2NUGA

Crystal structure of rnase iii from aquifex aeolicus complexed with ds-rna at 1.7-angstrom resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
216
structure length
216
Chain Sequence
MLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords 5'-R(P*AP*AP*GP*GP*UP*CP*AP*UP*UP*CP*G)-3'
publication title A stepwise model for double-stranded RNA processing by ribonuclease III.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 75
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 2nugA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2nugA02
1N32E 2LTRA 2FFLA 3C4TA 2LRSA 3ADGA 4YHHE 5IWAE 1XNQE 2RTXA 4DR1E 2UXBE 4OX9E 3J7Yp 2JY9A 3RV0A 1RC7A 5LMNE 2UUAE 3N3WA 1STUA 1T4LB 2DB2A 4GKKE 1T4NA 4DV3E 4JI5E 4DR2E 2L3JA 1DI2A 4DV2E 2EB1A 2L2MA 2NUGA 2LTSA 1QU6A 1YYKA 1YYOA 4JI4E 1N33E 2LJHA 4GKJE 2LUQA 1WHNA 4LFBE 4DUYE 2LBSB 4YY3E 1GQEA 1I94E 1FJGE 4B3TE 2N3GA 1WHQA 3VYYA 4LF9E 4JI7E 2F4VE 3VYXA 2B7TA 4DV0E 4X62E 4DUZE 4NXME 2NUFA 4LF7E 1EKZA 1XMOE 4DR6E 1UHZA 3LLHA 1FKAE 4JI0E 4B3SE 4DR4E 4DV6E 4LF5E 2B7VA 2IHR1 2VQFE 4JI3E 2N3HA 4WYQB 2CPNA 4JI1E 4JI6E 4JV5E 5LMUE 1JFZA 3O2RA 5BR8E 2EZ6A 4WFTA 4KHPE 2KHXA 1YYWA 1J26A 2RS6A 3T1HE 1N34E 2B3TB 2UUBE 4JI2E 2QVWA 1UILA 4DKKA 4OUNA 1HR0E 1ZBTA 1RQ0A 1N36E 2NUEA 4NXNE 4B3RE 4B3ME 4JYAE 4JI8E 1T4OA 1YZ9A 2A11A 4OOGC 3ADIA 4X66E 2L2NA 2UXCE 3ADJA 3HTXA 2L3CA 2JVAA 3RV1A 3P1XA 4DV1E 4DV4E 1IBME 2LUPB 4M2ZA 2YT4A 1HNZE 4LFCE 1XNRE 2NA2A 4LFAE 3ADLA 2HHHE 1IBKE 2RSMA 4DV5E 4X65E 3T1YE 2DMYA 5CFFE 4DR7E 2GSLA 1O0WA 2UUCE 2RS7A 1U61A 4AQYE 1J5EE 4DR5E 1X49A 1IBLE 2E5LE 2UXDE 1X48A 4LF6E 2UU9E 1I4SA 1XMQE 4X64E 3O2RB 4DR3E 2DIXA 2L2KB 4X8WA 2ZM6E 1HNXE 3OTOE 4LF4E 4LF8E 4DV7E 4K0KE 1PKPA 1X47A 1HNWE 2L33A 4M30A 2VQEE 2MDRA 3C4BA 1RC5A
chains in the Genus database with same CATH superfamily
2EMLA 2YU8A 2EPRA 2LRSA 3C4TA 3ADGA 4F54A 4X9JA 2YU5A 5IWAE 2RTXA 2EM9A 4OX9E 2EOMA 2EPLX 1IQSA 2JY9A 4R8OA 1AAYA 1RC7A 5AC4A 2JWOA 1DQ3A 2EPAA 5FLXC 3UK3C 2DB2A 1T4NA 2L8TA 3JAMC 2EN6A 2NUGA 1ZTDA 3HPSA 2LJHA 3J81C 3EPHA 4M9VC 4YY3E 4HEIA 5AASA 2N3GA 2J7JA 2JR1A 3EPJA 3VYXA 1Z1BA 4NXME 3DF6A 2NUFA 4R2CA 2WBUA 4MLVA 3KZZA 3OMLA 2YRHA 2G7HA 3EPLA 4DR4E 5LL6R 2EORA 2H36X 2EMYA 2RSIA 4BHBA 