1RC7A

Crystal structure of rnase iii mutant e110k from aquifex aeolicus complexed with ds-rna at 2.15 angstrom resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
220
structure length
220
Chain Sequence
MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFKALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords 5'-R(*GP*GP*CP*GP*CP*GP*CP*GP*CP*C)-3'
publication title Noncatalytic Assembly of Ribonuclease III with Double-Stranded RNA.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 83
structure length 220
sequence length 220
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 1rc7A01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1rc7A02
1HNXE 3ADIA 1YZ9A 2DMYA 4DV6E 4JV5E 3OTOE 1QU6A 1X47A 2RSMA 3T1HE 1IBKE 2NUFA 1T4NA 4WFTA 3ADJA 2MDRA 1STUA 4LF9E 3C4BA 2UU9E 2ZM6E 4JI3E 4DV4E 4DR6E 2LJHA 4DR1E 3T1YE 4DUZE 1RQ0A 1XMQE 2N3HA 4M2ZA 4JI1E 4DV0E 1GQEA 2L2KB 2LBSB 2L33A 2UUBE 1YYKA 2EB1A 2B3TB 1J26A 5BR8E 1N33E 3J7Yp 4LF4E 4YHHE 2N3GA 3O2RB 1T4OA 2B7TA 4KHPE 4GKJE 2LUPB 4DR7E 4OUNA 4DV1E 3HTXA 4JI8E 1YYOA 5LMNE 1U61A 4X8WA 1EKZA 2F4VE 2LUQA 2LTRA 2UUAE 2RS7A 4M30A 4NXNE 4LFBE 1HNWE 2LTSA 3VYYA 1UHZA 3N3WA 1DI2A 3LLHA 2RS6A 4X62E 1IBLE 4LFCE 3P1XA 1T4LB 4GKKE 1UILA 1HNZE 4LF8E 4DV3E 2LRSA 2UXCE 5IWAE 4DR2E 1HR0E 3VYXA 1N36E 2IHR1 4X66E 2YT4A 2EZ6A 2JY9A 2L2MA 1YYWA 4B3TE 2UXBE 2DIXA 2E5LE 1X49A 4LF6E 1FKAE 4JI2E 2HHHE 4OX9E 1ZBTA 4JI6E 4NXME 3ADLA 4DKKA 1O0WA 1WHNA 2KHXA 4B3ME 2CPNA 3RV0A 4DV7E 1N32E 4X64E 2NUEA 4B3SE 4OOGC 1RC7A 5CFFE 2VQEE 1XNRE 3ADGA 2VQFE 4K0KE 2QVWA 1XMOE 1RC5A 1X48A 4JYAE 2B7VA 1N34E 4X65E 3RV1A 4YY3E 2L3JA 4JI5E 4LFAE 4DV2E 4DR3E 1PKPA 2GSLA 2L2NA 1FJGE 4JI7E 4JI0E 5LMUE 4JI4E 4DV5E 4AQYE 1I94E 3O2RA 4LF7E 2FFLA 1XNQE 3C4TA 2NUGA 1WHQA 1I4SA 2JVAA 4DR4E 2A11A 2UXDE 2NA2A 4DUYE 2DB2A 4WYQB 4DR5E 2L3CA 2UUCE 1JFZA 1IBME 4B3RE 1J5EE 4LF5E 2RTXA
chains in the Genus database with same CATH superfamily
