4M30A

Crystal structure of rnase iii complexed with double-stranded rna and amp (type ii cleavage)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
220
structure length
220
Chain Sequence
KMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Ribonuclease 3
publication title RNase III: Genetics and Function; Structure and Mechanism.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 78
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 4m30A01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4m30A02
4WFTA 1T4LB 4JV5E 1X47A 1RC7A 1GQEA 3C4TA 4JI2E 2B7VA 2JVAA 2YT4A 4M30A 3LLHA 4DV2E 2B3TB 3T1YE 1UHZA 1IBKE 2NUGA 1HNXE 4K0KE 2DB2A 1YZ9A 4DV1E 2UXCE 2N3GA 3O2RA 1N33E 5LMNE 2RS7A 4DUZE 4NXME 1HNWE 2L2NA 2EB1A 5IWAE 4B3SE 4X62E 1WHNA 2EZ6A 1QU6A 1O0WA 4JI8E 4JI3E 2A11A 1U61A 4DV0E 1WHQA 4LF6E 2UUBE 4B3TE 4LF7E 3RV1A 3P1XA 4X65E 1HNZE 2RTXA 2ZM6E 2IHR1 4B3RE 2LRSA 1XMOE 1FKAE 1YYKA 1X49A 2LTSA 1UILA 2KHXA 4YY3E 2L3CA 1J5EE 4DR1E 4LF8E 2LBSB 1T4NA 2LUPB 2N3HA 3J7Yp 1STUA 4DKKA 4DV5E 2NUFA 4YHHE 1HR0E 4LFAE 1N36E 1JFZA 3HTXA 2DMYA 4DR6E 4GKJE 4JI5E 2RSMA 1XNRE 4DV6E 2UXBE 4DV7E 4OOGC 4OX9E 2JY9A 3T1HE 4WYQB 2DIXA 1I4SA 4DR2E 4AQYE 1RC5A 2RS6A 4LF5E 2LJHA 4DR3E 1EKZA 1N32E 4LFBE 1X48A 3VYYA 2MDRA 3ADJA 2F4VE 4JYAE 2HHHE 1XMQE 4X8WA 3ADIA 2VQFE 3RV0A 4DV4E 3C4BA 4JI4E 4GKKE 2NA2A 1I94E 2UUCE 4LF9E 1DI2A 2GSLA 2E5LE 1RQ0A 4LFCE 1T4OA 2L33A 3ADLA 2LUQA 3OTOE 4DV3E 2UUAE 4JI0E 5BR8E 2B7TA 2VQEE 4DR5E 1N34E 4JI7E 4X66E 1YYWA 1FJGE 4KHPE 4B3ME 4OUNA 4LF4E 2UXDE 3O2RB 1IBME 1IBLE 1XNQE 2LTRA 5LMUE 4M2ZA 2FFLA 2NUEA 2CPNA 4DUYE 4X64E 1J26A 1PKPA 4JI1E 2L2KB 2UU9E 3ADGA 1YYOA 1ZBTA 3VYXA 4DR7E 4NXNE 2QVWA 2L3JA 4JI6E 4DR4E 2L2MA 5CFFE 3N3WA
chains in the Genus database with same CATH superfamily
1BBOA 4WFTA 3MHSC 2EL5A 2YZTA 2V89A 4I8OA 4JV5E 2EN6A 2EPKX 2FGGA 4O24A 3C4TA 1IQOA 2VRDA 1WJPA 2YTPA 1EH8A 1HNXE 2DB2A 5KL6A 1T38A 3F6HA 2YRKA 3O2RA 3TQMA 3KZYA 2EOQA 2EB1A 5IWAE 4B3SE 2GLIA 1O0WA 4JI3E 4DV0E 1WHQA 2VF1A 3MSWA 3P1XA 2FV4B 2K4VA 5A2QC 2IHR1 4IS1C 2WCC3 2EM2A 2LVHA 2V8QB 5FLXC 2LTSA 1UILA 2KHXA 2L3CA 2EPLX 4DKKA 2YTIA 2EMKA 5AE1A 3KWRA 3FIGA 4F9CB 4JI5E 2YRMA 2LE2A 4OX9E 3T1HE 2EPCA 2JR1A 1I4SA 4DR3E 1X48A 3VYYA 