2ELYA 1X3CA 3AUZA 4LF5E 2IHR1 2VQFE 2YTNA 1L4SA 4WYQB 2EMFA 2GPIA 2GLIA 3TQMA 5KL6A 5AC5A 5LMUE 2HC5A 4WFTA 1YYWA 2YRKA 2RS6A 2YTGA 2EP3A 4R2RA 4HTGA 2QVWA 2EJ4A 4WXDA 1ZU1A 1BB8A 1SR9A 2MKDA 4NXNE 4B3RE 4JYAE 1GZ6A 4Q35B 1YZ9A 2DGCA 4OOGC 2VE7C 2EN2A 1PJQA 4BMJA 2EOYA 2JVAA 2LVHA 4DV4E 3P1XA 2EOOA 2LUPB 2E72A 5KL5A 4LFCE 2JOBA 2RSMA 4P7DA 4I8OA 2RQLA 2RS7A 4AQYE 4DR5E 2MC6A 4R2SA 1IBLE 2EL6A 1TF6A 2E5LE 2UXDE 2ELZA 1KJKA 1A1LA 4R2DA 1UBDC 5F3WA 1MEYC 2L2KB 2ZM6E 4DV7E 2CTDA 3F6GA 2KOUA 2Q8UA 5AE1A 2VQEE 1YYKA 3C4BA 2LV2A 2EM7A 1NCSA 5LLQA 2EMHA 2V86A 3K6QA 1JK1A 4DR1E 1GTKA 2LE2A 4J8ZA 3J7AG 2V87A 2YTJA 1IQOA 4M0VA 3RV0A 5LMNE 2UUAE 2HGHA 4L8NA 4DV3E 4JI5E 2D9HA 2L3JA 2EM8A 2EB1A 2JP9A 2LTSA 1B69A 1YYOA 1RMDA 4GKJE 1WHNA 1GQEA 1I94E 1FJGE 1WHQA 3JTZA 3VYYA 2EPCA 2EM0A 4ZYEA 2F4VE 2YWQA 4F9AB 2EMIA 2EMXA 4DV0E 3LLHA 5A6JA 1FKAE 4JI0E 1X5WA 2EM5A 3BIDA 2EMZA 4BC7A 2EM3A 3VK6A 1SFEA 2EN1A 5A6BD 3DJWA 4FK5C 3ECRA 4JI3E 2N3HA 1A1IA 2CPNA 4JI6E 4RHBB 4WPYA 2DLQA 2EPNA 1J26A 2KHXA 4BCAA 2B3TB 4MLQA 2UUBE 2VF1A 4DKKA 4O4KA 3RMPA 2EOIA 1PJTA 1RQ0A 4KWYA 2YTPA 3KZYA 5KL4A 4BBYA 4X66E 2EMBA 2L3CA 2KONA 4R03A 2BB8A 2YT4A 2JPAA 2EM6A 1A1JA 4R2QA 2YSOA 3KWRA 2HHHE 1IBKE 4X65E 5CFFE 2DSYA 4NZVA 1IMUA 1KYQA 1U61A 1J5EE 2VRDA 1X49A 1DGCA 1BBOA 1ZR9A 2WCC3 2EWLA 2F8BA 5T6JA 5A6AA 1LLMC 1QNTA 1HNXE 2EN3A 2R76A 4LF8E 4DMIA 4K0KE 4ZYHA 2LJUA 1PKPA 1HNWE 2MDRA 1RC5A 5A2QC 1T39A 1N32E 1AH5A 2LTRA 4YHHE 3IWCA 1XNQE 3J80C 4F9CB 2JYAA 2M4IA 3IWDA 3J7Yp 5KL3A 4L5NC 2ODRC 3L00A 2YSPA 3C6KA 4R2PA 2YTOA 2ODRD 1STUA 2YPNA 2EPOA 2BBGA 1A1HA 2YTDA 1F2IG 3FIGA 2DRPA 4KZSA 4DR2E 1QU6A 1G2FC 4JI4E 1YSAC 2YTEA 4LFBE 1YUJA 4DUYE 4WSPA 5IT9C 2L6MA 2V83A 1X6EA 5A6BA 4B3TE 3BBGA 4LF9E 4JI7E 4WSGA 3MHHC 4F6MA 1WRJA 4X62E 5AE2A 4LF7E 2V88A 1XMOE 1EKZA 3BGHA 2V85A 2B9DA 1BBGA 2WBTA 2EQ3A 1NEIA 2JOXA 2EPXA 2FGGA 2B7VA 1EH8A 2FV4B 2EOSA 2ADRA 4JI1E 5KL2A 3QG5C 1WJPA 2EZ6A 4KHPE 2E1MA 3T1HE 2GHFA 4R2EA 1N34E 4JI2E 1YUIA 1UILA 4NHRA 4OUNA 1HR0E 2M1SA 2EOXA 1T4OA 3EPKA 2A11A 2EMCA 3ADIA 2UXCE 2L2NA 2EOZA 4GZNC 2LCEA 2YTFA 1A1GA 3RV1A 2M7QA 4M2ZA 2EOHA 1HNZE 1XNRE 4IJDA 3T1YE 2YZTA 2EN7A 1O0WA 2K4VA 1EH7A 2YTIA 3M99B 2EQ1A 2EPKX 2L92A 3EQ1A 5A6KA 1A1FA 2UU9E 4LF6E 1UN6B 