4M30A

Crystal structure of rnase iii complexed with double-stranded rna and amp (type ii cleavage)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
220
structure length
220
Chain Sequence
KMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNase III: Genetics and Function; Structure and Mechanism.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
molecule keywords Ribonuclease 3
total genus 78
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 4m30A01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4m30A02
5IWAE 1RQ0A 4LFCE 4GKKE 2NUFA 1RC7A 2UXBE 1X47A 1O0WA 2L2MA 4B3TE 4DR7E 2DB2A 1N36E 3VYXA 2L2NA 1T4LB 2LJHA 4WYQB 2RTXA 2CPNA 2UUAE 2A11A 4LF5E 1FJGE 1GQEA 2KHXA 2E5LE 4DV7E 2LRSA 4OUNA 4JI8E 1EKZA 3OTOE 1UILA 1HR0E 1WHQA 2UU9E 2F4VE 5CFFE 4DR2E 1XNQE 1JFZA 3LLHA 4JI5E 4OOGC 1IBME 2B3TB 1IBLE 1J5EE 1FKAE 4GKJE 5LMUE 4JI0E 2LUPB 1N32E 4DV6E 3HTXA 1HNWE 4X62E 1YYWA 4DR3E 3C4BA 2NA2A 3RV1A 2UUBE 2DIXA 4JI1E 2LUQA 4JYAE 2HHHE 1HNZE 2LTRA 2B7TA 3C4TA 4JI4E 4AQYE 4NXME 4M30A 2UXCE 4OX9E 1XNRE 2QVWA 1T4OA 2N3HA 1YYOA 2L33A 2GSLA 1YYKA 2RSMA 4LF8E 5BR8E 3O2RB 2ZM6E 4DV0E 4WFTA 4DKKA 3VYYA 1YZ9A 4DV4E 4JI3E 1X49A 2B7VA 4LF7E 4YY3E 2UUCE 3P1XA 3ADLA 2IHR1 2DMYA 4JI7E 4DR4E 1PKPA 3ADIA 1WHNA 1QU6A 4YHHE 4JV5E 4NXNE 4X65E 1XMQE 3O2RA 2UXDE 1XMOE 5LMNE 4DR6E 2RS7A 4M2ZA 1RC5A 4DR1E 1N33E 2EZ6A 2JVAA 3RV0A 1STUA 4LF4E 1I94E 4X64E 3J7Yp 1U61A 4KHPE 4LF6E 3N3WA 4B3ME 2VQFE 2NUEA 2NUGA 4JI6E 4JI2E 2LBSB 1DI2A 4DV5E 1J26A 1X48A 4DR5E 2EB1A 3T1HE 4LFAE 2FFLA 4B3RE 2N3GA 4DV1E 3T1YE 4DV3E 2YT4A 3ADGA 1HNXE 1N34E 2LTSA 4LFBE 4X8WA 4DUYE 4K0KE 2RS6A 4DUZE 4B3SE 2VQEE 1ZBTA 2L3CA 4LF9E 1IBKE 1I4SA 2L2KB 1T4NA 3ADJA 4DV2E 2JY9A 4X66E 2MDRA 1UHZA 2L3JA
chains in the Genus database with same CATH superfamily
5IWAE 4NZVA 3EPKA 3MHHC 1RC7A 3VHTB 1A1IA 2UXBE 2EN1A 5LL6R 4DR7E 1PJSA 2EN3A 2EOIA 1LLMC 2LJHA 4WYQB 2CPNA 2A11A 2A25A 1GQEA 2KHXA 2E5LE 2FV4B 2LRSA 1X6HA 1YUJA 1SFEA 2CT1A 2MKNA 2EM8A 2UU9E 1GZ6A 3F6GA 2K4VA 2JOXA 1JFZA 2R76A 3LLHA 4O4KA 5A6BD 2JP9A 2EN6A 2WBSA 5LMUE 2LUPB 1HNWE 2LMZA 2ODRD 4X62E 3C4BA 4JYAE 2HHHE 2YU5A 1HNZE 5KL2A 4BC7A 1X6FA 4JI4E 2I9IA 4OX9E 1XNRE 1A1KA 4R2PA 3C6KA 3DJWA 2EQ3A 4GEQB 4KWYA 5BR8E 2HJJA 