4M30A

Crystal structure of rnase iii complexed with double-stranded rna and amp (type ii cleavage)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
220
structure length
220
Chain Sequence
KMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease 3
publication title RNase III: Genetics and Function; Structure and Mechanism.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
total genus 78
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 4m30A01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4m30A02
3N3WA 4JI6E 1WHQA 5IWAE 3HTXA 4LF4E 2RTXA 4X64E 1YYOA 2LBSB 1J5EE 2B7TA 2L2NA 4LF5E 2LJHA 4OOGC 2QVWA 1O0WA 4M2ZA 2YT4A 4X8WA 1FJGE 1N33E 1IBLE 1YYKA 2CPNA 4DV5E 3P1XA 5BR8E 4OX9E 1HNZE 4LF7E 4DV2E 2LUPB 1U61A 4YHHE 1T4NA 1I94E 1XNQE 4JYAE 4JI5E 2UXCE 4K0KE 1HNWE 2GSLA 2LTRA 2JY9A 3VYXA 2UUAE 4LF6E 4DR4E 1YYWA 4DV6E 4LF9E 1ZBTA 1XNRE 3T1HE 4DR3E 1RC7A 4X65E 2DB2A 4NXNE 1UILA 4JI4E 4AQYE 4LFBE 4WFTA 2VQEE 4DV3E 4NXME 4JI3E 2NUEA 1XMOE 2L3JA 4JI8E 2NUFA 1X49A 2MDRA 3RV1A 4GKJE 1HR0E 4DR2E 4B3TE 2RS7A 1T4LB 1X47A 1X48A 4M30A 1PKPA 4B3RE 2LTSA 2EZ6A 4B3ME 4JI2E 1FKAE 4DUZE 1XMQE 4YY3E 1IBME 3ADGA 2KHXA 2UXDE 4JV5E 4DV7E 3ADJA 2IHR1 3LLHA 2VQFE 4LFAE 2L3CA 2B7VA 2L2KB 4WYQB 4DR7E 4X66E 2UXBE 2B3TB 1RQ0A 5LMNE 1GQEA 1N34E 4JI1E 4JI7E 4B3SE 4X62E 2EB1A 4LFCE 1UHZA 2RSMA 2LRSA 1J26A 3C4BA 1N36E 2N3HA 1EKZA 2DIXA 1WHNA 5LMUE 2N3GA 4DUYE 4KHPE 2A11A 2LUQA 2NUGA 4GKKE 4DR6E 3VYYA 3OTOE 1STUA 2L2MA 4DV1E 2JVAA 2FFLA 1I4SA 4DR1E 4DV4E 2UUBE 3C4TA 4JI0E 2F4VE 1RC5A 3O2RA 3O2RB 4DV0E 4DR5E 1YZ9A 2DMYA 1QU6A 1T4OA 4DKKA 2UU9E 3RV0A 3ADIA 2ZM6E 2NA2A 4LF8E 3T1YE 3ADLA 1N32E 1HNXE 2E5LE 2L33A 2HHHE 1DI2A 2RS6A 5CFFE 2UUCE 3J7Yp 1JFZA 4OUNA 1IBKE
chains in the Genus database with same CATH superfamily
3N3WA 2LO3A 4JI6E 5IWAE 3HTXA 5A6KA 2CTDA 4LF4E 4X64E 1X3CA 2ENHA 2BBGA 5AC5A 4LF5E 1O0WA 1N33E 2YT4A 4X8WA 1YSAC 1HNZE 2EN2A 2EQ0A 2LUPB 2EPXA 2RPCA 5KL4A 2LVHA 4JI5E 2ENAA 5KL5A 2ADRA 2ODRD 2EORA 2EE8A 2JY9A 2WBSA 4R2DA 3LMLA 2EL5A 4M0VA 2CSHA 4DR3E 4X65E 2DB2A 5IXMB 4NHRA 2LJUA 3BF2A 2NUEA 1KYQA 4JI8E 5IT9C 4R2EA 3RV1A 1HR0E 2JOXA 2M9AA 2YRKA 2FTXB 4BC9A 2EN3A 5KL2A 1PJTA 4R2CA 2RQLA 1PKPA 2MC5A 4B3RE 4GEQB 2Q8UA 1FKAE 1BBOA 