3THNA 4O24A 4LTYA 1XMQE 3O2RB 4DR3E 2DIXA 4X8WA 3VHTB 3AV0A 2EPZA 1X47A 3IWBA 3HXLA 3F6HA 2YRMA 1T38A 4IS1C 3JU0A 1PJSA 2LT7A 2FFLA 2A25A 2ENAA 2N8XA 4LU9A 1ZBQA 3C6MA 3H09A 2UXBE 2PRTA 2K7IA 4ZYGA 2ENHA 2DLKA 5KL7A 4F6NA 2WZOA 3HPZA 4P78A 2DMIA 2EL4A 3N3WA 5IXMB 2MC5A 2FTXB 2EPMX 2V8QB 1T4LB 1TF3A 4GKKE 2MDGA 1DI2A 4DV2E 4BC9A 1MGTA 2EM2A 2EPPA 2L2MA 1N33E 2LUQA 2LBSB 2EMAA 4WXCA 5AE3A 1WXRA 1JK2A 2LO3A 2B7TA 2EMGA 4TUGA 4DUZE 4DR6E 2EMKA 1UHZA 2EPUA 1TN9A 3THOB 4WX9A 4B3SE 2EN8A 3LMLA 4ZYDA 3HQ1A 4RH8A 3BF2A 2EMWA 4DV6E 3MSWA 2MKNA 4F9BB 1P47A 5TSEA 3ZOQB 2HJJA 4O43A 2WBSA 5IV8B 4JV5E 1JFZA 2EOJA 3O2RA 5BR8E 4O5GA 1YFHA 4BS9A 2M9AA 4F2JC 1ZBTA 2JXPA 1N36E 2NUEA 1PDAA 4B3ME 4JI8E 2I9IA 2EE8A 4R2AA 4N4RB 4Q28A 1A1KA 1X6HA 3ADJA 2V89A 2EOQA 3HTXA 4DV1E 4GEQB 5ADZA 2EOFA 1IBME 2EM4A 2YTQA 4TUIA 2NA2A 4LFAE 2EOEA 3ADLA 4DV5E 4BHCA 2DMYA 4DR7E 2GSLA 1YPNA 2UUCE 2CT1A 5A69A 2CSHA 1X6FA 1X48A 1I4SA 4X64E 2R1FA 5DNYA 2I13A 4LF4E 3OTOE 2EN4A 2EQ0A 3MHSC 1ZAAC 2LMZA 2NABA 2RPCA 2EL5A 2L33A 1G2DC 1N3GA 1EH6A 4M30A 2ENCA
chains in the Genus database with same CATH topology
5A2QC 2MDRA 1N32E 2LTRA 2FFLA 3C4TA 2LRSA 3ADGA 3IWCA 4LU9A 1ZBQA 2V86A 4F54A 3K6QA 5IWAE 2RTXA 3H09A 3J80C 4F9CB 4DR1E 2LE2A 4J8ZA 3J7AG 2UXBE 4OX9E 2V87A 2M4IA 3IWDA 3J7Yp 4L5NC 2ODRC 2JY9A 4R8OA 4M0VA 3RV0A 1RC7A 2WZOA 3HPZA 5LMNE 2UUAE 2JWOA 4P78A 4L8NA 3N3WA 2MC5A 1DQ3A 2FTXB 1STUA 2ODRD 5FLXC 2V8QB 1T4LB 2DB2A 4GKKE 1T4NA 3FIGA 4DV3E 4KZSA 4JI5E 4DR2E 2L3JA 2L8TA 1DI2A 3JAMC 4DV2E 4BC9A 2EB1A 2L2MA 2NUGA 2LTSA 1QU6A 4JI4E 1YYOA 1N33E 3HPSA 2LJHA 3J81C 2LUQA 4GKJE 1WHNA 4LFBE 4DUYE 4WSPA 2LBSB 4YY3E 1GQEA 5IT9C 1I94E 2L6MA 5AE3A 2V83A 1WXRA 5AASA 1FJGE 4B3TE 2N3GA 1WHQA 3JTZA 3VYYA 2JR1A 4LF9E 4JI7E 2F4VE 3VYXA 4F9AB 2B7TA 4DV0E 4X62E 4TUGA 4DUZE 3DF6A 2NUFA 5AE2A 2V88A 1XMOE 1EKZA 4LF7E 4DR6E 1UHZA 2V85A 2B9DA 3LLHA 1FKAE 4JI0E 3OMLA 2JOXA 2G7HA 4B3SE 3LMLA 5LL6R 4DR4E 2H36X 3HQ1A 4DV6E 4BC7A 3VK6A 3MSWA 3AUZA 2FGGA 4LF5E 1J26A 2B7VA 4F9BB 2FV4B 2IHR1 2VQFE 3DJWA 1XNQE 3ZOQB 4JI3E 2N3HA 4WYQB 2CPNA 4JI1E 4JI6E 4WPYA 4JV5E 5LMUE 1JFZA 3O2RA 3JU0A 2EZ6A 4WFTA 5BR8E 2KHXA 1YYWA 2E1MA 2RS6A 4BCAA 4KHPE 3T1HE 1N34E 2B3TB 2UUBE 4JI2E 2QVWA 2VF1A 1UILA 4DKKA 4BS9A 4OUNA 