2E1MA 1XMQE 1DQ3A 4DV4E 4J8ZA 4LTYA 2EM0A 2MKNA 2GSLA 4BMJA 2DLQA 5AE2A 2E5LE 2LV2A 5ADZA 1PJQA 2YTEA 1T4OA 2L33A 5IT9C 3OTOE 2LO3A 3ZOQB 2B7TA 2M1SA 2EPZA 4R2CA 4NZVA 4JI7E 1FJGE 2EL4A 3AUZA 4KHPE 1X6FA 4OUNA 2V86A 5A6BA 4LF4E 1XNQE 2GHFA 2NUEA 2JWOA 4O5GA 2EOFA 3HPSA 2M4IA 1PKPA 4BS9A 2L2KB 3ADGA 5KL2A 2EOEA 1ZBTA 3VYXA 2DSYA 1PDAA 2EMWA 2D9HA 4NHRA 2EN2A 1T4LB 2E72A 4TUGA 4JI2E 1MGTA 3LLHA 4M30A 4DV2E 2B3TB 3HXLA 1UHZA 3M99B 1IBKE 2WBTA 2EMGA 2YPNA 1YZ9A 4IJDA 3J7AG 1IMUA 1N33E 1UN6B 2RS7A 3JAMC 4DUZE 2EJ4A 4Q28A 2FTXB 4JI8E 1YSAC 5AE3A 5KL5A 5DNYA 5AC4A 2A11A 4KWYA 4BBYA 4LF6E 2V85A 2UUBE 4R2PA 4TUIA 4B3TE 4LF7E 4X65E 2RTXA 3VHTB 2ZM6E 4B3RE 2LRSA 2I9IA 1FKAE 1BB8A 2WBUA 2HJJA 5AASA 4LF8E 5KL3A 4WXDA 2LBSB 1A1IA 2HGHA 2RQLA 1STUA 1N3GA 1G2DC 2NUFA 3K6QA 4YHHE 1N36E 1JFZA 3OMLA 2DMYA 2H36X 2EOYA 4F54A 2ELYA 2LCEA 2UXBE 3HQ1A 4F9BB 2MC6A 2JP9A 3C6KA 2EMZA 4GEQB 2EN3A 3THOB 4ZYEA 1F2IG 4R2RA 4LF5E 2LJHA 2RPCA 4HEIA 2ELZA 3ADJA 1ZR9A 2F4VE 4JYAE 1GZ6A 3ADIA 1PJTA 2JXPA 2B9DA 1NEIA 4GKKE 4O43A 2EPPA 4Q35B 2K7IA 2EMAA 2LUQA 5BR8E 2EOIA 1L4SA 2LJUA 2V87A 4DR5E 2EPAA 4F6NA 1IBLE 2LTRA 5LMUE 2EMHA 4M2ZA 4WX9A 2EM4A 4DUYE 2EQ0A 1DGCA 3ECRA 4F2JC 1BBGA 4X9JA 1B69A 2EQ1A 2EMLA 4P7DA 4JI1E 4ZYGA 1A1HA 2UU9E 2G7HA 5KL4A 3EPKA 2ENHA 4DR7E 2CTDA 5A6AA 2QVWA 4JI6E 2EMCA 2L2MA 5CFFE 2EPNA 2J7JA 4R2QA 3BF2A 2EN4A 5F3WA 4WXCA 3THNA 1X47A 1A1LA 4L5NC 1RC7A 2EPXA 4O4KA 2BBGA 2B7VA 2JVAA 2EMXA 2YT4A 3UK3C 3L00A 3T1YE 2YTQA 5A6KA 2NUGA 3KZZA 2EN8A 1X5WA 5T6JA 2EPMX 4BCAA 2EN7A 2JPAA 5LLQA 4LU9A 2MDGA 1A1JA 2EM5A 1LLMC 1ZBQA 2EM6A 1EH7A 1A1FA 2BB8A 4NXME 1HNWE 1A1KA 1AH5A 4X62E 1QU6A 2V83A 2KOUA 2NABA 1U61A 2DRPA 2EORA 3RV1A 1HNZE 2EWLA 2HC5A 4R2EA 1YYKA 1X49A 2WZOA 1YUIA 4YY3E 1RMDA 2EPUA 1ZTDA 1TF3A 4L8NA 2Q8UA 2MKDA 1YUJA 2YTNA 2CT1A 4DV5E 2EM8A 1HR0E 1NCSA 1QNTA 2EOMA 2L6MA 2EOJA 3BGHA 3HTXA 4WSPA 1WRJA 4DR6E 3C6MA 4GKJE 1JK2A 5IV8B 3HPZA 2RSMA 3QG5C 4DV6E 3IWCA 2JY9A 4BHCA 3VK6A 2DIXA 4AQYE 2I13A 2ADRA 4ZYDA 1EKZA 1ZAAC 1N32E 4LFBE 2EMBA 2MDRA 1KJKA 2L8TA 2YWQA 2EMIA 2HHHE 4X8WA 2EL6A 1G2FC 3F6GA 2M7QA 2NA2A 4RHBB 1I94E 1TN9A 2V88A 2UUCE 2YTFA 2YU5A 4R2DA 2L92A 4M0VA 4BC9A 4LFCE 3DF6A 3ADLA 2EPRA 4GZNC 1EH6A 4JI0E 2EOOA 4N4RB 4HTGA 