2GPIA 2EMFA 3C6MA 3ECRA 3TQMA 4WX9A 5KL6A 2ELZA 1IBKE 4R2RA 1SFEA 2EM4A 2YRMA 2EPLX 4DR6E 4F9BB 3J7AG 2LJHA 4RHBB 3DJWA 4DUZE 4M9VC 4M2ZA 2EP3A 1GQEA 3EPKA 2UUBE 2KONA 2B3TB 3J81C 1T39A 1J26A 5BR8E 1N33E 1X6FA 2R76A 1A1GA 1TN9A 4HEIA 4KHPE 4GKJE 5AC4A 1ZTDA 5DNYA 4DR7E 2LO3A 4JI8E 1P47A 1G2DC 1NCSA 2EM6A 2L8TA 1L4SA 4BBYA 1EKZA 2LTRA 2EPAA 1MEYC 2RS7A 3KWRA 1A1FA 2YTEA 3VYYA 3JAMC 2DLQA 1PJTA 2YTOA 1A1JA 2EMGA 3JU0A 5LLQA 2E72A 1ZBQA 4GEQB 5A69A 1X6HA 2YTDA 2YWQA 1HNZE 2YSPA 2A25A 4HTGA 2PRTA 1HR0E 2NABA 4F54A 1A1IA 1N36E 2EE8A 3HPZA 2JY9A 4B3TE 4NZVA 4WXCA 4N4RB 3DF6A 1GTKA 1X49A 2YU5A 1FKAE 4OX9E 3EPHA 4JI6E 2WCC3 2J7JA 2B9DA 2CPNA 1KYQA 5TSEA 2EM2A 4OOGC 1RC7A 2EPMX 2VQEE 2EPOA 4MLVA 3ADGA 4DMIA 1IQSA 4GZNC 4JYAE 1X48A 4ZYHA 1PJQA 4X65E 3RV1A 4BHBA 2JXPA 2WBTA 4YY3E 4LFAE 4DV2E 3ZOQB 2EN4A 4BCAA 4NHRA 1BBOA 2M1SA 4LF7E 2Q8UA 3C4TA 2A11A 2EOIA 2FTXB 2NA2A 2UXDE 2V87A 4WYQB 4DR5E 1IBME 3BGHA 1HNXE 2EN7A 4DV6E 4JV5E 4LU9A 2ODRD 1X47A 2RSMA 2EPXA 3OMLA 2EN3A 3IWBA 2EL5A 5KL4A 4R2EA 3C4BA 2EMHA 2JYAA 2M7QA 4JI3E 2EPKX 2KOUA 1RMDA 4DR1E 3T1YE 5A6AA 2DGCA 2EM9A 2EWLA 2N3HA 4JI1E 4DV0E 5FLXC 2CSHA 2L2KB 2LBSB 1EH6A 2L33A 1YYKA 4IS1C 2JPAA 3J7Yp 3O2RB 1T4OA 2EPUA 2EN2A 4R2QA 4R8OA 1AH5A 3THNA 2EOMA 1YYOA 1SR9A 1U61A 5T6JA 2EJ4A 4X8WA 2EL4A 2UUAE 5AE1A 4L5NC 2K7IA 3BIDA 1DGCA 1X3CA 4NXNE 4LFBE 4IJDA 3UK3C 1UHZA 3N3WA 2RS6A 1MGTA 5IT9C 4LFCE 2RPCA 3P1XA 4F6NA 3J80C 1BBGA 4R2CA 4DV3E 2LRSA 3HXLA 2BB8A 4DR2E 3LMLA 3VYXA 1IMUA 5AE2A 2YTJA 1JK2A 2ENHA 2EOYA 5F3WA 2EMIA 4JI2E 2HHHE 1ZBTA 1ZAAC 2LJUA 4NXME 4O4KA 1WHNA 2HC5A 5LL6R 4L8NA 5KL3A 2YU8A 2I9IA 4B3SE 2FGGA 2K4VA 2EN1A 1UBDC 2EQ3A 2V89A 2EQ1A 3MHHC 2EMAA 4TUIA 2YZTA 1N34E 2R1FA 4JI5E 1PKPA 4JI7E 2I13A 1Z1BA 4JI4E 4AQYE 1AAYA 1I94E 1X5WA 2FFLA 4BS9A 1XNQE 2JOBA 2DMIA 2DB2A 2ELYA 4X9JA 5A6JA 3IWDA 2L3CA 2UUCE 1JFZA 4B3RE 2MKDA 2EM0A 3EPLA 1B69A 3QG5C 3ADIA 2DMYA 2V86A 1UN6B 2YTFA 2EOZA 3HPSA 1QU6A 4MLQA 2ENCA 2EMZA 