1HR0E 3RMPA 2M1SA 1ZBTA 1RQ0A 1SR9A 2NUEA 1N36E 4NXNE 4B3RE 4B3ME 4JYAE 4JI8E 1GZ6A 1T4OA 4BBYA 1YZ9A 2A11A 4OOGC 4Q28A 2VE7C 2L2NA 4X66E 3ADIA 2UXCE 4BMJA 3ADJA 2V89A 4YHHE 3HTXA 2L3CA 2JVAA 2KONA 4R03A 3RV1A 3P1XA 4GEQB 2M7QA 5ADZA 4DV1E 4DV4E 2LUPB 1IBME 4M2ZA 2YT4A 1HNZE 4TUIA 4LFCE 1XNRE 2NA2A 4LFAE 3ADLA 3KWRA 2HHHE 2JOBA 1IBKE 2RSMA 4DV5E 4X65E 3T1YE 2DMYA 2DSYA 5CFFE 4P7DA 4I8OA 4DR7E 2GSLA 2YZTA 1O0WA 2UUCE 2RS7A 2K4VA 1U61A 4AQYE 1J5EE 4DR5E 2MC6A 1X49A 1IBLE 2E5LE 2UXDE 1X48A 4LF6E 2L92A 2UU9E 1I4SA 2EWLA 2F8BA 4LTYA 5T6JA 5DNYA 4X64E 5F3WA 3O2RB 1XMQE 4DR3E 2DIXA 2L2KB 4X8WA 2ZM6E 3AV0A 4NXME 1HNXE 3OTOE 4LF4E 4LF8E 4DMIA 2LMZA 4DV7E 4K0KE 1PKPA 1X47A 3F6GA 3HXLA 3IWBA 3F6HA 1HNWE 2L33A 2KOUA 4M30A 5AE1A 2VQEE 1YYKA 3C4BA 1RC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N32 E;  2LTR A;  2FFL A;  3C4T A;  2LRS A;  3ADG A;  4YHH E;  5IWA E;  1XNQ E;  2RTX A;  4DR1 E;  2UXB E;  4OX9 E;  3J7Y p;  2JY9 A;  3RV0 A;  1RC7 A;  5LMN E;  2UUA E;  3N3W A;  1STU A;  1T4L B;  2DB2 A;  4GKK E;  1T4N A;  4DV3 E;  4JI5 E;  4DR2 E;  2L3J A;  1DI2 A;  4DV2 E;  2EB1 A;  2L2M A;  2NUG A;  2LTS A;  1QU6 A;  1YYK A;  1YYO A;  4JI4 E;  1N33 E;  2LJH A;  4GKJ E;  2LUQ A;  1WHN A;  4LFB E;  4DUY E;  2LBS B;  4YY3 E;  1GQE A;  1I94 E;  1FJG E;  4B3T E;  2N3G A;  1WHQ A;  3VYY A;  4LF9 E;  4JI7 E;  2F4V E;  3VYX A;  2B7T A;  4DV0 E;  4X62 E;  4DUZ E;  4NXM E;  2NUF A;  4LF7 E;  1EKZ A;  1XMO E;  4DR6 E;  1UHZ A;  3LLH A;  1FKA E;  4JI0 E;  4B3S E;  4DR4 E;  4DV6 E;  4LF5 E;  2B7V A;  2IHR 1;  2VQF E;  4JI3 E;  2N3H A;  4WYQ B;  2CPN A;  4JI1 E;  4JI6 E;  4JV5 E;  5LMU E;  1JFZ A;  3O2R A;  5BR8 E;  2EZ6 A;  4WFT A;  4KHP E;  2KHX A;  1YYW A;  1J26 A;  2RS6 A;  3T1H E;  1N34 E;  2B3T B;  2UUB E;  4JI2 E;  2QVW A;  1UIL A;  4DKK A;  4OUN A;  1HR0 E;  1ZBT A;  1RQ0 A;  1N36 E;  2NUE A;  4NXN E;  4B3R E;  4B3M E;  4JYA E;  4JI8 E;  1T4O A;  1YZ9 A;  2A11 A;  4OOG C;  3ADI A;  4X66 E;  2L2N A;  2UXC E;  3ADJ A;  3HTX A;  2L3C A;  2JVA A;  3RV1 A;  3P1X A;  4DV1 E;  4DV4 E;  1IBM E;  2LUP B;  4M2Z A;  2YT4 A;  1HNZ E;  4LFC E;  1XNR E;  2NA2 A;  4LFA E;  3ADL A;  2HHH E;  1IBK E;  2RSM A;  4DV5 E;  4X65 E;  3T1Y E;  2DMY A;  5CFF E;  