3HXLA 4WFTA 4DKKA 3VYYA 3OMLA 1A1FA 1G2DC 4ZYEA 4R8OA 3ADLA 2YSPA 2IHR1 2LJUA 4JI7E 2CTDA 2E1MA 4DR4E 1WHNA 2EP3A 2EPCA 4KZSA 2ENHA 4R2AA 2YTIA 1T39A 2ELZA 1XMOE 1AH5A 1RC5A 4BMJA 4DR1E 5A6KA 1L4SA 1F2IG 2YRHA 4KHPE 1NEIA 1MEYC 2L6MA 2RQLA 3AUZA 2NUEA 1P47A 4BS9A 4BHCA 1J26A 2H36X 3IWDA 1BBOA 4ZYHA 1A1LA 4LFAE 2FFLA 2WBTA 2YT4A 3ADGA 5A69A 3IWCA 2EPAA 2EMIA 4DUYE 4X9JA 2RS6A 4DUZE 1WRJA 2R1FA 5F3WA 2VQEE 3QG5C 2EM2A 4LF9E 2YTPA 4DV2E 2JY9A 2EMHA 2GHFA 2MDRA 2WZOA 2EPZA 2NUFA 2KOUA 3K6QA 2DRPA 4F2JC 2L2MA 4M0VA 2WCC3 3KWRA 2DB2A 4IJDA 4F9CB 3VYXA 1BBGA 2UUAE 1TF3A 4LF5E 5A6JA 2EOYA 2JR1A 3MSWA 1FJGE 1ZR9A 4RH8A 4DV7E 4OUNA 2RPCA 1A1GA 2EMGA 1G2FC 3JU0A 3UK3C 1WHQA 1JK1A 4F9BB 2F4VE 4RHBB 4DR2E 2EM0A 1A1HA 4J8ZA 2YTOA 1NCSA 1J5EE 1FKAE 4WPYA 4NHRA 1ZU1A 2NA2A 2LUQA 2EM3A 5AE1A 4LU9A 2B7TA 2DSYA 4NXME 2EM7A 4P78A 4M30A 4ZYDA 5KL7A 3BBGA 2QVWA 5AE3A 2N3HA 2HGHA 3HPSA 1YYOA 2L33A 1YYKA 2RSMA 4F9AB 3BF2A 3O2RB 5AC4A 4DV0E 2EPUA 2L92A 2JWOA 1X49A 2B7VA 4LF7E 1EH7A 1PJTA 2DMYA 1PKPA 3THOB 3J7AG 5KL5A 1QU6A 2EL6A 1XMQE 3O2RA 1PJQA 2MC6A 2EL4A 5A6BA 5LMNE 4BC9A 1WJPA 5A6AA 2EPLX 3HQ1A 1STUA 1I94E 1YFHA 4R2CA 4LF6E 4B3ME 1SR9A 3F6HA 4FK5C 2D9HA 4DV5E 2YZTA 1ZTDA 4N4RB 2G7HA 2EMXA 2F8BA 4B3RE 2EPRA 2JOBA 1JK2A 4F6NA 2YTDA 1HNXE 1IQOA 1X6EA 2EPMX 2GLIA 5AE2A 4B3SE 2LO3A 2L3CA 1I4SA 1T4NA 3M99B 4HEIA 2EE8A 4X66E 1IQSA 3HPZA 2V8QB 2EPKX 4O24A 1RQ0A 1X47A 1A1JA 1X5WA 2I13A 2EWLA 3IWBA 2BB8A 2V87A 4JI8E 3OTOE 2LCEA 5CFFE 3LMLA 2EOHA 1XNQE 2JYAA 2EOMA 2YTNA 2YSOA 4OOGC 2FGGA 2B3TB 1IBLE 1KJKA 1GTKA 4R03A 5KL4A 2BBGA 2YU8A 2M1SA 4L5NC 5T6JA 2B9DA 1N32E 3HTXA 2CSHA 4BBYA 4R2RA 3RV1A 4JI1E 2YWQA 4GZNC 5TSEA 2EORA 2EPPA 2V89A 2ENAA 2UXCE 3VK6A 2EMLA 2LVHA 1T4OA 2ADRA 3THNA 2GSLA 2EM5A 2EQ0A 2K7IA 1N3GA 2PRTA 4DV4E 1UBDC 2YTQA 4R2SA 2MC5A 1TN9A 1KYQA 2EJ4A 2EMCA 2LT7A 2EL5A 2V88A 3FIGA 3KZZA 4WXDA 2EMKA 4YHHE 4WXCA 2EMZA 4NXNE 2EPXA 2M4IA 3L00A 5AASA 1Z1BA 4R2EA 5KL6A 2JPAA 1YSAC 2EM4A 2UXDE 3H09A 3J81C 2DMIA 2EMAA 1ZBQA 4DR6E 4M2ZA 5ADZA 2E72A 2EZ6A 1N33E 3RV0A 4LF4E 4X64E 3J7Yp 1U61A 2FTXB 2V86A 1BB8A 3N3WA 2EM9A 2NABA 1RMDA 2VQFE 2YRMA 4JI6E 4JI2E 2EOEA 4DR5E 2EB1A 3T1HE 5A2QC 5IXMB 2VE7C 1YPNA 4R2DA 2DLKA 4DV1E 3T1YE 2EOJA 3TQMA 4LFBE 