4M30A

Crystal structure of rnase iii complexed with double-stranded rna and amp (type ii cleavage)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
220
structure length
220
Chain Sequence
KMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease 3
publication title RNase III: Genetics and Function; Structure and Mechanism.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
total genus 78
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 4m30A01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4m30A02
4X8WA 4OX9E 2UUBE 4YHHE 5BR8E 1N33E 4X66E 1HNZE 2LTRA 4DV5E 4K0KE 2RTXA 4DR5E 1I4SA 1STUA 4JI7E 3VYXA 2ZM6E 4JI3E 4B3SE 2GSLA 3O2RA 2B7VA 1N34E 4DR6E 4X62E 2IHR1 2VQEE 4LF5E 2N3HA 4GKJE 1YYWA 1T4NA 4AQYE 2UXCE 1DI2A 2NA2A 5LMNE 4NXME 1XNRE 1YYOA 1I94E 2F4VE 2QVWA 5IWAE 4DV7E 3P1XA 2HHHE 4LF4E 4NXNE 2E5LE 2LJHA 1QU6A 5CFFE 4DUYE 2UUAE 4KHPE 2L2NA 1X47A 4JI8E 2LBSB 2DMYA 2L3CA 4DR2E 1FKAE 2UUCE 1N32E 2NUEA 2B3TB 1YZ9A 2RS6A 4OOGC 4GKKE 4JI6E 4DV6E 4DR3E 4WYQB 3RV0A 2UXBE 4LF8E 2JVAA 1JFZA 4JI4E 4DR4E 2NUGA 4LF7E 4JV5E 4M2ZA 3ADJA 3C4TA 2YT4A 4OUNA 2L2MA 1X49A 1RC7A 1T4OA 4DKKA 4LF9E 2LUQA 2L2KB 2NUFA 4DV0E 4JI1E 3O2RB 3RV1A 1IBKE 1WHNA 2RS7A 1U61A 1XMOE 3HTXA 4B3ME 3J7Yp 1HNWE 1GQEA 4WFTA 4X65E 4DR1E 1J5EE 1FJGE 3T1HE 2L3JA 2FFLA 4DV2E 4B3RE 3OTOE 1WHQA 2CPNA 1XMQE 4LFCE 4DV3E 2RSMA 4DR7E 4DV4E 1UHZA 3VYYA 2JY9A 2UXDE 1EKZA 3ADGA 3N3WA 4LFAE 5LMUE 2LUPB 4DUZE 4JI0E 3LLHA 2DIXA 4B3TE 1XNQE 4DV1E 1HNXE 2LRSA 4X64E 2EZ6A 1RC5A 1T4LB 4JI5E 4LFBE 4M30A 1J26A 3ADIA 1HR0E 1IBME 2N3GA 2LTSA 1O0WA 3T1YE 1RQ0A 2DB2A 2A11A 2UU9E 2KHXA 4JI2E 1YYKA 4JYAE 2VQFE 1UILA 1IBLE 2B7TA 4YY3E 1ZBTA 2MDRA 3C4BA 1X48A 3ADLA 2EB1A 4LF6E 2L33A 1PKPA 1N36E
chains in the Genus database with same CATH superfamily
4R2EA 3H09A 3VHTB 1HNZE 1YSAC 2MDGA 1YUIA 2YTQA 4NZVA 3VYXA 4JI3E 2EN6A 3MHHC 1YUJA 4DR6E 4X62E 5A6KA 1IQSA 4F54A 1DI2A 4L8NA 1NCSA 1PDAA 1XNRE 3THNA 2F4VE 2BB8A 2YTNA 1YPNA 5A69A 4J8ZA 4DV7E 2YSPA 2JR1A 4O43A 2WCC3 2HHHE 2YRHA 2MKNA 4R2SA 1EH8A 2EM7A 1X6EA 2UUAE 4BHCA 5A6BD 2LBSB 2EOSA 3J7AG 4NHRA 2EL6A 1X6FA 4IJDA 3EQ1A 1A1HA 1MGTA 2JPAA 2VRDA 4R2RA 1A1GA 3DF6A 2FTXB 3KZZA 4WYQB 2UXBE 2EN3A 2JWOA 5AC5A 4LF7E 1TF3A 5AE1A 5IXMB 