2NUGA

Crystal structure of rnase iii from aquifex aeolicus complexed with ds-rna at 1.7-angstrom resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
216
structure length
216
Chain Sequence
b'MLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(P*AP*AP*GP*GP*UP*CP*AP*UP*UP*CP*G)-3'
publication title A stepwise model for double-stranded RNA processing by ribonuclease III.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
total genus 75
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 2nugA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2nugA02
1UILA 2NA2A 2L2MA 2DIXA 4JI5E 1STUA 4GKKE 2NUGA 4AQYE 4LF9E 1X47A 4GKJE 2B3TB 3C4TA 4DR4E 1T4NA 5CFFE 4M2ZA 1HNZE 2LTSA 2UUBE 1HNXE 2LBSB 2RS6A 4DUYE 3ADJA 1WHQA 2F4VE 2N3HA 3OTOE 4JI1E 4DV7E 4JI2E 2LUQA 1GQEA 1IBME 1HR0E 2UXBE 1RQ0A 1XMQE 2UU9E 4OOGC 1N36E 3RV1A 2JVAA 1IBLE 4NXME 2MDRA 3LLHA 3N3WA 4X8WA 4KHPE 1T4OA 2DMYA 4DV0E 2EZ6A 2FFLA 1RC5A 2L2NA 4JI3E 2UXDE 4JI7E 2RS7A 4LF4E 4JI4E 1J5EE 1N32E 1FJGE 2LTRA 4OX9E 2LRSA 4DR2E 1XNRE 4DV3E 4WYQB 3RV0A 2LJHA 3ADIA 4JV5E 1J26A 2L3JA 2CPNA 2L33A 4K0KE 5IWAE 4DR6E 2IHR1 2EB1A 1HNWE 2RTXA 2UUCE 3HTXA 1UHZA 1PKPA 2A11A 2LUPB 3T1YE 2VQFE 1QU6A 2RSMA 1X49A 4JI0E 4B3RE 4DR5E 4YY3E 5LMUE 4B3SE 4M30A 4B3ME 1RC7A 4LFCE 4JYAE 4LFBE 4X62E 1XMOE 1IBKE 4B3TE 2B7TA 2QVWA 3J7Yp 1YYWA 4LF8E 3C4BA 1YYKA 2NUEA 4JI8E 3O2RA 1X48A 2KHXA 5BR8E 2L2KB 2ZM6E 2E5LE 1N33E 4DR3E 2DB2A 4DR7E 3O2RB 3VYXA 4DV5E 4DUZE 4NXNE 1JFZA 1XNQE 1N34E 3T1HE 4YHHE 1FKAE 2L3CA 4JI6E 5LMNE 2YT4A 4X64E 2VQEE 3ADGA 4DV2E 1EKZA 4X65E 4DR1E 1YZ9A 4LF5E 2B7VA 1U61A 1WHNA 4DKKA 2GSLA 2UXCE 1O0WA 2UUAE 2N3GA 1ZBTA 4DV6E 1I4SA 3P1XA 1DI2A 4DV4E 2HHHE 2NUFA 3VYYA 4LF6E 4WFTA 1I94E 2JY9A 4LFAE 4DV1E 3ADLA 4X66E 1T4LB 1YYOA 4LF7E 4OUNA
chains in the Genus database with same CATH superfamily
1UILA 2JR1A 2NA2A 2DIXA 2MKNA 1STUA 1G2FC 5KL7A 5AE3A 1ZR9A 2H36X 1L4SA 3LMLA 5AC4A 1A1LA 3TQMA 2EM9A 1HNZE 1ZAAC 2R1FA 1SFEA 2LBSB 4DUYE 3ADJA 1G2DC 1EH7A 2LUQA 1GQEA 1HR0E 1RQ0A 1LLMC 2EM0A 2EQ0A 1TN9A 1IBLE 2EPAA 2DMYA 1A1IA 1UBDC 2JP9A 1X6EA 1WRJA 3BF2A 4WXCA 1P47A 4JI7E 4LF4E 2K7IA 1Z1BA 4P7DA 2LTRA 1PJSA 3F6GA 4DV3E 5KL3A 3ADIA 4KWYA 4JV5E 2MDGA 2M4IA 4MLVA 2CPNA 2L33A 4GZNC 2K4VA 