2VQEE 4X66E 2ODRD 2ENAA 4F6MA 2LT7A 2YTJA 2ENCA 4P78A 3IWBA 4X64E 3RMPA 1MEYC 3LMLA 2LMZA 3DJWA 1YYOA 3AV0A 1ZU1A 1UBDC 4NXNE 2YRHA 4DR4E 2JYAA 2L3JA 5A69A 2EMFA 2EM3A 4R2AA 2YSPA 3EPHA 3JTZA 4F9AB 2JOXA 2EE8A 1GQEA 2MC5A 2DLKA 2N8XA 4DMIA 2EPOA 5A6JA 4M9VC 4FK5C 3EPJA 1T39A 4K0KE 1P47A 4WPYA 2EOZA 4DV1E 2UXCE 2N3GA 2GPIA 3EPLA 3EQ1A 5LMNE 1SR9A 2YTGA 5KL7A 2L2NA 1WHNA 1TF6A 2EZ6A 4MLVA 2EN1A 4BHBA 3J80C 1XMOE 1Z1BA 2EOHA 4KZSA 1J5EE 4DR1E 1SFEA 1T4NA 1PJSA 2KONA 2N3HA 2LUPB 3J7Yp 4RH8A 2YSOA 4LFAE 2ODRC 4WSGA 2EQ3A 2YU8A 3BIDA 1A1GA 1XNRE 2YTDA 4DV7E 4OOGC 5AC5A 4MLQA 3BBGA 4WYQB 4DR2E 2DMIA 2EM9A 1WXRA 1RC5A 2RS6A 2F8BA 1X6HA 3MHHC 2VE7C 1X6EA 5A6BD 1IQSA 2YTOA 2R76A 2EP3A 2R1FA 2VQFE 3RV0A 1YFHA 1KYQA 3JU0A 3C4BA 5IXMB 4JI4E 2EMYA 4LF9E 1DI2A 1RQ0A 1X3CA 4BC7A 4DV3E 2UUAE 4R2SA 1GTKA 2A25A 1YPNA 2EM7A 1N34E 2EOXA 1YYWA 4ZYHA 4B3ME 4R8OA 3IWDA 2UXDE 3O2RB 3J81C 5LL6R 1AAYA 1IBME 2FFLA 2CPNA 2RSIA 3H09A 1J26A 2CSHA 2EOSA 4R03A 2DGCA 2M9AA 1JK1A 2PRTA 5TSEA 2WBSA 2JOBA 3N3WA
chains in the Genus database with same CATH topology
4WFTA 5F3WA 2YZTA 2V89A 3JTZA 4I8OA 4F9AB 1T4LB 4JV5E 1X47A 4TUGA 2FGGA 2JOXA 4L5NC 1RC7A 1GQEA 3C4TA 2MC5A 4JI2E 2B7VA 2JVAA 2YT4A 4M30A 3LLHA 4DV2E 2B3TB 3HXLA 4DMIA 3T1YE 1UHZA 1IBKE 2NUGA 1HNXE 4K0KE 2DB2A 1YZ9A 5T6JA 4WPYA 4BCAA 4DV1E 2UXCE 3J7AG 2N3GA 4LU9A 3F6HA 3O2RA 1N33E 5LMNE 2RS7A 3JAMC 1ZBQA 1SR9A 4DUZE 4Q28A 4NXME 1HNWE 2L2NA 2EB1A 5IWAE 4B3SE 4X62E 1WHNA 2FTXB 2EZ6A 1QU6A 1O0WA 4JI8E 5AE3A 5DNYA 4JI3E 2V83A 2KOUA 2A11A 1U61A 4BBYA 1WHQA 4DV0E 4LF6E 2VF1A 2V85A 2UUBE 3MSWA 4TUIA 4B3TE 4LF7E 3RV1A 3P1XA 2FV4B 2K4VA 4X65E 5A2QC 1HNZE 2EWLA 2RTXA 3J80C 2ZM6E 2IHR1 4B3RE 2LRSA 1XMOE 4KZSA 1FKAE 1YYKA 1X49A 2WZOA 2V8QB 5FLXC 2LTSA 1UILA 2KHXA 5AASA 4YY3E 2L3CA 1J5EE 4DR1E 4LF8E 2LBSB 1T4NA 2LUPB 2KONA 2N3HA 4L8NA 1STUA 4DKKA 3J7Yp 4OX9E 4DV5E 2NUFA 4LF4E 3K6QA 4YHHE 2ODRC 1HR0E 4LFAE 2L6MA 1JFZA 3OMLA 3KWRA 2DMYA 2H36X 4WSPA 5AE1A 4F54A 1N36E 3FIGA 3HTXA 4DR6E 4GKJE 3HPZA 4F9CB 2RSMA 4JI5E 4DV6E 1XNRE 4DV7E 2UXBE 2LE2A 4OOGC 3HQ1A 4F9BB 3IWCA 2JY9A 2MC6A 3T1HE 4GEQB 3VK6A 4WYQB 2JR1A 2DIXA 1I4SA 1WXRA 4DR2E 1RC5A 4AQYE 2RS6A 2F8BA 4LF5E 2LJHA 4DR3E 1EKZA 1N32E 4LFBE 2VE7C 1X48A 3VYYA 