2EN8A 4R2QA 4LF9E 2LUQA 2L2KB 2EPMX 2R76A 3KZYA 2RS7A 1XMOE 4HEIA 4WFTA 1FJGE 1PJTA 1A1KA 2EPLX 4R2DA 3IWDA 3OTOE 1WHQA 2EM3A 4DR7E 3VYYA 2RQLA 1ZR9A 5TSEA 4MLQA 1EKZA 2K4VA 3ADGA 3HPSA 4ZYGA 4LFAE 5LMUE 1G2DC 4DUZE 4JI0E 2DLKA 2KONA 2LV2A 1HNXE 4X64E 2EZ6A 1WRJA 2FGGA 1ZTDA 3TQMA 4LU9A 1J26A 3ADIA 1HR0E 2LTSA 5DNYA 4WSPA 1O0WA 2EPXA 1RQ0A 2UU9E 2LT7A 1PJQA 2WBUA 2VQFE 1UBDC 2LCEA 3C4BA 2YTJA 4R2CA 2DGCA 1RMDA 4X9JA 2L33A 2YTIA 2YTFA 2N8XA 4X8WA 1AAYA 4YHHE 2DMIA 5BR8E 1N33E 3THOB 2WBSA 5KL7A 2ENCA 2EMZA 2V87A 4RHBB 2M1SA 2EMXA 1AH5A 2RTXA 4I8OA 1I4SA 1STUA 2JOXA 3C6MA 3EPLA 2IHR1 2VQEE 3HQ1A 2N3HA 2RPCA 4LF5E 1T4NA 4AQYE 2UXCE 1UN6B 4WXCA 4NXME 2R1FA 2ENAA 5IWAE 4LTYA 2EJ4A 4O4KA 2EM2A 2M7QA 4LF4E 4BHBA 2E5LE 4P78A 1JK1A 1WJPA 2HJJA 4DUYE 2I13A 2EE8A 4JI8E 2YU5A 2YRKA 4DR2E 2UUCE 2NABA 5T6JA 2FV4B 1N32E 2YZTA 2EOMA 3UK3C 1X6HA 2EOFA 3BGHA 1A1LA 1JFZA 1X5WA 2V89A 3HPZA 1T38A 4JI4E 4DR4E 2VF1A 2NUGA 2E72A 1GTKA 2GLIA 3JTZA 1RC7A 2EMAA 4DKKA 1EH6A 4ZYEA 1WHNA 4WPYA 1U61A 1MEYC 4Q28A 4X65E 2EMGA 4DR1E 2EPNA 4F2JC 3T1HE 2L3JA 4DV2E 4B3RE 2EL5A 3F6GA 4DV4E 3KWRA 3OMLA 2EN4A 3LLHA 1NEIA 2CSHA 4DV1E 2EPAA 3BIDA 4M30A 2I9IA 4BMJA 1ZAAC 2MKDA 2N3GA 1ZBQA 4TUGA 5A2QC 3T1YE 2EOXA 2DB2A 2ODRD 2KHXA 2ODRC 1UILA 2EM5A 1SFEA 2V86A 3M99B 2EL4A 1PJSA 4BCAA 3BBGA 2D9HA 3ADLA 4WXDA 2EM0A 1PKPA 2EOYA 3FIGA 3F6HA 4OX9E 2UUBE 4X66E 2GHFA 5LLQA 1T39A 2V83A 4DR5E 2ZM6E 4B3SE 2GSLA 2B7VA 2CTDA 2EMHA 2YTPA 1DGCA 2M9AA 4F9AB 2EOQA 2EOJA 2EPZA 2YWQA 5FLXC 2NA2A 4L5NC 4GZNC 2EQ3A 5LMNE 1BBOA 1YYOA 3JU0A 2EM4A 5A6JA 3VK6A 2V88A 1SR9A 2H36X 4NXNE 2EPOA 2EORA 2EMLA 4RH8A 5CFFE 4KHPE 1BB8A 4DMIA 1X47A 2L3CA 2PRTA 1FKAE 2JYAA 4WX9A 2EOEA 4BS9A 2RS6A 2EPPA 2L6MA 4R03A 1A1JA 2DSYA 4TUIA 4JI6E 4DV6E 5KL2A 3RV0A 2JVAA 3IWCA 1G2FC 2WZOA 4M2ZA 3ADJA 2EMWA 3C4TA 4OUNA 4IS1C 1X49A 1T4OA 3HXLA 4R2AA 1DQ3A 3O2RB 4BBYA 3RV1A 2EM6A 4B3ME 3BF2A 3QG5C 1GQEA 1J5EE 5IV8B 1LLMC 5AASA 2F8BA 2EPRA 3EPHA 5LL6R 2LJUA 4M0VA 2CPNA 4F6MA 2HC5A 4DV3E 2RSMA 1UHZA 4R2PA 2JY9A 3K6QA 2UXDE 1F2IG 3N3WA 1JK2A 2LUPB 2EPKX 2EMIA 2DIXA 4B3TE 1XNQE 4F9BB 2ELZA 2L8TA 4JI5E 1RC5A 2EOZA 2G7HA 2L92A 1T4LB 3DJWA 1IMUA 2YU8A 3EPJA 1IBME 2B9DA 4MLVA 1GZ6A 5IT9C 5KL5A 1YYKA 2EMBA 2B7TA 2YTDA 