2E1MA 1DGCA 2LVHA 2ENAA 2A11A 5KL6A 2YTOA 2LUPB 1IMUA 2MC5A 2EMAA 2EMLA 2RSMA 2YRMA 4DR5E 4IJDA 3IWBA 4LFCE 1UN6B 1IBKE 1AAYA 2YU5A 2EM3A 2I9IA 4WSGA 3C4BA 1YYKA 2EPRA 2EMCA 2KONA 5F3WA 2DLKA 3KZZA 3O2RA 1X48A 2CTDA 1BBGA 5BR8E 4F9AB 3EPKA 2E5LE 2DB2A 4DV5E 4LTYA 2V89A 2M7QA 1FKAE 2YPNA 2J7JA 2LE2A 2HGHA 3KWRA 3JAMC 3IWCA 2B9DA 2EN2A 1ZU1A 5A69A 2YRKA 1WHNA 1B69A 2YZTA 2UUAE 4GEQB 4DV6E 1ZBTA 4DV4E 4LF6E 2CT1A 2EMKA 4WFTA 2EPLX 2JY9A 4MLQA 2EOFA 4DV1E 5AE1A 2BBGA 1T4LB 4P78A 4GKKE 4N4RB 3L00A 4LF9E 3C6MA 4GKJE 2B3TB 2R76A 2EN8A 3FIGA 4DR4E 1T4NA 2JYAA 1HNXE 1IQSA 5IXMB 3OTOE 3HXLA 4DV7E 1A1KA 3J80C 1KYQA 4BMJA 1A1HA 4F9CB 2UU9E 4R2CA 4KHPE 4O5GA 4R2PA 2YTEA 2YTFA 5IV8B 3F6HA 4JI3E 4HTGA 2RSIA 1N32E 2YTGA 4LU9A 4TUIA 1XNRE 2EJ4A 3RV0A 2EOOA 2LJHA 4WX9A 2L3JA 5IWAE 2IHR1 2CSHA 2YTJA 1WXRA 3QG5C 2M1SA 2EOIA 1JK2A 1QU6A 2WZOA 4JI0E 2EL6A 5LMUE 4B3SE 4M30A 3BBGA 4I8OA 2YTIA 4R2EA 2EN1A 1YUJA 4X9JA 2EM6A 5KL4A 2BB8A 4FK5C 4B3TE 2EN7A 2B7TA 3J7Yp 1KJKA 4LF8E 1ZTDA 2F8BA 2ENHA 2EPUA 4JI8E 2L2KB 2ZM6E 3EQ1A 2JWOA 2YRHA 4RH8A 2EORA 3O2RB 4F6MA 3VYXA 3VHTB 2EWLA 1JFZA 1XNQE 2EN6A 2DMIA 3AUZA 5TSEA 5LMNE 2EMZA 5AE2A 4X64E 2EN4A 2EMGA 2VQEE 1SR9A 4X65E 1YZ9A 2EQ1A 4R2QA 2DGCA 3RMPA 2EM4A 5FLXC 1IQOA 1DI2A 2EPCA 2HHHE 3MSWA 3VYYA 5AASA 2LCEA 4BBYA 2EM7A 4WPYA 1I94E 2EOHA 3DF6A 2I13A 4LFAE 3K6QA 4R2SA 5LLQA 3ADLA 4X66E 2VE7C 4J8ZA 4ZYDA 2EPMX 2YTPA 2L2MA 4JI5E 2NUGA 2WCC3 5AC5A 4ZYEA 2EPNA 2EOSA 1A1JA 5IT9C 5CFFE 4M2ZA 5A6BA 2MKDA 1X6HA 2UUBE 1BB8A 4L8NA 4IS1C 2N3HA 2ODRD 4JI2E 1X5WA 2EOMA 2ODRC 2ELYA 2V87A 4OOGC 3RV1A 2JVAA 2MDRA 3LLHA 3THNA 2EZ6A 4KZSA 2FFLA 2UXDE 4JI4E 1N3GA 1T38A 1TF6A 5A6BD 4OX9E 4DR2E 2ENCA 4WYQB 1J26A 3HPZA 2V8QB 3ZOQB 4K0KE 2EMFA 4DR6E 2EB1A 2RPCA 1MEYC 4BC9A 2RTXA 1HNWE 3JTZA 3HTXA 1UHZA 1PKPA 3C6KA 4RHBB 3T1YE 1QNTA 3J81C 1X49A 2JOXA 2VF1A 4B3ME 3THOB 4LFBE 3DJWA 1GTKA 1XMOE 1BBOA 2YSPA 3AV0A 2LMZA 1NCSA 5A2QC 1YYWA 2EOEA 3JU0A 3BIDA 2EOYA 2EOJA 2KHXA 4R2AA 2EMBA 5A6AA 2YWQA 1N33E 2WBTA 2LT7A 4HEIA 4O4KA 4DR7E 4ZYGA 2EL5A 4DUZE 1A1FA 2JPAA 1YPNA 1T39A 2ADRA 2ELZA 3T1HE 2EQ3A 2L3CA 1F2IG 2YT4A 2V83A 2GLIA 3BGHA 2VRDA 2L92A 2V85A 2HC5A 2B7VA 2DLQA 2EE8A 1U61A 2L6MA 2RQLA 4Q35B 2GSLA 2YTNA 4DKKA 2EN3A 1TF3A 3J7AG 