4DR7 E;  2GSL A;  1O0W A;  2UUC E;  2RS7 A;  1U61 A;  4AQY E;  1J5E E;  4DR5 E;  1X49 A;  1IBL E;  2E5L E;  2UXD E;  1X48 A;  4LF6 E;  2UU9 E;  1I4S A;  1XMQ E;  4X64 E;  3O2R B;  4DR3 E;  2DIX A;  2L2K B;  4X8W A;  2ZM6 E;  1HNX E;  3OTO E;  4LF4 E;  4LF8 E;  4DV7 E;  4K0K E;  1PKP A;  1X47 A;  1HNW E;  2L33 A;  4M30 A;  2VQE E;  2MDR A;  3C4B A;  1RC5 A; 
#chains in the Genus database with same CATH topology
 2EML A;  2YU8 A;  2EPR A;  2LRS A;  3C4T A;  3ADG A;  4F54 A;  4X9J A;  2YU5 A;  5IWA E;  2RTX A;  2EM9 A;  4OX9 E;  2EOM A;  2EPL X;  1IQS A;  2JY9 A;  4R8O A;  1AAY A;  1RC7 A;  5AC4 A;  2JWO A;  1DQ3 A;  2EPA A;  5FLX C;  3UK3 C;  2DB2 A;  1T4N A;  2L8T A;  3JAM C;  2EN6 A;  2NUG A;  1ZTD A;  3HPS A;  2LJH A;  3J81 C;  3EPH A;  4M9V C;  4YY3 E;  4HEI A;  5AAS A;  2N3G A;  2J7J A;  2JR1 A;  3EPJ A;  3VYX A;  1Z1B A;  4NXM E;  3DF6 A;  2NUF A;  4R2C A;  2WBU A;  4MLV A;  3KZZ A;  3OML A;  2YRH A;  2G7H A;  3EPL A;  4DR4 E;  5LL6 R;  2EOR A;  2H36 X;  2EMY A;  2RSI A;  4BHB A;  2ELY A;  1X3C A;  3AUZ A;  4LF5 E;  2IHR 1;  2VQF E;  2YTN A;  1L4S A;  4WYQ B;  2EMF A;  2GPI A;  2GLI A;  3TQM A;  5KL6 A;  5AC5 A;  5LMU E;  2HC5 A;  4WFT A;  1YYW A;  2YRK A;  2RS6 A;  2YTG A;  2EP3 A;  4R2R A;  4HTG A;  2QVW A;  2EJ4 A;  4WXD A;  1ZU1 A;  1BB8 A;  1SR9 A;  2MKD A;  4NXN E;  4B3R E;  4JYA E;  1GZ6 A;  4Q35 B;  1YZ9 A;  2DGC A;  4OOG C;  2VE7 C;  2EN2 A;  1PJQ A;  4BMJ A;  2EOY A;  2JVA A;  2LVH A;  4DV4 E;  3P1X A;  2EOO A;  2LUP B;  2E72 A;  5KL5 A;  4LFC E;  2JOB A;  2RSM A;  4P7D A;  4I8O A;  2RQL A;  2RS7 A;  4AQY E;  4DR5 E;  2MC6 A;  4R2S A;  1IBL E;  2EL6 A;  1TF6 A;  2E5L E;  2UXD E;  2ELZ A;  1KJK A;  1A1L A;  4R2D A;  1UBD C;  5F3W A;  1MEY C;  2L2K B;  2ZM6 E;  4DV7 E;  2CTD A;  3F6G A;  2KOU A;  2Q8U A;  5AE1 A;  2VQE E;  1YYK A;  3C4B A;  2LV2 A;  2EM7 A;  1NCS A;  5LLQ A;  2EMH A;  2V86 A;  3K6Q A;  1JK1 A;  4DR1 E;  1GTK A;  2LE2 A;  4J8Z A;  3J7A G;  2V87 A;  2YTJ A;  1IQO A;  4M0V A;  3RV0 A;  5LMN E;  2UUA E;  2HGH A;  4L8N A;  4DV3 E;  4JI5 E;  2D9H A;  2L3J A;  2EM8 A;  2EB1 A;  2JP9 A;  2LTS A;  1B69 A;  1YYO A;  1RMD A;  4GKJ E;  1WHN A;  1GQE A;  1I94 E;  1FJG E;  1WHQ A;  3JTZ A;  3VYY A;  2EPC