1X3CA 1ZBTA 1X48A 2LO3A 2YPNA 4KWYA 5AC4A 5A6BA 4O24A 1KJKA 2A25A 2ELYA 2JP9A 1B69A 4FK5C 2LTRA 4DV5E 4K0KE 4JI7E 1N3GA 2EOOA 3O2RA 4WSGA 4R8OA 3IWBA 1N34E 3J80C 2EMCA 4Q35B 4ZYHA 1WXRA 5F3WA 4GKJE 1YYWA 4P7DA 1BBGA 1A1IA 4BC7A 2EQ1A 2VE7C 2EOIA 1I94E 3LMLA 2QVWA 3P1XA 1ZU1A 1KYQA 4GEQB 4O5GA 2LJHA 1QU6A 2M4IA 2L2NA 1IQOA 4KZSA 1A1FA 1P47A 2DMYA 5AE2A 4F9CB 1QNTA 2RSIA 2LMZA 2NUEA 2B3TB 2BBGA 5KL4A 2EM9A 1YZ9A 5ADZA 3AUZA 4OOGC 2YTOA 4GKKE 4DR3E 2YTGA 4LF8E 5KL3A 2DLQA 3JAMC 3MHSC 4JV5E 3ECRA 2YT4A 2HGHA 2L2MA 2ADRA 3ZOQB 5AE3A 2EMYA 1Z1BA 1TN9A 2LE2A 2NUFA 4DV0E 2EP3A 2Q8UA 4JI1E 2EN7A 1IBKE 2V85A 3HTXA 3J7Yp 5A6AA 1HNWE 2EQ0A 2CT1A 4BC9A 2EMFA 2EPUA 2FFLA 3C6KA 1L4SA 1XMQE 2K7IA 2MC5A 4HTGA 4LFCE 4M9VC 4ZYDA 2KOUA 2YTEA 2MC6A 2EMKA 2GPIA 2LVHA 2YSOA 2JXPA 1EH7A 2E1MA 2V8QB 3MSWA 2WBTA 4N4RB 3L00A 2LRSA 2ENHA 2EN2A 2EPCA 4LFBE 3EPKA 4F6NA 2EN1A 2A11A 4JI2E 4JYAE 1IBLE 2DRPA 2EM8A 4YY3E 2MDRA 1TF6A 5KL6A 2YRMA 2EWLA 1YFHA 2EB1A 3RMPA 2JOBA 4LF6E 3AV0A 2J7JA 3J81C 1N36E 2EOHA
chains in the Genus database with same CATH topology
3F6HA 4X8WA 4OX9E 2UUBE 4YHHE 3H09A 5BR8E 1N33E 4X66E 1HNZE 2LTRA 2V87A 2M1SA 4DV5E 4K0KE 2RTXA 2V83A 4I8OA 4DR5E 1I4SA 1STUA 2JOXA 4JI7E 2ZM6E 4JI3E 4B3SE 3VYXA 2GSLA 3O2RA 2B7VA 4R8OA 3IWBA 1N34E 3J80C 4DR6E 4X62E 2IHR1 2VQEE 3HQ1A 2N3HA 4LF5E 1WXRA 4GKJE 5F3WA 1YYWA 4P7DA 1T4NA 4F9AB 4AQYE 2UXCE 1DI2A 4F54A 4BC7A 4L8NA 2NA2A 5FLXC 4L5NC 5LMNE 4NXME 2VE7C 1XNRE 1YYOA 3JU0A 1I94E 2F4VE 3LMLA 3VK6A 2QVWA 5IWAE 2V88A 1SR9A 4LTYA 4J8ZA 4DV7E 2H36X 4JI5E 3P1XA 2JR1A 2M7QA 2HHHE 4LF4E 4NXNE 4GEQB 2E5LE 4P78A 2LJHA 1QU6A 5CFFE 4DUYE 2UUAE 2M4IA 2L2NA 4KHPE 4KZSA 4DMIA 1X47A 4JI8E 2LBSB 3J7AG 2DMYA 2L3CA 5AE2A 4DR2E 1FKAE 2UUCE 4F9CB 5T6JA 2FV4B 1N32E 2LMZA 2YZTA 2NUEA 2B3TB 4BS9A 1YZ9A 2RS6A 5ADZA 2L6MA 3AUZA 4R03A 4OOGC 2DSYA 4TUIA 4JI6E 4GKKE 3DF6A 4DV6E 2FTXB 4DR3E 4WYQB 3RV0A 2UXBE 4LF8E 2JVAA 1JFZA 2V89A 3HPZA 4JI4E 4DR4E 2JWOA 2VF1A 2NUGA 3IWCA 3JAMC 4LF7E 4JV5E 2WZOA 4M2ZA 3ADJA 3C4TA 2YT4A 4OUNA 2L2MA 5AE1A 1X49A 1RC7A 1T4OA 3HXLA 3JTZA 2LUQA 3ZOQB 4DKKA 1DQ3A 2LE2A 5AE3A 2L2KB 2NUFA 4DV0E 4JI1E 3O2RB 4BBYA 3RV1A 1IBKE 1WHNA 4WPYA 2V85A 2RS7A 1U61A 1XMOE 3HTXA 4B3ME 3J7Yp 4LF9E 1HNWE 4Q28A 