2UXCE 3HQ1A 1YUIA 2N3GA 5A6JA 1I4SA 2EPKX 3KZYA 3P1XA 2EOQA 4WSPA 1EH8A 4ZYHA 1JK1A 4O43A 3M99B 5DNYA 2LO3A 1DQ3A 4R2DA 5T6JA 4AQYE 5ADZA 1X47A 3C4TA 5KL2A 2A25A 3OMLA 4NZVA 1X3CA 2EOXA 2EMYA 2EPXA 3VK6A 1MGTA 2DSYA 4O24A 2LTSA 2RS6A 1YFHA 1WHQA 2F4VE 2LV2A 4M0VA 4JI1E 2EM2A 2YU8A 1IBME 2UXBE 3MHHC 2PRTA 4NHRA 2EP3A 1XMQE 2GPIA 1N36E 4BHBA 1EH6A 4NXME 1PJTA 2GHFA 3N3WA 4X8WA 1T4OA 2EL4A 4DV0E 2KOUA 2HJJA 3EPLA 2EPPA 2L2NA 1RC5A 3UK3C 2RS7A 2YTQA 4DMIA 4F6NA 4BHCA 4M9VC 1J5EE 2N8XA 1FJGE 4F9BB 2LRSA 2G7HA 2FV4B 2EOZA 5KL5A 2LJUA 2UUCE 3EPJA 2EMIA 2MC6A 1ZBQA 1YSAC 2FGGA 2VQFE 4B3RE 1PJQA 2E72A 4YY3E 4R8OA 2EPZA 1RC7A 4JYAE 2DRPA 4X62E 3IWDA 2EMHA 2QVWA 4BCAA 2EM8A 2NUEA 2M9AA 1RMDA 3HPSA 2L8TA 1X6FA 1GZ6A 4TUGA 4DR3E 3ECRA 2Q8UA 3H09A 4NXNE 4R03A 1N34E 2NABA 4L5NC 2YSOA 4F54A 4YHHE 2V88A 4JI6E 2FTXB 4BC7A 5A6KA 4R2RA 3ADGA 4WXDA 4DV2E 1EKZA 2WBUA 4DR1E 4LF5E 2EPOA 2YTDA 2D9HA 2EMXA 1AH5A 4F2JC 1O0WA 4BS9A 1PDAA 2NUFA 2WBSA 2V86A 3MHSC 2EMWA 4Q28A 5LL6R 3EPHA 1NEIA 2EM5A 1A1GA 2JOBA 1WJPA 1YYOA 2JXPA 4LF7E 4OUNA
chains in the Genus database with same CATH topology
1UILA 1DQ3A 2JR1A 2DIXA 2L2MA 1STUA 2NA2A 2NUGA 4JI5E 4GKKE 5AE3A 5T6JA 4AQYE 5ADZA 4LF9E 1X47A 4GKJE 2B3TB 3C4TA 2H36X 3OMLA 3FIGA 4DR4E 5IT9C 3LMLA 3VK6A 1T4NA 5CFFE 4M2ZA 2DSYA 1HNZE 1J26A 2LTSA 2UUBE 1HNXE 2UUAE 2LBSB 2RS6A 4DUYE 3ADJA 4L8NA 1WHQA 2F4VE 2N3HA 2ODRD 4M0VA 3OTOE 4JI1E 3HXLA 4DV7E 4JI2E 2LUQA 2ODRC 3J80C 1GQEA 4BMJA 1IBME 1HR0E 2UXBE 1RQ0A 4F9CB 1XMQE 2V87A 2UU9E 4OOGC 1N36E 3RV1A 2JVAA 1IBLE 4NXME 2MDRA 3LLHA 3N3WA 4X8WA 4KHPE 1T4OA 2DMYA 4DV0E 2KOUA 2EZ6A 4KZSA 2FFLA 1RC5A 2L2NA 3F6HA 4JI3E 2UXDE 4JI7E 2RS7A 4DMIA 4LF4E 4JI4E 1J5EE 1N32E 1FJGE 4P7DA 2LTRA 4F9BB 4LU9A 4TUIA 4OX9E 2LRSA 4DR2E 3F6GA 1FKAE 2G7HA 2FV4B 4WYQB 3RV0A 2LJHA 4DV3E 1XNRE 3HPZA 2L3JA 2V8QB 3ADIA 2M4IA 4JV5E 2CPNA 2L33A 3ZOQB 5IWAE 4DR6E 2IHR1 4K0KE 2EB1A 1HNWE 4BC9A 2RTXA 2UUCE 2K4VA 3JTZA 2E1MA 1UHZA 2M1SA 1WXRA 1PKPA 2A11A 3HTXA 2MC6A 2LUPB 1ZBQA 2MC5A 2FGGA 3T1YE 2VQFE 1QU6A 2RSMA 1X49A 2WZOA 3J81C 4JI0E 2JOXA 2VF1A 4B3RE 4DR5E 4YY3E 5LMUE 4R8OA 4M30A 3IWBA 1RC7A 4I8OA 4B3SE 4B3ME 4LFCE 4JYAE 4LFBE 3DJWA 4X62E 1XMOE 1IBKE 3AV0A 2LMZA 3IWDA 5A2QC 4B3TE 2B7TA 2QVWA 3J7Yp 