2MDRA 3ADJA 2E1MA 2F4VE 2L8TA 4JYAE 1GZ6A 1XMQE 4X8WA 2HHHE 1DQ3A 3RV0A 2VQFE 3ADIA 2B9DA 4DV4E 4J8ZA 3JU0A 3C4BA 4JI4E 4LTYA 3F6GA 2M7QA 4GKKE 2NA2A 1I94E 2UUCE 4LF9E 2V88A 1DI2A 2GSLA 2L92A 4BMJA 4M0VA 5AE2A 4BC9A 1RQ0A 3DF6A 5ADZA 2E5LE 1T4OA 4LFCE 2L33A 5IT9C 4BC7A 2LUQA 3ADLA 3OTOE 4DV3E 3ZOQB 2UUAE 4JI0E 5BR8E 2B7TA 2M1SA 2V87A 2VQEE 4DR5E 1N34E 4JI7E 4X66E 1YYWA 1FJGE 3AUZA 4KHPE 4B3ME 4OUNA 2V86A 3IWDA 2ODRD 4R8OA 3O2RB 3J81C 5LL6R 1IBLE 1IBME 2LTRA 5LMUE 1XNQE 4M2ZA 2FFLA 2NUEA 2CPNA 4DUYE 2UXDE 2JWOA 4P78A 3IWBA 4X64E 3HPSA 3H09A 3RMPA 4P7DA 3LMLA 2M4IA 1PKPA 4JI1E 1J26A 4R03A 4BS9A 2LMZA 2L2KB 2UU9E 3DJWA 3ADGA 1YYOA 1ZBTA 2G7HA 2DSYA 3AV0A 3VYXA 4DR7E 4NXNE 2QVWA 2JOBA 2L3JA 4JI6E 4DR4E 2L2MA 5CFFE 3N3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFT A;  1T4L B;  4JV5 E;  1X47 A;  1RC7 A;  1GQE A;  3C4T A;  4JI2 E;  2B7V A;  2JVA A;  2YT4 A;  4M30 A;  3LLH A;  4DV2 E;  2B3T B;  3T1Y E;  1UHZ A;  1IBK E;  2NUG A;  1HNX E;  4K0K E;  2DB2 A;  1YZ9 A;  4DV1 E;  2UXC E;  2N3G A;  3O2R A;  1N33 E;  5LMN E;  2RS7 A;  4DUZ E;  4NXM E;  1HNW E;  2L2N A;  2EB1 A;  5IWA E;  4B3S E;  4X62 E;  1WHN A;  2EZ6 A;  1QU6 A;  1O0W A;  4JI8 E;  4JI3 E;  2A11 A;  1U61 A;  4DV0 E;  1WHQ A;  4LF6 E;  2UUB E;  4B3T E;  4LF7 E;  3RV1 A;  3P1X A;  4X65 E;  1HNZ E;  2RTX A;  2ZM6 E;  2IHR 1;  4B3R E;  2LRS A;  1XMO E;  1FKA E;  1YYK A;  1X49 A;  2LTS A;  1UIL A;  2KHX A;  4YY3 E;  2L3C A;  1J5E E;  4DR1 E;  4LF8 E;  2LBS B;  1T4N A;  2LUP B;  2N3H A;  3J7Y p;  1STU A;  4DKK A;  4DV5 E;  2NUF A;  4YHH E;  1HR0 E;  4LFA E;  1N36 E;  1JFZ A;  3HTX A;  2DMY A;  4DR6 E;  4GKJ E;  4JI5 E;  2RSM A;  1XNR E;  4DV6 E;  2UXB E;  4DV7 E;  4OOG C;  4OX9 E;  2JY9 A;  3T1H E;  4WYQ B;  2DIX A;  1I4S A;  4DR2 E;  4AQY E;  1RC5 A;  2RS6 A;  4LF5 E;  2LJH A;  4DR3 E;  1EKZ A;  1N32 E;  4LFB E;  1X48 A;  3VYY A;  2MDR A;  3ADJ A;  2F4V E;  4JYA E;  2HHH E;  1XMQ E;  4X8W A;  3ADI A;  2VQF E;  3RV0 A;  4DV4 E;  3C4B A;  4JI4 E;  4GKK E;  2NA2 A;  1I94 E;  2UUC E;  4LF9 E;  1DI2 A;  2GSL A;  2E5L E;  1RQ0 A;  4LFC E;  1T4O A;  2L33 A;  3ADL A;  2LUQ A;  3OTO E;  4DV3 E;  2UUA E;  4JI0 E;  5BR8 E;  2B7T A;  2VQE E;  4DR5 E;  1N34 E;  4JI7 E;  4X66 