4WXCA 3ADJA 3LLHA 2IHR1 4NZVA 2L3CA 2B7VA 2L2KB 2EPAA 3VK6A 2DLQA 2UXBE 1GQEA 2JOBA 4LTYA 2EB1A 4L5NC 2MKDA 2LRSA 3C4BA 2YRHA 4RHBB 2R76A 4F9CB 1PJQA 2EJ4A 2EQ3A 3EPKA 2EOOA 2EPMX 2V87A 2A11A 4O5GA 4RH8A 3J80C 3HXLA 3VYYA 2L2MA 2YTQA 2YTPA 2L92A 4DV1E 1G2DC 1I4SA 4DR1E 2MDGA 2YSPA 3THOB 1UN6B 4JI0E 2F4VE 1IMUA 1RC5A 2JWOA 2L6MA 2D9HA 4DV0E 2EM6A 1YZ9A 2DMYA 3ADIA 3KZZA 2ZM6E 3IWBA 2YSOA 4TUIA 1YPNA 2EMYA 1L4SA 2LV2A 1A1HA 2RSIA 2M1SA 2JPAA 2FV4B 2JYAA 3AV0A 2LBSB 1J5EE 2F8BA 2MC6A 4FK5C 4MLQA 1FJGE 2ODRC 2CPNA 3P1XA 4OX9E 4O43A 2BB8A 2EQ1A 1DGCA 4BS9A 4YHHE 3THNA 4Q28A 3IWDA 2YRMA 1HNWE 1GZ6A 2EOXA 2GSLA 3H09A 4R8OA 2JP9A 2UUAE 4DR4E 2EPNA 1YYWA 4F9AB 4DV6E 5A69A 4LF9E 1XNRE 3UK3C 3AUZA 3JTZA 2VQEE 4DV3E 1JK1A 2EMGA 3IWCA 2EM8A 4O4KA 2L3JA 4GZNC 1Z1BA 2GHFA 4MLVA 2NUFA 2MDRA 1UBDC 5A6BA 2I9IA 3FIGA 1G2FC 1TN9A 1EH6A 5KL3A 4M30A 4LU9A 5A6JA 5AE1A 4KWYA 3C6KA 1ZBQA 4I8OA 1N3GA 4R2SA 2UXDE 4DV7E 3OMLA 2V89A 2DRPA 4WYQB 1DQ3A 4F54A 5DNYA 2B3TB 1A1IA 2WZOA 2EPLX 4F6MA 5LMNE 1EH7A 5TSEA 2DGCA 2EN1A 2YU5A 2EN7A 1P47A 1JK2A 1GTKA 2J7JA 4O24A 2MKNA 3BGHA 2V86A 5LLQA 1A1KA 1X5WA 1NEIA 2YTOA 3M99B 1BBGA 2EOJA 3EPHA 2EMHA 4GKKE 3HPSA 4DR6E 2YTGA 4WSPA 3J7AG 2EL4A 2JVAA 2FFLA 2LCEA 2M4IA 2EL6A 2B9DA 3O2RB 4DR5E 2EMFA 1T4OA 2EOFA 2HC5A 2NA2A 2DLKA 1N32E 1ZTDA 4KZSA 1QNTA 2E5LE 2EOMA 2HHHE 1DI2A 5CFFE 4M9VC 3J7Yp 2KONA 2VE7C 2EPKX 1JFZA 2NABA 2YWQA 4OUNA 4BHCA 4BMJA 5ADZA 2RTXA 2B7TA 2L2NA 1A1LA 4OOGC 5IV8B 4M2ZA 1IBLE 3HQ1A 4DV5E 4N4RB 4LF7E 4DV2E 2VF1A 1U61A 1T4NA 1I94E 1YFHA 1XNQE 4JYAE 2WBUA 3JAMC 4K0KE 3EPJA 5F3WA 4J8ZA 4TUGA 4LF6E 2EMIA 3F6GA 2EM3A 3EPLA 1ZBTA 3T1HE 1RC7A 2YTNA 2WCC3 1UILA 4LFBE 3TQMA 4AQYE 1A1JA 4WFTA 4HTGA 1KJKA 4NXME 2EMZA 3RMPA 2FGGA 4P78A 2LMZA 5FLXC 1X49A 2EOYA 2G7HA 4R2PA 2EN4A 4ZYHA 3C6MA 4DR2E 4BBYA 4B3TE 2RS7A 1X47A 2EPRA 5AE3A 2YU8A 4HEIA 1X6HA 2EOSA 2LE2A 3ECRA 2EZ6A 4JI2E 1PDAA 1XMQE 2EM2A 4YY3E 2A25A 1ZR9A 2EM7A 4JV5E 1NCSA 4LFAE 2VQFE 3BIDA 2M7QA 3DJWA 2EOZA 5AASA 2EMAA 1RQ0A 2V88A 1MEYC 1A1FA 4JI7E 2V85A 3BBGA 4LFCE 1J26A 2WBTA 4R2QA 5A6BD 1N36E 4BHBA 2JR1A 2ENCA 2H36X 3MSWA 4IJDA 2GPIA 1X6FA 2EM5A 2HGHA 3VHTB 4DUYE 2EMKA 1SR9A 2DSYA 2NUGA 4IS1C 4ZYDA 2GLIA 3OTOE 1LLMC 5KL6A 1SFEA 3O2RA 2EP3A 