1YYWA 4BCAA 4LF8E 3C4BA 1YYKA 2F8BA 2NUEA 3JU0A 2KONA 5F3WA 4JI8E 3O2RA 1X48A 2KHXA 3HPSA 2L8TA 5BR8E 2L2KB 2ZM6E 4F9AB 1GZ6A 2E5LE 1N33E 4TUGA 2JWOA 4DR3E 2DB2A 3H09A 4DR7E 3O2RB 3VYXA 4DV5E 4DUZE 4NXNE 4LTYA 2EWLA 1JFZA 4R03A 1XNQE 1N34E 2V89A 4L5NC 3AUZA 2M7QA 4F54A 4YHHE 2L3CA 3T1HE 2V88A 5LMNE 2FTXB 2LE2A 2V83A 2YT4A 4BC7A 5AE2A 4X64E 4JI6E 2VQEE 3KWRA 3JAMC 3ADGA 4DV2E 3IWCA 1EKZA 2B9DA 1SR9A 4X65E 4DR1E 2L92A 2V85A 1YZ9A 4LF5E 2B7VA 1U61A 1WHNA 2L6MA 4DKKA 2GSLA 2YZTA 3J7AG 2UXCE 1O0WA 3RMPA 3HQ1A 5FLXC 4GEQB 2N3GA 1ZBTA 4DV6E 1I4SA 3P1XA 4BS9A 4DV4E 1DI2A 2HHHE 2NUFA 3MSWA 3VYYA 5AASA 4LF6E 4BBYA 2V86A 4WSPA 4Q28A 4WPYA 4WFTA 5LL6R 1I94E 3DF6A 2JY9A 4LFAE 3K6QA 4DV1E 3ADLA 5AE1A 4X66E 2JOBA 5DNYA 1T4LB 2VE7C 4J8ZA 4P78A 1YYOA 4LF7E 4OUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UIL A;  2NA2 A;  2L2M A;  2DIX A;  4JI5 E;  1STU A;  4GKK E;  2NUG A;  4AQY E;  4LF9 E;  1X47 A;  4GKJ E;  2B3T B;  3C4T A;  4DR4 E;  1T4N A;  5CFF E;  4M2Z A;  1HNZ E;  2LTS A;  2UUB E;  1HNX E;  2LBS B;  2RS6 A;  4DUY E;  3ADJ A;  1WHQ A;  2F4V E;  2N3H A;  3OTO E;  4JI1 E;  4DV7 E;  4JI2 E;  2LUQ A;  1GQE A;  1IBM E;  1HR0 E;  2UXB E;  1RQ0 A;  1XMQ E;  2UU9 E;  4OOG C;  1N36 E;  3RV1 A;  2JVA A;  1IBL E;  4NXM E;  2MDR A;  3LLH A;  3N3W A;  4X8W A;  4KHP E;  1T4O A;  2DMY A;  4DV0 E;  2EZ6 A;  2FFL A;  1RC5 A;  2L2N A;  4JI3 E;  2UXD E;  4JI7 E;  2RS7 A;  4LF4 E;  4JI4 E;  1J5E E;  1N32 E;  1FJG E;  2LTR A;  4OX9 E;  2LRS A;  4DR2 E;  1XNR E;  4DV3 E;  4WYQ B;  3RV0 A;  2LJH A;  3ADI A;  4JV5 E;  1J26 A;  2L3J A;  2CPN A;  2L33 A;  4K0K E;  5IWA E;  4DR6 E;  2IHR 1;  2EB1 A;  1HNW E;  2RTX A;  2UUC E;  3HTX A;  1UHZ A;  1PKP A;  2A11 A;  2LUP B;  3T1Y E;  2VQF E;  1QU6 A;  2RSM A;  1X49 A;  4JI0 E;  4B3R E;  4DR5 E;  4YY3 E;  5LMU E;  4B3S E;  4M30 A;  4B3M E;  1RC7 A;  4LFC E;  4JYA E;  4LFB E;  4X62 E;  1XMO E;  1IBK E;  4B3T E;  2B7T A;  2QVW A;  3J7Y p;  1YYW A;  4LF8 E;  3C4B A;  1YYK A;  2NUE A;  4JI8 E;  3O2R A;  1X48 A;  2KHX A;  5BR8 E;  2L2K B;  2ZM6 E;  2E5L E;  1N33 E;  4DR3 E;  2DB2 A;  4DR7 E;  3O2R B;  3VYX A;  4DV5 E;  4DUZ E;  4NXN E;  1JFZ A;  1XNQ E;  1N34 E;  3T1H E;  4YHH E;  1FKA E;  2L3C A;  4JI6 E;  5LMN E;  2YT4 A;  4X64 E;  2VQE E;  3ADG A;  4DV2 E;  1EKZ A;  4X65 E;  4DR1 E;  1YZ9 A;  4LF5 E;  2B7V A;  1U61 A;  1WHN A;  4DKK A;  2GSL A;  2UXC E;  1O0W A;  2UUA E;  2N3G A;  1ZBT A;  4DV6 E;  1I4S A;  3P1X A;  1DI2 A;  4DV4 E;  2HHH E;  2NUF A;  3VYY A;  4LF6 E;  4WFT A;  1I94 E;  2JY9 A;  4LFA E;  4DV1 E;  3ADL A;  4X66 E;  1T4L B;  1YYO A;  4LF7 E;  4OUN A; 
#chains in the Genus database with same CATH topology
 1UIL A;  2JR1 A;  2NA2 A;  2DIX A;  2MKN A;  1STU A;  1G2F C;  5KL7 A;  5AE3 A;  1ZR9 A;  2H36 X;  1L4S A;  3LML A;  5AC4 A;  1A1L A;  3TQM A;  2EM9 A;  1HNZ E;  1ZAA C;  2R1F A;  1SFE A;  2LBS B;  4DUY E;  3ADJ A;  1G2D C;  1EH7 A;  2LUQ A;  1GQE A;  1HR0 E;  1RQ0 A;  1LLM C;  2EM0 A;  2EQ0 A;  1TN9 A;  1IBL E;  2EPA A;  2DMY A;  1A1I A;  1UBD C;  2JP9 A;  1X6E A;  1WRJ A;  3BF2 A;  4WXC A;  1P47 A;  4JI7 E;  4LF4 E;  2K7I A;  1Z1B A;  4P7D A;  2LTR A;  1PJS A;  3F6G A;  4DV3 E;  5KL3 A;  3ADI A;  4KWY A;  4JV5 E;  2MDG A;  2M4I A;  4MLV A;  2CPN A;  2L33 A;  4GZN C;  2K4V A;  2E1M A;  1DGC A;  2LVH A;  2ENA A;  2A11 A;  5KL6 A;  2YTO A;  2LUP B;  1IMU A;  2MC5 A;  2EMA A;  2EML A;  2RSM A;  2YRM A;  4DR5 E;  4IJD A;  3IWB A;  4LFC E;  1UN6 B;  1IBK E;  1AAY A;  2YU5 A;  2EM3 A;  2I9I A;  4WSG A;  3C4B A;  1YYK A;  2EPR A;  2EMC A;  2KON A;  5F3W A;  2DLK A;  3KZZ A;  3O2R A;  1X48 A;  2CTD A;  1BBG A;  5BR8 E;  4F9A B;  3EPK A;  2E5L E;  2DB2 A;  4DV5 E;  4LTY A;  2V89 A;  2M7Q A;  1FKA E;  2YPN A;  2J7J A;  2LE2 A;  2HGH A;  3KWR A;  3JAM C;  3IWC A;  2B9D A;  2EN2 A;  1ZU1 A;  5A69 A;  2YRK A;  1WHN A;  1B69 A;  2YZT A;  2UUA E;  4GEQ B;  4DV6 E;  1ZBT A;  4DV4 E;  4LF6 E;  2CT1 A;  2EMK A;  4WFT A;  2EPL X;  2JY9 A;  4MLQ A;  2EOF A;  4DV1 E;  5AE1 A;  2BBG A;  1T4L B;  4P78 A;  4GKK E;  4N4R B;  3L00 A;  4LF9 E;  3C6M A;  4GKJ E;  2B3T B;  2R76 A;  2EN8 A;  3FIG A;  4DR4 E;  1T4N A;  2JYA A;  1HNX E;  1IQS A;  5IXM B;  3OTO E;  3HXL A;  4DV7 E;  1A1K A;  3J80 C;  1KYQ A;  4BMJ A;  1A1H A;  4F9C B;  2UU9 E;  4R2C A;  4KHP E;  4O5G A;  4R2P A;  2YTE A;  2YTF A;  5IV8 B;  3F6H A;  4JI3 E;  4HTG A;  2RSI A;  1N32 E;  2YTG A;  4LU9 A;  4TUI A;  1XNR E;  2EJ4 A;  3RV0 A;  2EOO A;  2LJH A;  4WX9 A;  2L3J A;  5IWA