4X8WA 4IS1C 4WSPA 4K0KE 4BCAA 4LTYA 3ADJA 2LE2A 3AV0A 1UHZA 1IMUA 2YRKA 4LFCE 4GKKE 3KZYA 3ZOQB 2EOXA 2EQ1A 1ZAAC 1PDAA 2WBUA 1O0WA 2MKDA 4B3TE 1N36E 2L2NA 1T4LB 1TF6A 2RTXA 1YUIA 3EPLA 2EN4A 2EMBA 1AAYA 2YTJA 1EKZA 1UILA 2ODRC 2KONA 1HR0E 2EPNA 4TUIA 1QNTA 4TUGA 4F6MA 2Q8UA 4Q28A 2EMWA 4JI5E 2EM6A 1IBME 2YTEA 2EN7A 4MLVA 4WSGA 5KL3A 4GKJE 5FLXC 2HC5A 3DF6A 4JI0E 2VF1A 4DV6E 1YYWA 4L8NA 4DR3E 2UUBE 2DIXA 2DGCA 2V85A 2J7JA 2LV2A 4I8OA 2EOZA 2LTRA 2YPNA 4HTGA 5AC5A 3C4TA 3JTZA 4AQYE 3BGHA 4F54A 2V83A 3EPHA 4BHBA 2EN8A 2ENCA 4LF8E 2ZM6E 1YZ9A 4JI3E 4WX9A 4P7DA 2YTFA 4YY3E 2UUCE 3P1XA 4M9VC 2MDGA 2RSIA 4Q35B 1UN6B 3ADIA 4R2QA 2N8XA 4JV5E 4X65E 3RMPA 5IV8B 1X3CA 3EQ1A 2EOOA 3J80C 2JXPA 1DQ3A 2L8TA 2RS7A 2EOQA 2EMFA 2JVAA 2EN2A 1EH8A 5IT9C 2ELYA 2EPOA 4O5GA 1EH6A 2NUGA 2LBSB 1DI2A 1MGTA 1X48A 3JAMC 3ECRA 2N3GA 2M7QA 3EPJA 3BIDA 2YTGA 2GPIA 3C6MA 2VRDA 4DMIA 2M9AA 4DV3E 2DLQA 1N34E 2LTSA 5DNYA 1T38A 2EOFA 1WXRA 4O43A 2EMYA 1ZBTA 1IBKE 1B69A 2L2KB 2EOSA 4ZYGA 4MLQA 1DGCA 5LLQA 2L3JA 3MHSC
chains in the Genus database with same CATH topology
5IWAE 1RQ0A 4LFCE 3ZOQB 2KOUA 2NUFA 4GKKE 1RC7A 3K6QA 2UXBE 1X47A 1O0WA 2L2MA 4M0VA 5LL6R 3KWRA 2DB2A 1N36E 4F9CB 4B3TE 2L2NA 1T4LB 3VYXA 2EWLA 2LJHA 2RTXA 2CPNA 4WYQB 2UUAE 3IWBA 2A11A 4LF5E 1FJGE 2JR1A 3MSWA 1GQEA 2KHXA 2E5LE 2V87A 4DV7E 2FV4B 2LRSA 4OUNA 4JI8E 1EKZA 3OTOE 1UILA 2ODRC 3JU0A 2KONA 1WHQA 1HR0E 4F9BB 2UU9E 2F4VE 1GZ6A 3F6GA 5CFFE 4TUIA 2K4VA 3LMLA 4TUGA 4DR2E 1XNQE 2JOXA 2UUBE 4Q28A 1JFZA 3LLHA 4J8ZA 4JI5E 4OOGC 1IBME 2FGGA 2B3TB 1IBLE 1J5EE 1FKAE 4GKJE 5FLXC 4R03A 5LMUE 3DF6A 4JI0E 2M1SA 4L5NC 4WPYA 2B9DA 5T6JA 2LUPB 2VF1A 1N32E 4DV6E 3HTXA 2LMZA 2ODRD 1YYWA 4L8NA 3C4BA 2NA2A 3RV1A 4BBYA 2DIXA 4X62E 2LUQA 4DR3E 2V85A 4I8OA 2HHHE 5AE1A 4LU9A 1HNZE 2LTRA 2V89A 2B7TA 2DSYA 3C4TA 3JTZA 4BC7A 4AQYE 4JI4E 4P78A 4NXME 4M30A 2UXCE 4OX9E 3VK6A 4F54A 1XNRE 2V83A 2QVWA 1T4OA 5AE3A 2N3HA 3DJWA 1YYOA 2L33A 2GSLA 1YYKA 2RSMA 3HPSA 4GEQB 4F9AB 5BR8E 3O2RB 4LF8E 2ZM6E 4DV0E 2L92A 3HXLA 4WFTA 4DKKA 3OMLA 3VYYA 2JWOA 1YZ9A 4DV4E 4JI3E 1X49A 2B7VA 4P7DA 4R8OA 4LF7E 4YY3E 2UUCE 3P1XA 2MC5A 2IHR1 3ADLA 2DMYA 2V88A 3FIGA 4JI7E 2E1MA 1J26A 4DR4E 1PKPA 4JI2E 3J7AG 3ADIA 1WHNA 1QU6A 4YHHE 4KZSA 