2VRDA 1QU6A 4DKKA 3RV0A 2R1FA 3T1YE 2K7IA 3L00A 3QG5C 1IQOA 2EN6A 2YTIA 2UUCE 4DMIA 4F2JC 1T39A 2K4VA 4BC7A 5AE2A 4F6NA 2EMCA 2EMWA 2EM9A 1WHQA 1YYOA 2DMIA 2JXPA 2CT1A 2EPPA 2QVWA 2LJHA 1EH8A 1WRJA 2L8TA 1YUJA 2YTJA 1YYKA 2EMXA 3MHHC 5BR8E 1RMDA 2EWLA 2N8XA 2UXCE 4ZYEA 1T38A 3ZOQB 2E72A 2YPNA 2EOEA 2LTRA 2EPUA 2V8QB 2YTDA 3VYXA 4WXDA 2ELYA 2V83A 4F9BB 3EQ1A 3DF6A 5AC4A 1F2IG 4NXNE 1TF3A 5A6AA 1YUIA 4JI4E 1ZU1A 4JI3E 1XMOE 2EOHA 2EOQA 2ELZA 3MHSC 4WPYA 4GKJE 1T4LB 1WJPA 2EOIA 1X48A 2E1MA 4L8NA 2EPOA 4ZYGA 2LTSA 5KL7A 4B3ME 1A1GA 3KZYA 4DUZE 2PRTA 1IBME 3ADGA 2KHXA 4X9JA 1PJSA 3KWRA 2HJJA 4Q35B 4DR7E 4X66E 2YZTA 2EPCA 2I13A 2YTFA 1IQSA 1N34E 4JI1E 2EM0A 4B3SE 4X62E 1AH5A 1MGTA 1UHZA 2RSMA 5A2QC 1AAYA 2KOUA 1TF6A 2LT7A 1X6EA 2N3HA 3HPZA 1EKZA 2EPZA 4WSGA 1BB8A 2DIXA 1WHNA 5LMUE 2N3GA 4KHPE 2EMBA 2LUQA 2YTEA 4R03A 1STUA 2EN8A 3K6QA 4P7DA 1WXRA 1B69A 5LL6R 3JU0A 4DV4E 2UUBE 3C4TA 3J81C 4R2AA 4WX9A 4R2RA 2UU9E 4LF8E 1ZAAC 3ADLA 1HNXE 2L33A 4BCAA 2RS6A 3F6HA 5T6JA 2EMLA 2EM4A 1IBKE
chains in the Genus database with same CATH topology
3N3WA 2M1SA 2FV4B 4BMJA 4JI6E 1WHQA 5IWAE 3HTXA 5ADZA 3AV0A 4LF4E 2RTXA 4X64E 1YYOA 2LBSB 1J5EE 2B7TA 2F8BA 2L2NA 4LF5E 2MC6A 2LJHA 4OOGC 2QVWA 1O0WA 4M2ZA 2YT4A 2L8TA 4X8WA 1FJGE 1N33E 1IBLE 1YYKA 2ODRC 3HQ1A 2CPNA 4DV5E 3P1XA 5BR8E 4OX9E 1HNZE 4LF7E 4DV2E 2VF1A 2UXDE 2LUPB 4BS9A 1U61A 4YHHE 1T4NA 1I94E 1XNQE 4JYAE 2EWLA 4JI5E 4B3RE 4Q28A 3IWDA 2UXCE 3ZOQB 3JAMC 1GZ6A 4K0KE 1HNWE 2ODRD 2GSLA 2LTRA 5F3WA 2V8QB 4J8ZA 2JY9A 3H09A 4TUGA 4R8OA 2UUAE 3VYXA 4LF6E 4DR4E 4F9AB 1YYWA 3F6GA 4DV6E 3LMLA 2V83A 4F9BB 3DF6A 4LF9E 1ZBTA 1XNRE 4M0VA 3T1HE 4DR3E 1RC7A 4X65E 2DB2A 4NXNE 1UILA 4JI4E 4AQYE 4LFBE 4WFTA 3AUZA 3JTZA 2VQEE 4DV3E 4NXME 3RMPA 4JI3E 2NUEA 3IWCA 1XMOE 2FGGA 2L3JA 4P78A 2LMZA 4JI8E 5IT9C 5FLXC 2NUFA 1X49A 2MDRA 3RV1A 2G7HA 4WPYA 3FIGA 4GKJE 1HR0E 2JOXA 4BBYA 4DR2E 4B3TE 2RS7A 1T4LB 1X47A 2FTXB 1X48A 4BC9A 2E1MA 5AE3A 4M30A 1PKPA 2MC5A 2LE2A 4L8NA 2LTSA 2EZ6A 4LU9A 4GEQB 5AE1A 4B3ME 1FKAE 4JI2E 4DUZE 1XMQE 4YY3E 1ZBQA 3ADGA 2KHXA 4I8OA 1IBME 4JV5E 4DV7E 3ADJA 2IHR1 3KWRA 3LLHA 2V89A 3DJWA 2B7VA 3OMLA 2M7QA 2L3CA 2L2KB 2VQFE 5AASA 3VK6A 4WYQB 4DR7E 1DQ3A 4F54A 2YZTA 5DNYA 4X66E 2B3TB 2UXBE 