E;  2IHR 1;  2CSH A;  2YTJ A;  1WXR A;  3QG5 C;  2M1S A;  2EOI A;  1JK2 A;  1QU6 A;  2WZO A;  4JI0 E;  2EL6 A;  5LMU E;  4B3S E;  4M30 A;  3BBG A;  4I8O A;  2YTI A;  4R2E A;  2EN1 A;  1YUJ A;  4X9J A;  2EM6 A;  5KL4 A;  2BB8 A;  4FK5 C;  4B3T E;  2EN7 A;  2B7T A;  3J7Y p;  1KJK A;  4LF8 E;  1ZTD A;  2F8B A;  2ENH A;  2EPU A;  4JI8 E;  2L2K B;  2ZM6 E;  3EQ1 A;  2JWO A;  2YRH A;  4RH8 A;  2EOR A;  3O2R B;  4F6M A;  3VYX A;  3VHT B;  2EWL A;  1JFZ A;  1XNQ E;  2EN6 A;  2DMI A;  3AUZ A;  5TSE A;  5LMN E;  2EMZ A;  5AE2 A;  4X64 E;  2EN4 A;  2EMG A;  2VQE E;  1SR9 A;  4X65 E;  1YZ9 A;  2EQ1 A;  4R2Q A;  2DGC A;  3RMP A;  2EM4 A;  5FLX C;  1IQO A;  1DI2 A;  2EPC A;  2HHH E;  3MSW A;  3VYY A;  5AAS A;  2LCE A;  4BBY A;  2EM7 A;  4WPY A;  1I94 E;  2EOH A;  3DF6 A;  2I13 A;  4LFA E;  3K6Q A;  4R2S A;  5LLQ A;  3ADL A;  4X66 E;  2VE7 C;  4J8Z A;  4ZYD A;  2EPM X;  2YTP A;  2L2M A;  4JI5 E;  2NUG A;  2WCC 3;  5AC5 A;  4ZYE A;  2EPN A;  2EOS A;  1A1J A;  5IT9 C;  5CFF E;  4M2Z A;  5A6B A;  2MKD A;  1X6H A;  2UUB E;  1BB8 A;  4L8N A;  4IS1 C;  2N3H A;  2ODR D;  4JI2 E;  1X5W A;  2EOM A;  2ODR C;  2ELY A;  2V87 A;  4OOG C;  3RV1 A;  2JVA A;  2MDR A;  3LLH A;  3THN A;  2EZ6 A;  4KZS A;  2FFL A;  2UXD E;  4JI4 E;  1N3G A;  1T38 A;  1TF6 A;  5A6B D;  4OX9 E;  4DR2 E;  2ENC A;  4WYQ B;  1J26 A;  3HPZ A;  2V8Q B;  3ZOQ B;  4K0K E;  2EMF A;  4DR6 E;  2EB1 A;  2RPC A;  1MEY C;  4BC9 A;  2RTX A;  1HNW E;  3JTZ A;  3HTX A;  1UHZ A;  1PKP A;  3C6K A;  4RHB B;  3T1Y E;  1QNT A;  3J81 C;  1X49 A;  2JOX A;  2VF1 A;  4B3M E;  3THO B;  4LFB E;  3DJW A;  1GTK A;  1XMO E;  1BBO A;  2YSP A;  3AV0 A;  2LMZ A;  1NCS A;  5A2Q C;  1YYW A;  2EOE A;  3JU0 A;  3BID A;  2EOY A;  2EOJ A;  2KHX A;  4R2A A;  2EMB A;  5A6A A;  2YWQ A;  1N33 E;  2WBT A;  2LT7 A;  4HEI A;  4O4K A;  4DR7 E;  4ZYG A;  2EL5 A;  4DUZ E;  1A1F A;  2JPA A;  1YPN A;  1T39 A;  2ADR A;  2ELZ A;  3T1H E;  2EQ3 A;  2L3C A;  1F2I G;  2YT4 A;  2V83 A;  2GLI A;  3BGH A;  2VRD A;  2L92 A;  2V85 A;  2HC5 A;  2B7V A;  2DLQ A;  2EE8 A;  1U61 A;  2L6M A;  2RQL A;  4Q35 B;  2GSL A;  2YTN A;  4DKK A;  2EN3 A;  1TF3 A;  3J7A G;  2UXC E;  3HQ1 A;  1YUI A;  2N3G A;  5A6J A;  1I4S A;  2EPK X;  3KZY A;  3P1X