1GQEA 4WFTA 4X65E 4DR1E 1J5EE 1FJGE 4BC9A 3T1HE 5AASA 2F8BA 3IWDA 2FFLA 2L3JA 5LL6R 3OTOE 4DV2E 4B3RE 1WHQA 2CPNA 4M0VA 1XMQE 2MC5A 4LFCE 2KOUA 4DV3E 2RSMA 3F6GA 4DV4E 1UHZA 3VYYA 4DR7E 2JY9A 2MC6A 3K6QA 1EKZA 2UXDE 2K4VA 3ADGA 3HPSA 3KWRA 3N3WA 4LFAE 3OMLA 5LMUE 2LUPB 4DUZE 4JI0E 2E1MA 3LLHA 2KONA 2V8QB 3MSWA 2DIXA 4B3TE 1XNQE 4F9BB 4DV1E 1HNXE 2LRSA 4X64E 2L8TA 2EZ6A 1RC5A 2G7HA 2FGGA 2L92A 1T4LB 4M30A 3DJWA 4LU9A 4BMJA 4LFBE 1J26A 3ADIA 1HR0E 1IBME 2N3GA 1ZBQA 4TUGA 2LTSA 5DNYA 4WSPA 2B9DA 5A2QC 1O0WA 1GZ6A 3T1YE 1RQ0A 2DB2A 2A11A 2ODRD 5IT9C 2KHXA 2UU9E 1YYKA 4JI2E 4JYAE 2ODRC 1UILA 2VQFE 1IBLE 2B7TA 2V86A 4YY3E 1ZBTA 2MDRA 3C4BA 4BCAA 1X48A 3ADLA 2EWLA 2EB1A 3RMPA 2JOBA 2L33A 3FIGA 1PKPA 3AV0A 4LF6E 3J81C 1N36E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X8W A;  4OX9 E;  2UUB E;  4YHH E;  5BR8 E;  1N33 E;  4X66 E;  1HNZ E;  2LTR A;  4DV5 E;  4K0K E;  2RTX A;  4DR5 E;  1I4S A;  1STU A;  4JI7 E;  3VYX A;  2ZM6 E;  4JI3 E;  4B3S E;  2GSL A;  3O2R A;  2B7V A;  1N34 E;  4DR6 E;  4X62 E;  2IHR 1;  2VQE E;  4LF5 E;  2N3H A;  4GKJ E;  1YYW A;  1T4N A;  4AQY E;  2UXC E;  1DI2 A;  2NA2 A;  5LMN E;  4NXM E;  1XNR E;  1YYO A;  1I94 E;  2F4V E;  2QVW A;  5IWA E;  4DV7 E;  3P1X A;  2HHH E;  4LF4 E;  4NXN E;  2E5L E;  2LJH A;  1QU6 A;  5CFF E;  4DUY E;  2UUA E;  4KHP E;  2L2N A;  1X47 A;  4JI8 E;  2LBS B;  2DMY A;  2L3C A;  4DR2 E;  1FKA E;  2UUC E;  1N32 E;  2NUE A;  2B3T B;  1YZ9 A;  2RS6 A;  4OOG C;  4GKK E;  4JI6 E;  4DV6 E;  4DR3 E;  4WYQ B;  3RV0 A;  2UXB E;  4LF8 E;  2JVA A;  1JFZ A;  4JI4 E;  4DR4 E;  2NUG A;  4LF7 E;  4JV5 E;  4M2Z A;  3ADJ A;  3C4T A;  2YT4 A;  4OUN A;  2L2M A;  1X49 A;  1RC7 A;  1T4O A;  4DKK A;  4LF9 E;  2LUQ A;  2L2K B;  2NUF A;  4DV0 E;  4JI1 E;  3O2R B;  3RV1 A;  1IBK E;  1WHN A;  2RS7 A;  1U61 A;  1XMO E;  3HTX A;  4B3M E;  3J7Y p;  1HNW E;  1GQE A;  4WFT A;  4X65 E;  4DR1 E;  1J5E E;  1FJG E;  3T1H E;  2L3J A;  2FFL A;  4DV2 E;  4B3R E;  3OTO E;  1WHQ A;  2CPN A;  1XMQ E;  4LFC E;  4DV3 E;  2RSM A;  4DR7 E;  4DV4 E;  1UHZ A;  3VYY A;  2JY9 A;  2UXD E;  1EKZ A;  3ADG A;  3N3W A;  4LFA E;  5LMU E;  2LUP B;  4DUZ E;  4JI0 E;  3LLH A;  2DIX A;  4B3T E;  1XNQ E;  4DV1 E;  1HNX E;  2LRS A;  