2WZOA 1RQ0A 2V88A 5LMNE 1GQEA 1N34E 4JI1E 2JOBA 4LTYA 4JI7E 4B3SE 4X62E 2EB1A 2V85A 4L5NC 4LFCE 1UHZA 2RSMA 2LRSA 5A2QC 1J26A 3C4BA 1N36E 2KOUA 2JR1A 2H36X 3MSWA 2N3HA 3HPZA 1EKZA 4F9CB 2DIXA 2V86A 1WHNA 5LMUE 2N3GA 2V87A 4DUYE 4LFAE 4KHPE 2A11A 2LUQA 1SR9A 2DSYA 2NUGA 4R03A 3HPSA 4DR6E 3J80C 3HXLA 4GKKE 3VYYA 4WSPA 1STUA 2L2MA 3K6QA 4P7DA 2L92A 3OTOE 4DV1E 3J7AG 2JVAA 1WXRA 2FFLA 1I4SA 4DR1E 5LL6R 3JU0A 4DV4E 2UUBE 3C4TA 2M4IA 3J81C 4JI0E 2F4VE 1RC5A 2B9DA 2JWOA 3O2RA 3O2RB 2L6MA 4DV0E 4DR5E 1YZ9A 2DMYA 1QU6A 1T4OA 4DKKA 2UU9E 3RV0A 3ADIA 2ZM6E 3IWBA 4TUIA 2NA2A 4LF8E 3T1YE 3ADLA 1N32E 4KZSA 1HNXE 2E5LE 2L33A 4BCAA 2HHHE 1DI2A 2RS6A 3F6HA 5CFFE 2UUCE 4DMIA 3J7Yp 2K4VA 2KONA 2VE7C 5T6JA 1JFZA 4BC7A 4OUNA 5AE2A 1IBKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N3W A;  4JI6 E;  1WHQ A;  5IWA E;  3HTX A;  4LF4 E;  2RTX A;  4X64 E;  1YYO A;  2LBS B;  1J5E E;  2B7T A;  2L2N A;  4LF5 E;  2LJH A;  4OOG C;  2QVW A;  1O0W A;  4M2Z A;  2YT4 A;  4X8W A;  1FJG E;  1N33 E;  1IBL E;  1YYK A;  2CPN A;  4DV5 E;  3P1X A;  5BR8 E;  4OX9 E;  1HNZ E;  4LF7 E;  4DV2 E;  2LUP B;  1U61 A;  4YHH E;  1T4N A;  1I94 E;  1XNQ E;  4JYA E;  4JI5 E;  2UXC E;  4K0K E;  1HNW E;  2GSL A;  2LTR A;  2JY9 A;  3VYX A;  2UUA E;  4LF6 E;  4DR4 E;  1YYW A;  4DV6 E;  4LF9 E;  1ZBT A;  1XNR E;  3T1H E;  4DR3 E;  1RC7 A;  4X65 E;  2DB2 A;  4NXN E;  1UIL A;  4JI4 E;  4AQY E;  4LFB E;  4WFT A;  2VQE E;  4DV3 E;  4NXM E;  4JI3 E;  2NUE A;  1XMO E;  2L3J A;  4JI8 E;  2NUF A;  1X49 A;  2MDR A;  3RV1 A;  4GKJ E;  1HR0 E;  4DR2 E;  4B3T E;  2RS7 A;  1T4L B;  1X47 A;  1X48 A;  4M30 A;  1PKP A;  4B3R E;  2LTS A;  2EZ6 A;  4B3M E;  4JI2 E;  1FKA E;  4DUZ E;  1XMQ E;  4YY3 E;  1IBM E;  3ADG A;  2KHX A;  2UXD E;  4JV5 E;  4DV7 E;  3ADJ A;  2IHR 1;  3LLH A;  2VQF E;  4LFA E;  2L3C A;  2B7V A;  2L2K B;  4WYQ B;  4DR7 E;  4X66 E;  2UXB E;  2B3T B;  1RQ0 A;  5LMN E;  1GQE A;  1N34 E;  4JI1 E;  4JI7 E;  4B3S E;  4X62 E;  2EB1 A;  4LFC E;  1UHZ A;  2RSM A;  2LRS A;  1J26 A;  3C4B A;  1N36 E;  2N3H A;  1EKZ A;  2DIX A;  1WHN A;  5LMU E;  2N3G A;  4DUY E;  4KHP E;  2A11 A;  2LUQ A;  2NUG A;  4GKK E;  4DR6 E;  3VYY A;  3OTO E;  1STU A;  2L2M A;  4DV1 E;  2JVA A;  2FFL A;  