1DQ3A 2JOXA 2NUFA 4TUGA 2GLIA 1YPNA 2EN8A 4WFTA 3ADJA 2F8BA 4LF9E 5A6KA 1WRJA 2ZM6E 1EH7A 1YUJA 2VF1A 5AE3A 2N8XA 1RQ0A 2EB1A 1A1HA 1TF3A 2B7TA 4R2DA 2V83A 2LV2A 3L00A 3VHTB 5LMNE 4O24A 4BC7A 2LUQA 5AC5A 2DSYA 2EL6A 2YSOA 4WXDA 4M30A 2EM3A 1HNWE 1PJSA 2LTSA 1WXRA 1DI2A 1IBLE 1ZR9A 1BB8A 2MC6A 3C6KA 4GKKE 1UILA 2UXCE 4F2JC 1YSAC 5IWAE 4WSPA 5AASA 2IHR1 4X66E 2H36X 2EZ6A 2DLKA 2L2MA 5A6BD 2BBGA 2RQLA 2D9HA 1YYWA 2EOXA 2EORA 5A6BA 2DIXA 4LF6E 2LT7A 2EMYA 4P7DA 2WBUA 2ADRA 2EMXA 3RV0A 2NUEA 2EMCA 5KL7A 2VQFE 2HJJA 4K0KE 4F9AB 2M4IA 2L92A 2YTPA 2WZOA 4P78A 2L3JA 4R2SA 2EPCA 2GSLA 4DV5E 3F6GA 2EMKA 4LTYA 2EPRA 3JTZA 1WHQA 2JVAA 4DR4E 3K6QA 2EQ0A 3F6HA 1F2IG 4R2AA 2EOHA 1J5EE 1YZ9A 4ZYEA 3OTOE 1A1LA 2CTDA 2YRKA 3EQ1A 3T1HE 4WSGA 2YTGA 1T4NA 2MDRA 1STUA 2UU9E 1EH8A 2M9AA 2VRDA 1YFHA 3EPJA 4DV4E 1GZ6A 3RMPA 2EOQA 2MC5A 2LCEA 2CT1A 1XMQE 2EPNA 2LMZA 2MDGA 5KL5A 1A1KA 4LF4E 4YHHE 2N3GA 2YTNA 2JP9A 2V85A 1WJPA 4OUNA 2LUPB 3KZYA 4DV1E 1KJKA 3HTXA 3BBGA 2LE2A 2WBSA 3FIGA 2F4VE 2E1MA 1N3GA 2EMBA 2EOOA 1IQOA 2GHFA 1ZU1A 4RH8A 2ODRC 3THOB 4ZYGA 2EM8A 2EOFA 1LLMC 3LLHA 4R03A 4X62E 5IXMB 4Q28A 2G7HA 4BHCA 1T4LB 2EN6A 2EOSA 4LF8E 2LVHA 1QNTA 1T38A 2JR1A 2FV4B 4M0VA 2EOJA 3MSWA 5IV8B 2YPNA 2YT4A 3HQ1A 1G2FC 3AV0A 2VE7C 4J8ZA 1NEIA 4O43A 3M99B 1TF6A 5ADZA 2EMLA 2UXBE 2E5LE 2EMWA 2EPPA 4F6MA 2HGHA 2RSIA 3H09A 4ZYDA 3BF2A 3IWCA 4BC9A 3ADLA 2YRHA 4DKKA 1O0WA 2KHXA 4F9CB 4B3ME 4KWYA 2ENAA 4Q35B 4DV7E 1N32E 4X64E 2EOEA 3VK6A 5CFFE 4R2PA 1XNRE 4KZSA 2QVWA 4O5GA 2EPZA 1XMOE 1RC5A 2B7VA 2V88A 1PDAA 4DR3E 2L2NA 2EM7A 1YUIA 1FJGE 2MKNA 4JI0E 4WPYA 5LMUE 1JK1A 2L6MA 3O2RA 2JWOA 2NUGA 1X6EA 3KZZA 1I4SA 2V8QB 4BMJA 2EM5A 4FK5C 2DRPA 2YTIA 4DUYE 3AUZA 3MHSC 5A2QC 2YTQA 4I8OA 5KL2A 4LF5E 2RTXA
chains in the Genus database with same CATH topology