4X64 E;  2EZ6 A;  1RC5 A;  1T4L B;  4JI5 E;  4LFB E;  4M30 A;  1J26 A;  3ADI A;  1HR0 E;  1IBM E;  2N3G A;  2LTS A;  1O0W A;  3T1Y E;  1RQ0 A;  2DB2 A;  2A11 A;  2UU9 E;  2KHX A;  4JI2 E;  1YYK A;  4JYA E;  2VQF E;  1UIL A;  1IBL E;  2B7T A;  4YY3 E;  1ZBT A;  2MDR A;  3C4B A;  1X48 A;  3ADL A;  2EB1 A;  4LF6 E;  2L33 A;  1PKP A;  1N36 E; 
#chains in the Genus database with same CATH topology
 4R2E A;  3H09 A;  3VHT B;  1HNZ E;  1YSA C;  2MDG A;  1YUI A;  2YTQ A;  4NZV A;  3VYX A;  4JI3 E;  2EN6 A;  3MHH C;  1YUJ A;  4DR6 E;  4X62 E;  5A6K A;  1IQS A;  4F54 A;  1DI2 A;  4L8N A;  1NCS A;  1PDA A;  1XNR E;  3THN A;  2F4V E;  2BB8 A;  2YTN A;  1YPN A;  5A69 A;  4J8Z A;  4DV7 E;  2YSP A;  2JR1 A;  4O43 A;  2WCC 3;  2HHH E;  2YRH A;  2MKN A;  4R2S A;  1EH8 A;  2EM7 A;  1X6E A;  2UUA E;  4BHC A;  5A6B D;  2LBS B;  2EOS A;  3J7A G;  4NHR A;  2EL6 A;  1X6F A;  4IJD A;  3EQ1 A;  1A1H A;  1MGT A;  2JPA A;  2VRD A;  4R2R A;  1A1G A;  3DF6 A;  2FTX B;  3KZZ A;  4WYQ B;  2UXB E;  2EN3 A;  2JWO A;  5AC5 A;  4LF7 E;  1TF3 A;  5AE1 A;  5IXM B;  2EN8 A;  4R2Q A;  4LF9 E;  2LUQ A;  2L2K B;  2EPM X;  2R76 A;  3KZY A;  2RS7 A;  1XMO E;  4HEI A;  4WFT A;  1FJG E;  1PJT A;  1A1K A;  2EPL X;  4R2D A;  3IWD A;  3OTO E;  1WHQ A;  2EM3 A;  4DR7 E;  3VYY A;  2RQL A;  1ZR9 A;  5TSE A;  4MLQ A;  1EKZ A;  2K4V A;  3ADG A;  3HPS A;  4ZYG A;  4LFA E;  5LMU E;  1G2D C;  4DUZ E;  4JI0 E;  2DLK A;  2KON A;  2LV2 A;  1HNX E;  4X64 E;  2EZ6 A;  1WRJ A;  2FGG A;  1ZTD A;  3TQM A;  4LU9 A;  1J26 A;  3ADI A;  1HR0 E;  2LTS A;  5DNY A;  4WSP A;  1O0W A;  2EPX A;  1RQ0 A;  2UU9 E;  2LT7 A;  1PJQ A;  2WBU A;  2VQF E;  1UBD C;  2LCE A;  3C4B A;  2YTJ A;  4R2C A;  2DGC A;  1RMD A;  4X9J A;  2L33 A;  2YTI A;  2YTF A;  2N8X A;  4X8W A;  1AAY A;  4YHH E;  2DMI A;  5BR8 E;  1N33 E;  3THO B;  2WBS A;  5KL7 A;  2ENC A;  2EMZ A;  2V87 A;  4RHB B;  2M1S A;  2EMX A;  1AH5 A;  2RTX A;  4I8O A;  1I4S A;  1STU A;  2JOX A;  3C6M A;  3EPL A;  2IHR 1;  2VQE E;  3HQ1 A;  2N3H A;  2RPC A;  4LF5 E;  1T4N A;  4AQY E;  2UXC E;  1UN6 B;  4WXC A;  4NXM E;  2R1F A;  2ENA A;  5IWA E;  4LTY A;  2EJ4 A;  4O4K A;  2EM2 A;  2M7Q A;  4LF4 E;  4BHB A;  2E5L E;  4P78 A;  1JK1 A;  1WJP A;  2HJJ A;  4DUY E;  2I13 A;  2EE8 A;  4JI8 E;  2YU5 A;  2YRK A;  4DR2 E;  2UUC E;  2NAB A;  5T6J A;  2FV4 B;  1N32 E;  2YZT A;  2EOM A;  3UK3 C;  1X6H A;  2EOF A;  3BGH A;  1A1L A;  1JFZ A;  1X5W A;  2V89 A;  3HPZ A;  1T38 A;  4JI4 E;  4DR4 E;  2VF1 A;  2NUG A;  2E72 A;  1GTK A;  2GLI A;  3JTZ A;  1RC7 A;  2EMA A;  4DKK A;  1EH6 A;  4ZYE A;  1WHN A;  4WPY A;  1U61 A;  1MEY C;  4Q28 A;  4X65 E;  2EMG A;  4DR1 E;  2EPN A;  4F2J C;  3T1H E;  2L3J A;  4DV2 E;  4B3R E;  2EL5 A;  3F6G A;  4DV4 E;  3KWR A;  3OML A;  2EN4 A;  3LLH A;  1NEI A;  2CSH A;  4DV1 E;  2EPA A;  3BID A;  4M30 A;  2I9I A;  4BMJ A;  1ZAA C;  2MKD A;  2N3G A;  1ZBQ A;  4TUG A;  5A2Q C;  3T1Y E;  2EOX A;  2DB2 A;  2ODR D;  2KHX A;  2ODR C;  1UIL A;  2EM5 A;  1SFE A;  2V86 A;  3M99 B;  2EL4 A;  1PJS A;  4BCA A;  3BBG A;  2D9H A;  3ADL A;  4WXD A;  2EM0 A;  1PKP A;  2EOY A;  3FIG A;  3F6H A;  4OX9 E;  2UUB E;  4X66 E;  2GHF A;  5LLQ A;  1T39 A;  2V83 A;  4DR5 E;  2ZM6 E;  4B3S E;  2GSL A;  2B7V A;  2CTD A;  2EMH A;  2YTP A;  1DGC A;  2M9A A;  4F9A B;  2EOQ A;  2EOJ A;  2EPZ A;  2YWQ A;  5FLX C;  2NA2 A;  4L5N C;  4GZN C;  2EQ3 A;  5LMN E;  1BBO A;  1YYO A;  3JU0 A;  2EM4 A;  5A6J A;  3VK6 A;  2V88 A;  1SR9 A;  2H36 X;  4NXN E;  2EPO A;  2EOR A;  2EML A;  4RH8 A;  5CFF E;  4KHP E;  1BB8 A;  4DMI A;  1X47 A;  2L3C A;  2PRT A;  1FKA E;  2JYA A;  4WX9 A;  2EOE A;  4BS9 A;  2RS6 A;  2EPP A;  2L6M A;  4R03 A;  1A1J A;  2DSY A;  4TUI A;  4JI6 E;  4DV6 E;  5KL2 A;  3RV0 A;  2JVA A;  3IWC A;  1G2F C;  2WZO A;  4M2Z A;  3ADJ A;  2EMW A;  3C4T A;  4OUN A;  4IS1 C;  1X49 A;  1T4O A;  3HXL A;  4R2A A;  1DQ3 A;  3O2R B;  4BBY A;  3RV1 A;  2EM6 A;  4B3M E;  3BF2 A;  3QG5 C;  1GQE A;  1J5E E;  5IV8 B;  1LLM C;  5AAS A;  2F8B A;  2EPR A;  3EPH A;  5LL6 R;  2LJU A;  4M0V A;  2CPN A;  4F6M A;  2HC5 A;  4DV3 E;  2RSM A;  1UHZ A;  4R2P A;  2JY9 A;  3K6Q A;  2UXD E;  1F2I G;  3N3W A;  1JK2 A;  2LUP B;  2EPK X;  2EMI A;  2DIX A;  4B3T E;  1XNQ E;  4F9B B;  2ELZ A;  2L8T A;  4JI5 E;  1RC5 A;  2EOZ A;  2G7H A;  2L92 A;  1T4L B;  3DJW A;  1IMU A;  2YU8 A;  3EPJ A;  1IBM E;  2B9D A;  4MLV A;  1GZ6 A;  5IT9 C;  5KL5 A;  1YYK A;  2EMB A;  2B7T A;  2YTD A;  1X3C A;  1ZBT A;  1X48 A;  2LO3 A;  