1I4S A;  4DR1 E;  4DV4 E;  2UUB E;  3C4T A;  4JI0 E;  2F4V E;  1RC5 A;  3O2R A;  3O2R B;  4DV0 E;  4DR5 E;  1YZ9 A;  2DMY A;  1QU6 A;  1T4O A;  4DKK A;  2UU9 E;  3RV0 A;  3ADI A;  2ZM6 E;  2NA2 A;  4LF8 E;  3T1Y E;  3ADL A;  1N32 E;  1HNX E;  2E5L E;  2L33 A;  2HHH E;  1DI2 A;  2RS6 A;  5CFF E;  2UUC E;  3J7Y p;  1JFZ A;  4OUN A;  1IBK E; 
#chains in the Genus database with same CATH topology
 3N3W A;  2LO3 A;  4JI6 E;  5IWA E;  3HTX A;  5A6K A;  2CTD A;  4LF4 E;  4X64 E;  1X3C A;  2ENH A;  2BBG A;  5AC5 A;  4LF5 E;  1O0W A;  1N33 E;  2YT4 A;  4X8W A;  1YSA C;  1HNZ E;  2EN2 A;  2EQ0 A;  2LUP B;  2EPX A;  2RPC A;  5KL4 A;  2LVH A;  4JI5 E;  2ENA A;  5KL5 A;  2ADR A;  2ODR D;  2EOR A;  2EE8 A;  2JY9 A;  2WBS A;  4R2D A;  3LML A;  2EL5 A;  4M0V A;  2CSH A;  4DR3 E;  4X65 E;  2DB2 A;  5IXM B;  4NHR A;  2LJU A;  3BF2 A;  2NUE A;  1KYQ A;  4JI8 E;  5IT9 C;  4R2E A;  3RV1 A;  1HR0 E;  2JOX A;  2M9A A;  2YRK A;  2FTX B;  4BC9 A;  2EN3 A;  5KL2 A;  1PJT A;  4R2C A;  2RQL A;  1PKP A;  2MC5 A;  4B3R E;  4GEQ B;  2Q8U A;  1FKA E;  1BBO A;  4WXC A;  3ADJ A;  3LLH A;  2IHR 1;  4NZV A;  2L3C A;  2B7V A;  2L2K B;  2EPA A;  3VK6 A;  2DLQ A;  2UXB E;  1GQE A;  2JOB A;  4LTY A;  2EB1 A;  4L5N C;  2MKD A;  2LRS A;  3C4B A;  2YRH A;  4RHB B;  2R76 A;  4F9C B;  1PJQ A;  2EJ4 A;  2EQ3 A;  3EPK A;  2EOO A;  2EPM X;  2V87 A;  2A11 A;  4O5G A;  4RH8 A;  3J80 C;  3HXL A;  3VYY A;  2L2M A;  2YTQ A;  2YTP A;  2L92 A;  4DV1 E;  1G2D C;  1I4S A;  4DR1 E;  2MDG A;  2YSP A;  3THO B;  1UN6 B;  4JI0 E;  2F4V E;  1IMU A;  1RC5 A;  2JWO A;  2L6M A;  2D9H A;  4DV0 E;  2EM6 A;  1YZ9 A;  2DMY A;  3ADI A;  3KZZ A;  2ZM6 E;  3IWB A;  2YSO A;  4TUI A;  1YPN A;  2EMY A;  1L4S A;  2LV2 A;  1A1H A;  2RSI A;  2M1S A;  2JPA A;  2FV4 B;  2JYA A;  3AV0 A;  2LBS B;  1J5E E;  2F8B A;  2MC6 A;  4FK5 C;  4MLQ A;  1FJG E;  2ODR C;  2CPN A;  3P1X A;  4OX9 E;  4O43 A;  2BB8 A;  2EQ1 A;  1DGC A;  4BS9 A;  4YHH E;  3THN A;  4Q28 A;  3IWD A;  2YRM A;  1HNW E;  1GZ6 A;  2EOX A;  2GSL A;  3H09 A;  4R8O A;  2JP9 A;  2UUA E;  4DR4 E;  2EPN A;  1YYW A;  4F9A B;  4DV6 E;  5A69 A;  4LF9 E;  1XNR E;  3UK3 C;  3AUZ A;  3JTZ A;  2VQE E;  4DV3 E;  1JK1 A;  2EMG A;  3IWC A;  2EM8 A;  4O4K