4JV5E 4NXNE 4X65E 2M4IA 5AASA 3RMPA 1XMQE 3O2RA 2MC6A 4JYAE 2UXDE 3H09A 3J80C 1ZBQA 1XMOE 1DQ3A 2L8TA 4BC9A 5LMNE 4DR6E 2RS7A 4M2ZA 1RC5A 5ADZA 4BMJA 4DR1E 2EZ6A 1N33E 2JVAA 3RV0A 3HQ1A 1STUA 4LF4E 1I94E 5IT9C 4X64E 3J7Yp 1U61A 4KHPE 2FTXB 2V86A 2L6MA 3N3WA 3AUZA 4LF6E 4B3ME 2VQFE 2NUEA 2NUGA 1SR9A 4BS9A 3F6HA 2LBSB 4JI6E 4DV5E 2H36X 3IWDA 1X48A 4DR5E 1DI2A 2EB1A 3JAMC 2YZTA 5A2QC 3T1HE 4LFAE 2FFLA 4B3RE 2G7HA 2F8BA 2N3GA 2VE7C 2M7QA 4JI1E 4DR7E 4DV1E 4DMIA 2JOBA 3T1YE 4DV3E 2YT4A 3ADGA 1HNXE 1N34E 2LTSA 5DNYA 3IWCA 4LFBE 4X8WA 5AE2A 4WSPA 1WXRA 4DUYE 4K0KE 2RS6A 4DUZE 1HNWE 4BCAA 5F3WA 4B3SE 2VQEE 1ZBTA 2L3CA 4LF9E 1IBKE 4LTYA 1I4SA 2L2KB 1T4NA 3ADJA 4DV2E 2JY9A 2LE2A 4X66E 3AV0A 2MDRA 2WZOA 1UHZA 3HPZA 2V8QB 2L3JA 3J81C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA E;  1RQ0 A;  4LFC E;  4GKK E;  2NUF A;  1RC7 A;  2UXB E;  1X47 A;  1O0W A;  2L2M A;  4B3T E;  4DR7 E;  2DB2 A;  1N36 E;  3VYX A;  2L2N A;  1T4L B;  2LJH A;  4WYQ B;  2RTX A;  2CPN A;  2UUA E;  2A11 A;  4LF5 E;  1FJG E;  1GQE A;  2KHX A;  2E5L E;  4DV7 E;  2LRS A;  4OUN A;  4JI8 E;  1EKZ A;  3OTO E;  1UIL A;  1HR0 E;  1WHQ A;  2UU9 E;  2F4V E;  5CFF E;  4DR2 E;  1XNQ E;  1JFZ A;  3LLH A;  4JI5 E;  4OOG C;  1IBM E;  2B3T B;  1IBL E;  1J5E E;  1FKA E;  4GKJ E;  5LMU E;  4JI0 E;  2LUP B;  1N32 E;  4DV6 E;  3HTX A;  1HNW E;  4X62 E;  1YYW A;  4DR3 E;  3C4B A;  2NA2 A;  3RV1 A;  2UUB E;  2DIX A;  4JI1 E;  2LUQ A;  4JYA E;  2HHH E;  1HNZ E;  2LTR A;  2B7T A;  3C4T A;  4JI4 E;  4AQY E;  4NXM E;  4M30 A;  2UXC E;  4OX9 E;  1XNR E;  2QVW A;  1T4O A;  2N3H A;  1YYO A;  2L33 A;  2GSL A;  1YYK A;  2RSM A;  4LF8 E;  5BR8 E;  3O2R B;  2ZM6 E;  4DV0 E;  4WFT A;  4DKK A;  3VYY A;  1YZ9 A;  4DV4 E;  4JI3 E;  1X49 A;  2B7V A;  4LF7 E;  4YY3 E;  2UUC E;  3P1X A;  3ADL A;  2IHR 1;  2DMY A;  4JI7 E;  4DR4 E;  1PKP A;  3ADI A;  1WHN A;  1QU6 A;  4YHH E;  4JV5 E;  4NXN E;  4X65 E;  1XMQ E;  3O2R A;  2UXD E;  1XMO E;  5LMN E;  4DR6 E;  2RS7 A;  4M2Z A;  1RC5 A;  4DR1 E;  1N33 E;  2EZ6 A;  2JVA A;  3RV0 A;  1STU A;  4LF4 E;  1I94 E;  4X64 E;  3J7Y p;  1U61 A;  4KHP E;  4LF6 E;  3N3W A;  4B3M E;  2VQF E;  2NUE A;  2NUG A;  4JI6 E;  4JI2 E;  2LBS B;  1DI2 A;  4DV5 E;  1J26 A;  