A;  2EOQ A;  4WSP A;  1EH8 A;  4ZYH A;  1JK1 A;  4O43 A;  3M99 B;  5DNY A;  2LO3 A;  1DQ3 A;  4R2D A;  5T6J A;  4AQY E;  5ADZ A;  1X47 A;  3C4T A;  5KL2 A;  2A25 A;  3OML A;  4NZV A;  1X3C A;  2EOX A;  2EMY A;  2EPX A;  3VK6 A;  1MGT A;  2DSY A;  4O24 A;  2LTS A;  2RS6 A;  1YFH A;  1WHQ A;  2F4V E;  2LV2 A;  4M0V A;  4JI1 E;  2EM2 A;  2YU8 A;  1IBM E;  2UXB E;  3MHH C;  2PRT A;  4NHR A;  2EP3 A;  1XMQ E;  2GPI A;  1N36 E;  4BHB A;  1EH6 A;  4NXM E;  1PJT A;  2GHF A;  3N3W A;  4X8W A;  1T4O A;  2EL4 A;  4DV0 E;  2KOU A;  2HJJ A;  3EPL A;  2EPP A;  2L2N A;  1RC5 A;  3UK3 C;  2RS7 A;  2YTQ A;  4DMI A;  4F6N A;  4BHC A;  4M9V C;  1J5E E;  2N8X A;  1FJG E;  4F9B B;  2LRS A;  2G7H A;  2FV4 B;  2EOZ A;  5KL5 A;  2LJU A;  2UUC E;  3EPJ A;  2EMI A;  2MC6 A;  1ZBQ A;  1YSA C;  2FGG A;  2VQF E;  4B3R E;  1PJQ A;  2E72 A;  4YY3 E;  4R8O A;  2EPZ A;  1RC7 A;  4JYA E;  2DRP A;  4X62 E;  3IWD A;  2EMH A;  2QVW A;  4BCA A;  2EM8 A;  2NUE A;  2M9A A;  1RMD A;  3HPS A;  2L8T A;  1X6F A;  1GZ6 A;  4TUG A;  4DR3 E;  3ECR A;  2Q8U A;  3H09 A;  4NXN E;  4R03 A;  1N34 E;  2NAB A;  4L5N C;  2YSO A;  4F54 A;  4YHH E;  2V88 A;  4JI6 E;  2FTX B;  4BC7 A;  5A6K A;  4R2R A;  3ADG A;  4WXD A;  4DV2 E;  1EKZ A;  2WBU A;  4DR1 E;  4LF5 E;  2EPO A;  2YTD A;  2D9H A;  2EMX A;  1AH5 A;  4F2J C;  1O0W A;  4BS9 A;  1PDA A;  2NUF A;  2WBS A;  2V86 A;  3MHS C;  2EMW A;  4Q28 A;  5LL6 R;  3EPH A;  1NEI A;  2EM5 A;  1A1G A;  2JOB A;  1WJP A;  1YYO A;  2JXP A;  4LF7 E;  4OUN A; 
#chains in the Genus database with same CATH homology
 1UIL A;  1DQ3 A;  2JR1 A;  2DIX A;  2L2M A;  1STU A;  2NA2 A;  2NUG A;  4JI5 E;  4GKK E;  5AE3 A;  5T6J A;  4AQY E;  5ADZ A;  4LF9 E;  1X47 A;  4GKJ E;  2B3T B;  3C4T A;  2H36 X;  3OML A;  3FIG A;  4DR4 E;  5IT9 C;  3LML A;  3VK6 A;  1T4N A;  5CFF E;  4M2Z A;  2DSY A;  1HNZ E;  1J26 A;  2LTS A;  2UUB E;  1HNX E;  2UUA E;  2LBS B;  2RS6 A;  4DUY E;  3ADJ A;  4L8N A;  1WHQ A;  2F4V E;  2N3H A;  2ODR D;  4M0V A;  3OTO E;  4JI1 E;  3HXL A;  4DV7 E;  4JI2 E;  2LUQ A;  2ODR C;  3J80 C;  1GQE A;  4BMJ A;  1IBM E;  1HR0 E;  2UXB E;  1RQ0 A;  4F9C B;  1XMQ E;  2V87 A;  2UU9 E;  4OOG C;  1N36 E;  3RV1 A;  2JVA A;  1IBL E;  4NXM E;  2MDR A;  3LLH