2YPN A;  4KWY A;  5AC4 A;  5A6B A;  4O24 A;  1KJK A;  2A25 A;  2ELY A;  2JP9 A;  1B69 A;  4FK5 C;  2LTR A;  4DV5 E;  4K0K E;  4JI7 E;  1N3G A;  2EOO A;  3O2R A;  4WSG A;  4R8O A;  3IWB A;  1N34 E;  3J80 C;  2EMC A;  4Q35 B;  4ZYH A;  1WXR A;  5F3W A;  4GKJ E;  1YYW A;  4P7D A;  1BBG A;  1A1I A;  4BC7 A;  2EQ1 A;  2VE7 C;  2EOI A;  1I94 E;  3LML A;  2QVW A;  3P1X A;  1ZU1 A;  1KYQ A;  4GEQ B;  4O5G A;  2LJH A;  1QU6 A;  2M4I A;  2L2N A;  1IQO A;  4KZS A;  1A1F A;  1P47 A;  2DMY A;  5AE2 A;  4F9C B;  1QNT A;  2RSI A;  2LMZ A;  2NUE A;  2B3T B;  2BBG A;  5KL4 A;  2EM9 A;  1YZ9 A;  5ADZ A;  3AUZ A;  4OOG C;  2YTO A;  4GKK E;  4DR3 E;  2YTG A;  4LF8 E;  5KL3 A;  2DLQ A;  3JAM C;  3MHS C;  4JV5 E;  3ECR A;  2YT4 A;  2HGH A;  2L2M A;  2ADR A;  3ZOQ B;  5AE3 A;  2EMY A;  1Z1B A;  1TN9 A;  2LE2 A;  2NUF A;  4DV0 E;  2EP3 A;  2Q8U A;  4JI1 E;  2EN7 A;  1IBK E;  2V85 A;  3HTX A;  3J7Y p;  5A6A A;  1HNW E;  2EQ0 A;  2CT1 A;  4BC9 A;  2EMF A;  2EPU A;  2FFL A;  3C6K A;  1L4S A;  1XMQ E;  2K7I A;  2MC5 A;  4HTG A;  4LFC E;  4M9V C;  4ZYD A;  2KOU A;  2YTE A;  2MC6 A;  2EMK A;  2GPI A;  2LVH A;  2YSO A;  2JXP A;  1EH7 A;  2E1M A;  2V8Q B;  3MSW A;  2WBT A;  4N4R B;  3L00 A;  2LRS A;  2ENH A;  2EN2 A;  2EPC A;  4LFB E;  3EPK A;  4F6N A;  2EN1 A;  2A11 A;  4JI2 E;  4JYA E;  1IBL E;  2DRP A;  2EM8 A;  4YY3 E;  2MDR A;  1TF6 A;  5KL6 A;  2YRM A;  2EWL A;  1YFH A;  2EB1 A;  3RMP A;  2JOB A;  4LF6 E;  3AV0 A;  2J7J A;  3J81 C;  1N36 E;  2EOH A; 
#chains in the Genus database with same CATH homology
 3F6H A;  4X8W A;  4OX9 E;  2UUB E;  4YHH E;  3H09 A;  5BR8 E;  1N33 E;  4X66 E;  1HNZ E;  2LTR A;  2V87 A;  2M1S A;  4DV5 E;  4K0K E;  2RTX A;  2V83 A;  4I8O A;  4DR5 E;  1I4S A;  1STU A;  2JOX A;  4JI7 E;  2ZM6 E;  4JI3 E;  4B3S E;  3VYX A;  2GSL A;  3O2R A;  2B7V A;  4R8O A;  3IWB A;  1N34 E;  3J80 C;  4DR6 E;  4X62 E;  2IHR 1;  2VQE E;  3HQ1 A;  2N3H A;  4LF5 E;  1WXR A;  4GKJ E;  5F3W A;  1YYW A;  4P7D A;  1T4N A;  4F9A B;  4AQY E;  2UXC E;  1DI2 A;  4F54 A;  4BC7 A;  4L8N A;  2NA2 A;  5FLX C;  4L5N C;  5LMN E;  4NXM E;  2VE7 C;  1XNR E;  1YYO A;  3JU0 A;  1I94 E;  2F4V E;  3LML A;  3VK6 A;  2QVW A;  5IWA E;  2V88 A;  1SR9 A;  4LTY A;  4J8Z