A;  2EM0 A;  4ZYE A;  2F4V E;  2YWQ A;  4F9A B;  2EMI A;  2EMX A;  4DV0 E;  3LLH A;  5A6J A;  1FKA E;  4JI0 E;  1X5W A;  2EM5 A;  3BID A;  2EMZ A;  4BC7 A;  2EM3 A;  3VK6 A;  1SFE A;  2EN1 A;  5A6B D;  3DJW A;  4FK5 C;  3ECR A;  4JI3 E;  2N3H A;  1A1I A;  2CPN A;  4JI6 E;  4RHB B;  4WPY A;  2DLQ A;  2EPN A;  1J26 A;  2KHX A;  4BCA A;  2B3T B;  4MLQ A;  2UUB E;  2VF1 A;  4DKK A;  4O4K A;  3RMP A;  2EOI A;  1PJT A;  1RQ0 A;  4KWY A;  2YTP A;  3KZY A;  5KL4 A;  4BBY A;  4X66 E;  2EMB A;  2L3C A;  2KON A;  4R03 A;  2BB8 A;  2YT4 A;  2JPA A;  2EM6 A;  1A1J A;  4R2Q A;  2YSO A;  3KWR A;  2HHH E;  1IBK E;  4X65 E;  5CFF E;  2DSY A;  4NZV A;  1IMU A;  1KYQ A;  1U61 A;  1J5E E;  2VRD A;  1X49 A;  1DGC A;  1BBO A;  1ZR9 A;  2WCC 3;  2EWL A;  2F8B A;  5T6J A;  5A6A A;  1LLM C;  1QNT A;  1HNX E;  2EN3 A;  2R76 A;  4LF8 E;  4DMI A;  4K0K E;  4ZYH A;  2LJU A;  1PKP A;  1HNW E;  2MDR A;  1RC5 A;  5A2Q C;  1T39 A;  1N32 E;  1AH5 A;  2LTR A;  4YHH E;  3IWC A;  1XNQ E;  3J80 C;  4F9C B;  2JYA A;  2M4I A;  3IWD A;  3J7Y p;  5KL3 A;  4L5N C;  2ODR C;  3L00 A;  2YSP A;  3C6K A;  4R2P A;  2YTO A;  2ODR D;  1STU A;  2YPN A;  2EPO A;  2BBG A;  1A1H A;  2YTD A;  1F2I G;  3FIG A;  2DRP A;  4KZS A;  4DR2 E;  1QU6 A;  1G2F C;  4JI4 E;  1YSA C;  2YTE A;  4LFB E;  1YUJ A;  4DUY E;  4WSP A;  5IT9 C;  2L6M A;  2V83 A;  1X6E A;  5A6B A;  4B3T E;  3BBG A;  4LF9 E;  4JI7 E;  4WSG A;  3MHH C;  4F6M A;  1WRJ A;  4X62 E;  5AE2 A;  4LF7 E;  2V88 A;  1XMO E;  1EKZ A;  3BGH A;  2V85 A;  2B9D A;  1BBG A;  2WBT A;  2EQ3 A;  1NEI A;  2JOX A;  2EPX A;  2FGG A;  2B7V A;  1EH8 A;  2FV4 B;  2EOS A;  2ADR A;  4JI1 E;  5KL2 A;  3QG5 C;  1WJP A;  2EZ6 A;  4KHP E;  2E1M A;  3T1H E;  2GHF A;  4R2E A;  1N34 E;  4JI2 E;  1YUI A;  1UIL A;  4NHR A;  4OUN A;  1HR0 E;  2M1S A;  2EOX A;  1T4O A;  3EPK A;  2A11 A;  2EMC A;  3ADI A;  2UXC E;  2L2N A;  2EOZ A;  4GZN C;  2LCE A;  2YTF A;  1A1G A;  3RV1 A;  2M7Q A;  4M2Z A;  2EOH A;  1HNZ E;  1XNR E;  4IJD A;  3T1Y E;  2YZT A;  2EN7 A;  1O0W A;  2K4V A;  1EH7 A;  2YTI A;  3M99 B;  2EQ1 A;  2EPK X;  2L92 A;  3EQ1 A;  5A6K A;  1A1F A;  2UU9 E;  4LF6 E;  1UN6 B;  3THN A;  4O24 A;  4LTY A;  1XMQ E;  3O2R B;  4DR3 E;  2DIX A;  4X8W A;  3VHT