A;  3N3W A;  4X8W A;  4KHP E;  1T4O A;  2DMY A;  4DV0 E;  2KOU A;  2EZ6 A;  4KZS A;  2FFL A;  1RC5 A;  2L2N A;  3F6H A;  4JI3 E;  2UXD E;  4JI7 E;  2RS7 A;  4DMI A;  4LF4 E;  4JI4 E;  1J5E E;  1N32 E;  1FJG E;  4P7D A;  2LTR A;  4F9B B;  4LU9 A;  4TUI A;  4OX9 E;  2LRS A;  4DR2 E;  3F6G A;  1FKA E;  2G7H A;  2FV4 B;  4WYQ B;  3RV0 A;  2LJH A;  4DV3 E;  1XNR E;  3HPZ A;  2L3J A;  2V8Q B;  3ADI A;  2M4I A;  4JV5 E;  2CPN A;  2L33 A;  3ZOQ B;  5IWA E;  4DR6 E;  2IHR 1;  4K0K E;  2EB1 A;  1HNW E;  4BC9 A;  2RTX A;  2UUC E;  2K4V A;  3JTZ A;  2E1M A;  1UHZ A;  2M1S A;  1WXR A;  1PKP A;  2A11 A;  3HTX A;  2MC6 A;  2LUP B;  1ZBQ A;  2MC5 A;  2FGG A;  3T1Y E;  2VQF E;  1QU6 A;  2RSM A;  1X49 A;  2WZO A;  3J81 C;  4JI0 E;  2JOX A;  2VF1 A;  4B3R E;  4DR5 E;  4YY3 E;  5LMU E;  4R8O A;  4M30 A;  3IWB A;  1RC7 A;  4I8O A;  4B3S E;  4B3M E;  4LFC E;  4JYA E;  4LFB E;  3DJW A;  4X62 E;  1XMO E;  1IBK E;  3AV0 A;  2LMZ A;  3IWD A;  5A2Q C;  4B3T E;  2B7T A;  2QVW A;  3J7Y p;  1YYW A;  4BCA A;  4LF8 E;  3C4B A;  1YYK A;  2F8B A;  2NUE A;  3JU0 A;  2KON A;  5F3W A;  4JI8 E;  3O2R A;  1X48 A;  2KHX A;  3HPS A;  2L8T A;  5BR8 E;  2L2K B;  2ZM6 E;  4F9A B;  1GZ6 A;  2E5L E;  1N33 E;  4TUG A;  2JWO A;  4DR3 E;  2DB2 A;  3H09 A;  4DR7 E;  3O2R B;  3VYX A;  4DV5 E;  4DUZ E;  4NXN E;  4LTY A;  2EWL A;  1JFZ A;  4R03 A;  1XNQ E;  1N34 E;  2V89 A;  4L5N C;  3AUZ A;  2M7Q A;  4F54 A;  4YHH E;  2L3C A;  3T1H E;  2V88 A;  5LMN E;  2FTX B;  2LE2 A;  2V83 A;  2YT4 A;  4BC7 A;  5AE2 A;  4X64 E;  4JI6 E;  2VQE E;  3KWR A;  3JAM C;  3ADG A;  4DV2 E;  3IWC A;  1EKZ A;  2B9D A;  1SR9 A;  4X65 E;  4DR1 E;  2L92 A;  2V85 A;  1YZ9 A;  4LF5 E;  2B7V A;  1U61 A;  1WHN A;  2L6M A;  4DKK A;  2GSL A;  2YZT A;  3J7A G;  2UXC E;  1O0W A;  3RMP A;  3HQ1 A;  5FLX C;  4GEQ B;  2N3G A;  1ZBT A;  4DV6 E;  1I4S A;  3P1X A;  4BS9 A;  4DV4 E;  1DI2 A;  2HHH E;  2NUF A;  3MSW A;  3VYY A;  5AAS A;  4LF6 E;  4BBY A;  2V86 A;  4WSP A;  4Q28 A;  4WPY A;  4WFT A;  5LL6 R;  1I94 E;  3DF6 A;  2JY9 A;  4LFA E;  3K6Q A;  4DV1 E;  3ADL A;  5AE1 A;  4X66 E;  2JOB A;  5DNY A;  1T4L B;  2VE7 C;  4J8Z A;  4P78 A;  1YYO A;  4LF7 E;  4OUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...