1X48 A;  4DR5 E;  2EB1 A;  3T1H E;  4LFA E;  2FFL A;  4B3R E;  2N3G A;  4DV1 E;  3T1Y E;  4DV3 E;  2YT4 A;  3ADG A;  1HNX E;  1N34 E;  2LTS A;  4LFB E;  4X8W A;  4DUY E;  4K0K E;  2RS6 A;  4DUZ E;  4B3S E;  2VQE E;  1ZBT A;  2L3C A;  4LF9 E;  1IBK E;  1I4S A;  2L2K B;  1T4N A;  3ADJ A;  4DV2 E;  2JY9 A;  4X66 E;  2MDR A;  1UHZ A;  2L3J A; 
#chains in the Genus database with same CATH topology
 5IWA E;  4NZV A;  3EPK A;  3MHH C;  1RC7 A;  3VHT B;  1A1I A;  2UXB E;  2EN1 A;  5LL6 R;  4DR7 E;  1PJS A;  2EN3 A;  2EOI A;  1LLM C;  2LJH A;  4WYQ B;  2CPN A;  2A11 A;  2A25 A;  1GQE A;  2KHX A;  2E5L E;  2FV4 B;  2LRS A;  1X6H A;  1YUJ A;  1SFE A;  2CT1 A;  2MKN A;  2EM8 A;  2UU9 E;  1GZ6 A;  3F6G A;  2K4V A;  2JOX A;  1JFZ A;  2R76 A;  3LLH A;  4O4K A;  5A6B D;  2JP9 A;  2EN6 A;  2WBS A;  5LMU E;  2LUP B;  1HNW E;  2LMZ A;  2ODR D;  4X62 E;  3C4B A;  4JYA E;  2HHH E;  2YU5 A;  1HNZ E;  5KL2 A;  4BC7 A;  1X6F A;  4JI4 E;  2I9I A;  4OX9 E;  1XNR E;  1A1K A;  4R2P A;  3C6K A;  3DJW A;  2EQ3 A;  4GEQ B;  4KWY A;  5BR8 E;  2HJJ A;  3HXL A;  4WFT A;  4DKK A;  3VYY A;  3OML A;  1A1F A;  1G2D C;  4ZYE A;  4R8O A;  3ADL A;  2YSP A;  2IHR 1;  2LJU A;  4JI7 E;  2CTD A;  2E1M A;  4DR4 E;  1WHN A;  2EP3 A;  2EPC A;  4KZS A;  2ENH A;  4R2A A;  2YTI A;  1T39 A;  2ELZ A;  1XMO E;  1AH5 A;  1RC5 A;  4BMJ A;  4DR1 E;  5A6K A;  1L4S A;  1F2I G;  2YRH A;  4KHP E;  1NEI A;  1MEY C;  2L6M A;  2RQL A;  3AUZ A;  2NUE A;  1P47 A;  4BS9 A;  4BHC A;  1J26 A;  2H36 X;  3IWD A;  1BBO A;  4ZYH A;  1A1L A;  4LFA E;  2FFL A;  2WBT A;  2YT4 A;  3ADG A;  5A69 A;  3IWC A;  2EPA A;  2EMI A;  4DUY E;  4X9J A;  2RS6 A;  4DUZ E;  1WRJ A;  2R1F A;  5F3W A;  2VQE E;  3QG5 C;  2EM2 A;  4LF9 E;  2YTP A;  4DV2 E;  2JY9 A;  2EMH A;  2GHF A;  2MDR A;  2WZO A;  2EPZ A;  2NUF A;  2KOU A;  3K6Q A;  2DRP A;  4F2J C;  2L2M A;  4M0V A;  2WCC 3;  3KWR A;  2DB2 A;  4IJD A;  4F9C B;  3VYX A;  1BBG A;  2UUA E;  1TF3 A;  4LF5 E;  5A6J A;  2EOY A;  2JR1 A;  3MSW A;  1FJG E;  1ZR9 A;  4RH8 A;  4DV7 E;  4OUN A;  2RPC A;  1A1G A;  2EMG A;  1G2F C;  3JU0 A;  3UK3 C;  1WHQ A;  1JK1 A;  4F9B B;  2F4V E;  4RHB B;  4DR2 E;  2EM0 A;  1A1H A;  4J8Z A;  2YTO A;  1NCS A;  1J5E E;  1FKA E;  4WPY