B;  3AV0 A;  2EPZ A;  1X47 A;  3IWB A;  3HXL A;  3F6H A;  2YRM A;  1T38 A;  4IS1 C;  3JU0 A;  1PJS A;  2LT7 A;  2FFL A;  2A25 A;  2ENA A;  2N8X A;  4LU9 A;  1ZBQ A;  3C6M A;  3H09 A;  2UXB E;  2PRT A;  2K7I A;  4ZYG A;  2ENH A;  2DLK A;  5KL7 A;  4F6N A;  2WZO A;  3HPZ A;  4P78 A;  2DMI A;  2EL4 A;  3N3W A;  5IXM B;  2MC5 A;  2FTX B;  2EPM X;  2V8Q B;  1T4L B;  1TF3 A;  4GKK E;  2MDG A;  1DI2 A;  4DV2 E;  4BC9 A;  1MGT A;  2EM2 A;  2EPP A;  2L2M A;  1N33 E;  2LUQ A;  2LBS B;  2EMA A;  4WXC A;  5AE3 A;  1WXR A;  1JK2 A;  2LO3 A;  2B7T A;  2EMG A;  4TUG A;  4DUZ E;  4DR6 E;  2EMK A;  1UHZ A;  2EPU A;  1TN9 A;  3THO B;  4WX9 A;  4B3S E;  2EN8 A;  3LML A;  4ZYD A;  3HQ1 A;  4RH8 A;  3BF2 A;  2EMW A;  4DV6 E;  3MSW A;  2MKN A;  4F9B B;  1P47 A;  5TSE A;  3ZOQ B;  2HJJ A;  4O43 A;  2WBS A;  5IV8 B;  4JV5 E;  1JFZ A;  2EOJ A;  3O2R A;  5BR8 E;  4O5G A;  1YFH A;  4BS9 A;  2M9A A;  4F2J C;  1ZBT A;  2JXP A;  1N36 E;  2NUE A;  1PDA A;  4B3M E;  4JI8 E;  2I9I A;  2EE8 A;  4R2A A;  4N4R B;  4Q28 A;  1A1K A;  1X6H A;  3ADJ A;  2V89 A;  2EOQ A;  3HTX A;  4DV1 E;  4GEQ B;  5ADZ A;  2EOF A;  1IBM E;  2EM4 A;  2YTQ A;  4TUI A;  2NA2 A;  4LFA E;  2EOE A;  3ADL A;  4DV5 E;  4BHC A;  2DMY A;  4DR7 E;  2GSL A;  1YPN A;  2UUC E;  2CT1 A;  5A69 A;  2CSH A;  1X6F A;  1X48 A;  1I4S A;  4X64 E;  2R1F A;  5DNY A;  2I13 A;  4LF4 E;  3OTO E;  2EN4 A;  2EQ0 A;  3MHS C;  1ZAA C;  2LMZ A;  2NAB A;  2RPC A;  2EL5 A;  2L33 A;  1G2D C;  1N3G A;  1EH6 A;  4M30 A;  2ENC A; 
#chains in the Genus database with same CATH homology
 5A2Q C;  2MDR A;  1N32 E;  2LTR A;  2FFL A;  3C4T A;  2LRS A;  3ADG A;  3IWC A;  4LU9 A;  1ZBQ A;  2V86 A;  4F54 A;  3K6Q A;  5IWA E;  2RTX A;  3H09 A;  3J80 C;  4F9C B;  4DR1 E;  2LE2 A;  4J8Z A;  3J7A G;  2UXB E;  4OX9 E;  2V87 A;  2M4I A;  3IWD A;  3J7Y p;  4L5N C;  2ODR C;  2JY9 A;  4R8O A;  4M0V A;  3RV0 A;  1RC7 A;  2WZO A;  3HPZ A;  5LMN E;  2UUA E;  2JWO A;  4P78 A;  4L8N A;  3N3W A;  2MC5 A;  1DQ3 A;  2FTX B;  1STU A;  2ODR D;  5FLX C;  2V8Q B;  1T4L B;  2DB2 A;  4GKK E;  1T4N A;  3FIG A;  4DV3 E;  4KZS A;  4JI5 E;  4DR2 E;  2L3J A;  2L8T A;  1DI2 A;  3JAM C;  4DV2 E;  4BC9 A;  2EB1 A;  2L2M A;  2NUG A;  2LTS A;  1QU6 A;  4JI4 