A;  2L3J A;  4GZN C;  1Z1B A;  2GHF A;  4MLV A;  2NUF A;  2MDR A;  1UBD C;  5A6B A;  2I9I A;  3FIG A;  1G2F C;  1TN9 A;  1EH6 A;  5KL3 A;  4M30 A;  4LU9 A;  5A6J A;  5AE1 A;  4KWY A;  3C6K A;  1ZBQ A;  4I8O A;  1N3G A;  4R2S A;  2UXD E;  4DV7 E;  3OML A;  2V89 A;  2DRP A;  4WYQ B;  1DQ3 A;  4F54 A;  5DNY A;  2B3T B;  1A1I A;  2WZO A;  2EPL X;  4F6M A;  5LMN E;  1EH7 A;  5TSE A;  2DGC A;  2EN1 A;  2YU5 A;  2EN7 A;  1P47 A;  1JK2 A;  1GTK A;  2J7J A;  4O24 A;  2MKN A;  3BGH A;  2V86 A;  5LLQ A;  1A1K A;  1X5W A;  1NEI A;  2YTO A;  3M99 B;  1BBG A;  2EOJ A;  3EPH A;  2EMH A;  4GKK E;  3HPS A;  4DR6 E;  2YTG A;  4WSP A;  3J7A G;  2EL4 A;  2JVA A;  2FFL A;  2LCE A;  2M4I A;  2EL6 A;  2B9D A;  3O2R B;  4DR5 E;  2EMF A;  1T4O A;  2EOF A;  2HC5 A;  2NA2 A;  2DLK A;  1N32 E;  1ZTD A;  4KZS A;  1QNT A;  2E5L E;  2EOM A;  2HHH E;  1DI2 A;  5CFF E;  4M9V C;  3J7Y p;  2KON A;  2VE7 C;  2EPK X;  1JFZ A;  2NAB A;  2YWQ A;  4OUN A;  4BHC A;  4BMJ A;  5ADZ A;  2RTX A;  2B7T A;  2L2N A;  1A1L A;  4OOG C;  5IV8 B;  4M2Z A;  1IBL E;  3HQ1 A;  4DV5 E;  4N4R B;  4LF7 E;  4DV2 E;  2VF1 A;  1U61 A;  1T4N A;  1I94 E;  1YFH A;  1XNQ E;  4JYA E;  2WBU A;  3JAM C;  4K0K E;  3EPJ A;  5F3W A;  4J8Z A;  4TUG A;  4LF6 E;  2EMI A;  3F6G A;  2EM3 A;  3EPL A;  1ZBT A;  3T1H E;  1RC7 A;  2YTN A;  2WCC 3;  1UIL A;  4LFB E;  3TQM A;  4AQY E;  1A1J A;  4WFT A;  4HTG A;  1KJK A;  4NXM E;  2EMZ A;  3RMP A;  2FGG A;  4P78 A;  2LMZ A;  5FLX C;  1X49 A;  2EOY A;  2G7H A;  4R2P A;  2EN4 A;  4ZYH A;  3C6M A;  4DR2 E;  4BBY A;  4B3T E;  2RS7 A;  1X47 A;  2EPR A;  5AE3 A;  2YU8 A;  4HEI A;  1X6H A;  2EOS A;  2LE2 A;  3ECR A;  2EZ6 A;  4JI2 E;  1PDA A;  1XMQ E;  2EM2 A;  4YY3 E;  2A25 A;  1ZR9 A;  2EM7 A;  4JV5 E;  1NCS A;  4LFA E;  2VQF E;  3BID A;  2M7Q A;  3DJW A;  2EOZ A;  5AAS A;  2EMA A;  1RQ0 A;  2V88 A;  1MEY C;  1A1F A;  4JI7 E;  2V85 A;  3BBG A;  4LFC E;  1J26 A;  2WBT A;  4R2Q A;  5A6B D;  1N36 E;  4BHB A;  2JR1 A;  2ENC A;  2H36 X;  3MSW A;  4IJD A;  2GPI A;  1X6F A;  2EM5 A;  2HGH A;  3VHT B;  4DUY E;  2EMK A;  1SR9 A;  2DSY A;  2NUG A;  4IS1 C;  4ZYD A;  2GLI A;  3OTO E;  1LLM C;  5KL6 A;  1SFE A;  3O2R A;  2EP3 A;  2VRD A;  1QU6 A;  4DKK A;  3RV0 A;  