E;  1YYW A;  1FJG E;  4KHP E;  4B3M E;  4OUN A;  4LF4 E;  2UXD E;  3O2R B;  1IBM E;  1IBL E;  1XNQ E;  2LTR A;  5LMU E;  4M2Z A;  2FFL A;  2NUE A;  2CPN A;  4DUY E;  4X64 E;  1J26 A;  1PKP A;  4JI1 E;  2L2K B;  2UU9 E;  3ADG A;  1YYO A;  1ZBT A;  3VYX A;  4DR7 E;  4NXN E;  2QVW A;  2L3J A;  4JI6 E;  4DR4 E;  2L2M A;  5CFF E;  3N3W A; 
#chains in the Genus database with same CATH topology
 1BBO A;  4WFT A;  3MHS C;  2EL5 A;  2YZT A;  2V89 A;  4I8O A;  4JV5 E;  2EN6 A;  2EPK X;  2FGG A;  4O24 A;  3C4T A;  1IQO A;  2VRD A;  1WJP A;  2YTP A;  1EH8 A;  1HNX E;  2DB2 A;  5KL6 A;  1T38 A;  3F6H A;  2YRK A;  3O2R A;  3TQM A;  3KZY A;  2EOQ A;  2EB1 A;  5IWA E;  4B3S E;  2GLI A;  1O0W A;  4JI3 E;  4DV0 E;  1WHQ A;  2VF1 A;  3MSW A;  3P1X A;  2FV4 B;  2K4V A;  5A2Q C;  2IHR 1;  4IS1 C;  2WCC 3;  2EM2 A;  2LVH A;  2V8Q B;  5FLX C;  2LTS A;  1UIL A;  2KHX A;  2L3C A;  2EPL X;  4DKK A;  2YTI A;  2EMK A;  5AE1 A;  3KWR A;  3FIG A;  4F9C B;  4JI5 E;  2YRM A;  2LE2 A;  4OX9 E;  3T1H E;  2EPC A;  2JR1 A;  1I4S A;  4DR3 E;  1X48 A;  3VYY A;  2E1M A;  1XMQ E;  1DQ3 A;  4DV4 E;  4J8Z A;  4LTY A;  2EM0 A;  2MKN A;  2GSL A;  4BMJ A;  2DLQ A;  5AE2 A;  2E5L E;  2LV2 A;  5ADZ A;  1PJQ A;  2YTE A;  1T4O A;  2L33 A;  5IT9 C;  3OTO E;  2LO3 A;  3ZOQ B;  2B7T A;  2M1S A;  2EPZ A;  4R2C A;  4NZV A;  4JI7 E;  1FJG E;  2EL4 A;  3AUZ A;  4KHP E;  1X6F A;  4OUN A;  2V86 A;  5A6B A;  4LF4 E;  1XNQ E;  2GHF A;  2NUE A;  2JWO A;  4O5G A;  2EOF A;  3HPS A;  2M4I A;  1PKP A;  4BS9 A;  2L2K B;  3ADG A;  5KL2 A;  2EOE A;  1ZBT A;  3VYX A;  2DSY A;  1PDA A;  2EMW A;  2D9H A;  4NHR A;  2EN2 A;  1T4L B;  2E72 A;  4TUG A;  4JI2 E;  1MGT A;  3LLH A;  4M30 A;  4DV2 E;  2B3T B;  3HXL A;  1UHZ A;  3M99 B;  1IBK E;  2WBT A;  2EMG A;  2YPN A;  1YZ9 A;  4IJD A;  3J7A G;  1IMU A;  1N33 E;  1UN6 B;  2RS7 A;  3JAM C;  4DUZ E;  2EJ4 A;  4Q28 A;  2FTX B;  4JI8 E;  1YSA C;  5AE3 A;  5KL5 A;  5DNY A;  5AC4 A;  2A11 A;  4KWY A;  4BBY A;  4LF6 E;  2V85 A;  2UUB E;  4R2P A;  4TUI A;  4B3T E;  4LF7 E;  4X65 E;  2RTX A;  3VHT B;  2ZM6 E;  4B3R E;  2LRS A;  2I9I A;  1FKA E;  1BB8 A;  2WBU A;  2HJJ A;  5AAS A;  4LF8 E;  5KL3 A;  4WXD A;  2LBS B;  1A1I A;  2HGH A;  2RQL A;  1STU