A;  4NHR A;  1ZU1 A;  2NA2 A;  2LUQ A;  2EM3 A;  5AE1 A;  4LU9 A;  2B7T A;  2DSY A;  4NXM E;  2EM7 A;  4P78 A;  4M30 A;  4ZYD A;  5KL7 A;  3BBG A;  2QVW A;  5AE3 A;  2N3H A;  2HGH A;  3HPS A;  1YYO A;  2L33 A;  1YYK A;  2RSM A;  4F9A B;  3BF2 A;  3O2R B;  5AC4 A;  4DV0 E;  2EPU A;  2L92 A;  2JWO A;  1X49 A;  2B7V A;  4LF7 E;  1EH7 A;  1PJT A;  2DMY A;  1PKP A;  3THO B;  3J7A G;  5KL5 A;  1QU6 A;  2EL6 A;  1XMQ E;  3O2R A;  1PJQ A;  2MC6 A;  2EL4 A;  5A6B A;  5LMN E;  4BC9 A;  1WJP A;  5A6A A;  2EPL X;  3HQ1 A;  1STU A;  1I94 E;  1YFH A;  4R2C A;  4LF6 E;  4B3M E;  1SR9 A;  3F6H A;  4FK5 C;  2D9H A;  4DV5 E;  2YZT A;  1ZTD A;  4N4R B;  2G7H A;  2EMX A;  2F8B A;  4B3R E;  2EPR A;  2JOB A;  1JK2 A;  4F6N A;  2YTD A;  1HNX E;  1IQO A;  1X6E A;  2EPM X;  2GLI A;  5AE2 A;  4B3S E;  2LO3 A;  2L3C A;  1I4S A;  1T4N A;  3M99 B;  4HEI A;  2EE8 A;  4X66 E;  1IQS A;  3HPZ A;  2V8Q B;  2EPK X;  4O24 A;  1RQ0 A;  1X47 A;  1A1J A;  1X5W A;  2I13 A;  2EWL A;  3IWB A;  2BB8 A;  2V87 A;  4JI8 E;  3OTO E;  2LCE A;  5CFF E;  3LML A;  2EOH A;  1XNQ E;  2JYA A;  2EOM A;  2YTN A;  2YSO A;  4OOG C;  2FGG A;  2B3T B;  1IBL E;  1KJK A;  1GTK A;  4R03 A;  5KL4 A;  2BBG A;  2YU8 A;  2M1S A;  4L5N C;  5T6J A;  2B9D A;  1N32 E;  3HTX A;  2CSH A;  4BBY A;  4R2R A;  3RV1 A;  4JI1 E;  2YWQ A;  4GZN C;  5TSE A;  2EOR A;  2EPP A;  2V89 A;  2ENA A;  2UXC E;  3VK6 A;  2EML A;  2LVH A;  1T4O A;  2ADR A;  3THN A;  2GSL A;  2EM5 A;  2EQ0 A;  2K7I A;  1N3G A;  2PRT A;  4DV4 E;  1UBD C;  2YTQ A;  4R2S A;  2MC5 A;  1TN9 A;  1KYQ A;  2EJ4 A;  2EMC A;  2LT7 A;  2EL5 A;  2V88 A;  3FIG A;  3KZZ A;  4WXD A;  2EMK A;  4YHH E;  4WXC A;  2EMZ A;  4NXN E;  2EPX A;  2M4I A;  3L00 A;  5AAS A;  1Z1B A;  4R2E A;  5KL6 A;  2JPA A;  1YSA C;  2EM4 A;  2UXD E;  3H09 A;  3J81 C;  2DMI A;  2EMA A;  1ZBQ A;  4DR6 E;  4M2Z A;  5ADZ A;  2E72 A;  2EZ6 A;  1N33 E;  3RV0 A;  4LF4 E;  4X64 E;  3J7Y p;  1U61 A;  2FTX B;  2V86 A;  1BB8 A;  3N3W A;  2EM9 A;  2NAB A;  1RMD A;  2VQF E;  2YRM A;  4JI6 E;  4JI2 E;  2EOE A;  4DR5 E;  2EB1 A;  3T1H E;  5A2Q C;  5IXM B;  2VE7 C;  1YPN A;  4R2D A;  2DLK A;  4DV1 E;  3T1Y E;  2EOJ A;  3TQM A;  4LFB E;  4X8W A;  4IS1 C;  4WSP A;  4K0K E;  4BCA A;  