  2EOI A;  4F9A B;  5F3W A;  2WBS A;  1SR9 A;  2MDR A;  2JVA A; 
#chains in the Genus database with same CATH homology
 2ODR C;  2YT4 A;  4YY3 E;  4B3R E;  4WPY A;  1IBM E;  4DV6 E;  1U61 A;  1X47 A;  3J80 C;  3VYY A;  2M1S A;  2IHR 1;  2UU9 E;  4R03 A;  2V85 A;  3AV0 A;  2L3J A;  4JI6 E;  4KZS A;  2FFL A;  2B7T A;  3T1Y E;  2UUA E;  2L3C A;  3HTX A;  2E1M A;  1YZ9 A;  3HPZ A;  4JI5 E;  4DR1 E;  4JI2 E;  2F4V E;  2N3G A;  2ODR D;  2VQE E;  2LTS A;  5A2Q C;  4M30 A;  5DNY A;  4P7D A;  5AE3 A;  2EZ6 A;  2JOX A;  3KWR A;  2LUP B;  2A11 A;  2JOB A;  2V87 A;  1HR0 E;  1ZBT A;  1XNR E;  2LTR A;  1J26 A;  4LFC E;  4OX9 E;  4DV5 E;  4WYQ B;  4DMI A;  4JI0 E;  2L6M A;  3RMP A;  4X66 E;  4BS9 A;  5AE1 A;  2N3H A;  2UXC E;  4JYA E;  2LRS A;  3N3W A;  2L2M A;  1T4O A;  5LL6 R;  4L5N C;  2LE2 A;  3ADL A;  5LMN E;  2KON A;  1I94 E;  4DR5 E;  1XMQ E;  4KHP E;  1STU A;  2LUQ A;  1XNQ E;  3HXL A;  2RS6 A;  1GZ6 A;  2B3T B;  4DV4 E;  1JFZ A;  4DR3 E;  2LBS B;  2NA2 A;  5ADZ A;  2V8Q B;  3DF6 A;  4GEQ B;  4P78 A;  4JI7 E;  4F9C B;  1HNX E;  4WFT A;  1HNZ E;  3RV0 A;  4DV7 E;  4NXN E;  3HQ1 A;  4LF5 E;  2HHH E;  5FLX C;  4DR4 E;  3IWD A;  4DUZ E;  1IBL E;  2UXB E;  2MC6 A;  1YYW A;  2E5L E;  2VQF E;  2UXD E;  1WHQ A;  2LMZ A;  4B3T E;  1O0W A;  2G7H A;  2RS7 A;  4L8N A;  5T6J A;  2EB1 A;  4B3M E;  1GQE A;  4LFB E;  1UIL A;  4K0K E;  3OTO E;  4DR2 E;  4LF7 E;  1T4L B;  3DJW A;  3LLH A;  3K6Q A;  2K4V A;  2B7V A;  1X49 A;  1FJG E;  3O2R B;  3ADI A;  4DR6 E;  3VK6 A;  4JI3 E;  3F6G A;  4LF8 E;  3MSW A;  4B3S E;  4WSP A;  2V86 A;  4BC9 A;  2M4I A;  4M2Z A;  2L2K B;  2L8T A;  3T1H E;  3RV1 A;  3P1X A;  1UHZ A;  2NUE A;  4DV1 E;  4OOG C;  2JWO A;  2DIX A;  1YYO A;  3H09 A;  2UUC E;  4NXM E;  4GKJ E;  4JV5 E;  3OML A;  2V89 A;  4JI4 E;  2RTX A;  1I4S A;  4LF4 E;  3AUZ A;  2CPN A;  5CFF E;  3C4T A;  1PKP A;  2B9D A;  4J8Z A;  1WXR A;  2GSL A;  1XMO E;  2H36 X;  2KOU A;  4DV2 E;  3J7A G;  3FIG A;  5AAS A;  2LJH A;  1WHN A;  4BCA A;  1X48 A;  2YZT A;  2FTX B;  2JR1 A;  3ADG A;  3HPS A;  4X8W A;  4JI1 E;  4LF9 E;  3VYX A;  1N36 E;  4DKK A;  1RC5 A;  2QVW A;  1ZBQ A;  1RQ0 A;  2FV4 B;  2L2N A;  4GKK E;  3IWB A;  5IWA E;  1QU6 A;  4LFA E;  4F54 A;  4DR7 E;  2EWL A;  2VE7 C;  1YYK A;  4M0V A;  1T4N A;  2DB2 A;  4F9B B;  3JAM C;  4BBY A;  4YHH E;  4JI8 E;  4X62 E;  3J81 C;  2JY9 A;  4LTY A;  2F8B A;  2ZM6 E;  1FKA E;  4X65 E;  3O2R A;  2NUF A;  1IBK E;  4I8O A;  4Q28 A;  4X64 E;  4TUG A;  1RC7 A;  3F6H A;  5BR8 E;  4BC7 A;  1HNW E;  5AE2 A;  4LU9 A;  2L92 A;  3LML A;  2WZO A;  4DV3 E;  3JTZ A;  2V83 A;  3J7Y p;  4OUN A;  5LMU E;  4LF6 E;  3IWC A;  1N32 E;  3C4B A;  3JU0 A;  2DMY A;  1DQ3 A;  2FGG A;  4R8O A;  2VF1 A;  2L33 A;  1N34 E;  2M7Q A;  3ZOQ B;  4DV0 E;  2UUB E;  2RSM A;  3ADJ A;  1DI2 A;  2KHX A;  2NUG A;  2DSY A;  4F9A B;  4DUY E;  5IT9 C;  5F3W A;  1SR9 A;  4TUI A;  2MC5 A;  1EKZ A;  2V88 A;  2MDR A;  1J5E E;  4AQY E;  1N33 E;  4BMJ A;  2JVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...