A;  4DV7 E;  2H36 X;  4JI5 E;  3P1X A;  2JR1 A;  2M7Q A;  2HHH E;  4LF4 E;  4NXN E;  4GEQ B;  2E5L E;  4P78 A;  2LJH A;  1QU6 A;  5CFF E;  4DUY E;  2UUA E;  2M4I A;  2L2N A;  4KHP E;  4KZS A;  4DMI A;  1X47 A;  4JI8 E;  2LBS B;  3J7A G;  2DMY A;  2L3C A;  5AE2 A;  4DR2 E;  1FKA E;  2UUC E;  4F9C B;  5T6J A;  2FV4 B;  1N32 E;  2LMZ A;  2YZT A;  2NUE A;  2B3T B;  4BS9 A;  1YZ9 A;  2RS6 A;  5ADZ A;  2L6M A;  3AUZ A;  4R03 A;  4OOG C;  2DSY A;  4TUI A;  4JI6 E;  4GKK E;  3DF6 A;  4DV6 E;  2FTX B;  4DR3 E;  4WYQ B;  3RV0 A;  2UXB E;  4LF8 E;  2JVA A;  1JFZ A;  2V89 A;  3HPZ A;  4JI4 E;  4DR4 E;  2JWO A;  2VF1 A;  2NUG A;  3IWC A;  3JAM C;  4LF7 E;  4JV5 E;  2WZO A;  4M2Z A;  3ADJ A;  3C4T A;  2YT4 A;  4OUN A;  2L2M A;  5AE1 A;  1X49 A;  1RC7 A;  1T4O A;  3HXL A;  3JTZ A;  2LUQ A;  3ZOQ B;  4DKK A;  1DQ3 A;  2LE2 A;  5AE3 A;  2L2K B;  2NUF A;  4DV0 E;  4JI1 E;  3O2R B;  4BBY A;  3RV1 A;  1IBK E;  1WHN A;  4WPY A;  2V85 A;  2RS7 A;  1U61 A;  1XMO E;  3HTX A;  4B3M E;  3J7Y p;  4LF9 E;  1HNW E;  4Q28 A;  1GQE A;  4WFT A;  4X65 E;  4DR1 E;  1J5E E;  1FJG E;  4BC9 A;  3T1H E;  5AAS A;  2F8B A;  3IWD A;  2FFL A;  2L3J A;  5LL6 R;  3OTO E;  4DV2 E;  4B3R E;  1WHQ A;  2CPN A;  4M0V A;  1XMQ E;  2MC5 A;  4LFC E;  2KOU A;  4DV3 E;  2RSM A;  3F6G A;  4DV4 E;  1UHZ A;  3VYY A;  4DR7 E;  2JY9 A;  2MC6 A;  3K6Q A;  1EKZ A;  2UXD E;  2K4V A;  3ADG A;  3HPS A;  3KWR A;  3N3W A;  4LFA E;  3OML A;  5LMU E;  2LUP B;  4DUZ E;  4JI0 E;  2E1M A;  3LLH A;  2KON A;  2V8Q B;  3MSW A;  2DIX A;  4B3T E;  1XNQ E;  4F9B B;  4DV1 E;  1HNX E;  2LRS A;  4X64 E;  2L8T A;  2EZ6 A;  1RC5 A;  2G7H A;  2FGG A;  2L92 A;  1T4L B;  4M30 A;  3DJW A;  4LU9 A;  4BMJ A;  4LFB E;  1J26 A;  3ADI A;  1HR0 E;  1IBM E;  2N3G A;  1ZBQ A;  4TUG A;  2LTS A;  5DNY A;  4WSP A;  2B9D A;  5A2Q C;  1O0W A;  1GZ6 A;  3T1Y E;  1RQ0 A;  2DB2 A;  2A11 A;  2ODR D;  5IT9 C;  2KHX A;  2UU9 E;  1YYK A;  4JI2 E;  4JYA E;  2ODR C;  1UIL A;  2VQF E;  1IBL E;  2B7T A;  2V86 A;  4YY3 E;  1ZBT A;  2MDR A;  3C4B A;  4BCA A;  1X48 A;  3ADL A;  2EWL A;  2EB1 A;  3RMP A;  2JOB A;  2L33 A;  3FIG A;  1PKP A;  3AV0 A;  4LF6 E;  3J81 C;  1N36 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...