2R1F A;  3T1Y E;  2K7I A;  3L00 A;  3QG5 C;  1IQO A;  2EN6 A;  2YTI A;  2UUC E;  4DMI A;  4F2J C;  1T39 A;  2K4V A;  4BC7 A;  5AE2 A;  4F6N A;  2EMC A;  2EMW A;  2EM9 A;  1WHQ A;  1YYO A;  2DMI A;  2JXP A;  2CT1 A;  2EPP A;  2QVW A;  2LJH A;  1EH8 A;  1WRJ A;  2L8T A;  1YUJ A;  2YTJ A;  1YYK A;  2EMX A;  3MHH C;  5BR8 E;  1RMD A;  2EWL A;  2N8X A;  2UXC E;  4ZYE A;  1T38 A;  3ZOQ B;  2E72 A;  2YPN A;  2EOE A;  2LTR A;  2EPU A;  2V8Q B;  2YTD A;  3VYX A;  4WXD A;  2ELY A;  2V83 A;  4F9B B;  3EQ1 A;  3DF6 A;  5AC4 A;  1F2I G;  4NXN E;  1TF3 A;  5A6A A;  1YUI A;  4JI4 E;  1ZU1 A;  4JI3 E;  1XMO E;  2EOH A;  2EOQ A;  2ELZ A;  3MHS C;  4WPY A;  4GKJ E;  1T4L B;  1WJP A;  2EOI A;  1X48 A;  2E1M A;  4L8N A;  2EPO A;  4ZYG A;  2LTS A;  5KL7 A;  4B3M E;  1A1G A;  3KZY A;  4DUZ E;  2PRT A;  1IBM E;  3ADG A;  2KHX A;  4X9J A;  1PJS A;  3KWR A;  2HJJ A;  4Q35 B;  4DR7 E;  4X66 E;  2YZT A;  2EPC A;  2I13 A;  2YTF A;  1IQS A;  1N34 E;  4JI1 E;  2EM0 A;  4B3S E;  4X62 E;  1AH5 A;  1MGT A;  1UHZ A;  2RSM A;  5A2Q C;  1AAY A;  2KOU A;  1TF6 A;  2LT7 A;  1X6E A;  2N3H A;  3HPZ A;  1EKZ A;  2EPZ A;  4WSG A;  1BB8 A;  2DIX A;  1WHN A;  5LMU E;  2N3G A;  4KHP E;  2EMB A;  2LUQ A;  2YTE A;  4R03 A;  1STU A;  2EN8 A;  3K6Q A;  4P7D A;  1WXR A;  1B69 A;  5LL6 R;  3JU0 A;  4DV4 E;  2UUB E;  3C4T A;  3J81 C;  4R2A A;  4WX9 A;  4R2R A;  2UU9 E;  4LF8 E;  1ZAA C;  3ADL A;  1HNX E;  2L33 A;  4BCA A;  2RS6 A;  3F6H A;  5T6J A;  2EML A;  2EM4 A;  1IBK E; 
#chains in the Genus database with same CATH homology
 3N3W A;  2M1S A;  2FV4 B;  4BMJ A;  4JI6 E;  1WHQ A;  5IWA E;  3HTX A;  5ADZ A;  3AV0 A;  4LF4 E;  2RTX A;  4X64 E;  1YYO A;  2LBS B;  1J5E E;  2B7T A;  2F8B A;  2L2N A;  4LF5 E;  2MC6 A;  2LJH A;  4OOG C;  2QVW A;  1O0W A;  4M2Z A;  2YT4 A;  2L8T A;  4X8W A;  1FJG E;  1N33 E;  1IBL E;  1YYK A;  2ODR C;  3HQ1 A;  2CPN A;  4DV5 E;  3P1X A;  5BR8 E;  4OX9 E;  1HNZ E;  4LF7 E;  4DV2 E;  2VF1 A;  2UXD E;  2LUP B;  4BS9 A;  1U61 A;  4YHH E;  1T4N A;  1I94 E;  1XNQ E;  4JYA E;  2EWL A;  4JI5 E;  4B3R E;  4Q28 A;  3IWD A;  2UXC E;  3ZOQ B;  3JAM C;  1GZ6 A;  4K0K E;  1HNW E;  2ODR D;  2GSL A;  2LTR A;  5F3W A;  2V8Q B;  4J8Z A;  2JY9 A;  3H09 A;  