3O2RB

Structural flexibility in region involved in dimer formation of nuclease domain of ribonuclase iii (rnc) from campylobacter jejuni
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
144
structure length
142
Chain Sequence
NIEKLEQSLTYEFKDKNLLIHALTHKSFKSYNNERLEFLGDAVLDLVVGEYLFHKFAKDAEGDLSKLRAALVNEKSFAKIANSLNLGDFILMSVAEENNGGKEKPSILSDALEAIIGAIHLEAGFEFAKTIALRLIEKNFPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease III
publication title Structural Flexibility in Region Involved in Dimer Formation of Nuclease Domain of Ribonuclase III (rnc) from Campylobacter jejuni.
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Hydrolase
total genus 60
structure length 142
sequence length 144
chains with identical sequence D
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14622 Ribonucleas_3_3 Ribonuclease-III-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 3o2rB00
3C4BA 1YYWA 3O2RB 4OUNA 2FFLA 2EZ6A 1YYOA 3RV1A 2NUFA 4M30A 1YZ9A 2QVWA 4M2ZA 3N3WA 1I4SA 1RC7A 1YYKA 1U61A 2EB1A 1JFZA 3C4TA 3RV0A 1RC5A 2NUEA 2A11A 3O2RA 2NUGA 1O0WA 4OOGC 2GSLA
chains in the Genus database with same CATH superfamily
3C4BA 1YYWA 3O2RB 4OUNA 2FFLA 2EZ6A 1YYOA 3RV1A 2NUFA 4M30A 1YZ9A 2QVWA 4M2ZA 3N3WA 1I4SA 1RC7A 1YYKA 1U61A 2EB1A 1JFZA 3C4TA 3RV0A 1RC5A 2NUEA 2A11A 3O2RA 1ZTDA 2NUGA 1O0WA 4OOGC 2GSLA
chains in the Genus database with same CATH topology
3C4BA 1YYWA 3O2RB 4OUNA 2FFLA 2EZ6A 1YYOA 3RV1A 2NUFA 4M30A 1YZ9A 2QVWA 4M2ZA 3N3WA 1I4SA 1RC7A 1YYKA 1U61A 2EB1A 1JFZA 3C4TA 3RV0A 1RC5A 2NUEA 2A11A 3O2RA 2NUGA 1O0WA 4OOGC 2GSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C4B A;  1YYW A;  3O2R B;  4OUN A;  2FFL A;  2EZ6 A;  1YYO A;  3RV1 A;  2NUF A;  4M30 A;  1YZ9 A;  2QVW A;  4M2Z A;  3N3W A;  1I4S A;  1RC7 A;  1YYK A;  1U61 A;  2EB1 A;  1JFZ A;  3C4T A;  3RV0 A;  1RC5 A;  2NUE A;  2A11 A;  3O2R A;  2NUG A;  1O0W A;  4OOG C;  2GSL A; 
#chains in the Genus database with same CATH topology
 3C4B A;  1YYW A;  3O2R B;  4OUN A;  2FFL A;  2EZ6 A;  1YYO A;  3RV1 A;  2NUF A;  4M30 A;  1YZ9 A;  2QVW A;  4M2Z A;  3N3W A;  1I4S A;  1RC7 A;  1YYK A;  1U61 A;  2EB1 A;  1JFZ A;  3C4T A;  3RV0 A;  1RC5 A;  2NUE A;  2A11 A;  3O2R A;  1ZTD A;  2NUG A;  1O0W A;  4OOG C;  2GSL A; 
#chains in the Genus database with same CATH homology
 3C4B A;  1YYW A;  3O2R B;  4OUN A;  2FFL A;  2EZ6 A;  1YYO A;  3RV1 A;  2NUF A;  4M30 A;  1YZ9 A;  2QVW A;  4M2Z A;  3N3W A;  1I4S A;  1RC7 A;  1YYK A;  1U61 A;  2EB1 A;  1JFZ A;  3C4T A;  3RV0 A;  1RC5 A;  2NUE A;  2A11 A;  3O2R A;  2NUG A;  1O0W A;  4OOG C;  2GSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...