4LTY A;  3ADJ A;  2LE2 A;  3AV0 A;  1UHZ A;  1IMU A;  2YRK A;  4LFC E;  4GKK E;  3KZY A;  3ZOQ B;  2EOX A;  2EQ1 A;  1ZAA C;  1PDA A;  2WBU A;  1O0W A;  2MKD A;  4B3T E;  1N36 E;  2L2N A;  1T4L B;  1TF6 A;  2RTX A;  1YUI A;  3EPL A;  2EN4 A;  2EMB A;  1AAY A;  2YTJ A;  1EKZ A;  1UIL A;  2ODR C;  2KON A;  1HR0 E;  2EPN A;  4TUI A;  1QNT A;  4TUG A;  4F6M A;  2Q8U A;  4Q28 A;  2EMW A;  4JI5 E;  2EM6 A;  1IBM E;  2YTE A;  2EN7 A;  4MLV A;  4WSG A;  5KL3 A;  4GKJ E;  5FLX C;  2HC5 A;  3DF6 A;  4JI0 E;  2VF1 A;  4DV6 E;  1YYW A;  4L8N A;  4DR3 E;  2UUB E;  2DIX A;  2DGC A;  2V85 A;  2J7J A;  2LV2 A;  4I8O A;  2EOZ A;  2LTR A;  2YPN A;  4HTG A;  5AC5 A;  3C4T A;  3JTZ A;  4AQY E;  3BGH A;  4F54 A;  2V83 A;  3EPH A;  4BHB A;  2EN8 A;  2ENC A;  4LF8 E;  2ZM6 E;  1YZ9 A;  4JI3 E;  4WX9 A;  4P7D A;  2YTF A;  4YY3 E;  2UUC E;  3P1X A;  4M9V C;  2MDG A;  2RSI A;  4Q35 B;  1UN6 B;  3ADI A;  4R2Q A;  2N8X A;  4JV5 E;  4X65 E;  3RMP A;  5IV8 B;  1X3C A;  3EQ1 A;  2EOO A;  3J80 C;  2JXP A;  1DQ3 A;  2L8T A;  2RS7 A;  2EOQ A;  2EMF A;  2JVA A;  2EN2 A;  1EH8 A;  5IT9 C;  2ELY A;  2EPO A;  4O5G A;  1EH6 A;  2NUG A;  2LBS B;  1DI2 A;  1MGT A;  1X48 A;  3JAM C;  3ECR A;  2N3G A;  2M7Q A;  3EPJ A;  3BID A;  2YTG A;  2GPI A;  3C6M A;  2VRD A;  4DMI A;  2M9A A;  4DV3 E;  2DLQ A;  1N34 E;  2LTS A;  5DNY A;  1T38 A;  2EOF A;  1WXR A;  4O43 A;  2EMY A;  1ZBT A;  1IBK E;  1B69 A;  2L2K B;  2EOS A;  4ZYG A;  4MLQ A;  1DGC A;  5LLQ A;  2L3J A;  3MHS C; 
#chains in the Genus database with same CATH homology
 5IWA E;  1RQ0 A;  4LFC E;  3ZOQ B;  2KOU A;  2NUF A;  4GKK E;  1RC7 A;  3K6Q A;  2UXB E;  1X47 A;  1O0W A;  2L2M A;  4M0V A;  5LL6 R;  3KWR A;  2DB2 A;  1N36 E;  4F9C B;  4B3T E;  2L2N A;  1T4L B;  3VYX A;  2EWL A;  2LJH A;  2RTX A;  2CPN A;  4WYQ B;  2UUA E;  3IWB A;  2A11 A;  4LF5 E;  1FJG E;  2JR1 A;  3MSW A;  1GQE A;  2KHX A;  2E5L E;  2V87 A;  4DV7 E;  2FV4 B;  2LRS A;  4OUN A;  4JI8 E;  1EKZ A;  3OTO E;  1UIL A;  2ODR C;  3JU0 A;  2KON A;  1WHQ A;  1HR0 E;  4F9B B;  2UU9 E;  2F4V E;  1GZ6 A;  3F6G A;  5CFF E;  4TUI A;  2K4V A;  3LML A;  4TUG A;  4DR2 E;  1XNQ E;  2JOX A;  2UUB E;  4Q28 A;  1JFZ A;  3LLH A;  4J8Z A;  4JI5 E;  4OOG C;  