4TUG A;  4R8O A;  2UUA E;  3VYX A;  4LF6 E;  4DR4 E;  4F9A B;  1YYW A;  3F6G A;  4DV6 E;  3LML A;  2V83 A;  4F9B B;  3DF6 A;  4LF9 E;  1ZBT A;  1XNR E;  4M0V A;  3T1H E;  4DR3 E;  1RC7 A;  4X65 E;  2DB2 A;  4NXN E;  1UIL A;  4JI4 E;  4AQY E;  4LFB E;  4WFT A;  3AUZ A;  3JTZ A;  2VQE E;  4DV3 E;  4NXM E;  3RMP A;  4JI3 E;  2NUE A;  3IWC A;  1XMO E;  2FGG A;  2L3J A;  4P78 A;  2LMZ A;  4JI8 E;  5IT9 C;  5FLX C;  2NUF A;  1X49 A;  2MDR A;  3RV1 A;  2G7H A;  4WPY A;  3FIG A;  4GKJ E;  1HR0 E;  2JOX A;  4BBY A;  4DR2 E;  4B3T E;  2RS7 A;  1T4L B;  1X47 A;  2FTX B;  1X48 A;  4BC9 A;  2E1M A;  5AE3 A;  4M30 A;  1PKP A;  2MC5 A;  2LE2 A;  4L8N A;  2LTS A;  2EZ6 A;  4LU9 A;  4GEQ B;  5AE1 A;  4B3M E;  1FKA E;  4JI2 E;  4DUZ E;  1XMQ E;  4YY3 E;  1ZBQ A;  3ADG A;  2KHX A;  4I8O A;  1IBM E;  4JV5 E;  4DV7 E;  3ADJ A;  2IHR 1;  3KWR A;  3LLH A;  2V89 A;  3DJW A;  2B7V A;  3OML A;  2M7Q A;  2L3C A;  2L2K B;  2VQF E;  5AAS A;  3VK6 A;  4WYQ B;  4DR7 E;  1DQ3 A;  4F54 A;  2YZT A;  5DNY A;  4X66 E;  2B3T B;  2UXB E;  2WZO A;  1RQ0 A;  2V88 A;  5LMN E;  1GQE A;  1N34 E;  4JI1 E;  2JOB A;  4LTY A;  4JI7 E;  4B3S E;  4X62 E;  2EB1 A;  2V85 A;  4L5N C;  4LFC E;  1UHZ A;  2RSM A;  2LRS A;  5A2Q C;  1J26 A;  3C4B A;  1N36 E;  2KOU A;  2JR1 A;  2H36 X;  3MSW A;  2N3H A;  3HPZ A;  1EKZ A;  4F9C B;  2DIX A;  2V86 A;  1WHN A;  5LMU E;  2N3G A;  2V87 A;  4DUY E;  4LFA E;  4KHP E;  2A11 A;  2LUQ A;  1SR9 A;  2DSY A;  2NUG A;  4R03 A;  3HPS A;  4DR6 E;  3J80 C;  3HXL A;  4GKK E;  3VYY A;  4WSP A;  1STU A;  2L2M A;  3K6Q A;  4P7D A;  2L92 A;  3OTO E;  4DV1 E;  3J7A G;  2JVA A;  1WXR A;  2FFL A;  1I4S A;  4DR1 E;  5LL6 R;  3JU0 A;  4DV4 E;  2UUB E;  3C4T A;  2M4I A;  3J81 C;  4JI0 E;  2F4V E;  1RC5 A;  2B9D A;  2JWO A;  3O2R A;  3O2R B;  2L6M A;  4DV0 E;  4DR5 E;  1YZ9 A;  2DMY A;  1QU6 A;  1T4O A;  4DKK A;  2UU9 E;  3RV0 A;  3ADI A;  2ZM6 E;  3IWB A;  4TUI A;  2NA2 A;  4LF8 E;  3T1Y E;  3ADL A;  1N32 E;  4KZS A;  1HNX E;  2E5L E;  2L33 A;  4BCA A;  2HHH E;  1DI2 A;  2RS6 A;  3F6H A;  5CFF E;  2UUC E;  4DMI A;  3J7Y p;  2K4V A;  2KON A;  2VE7 C;  5T6J A;  1JFZ A;  4BC7 A;  4OUN A;  5AE2 A;  1IBK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...