A;  1N3G A;  1G2D C;  2NUF A;  3K6Q A;  4YHH E;  1N36 E;  1JFZ A;  3OML A;  2DMY A;  2H36 X;  2EOY A;  4F54 A;  2ELY A;  2LCE A;  2UXB E;  3HQ1 A;  4F9B B;  2MC6 A;  2JP9 A;  3C6K A;  2EMZ A;  4GEQ B;  2EN3 A;  3THO B;  4ZYE A;  1F2I G;  4R2R A;  4LF5 E;  2LJH A;  2RPC A;  4HEI A;  2ELZ A;  3ADJ A;  1ZR9 A;  2F4V E;  4JYA E;  1GZ6 A;  3ADI A;  1PJT A;  2JXP A;  2B9D A;  1NEI A;  4GKK E;  4O43 A;  2EPP A;  4Q35 B;  2K7I A;  2EMA A;  2LUQ A;  5BR8 E;  2EOI A;  1L4S A;  2LJU A;  2V87 A;  4DR5 E;  2EPA A;  4F6N A;  1IBL E;  2LTR A;  5LMU E;  2EMH A;  4M2Z A;  4WX9 A;  2EM4 A;  4DUY E;  2EQ0 A;  1DGC A;  3ECR A;  4F2J C;  1BBG A;  4X9J A;  1B69 A;  2EQ1 A;  2EML A;  4P7D A;  4JI1 E;  4ZYG A;  1A1H A;  2UU9 E;  2G7H A;  5KL4 A;  3EPK A;  2ENH A;  4DR7 E;  2CTD A;  5A6A A;  2QVW A;  4JI6 E;  2EMC A;  2L2M A;  5CFF E;  2EPN A;  2J7J A;  4R2Q A;  3BF2 A;  2EN4 A;  5F3W A;  4WXC A;  3THN A;  1X47 A;  1A1L A;  4L5N C;  1RC7 A;  2EPX A;  4O4K A;  2BBG A;  2B7V A;  2JVA A;  2EMX A;  2YT4 A;  3UK3 C;  3L00 A;  3T1Y E;  2YTQ A;  5A6K A;  2NUG A;  3KZZ A;  2EN8 A;  1X5W A;  5T6J A;  2EPM X;  4BCA A;  2EN7 A;  2JPA A;  5LLQ A;  4LU9 A;  2MDG A;  1A1J A;  2EM5 A;  1LLM C;  1ZBQ A;  2EM6 A;  1EH7 A;  1A1F A;  2BB8 A;  4NXM E;  1HNW E;  1A1K A;  1AH5 A;  4X62 E;  1QU6 A;  2V83 A;  2KOU A;  2NAB A;  1U61 A;  2DRP A;  2EOR A;  3RV1 A;  1HNZ E;  2EWL A;  2HC5 A;  4R2E A;  1YYK A;  1X49 A;  2WZO A;  1YUI A;  4YY3 E;  1RMD A;  2EPU A;  1ZTD A;  1TF3 A;  4L8N A;  2Q8U A;  2MKD A;  1YUJ A;  2YTN A;  2CT1 A;  4DV5 E;  2EM8 A;  1HR0 E;  1NCS A;  1QNT A;  2EOM A;  2L6M A;  2EOJ A;  3BGH A;  3HTX A;  4WSP A;  1WRJ A;  4DR6 E;  3C6M A;  4GKJ E;  1JK2 A;  5IV8 B;  3HPZ A;  2RSM A;  3QG5 C;  4DV6 E;  3IWC A;  2JY9 A;  4BHC A;  3VK6 A;  2DIX A;  4AQY E;  2I13 A;  2ADR A;  4ZYD A;  1EKZ A;  1ZAA C;  1N32 E;  4LFB E;  2EMB A;  2MDR A;  1KJK A;  2L8T A;  2YWQ A;  2EMI A;  2HHH E;  4X8W A;  2EL6 A;  1G2F C;  3F6G A;  2M7Q A;  2NA2 A;  4RHB B;  1I94 E;  1TN9 A;  2V88 A;  2UUC E;  2YTF A;  2YU5 A;  4R2D A;  2L92 A;  4M0V A;  4BC9 A;  4LFC E;  3DF6 A;  3ADL A;  2EPR A;  4GZN C;  1EH6 A;  4JI0 E;  2EOO A;  4N4R B;  4HTG A;  2VQE E;  4X66 E;  2ODR D;  2ENA A;  