1IBM E;  2FGG A;  2B3T B;  1IBL E;  1J5E E;  1FKA E;  4GKJ E;  5FLX C;  4R03 A;  5LMU E;  3DF6 A;  4JI0 E;  2M1S A;  4L5N C;  4WPY A;  2B9D A;  5T6J A;  2LUP B;  2VF1 A;  1N32 E;  4DV6 E;  3HTX A;  2LMZ A;  2ODR D;  1YYW A;  4L8N A;  3C4B A;  2NA2 A;  3RV1 A;  4BBY A;  2DIX A;  4X62 E;  2LUQ A;  4DR3 E;  2V85 A;  4I8O A;  2HHH E;  5AE1 A;  4LU9 A;  1HNZ E;  2LTR A;  2V89 A;  2B7T A;  2DSY A;  3C4T A;  3JTZ A;  4BC7 A;  4AQY E;  4JI4 E;  4P78 A;  4NXM E;  4M30 A;  2UXC E;  4OX9 E;  3VK6 A;  4F54 A;  1XNR E;  2V83 A;  2QVW A;  1T4O A;  5AE3 A;  2N3H A;  3DJW A;  1YYO A;  2L33 A;  2GSL A;  1YYK A;  2RSM A;  3HPS A;  4GEQ B;  4F9A B;  5BR8 E;  3O2R B;  4LF8 E;  2ZM6 E;  4DV0 E;  2L92 A;  3HXL A;  4WFT A;  4DKK A;  3OML A;  3VYY A;  2JWO A;  1YZ9 A;  4DV4 E;  4JI3 E;  1X49 A;  2B7V A;  4P7D A;  4R8O A;  4LF7 E;  4YY3 E;  2UUC E;  3P1X A;  2MC5 A;  2IHR 1;  3ADL A;  2DMY A;  2V88 A;  3FIG A;  4JI7 E;  2E1M A;  1J26 A;  4DR4 E;  1PKP A;  4JI2 E;  3J7A G;  3ADI A;  1WHN A;  1QU6 A;  4YHH E;  4KZS A;  4JV5 E;  4NXN E;  4X65 E;  2M4I A;  5AAS A;  3RMP A;  1XMQ E;  3O2R A;  2MC6 A;  4JYA E;  2UXD E;  3H09 A;  3J80 C;  1ZBQ A;  1XMO E;  1DQ3 A;  2L8T A;  4BC9 A;  5LMN E;  4DR6 E;  2RS7 A;  4M2Z A;  1RC5 A;  5ADZ A;  4BMJ A;  4DR1 E;  2EZ6 A;  1N33 E;  2JVA A;  3RV0 A;  3HQ1 A;  1STU A;  4LF4 E;  1I94 E;  5IT9 C;  4X64 E;  3J7Y p;  1U61 A;  4KHP E;  2FTX B;  2V86 A;  2L6M A;  3N3W A;  3AUZ A;  4LF6 E;  4B3M E;  2VQF E;  2NUE A;  2NUG A;  1SR9 A;  4BS9 A;  3F6H A;  2LBS B;  4JI6 E;  4DV5 E;  2H36 X;  3IWD A;  1X48 A;  4DR5 E;  1DI2 A;  2EB1 A;  3JAM C;  2YZT A;  5A2Q C;  3T1H E;  4LFA E;  2FFL A;  4B3R E;  2G7H A;  2F8B A;  2N3G A;  2VE7 C;  2M7Q A;  4JI1 E;  4DR7 E;  4DV1 E;  4DMI A;  2JOB A;  3T1Y E;  4DV3 E;  2YT4 A;  3ADG A;  1HNX E;  1N34 E;  2LTS A;  5DNY A;  3IWC A;  4LFB E;  4X8W A;  5AE2 A;  4WSP A;  1WXR A;  4DUY E;  4K0K E;  2RS6 A;  4DUZ E;  1HNW E;  4BCA A;  5F3W A;  4B3S E;  2VQE E;  1ZBT A;  2L3C A;  4LF9 E;  1IBK E;  4LTY A;  1I4S A;  2L2K B;  1T4N A;  3ADJ A;  4DV2 E;  2JY9 A;  2LE2 A;  4X66 E;  3AV0 A;  2MDR A;  2WZO A;  1UHZ A;  3HPZ A;  2V8Q B;  2L3J A;  3J81 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...