E;  1YYO A;  1N33 E;  3HPS A;  2LJH A;  3J81 C;  2LUQ A;  4GKJ E;  1WHN A;  4LFB E;  4DUY E;  4WSP A;  2LBS B;  4YY3 E;  1GQE A;  5IT9 C;  1I94 E;  2L6M A;  5AE3 A;  2V83 A;  1WXR A;  5AAS A;  1FJG E;  4B3T E;  2N3G A;  1WHQ A;  3JTZ A;  3VYY A;  2JR1 A;  4LF9 E;  4JI7 E;  2F4V E;  3VYX A;  4F9A B;  2B7T A;  4DV0 E;  4X62 E;  4TUG A;  4DUZ E;  3DF6 A;  2NUF A;  5AE2 A;  2V88 A;  1XMO E;  1EKZ A;  4LF7 E;  4DR6 E;  1UHZ A;  2V85 A;  2B9D A;  3LLH A;  1FKA E;  4JI0 E;  3OML A;  2JOX A;  2G7H A;  4B3S E;  3LML A;  5LL6 R;  4DR4 E;  2H36 X;  3HQ1 A;  4DV6 E;  4BC7 A;  3VK6 A;  3MSW A;  3AUZ A;  2FGG A;  4LF5 E;  1J26 A;  2B7V A;  4F9B B;  2FV4 B;  2IHR 1;  2VQF E;  3DJW A;  1XNQ E;  3ZOQ B;  4JI3 E;  2N3H A;  4WYQ B;  2CPN A;  4JI1 E;  4JI6 E;  4WPY A;  4JV5 E;  5LMU E;  1JFZ A;  3O2R A;  3JU0 A;  2EZ6 A;  4WFT A;  5BR8 E;  2KHX A;  1YYW A;  2E1M A;  2RS6 A;  4BCA A;  4KHP E;  3T1H E;  1N34 E;  2B3T B;  2UUB E;  4JI2 E;  2QVW A;  2VF1 A;  1UIL A;  4DKK A;  4BS9 A;  4OUN A;  1HR0 E;  3RMP A;  2M1S A;  1ZBT A;  1RQ0 A;  1SR9 A;  2NUE A;  1N36 E;  4NXN E;  4B3R E;  4B3M E;  4JYA E;  4JI8 E;  1GZ6 A;  1T4O A;  4BBY A;  1YZ9 A;  2A11 A;  4OOG C;  4Q28 A;  2VE7 C;  2L2N A;  4X66 E;  3ADI A;  2UXC E;  4BMJ A;  3ADJ A;  2V89 A;  4YHH E;  3HTX A;  2L3C A;  2JVA A;  2KON A;  4R03 A;  3RV1 A;  3P1X A;  4GEQ B;  2M7Q A;  5ADZ A;  4DV1 E;  4DV4 E;  2LUP B;  1IBM E;  4M2Z A;  2YT4 A;  1HNZ E;  4TUI A;  4LFC E;  1XNR E;  2NA2 A;  4LFA E;  3ADL A;  3KWR A;  2HHH E;  2JOB A;  1IBK E;  2RSM A;  4DV5 E;  4X65 E;  3T1Y E;  2DMY A;  2DSY A;  5CFF E;  4P7D A;  4I8O A;  4DR7 E;  2GSL A;  2YZT A;  1O0W A;  2UUC E;  2RS7 A;  2K4V A;  1U61 A;  4AQY E;  1J5E E;  4DR5 E;  2MC6 A;  1X49 A;  1IBL E;  2E5L E;  2UXD E;  1X48 A;  4LF6 E;  2L92 A;  2UU9 E;  1I4S A;  2EWL A;  2F8B A;  4LTY A;  5T6J A;  5DNY A;  4X64 E;  5F3W A;  3O2R B;  1XMQ E;  4DR3 E;  2DIX A;  2L2K B;  4X8W A;  2ZM6 E;  3AV0 A;  4NXM E;  1HNX E;  3OTO E;  4LF4 E;  4LF8 E;  4DMI A;  2LMZ A;  4DV7 E;  4K0K E;  1PKP A;  1X47 A;  3F6G A;  3HXL A;  3IWB A;  3F6H A;  1HNW E;  2L33 A;  2KOU A;  4M30 A;  5AE1 A;  2VQE E;  1YYK A;  3C4B A;  1RC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...