4F6M A;  2LT7 A;  2YTJ A;  2ENC A;  4P78 A;  3IWB A;  4X64 E;  3RMP A;  1MEY C;  3LML A;  2LMZ A;  3DJW A;  1YYO A;  3AV0 A;  1ZU1 A;  1UBD C;  4NXN E;  2YRH A;  4DR4 E;  2JYA A;  2L3J A;  5A69 A;  2EMF A;  2EM3 A;  4R2A A;  2YSP A;  3EPH A;  3JTZ A;  4F9A B;  2JOX A;  2EE8 A;  1GQE A;  2MC5 A;  2DLK A;  2N8X A;  4DMI A;  2EPO A;  5A6J A;  4M9V C;  4FK5 C;  3EPJ A;  1T39 A;  4K0K E;  1P47 A;  4WPY A;  2EOZ A;  4DV1 E;  2UXC E;  2N3G A;  2GPI A;  3EPL A;  3EQ1 A;  5LMN E;  1SR9 A;  2YTG A;  5KL7 A;  2L2N A;  1WHN A;  1TF6 A;  2EZ6 A;  4MLV A;  2EN1 A;  4BHB A;  3J80 C;  1XMO E;  1Z1B A;  2EOH A;  4KZS A;  1J5E E;  4DR1 E;  1SFE A;  1T4N A;  1PJS A;  2KON A;  2N3H A;  2LUP B;  3J7Y p;  4RH8 A;  2YSO A;  4LFA E;  2ODR C;  4WSG A;  2EQ3 A;  2YU8 A;  3BID A;  1A1G A;  1XNR E;  2YTD A;  4DV7 E;  4OOG C;  5AC5 A;  4MLQ A;  3BBG A;  4WYQ B;  4DR2 E;  2DMI A;  2EM9 A;  1WXR A;  1RC5 A;  2RS6 A;  2F8B A;  1X6H A;  3MHH C;  2VE7 C;  1X6E A;  5A6B D;  1IQS A;  2YTO A;  2R76 A;  2EP3 A;  2R1F A;  2VQF E;  3RV0 A;  1YFH A;  1KYQ A;  3JU0 A;  3C4B A;  5IXM B;  4JI4 E;  2EMY A;  4LF9 E;  1DI2 A;  1RQ0 A;  1X3C A;  4BC7 A;  4DV3 E;  2UUA E;  4R2S A;  1GTK A;  2A25 A;  1YPN A;  2EM7 A;  1N34 E;  2EOX A;  1YYW A;  4ZYH A;  4B3M E;  4R8O A;  3IWD A;  2UXD E;  3O2R B;  3J81 C;  5LL6 R;  1AAY A;  1IBM E;  2FFL A;  2CPN A;  2RSI A;  3H09 A;  1J26 A;  2CSH A;  2EOS A;  4R03 A;  2DGC A;  2M9A A;  1JK1 A;  2PRT A;  5TSE A;  2WBS A;  2JOB A;  3N3W A; 
#chains in the Genus database with same CATH homology
 4WFT A;  5F3W A;  2YZT A;  2V89 A;  3JTZ A;  4I8O A;  4F9A B;  1T4L B;  4JV5 E;  1X47 A;  4TUG A;  2FGG A;  2JOX A;  4L5N C;  1RC7 A;  1GQE A;  3C4T A;  2MC5 A;  4JI2 E;  2B7V A;  2JVA A;  2YT4 A;  4M30 A;  3LLH A;  4DV2 E;  2B3T B;  3HXL A;  4DMI A;  3T1Y E;  1UHZ A;  1IBK E;  2NUG A;  1HNX E;  4K0K E;  2DB2 A;  1YZ9 A;  5T6J A;  4WPY A;  4BCA A;  4DV1 E;  2UXC E;  3J7A G;  2N3G A;  4LU9 A;  3F6H A;  3O2R A;  1N33 E;  5LMN E;  2RS7 A;  3JAM C;  1ZBQ A;  1SR9 A;  4DUZ E;  4Q28 A;  4NXM E;  1HNW E;  2L2N A;  2EB1 A;  5IWA E;  4B3S E;  4X62 E;  1WHN A;  2FTX B;  2EZ6 A;  1QU6 A;  1O0W A;  4JI8 E;  5AE3 A;  5DNY A;  4JI3 E;  2V83 A;  2KOU A;  2A11 A;  1U61 A;  4BBY A;  1WHQ A;  4DV0 E;  4LF6 E;  2VF1 A;  2V85 A;  2UUB E;  3MSW A;  4TUI A;  4B3T E;  4LF7 E;  3RV1 A;  3P1X A;  2FV4 B;  2K4V A;  4X65 E;  5A2Q C;  1HNZ E;  2EWL A;  2RTX A;  3J80 C;  2ZM6 E;  2IHR 1;  4B3R E;  2LRS A;  1XMO E;  4KZS A;  1FKA E;  1YYK A;  1X49 A;  2WZO A;  2V8Q B;  5FLX C;  2LTS A;  1UIL A;  2KHX A;  5AAS A;  4YY3 E;  2L3C A;  1J5E E;  4DR1 E;  4LF8 E;  2LBS B;  1T4N A;  2LUP B;  2KON A;  2N3H A;  4L8N A;  1STU A;  4DKK A;  3J7Y p;  4OX9 E;  4DV5 E;  2NUF A;  4LF4 E;  3K6Q A;  4YHH E;  2ODR C;  1HR0 E;  4LFA E;  2L6M A;  1JFZ A;  3OML A;  3KWR A;  2DMY A;  2H36 X;  4WSP A;  5AE1 A;  4F54 A;  1N36 E;  3FIG A;  3HTX A;  4DR6 E;  4GKJ E;  3HPZ A;  4F9C B;  2RSM A;  4JI5 E;  4DV6 E;  1XNR E;  4DV7 E;  2UXB E;  2LE2 A;  4OOG C;  3HQ1 A;  4F9B B;  3IWC A;  2JY9 A;  2MC6 A;  3T1H E;  4GEQ B;  3VK6 A;  4WYQ B;  2JR1 A;  2DIX A;  1I4S A;  1WXR A;  4DR2 E;  1RC5 A;  4AQY E;  2RS6 A;  2F8B A;  4LF5 E;  2LJH A;  4DR3 E;  1EKZ A;  1N32 E;  4LFB E;  2VE7 C;  1X48 A;  3VYY A;  2MDR A;  3ADJ A;  2E1M A;  2F4V E;  2L8T A;  4JYA E;  1GZ6 A;  1XMQ E;  4X8W A;  2HHH E;  1DQ3 A;  3RV0 A;  2VQF E;  3ADI A;  2B9D A;  4DV4 E;  4J8Z A;  3JU0 A;  3C4B A;  4JI4 E;  4LTY A;  3F6G A;  2M7Q A;  4GKK E;  2NA2 A;  1I94 E;  2UUC E;  4LF9 E;  2V88 A;  1DI2 A;  2GSL A;  2L92 A;  4BMJ A;  4M0V A;  5AE2 A;  4BC9 A;  1RQ0 A;  3DF6 A;  5ADZ A;  2E5L E;  1T4O A;  4LFC E;  2L33 A;  5IT9 C;  4BC7 A;  2LUQ A;  3ADL A;  3OTO E;  4DV3 E;  3ZOQ B;  2UUA E;  4JI0 E;  5BR8 E;  2B7T A;  2M1S A;  2V87 A;  2VQE E;  4DR5 E;  1N34 E;  4JI7 E;  4X66 E;  1YYW A;  1FJG E;  3AUZ A;  4KHP E;  4B3M E;  4OUN A;  2V86 A;  3IWD A;  2ODR D;  4R8O A;  3O2R B;  3J81 C;  5LL6 R;  1IBL E;  1IBM E;  2LTR A;  5LMU E;  1XNQ E;  4M2Z A;  2FFL A;  2NUE A;  2CPN A;  4DUY E;  2UXD E;  2JWO A;  4P78 A;  3IWB A;  4X64 E;  3HPS A;  3H09 A;  3RMP A;  4P7D A;  3LML A;  2M4I A;  1PKP A;  4JI1 E;  1J26 A;  4R03 A;  4BS9 A;  2LMZ A;  2L2K B;  2UU9 E;  3DJW A;  3ADG A;  1YYO A;  1ZBT A;  2G7H A;  2DSY A;  3AV0 A;  3VYX A;  4DR7 E;  4NXN E;  2QVW A;  2JOB A;  2L3J A;  4JI6 E;  4DR4 E;  2L2M A;  5CFF E;  3N3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...