1HNXE 3ADIA 1YZ9A 2DMYA 2V86A 4DV6E 4JV5E 3OTOE 4LU9A 2ODRD 1QU6A 1X47A 2RSMA 3HPSA 3OMLA 3IWBA 1DQ3A 2JOXA 2NUFA 4TUGA 3T1HE 1IBKE 1T4NA 4WFTA 3ADJA 2F8BA 2MDRA 1STUA 4LF9E 3C4BA 2UU9E 2M7QA 2ZM6E 4JI3E 4DV4E 4DR6E 2KOUA 2VF1A 1GZ6A 4F9BB 3RMPA 2MC5A 3J7AG 2LJHA 4DR1E 3T1YE 3DJWA 4DUZE 5AE3A 2EWLA 1RQ0A 1XMQE 2N3HA 4M2ZA 4JI1E 4DV0E 1GQEA 5FLXC 2LMZA 2L2KB 2LBSB 2L33A 2UUBE 1YYKA 2EB1A 2B3TB 2KONA 3J81C 1J26A 5BR8E 1N33E 3J7Yp 4LF4E 4YHHE 3O2RB 2N3GA 1T4OA 2B7TA 4KHPE 4R8OA 2V85A 5DNYA 4OUNA 2LUPB 2V83A 4DV1E 4DR7E 3HTXA 4GKJE 4JI8E 1YYOA 1SR9A 2LE2A 1U61A 5LMNE 5T6JA 2L8TA 4X8WA 4BBYA 3FIGA 1EKZA 4BC7A 2F4VE 2LUQA 2E1MA 2LTRA 2UUAE 5AE1A 4L5NC 1HR0E 2DSYA 2RS7A 4M30A 4NXNE 2ODRC 4LFBE 1HNWE 2LTSA 3KWRA 3VYYA 1UHZA 3N3WA 1WXRA 3JAMC 2RS6A 3LLHA 4R03A 4X62E 5IT9C 1DI2A 1IBLE 4Q28A 4LFCE 3JU0A 2G7HA 3P1XA 2MC6A 1ZBQA 1T4LB 4GKKE 1UILA 4GEQB 3J80C 1HNZE 4LF8E 4DV3E 2LRSA 3HXLA 2UXCE 5IWAE 4WSPA 4DR2E 2JR1A 2FV4B 3LMLA 4M0VA 4F54A 3MSWA 5AASA 1N36E 3VYXA 2IHR1 4X66E 2YT4A 3HQ1A 5AE2A 2H36X 2EZ6A 3HPZA 2JY9A 2L2MA 3AV0A 2VE7C 4J8ZA 1YYWA 4B3TE 5ADZA 2UXBE 2DIXA 3DF6A 5F3WA 2E5LE 1X49A 4LF6E 1FKAE 4JI2E 2HHHE 4OX9E 3H09A 1ZBTA 4P7DA 4JI6E 4NXME 3IWCA 4BC9A 3ADLA 4DKKA 1O0WA 2KHXA 1WHNA 2B9DA 5LL6R 2CPNA 4F9CB 4B3ME 4L8NA 3RV0A 4DV7E 1N32E 4X64E 2NUEA 4B3SE 3VK6A 4OOGC 1RC7A 2FGGA 2K4VA 5CFFE 2VQEE 1XNRE 3ADGA 2VQFE 2V89A 4DMIA 4KZSA 4F9AB 2M4IA 4K0KE 2QVWA 1XMOE 1RC5A 1X48A 2L92A 4JYAE 2B7VA 4TUIA 2YZTA 2V88A 1N34E 4X65E 3RV1A 2WZOA 4P78A 4YY3E 2L3JA 4JI5E 4DV2E 4DR3E 1PKPA 2GSLA 2L2NA 4LFAE 1FJGE 4JI7E 3ZOQB 4JI0E 4WPYA 5LMUE 4BCAA 2L6MA 4JI4E 4DV5E 3F6GA 2M1SA 4AQYE 1I94E 3O2RA 4LF7E 2FFLA 4LTYA 4BS9A 2JOBA 1XNQE 2JWOA 3JTZA 3C4TA 2NUGA 2JVAA 1I4SA 1WHQA 2V8QB 4BMJA 4DR4E 2A11A 2FTXB 2NA2A 3K6QA 4DUYE 2UXDE 3AUZA 5A2QC 2V87A 2DB2A 4WYQB 4DR5E 3F6HA 4I8OA 3IWDA 2L3CA 2UUCE 1JFZA 1IBME 4B3RE 1J5EE 4LF5E 2RTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNX E;  3ADI A;  1YZ9 A;  2DMY A;  4DV6 E;  4JV5 E;  3OTO E;  1QU6 A;  1X47 A;  2RSM A;  3T1H E;  1IBK E;  2NUF A;  1T4N A;  4WFT A;  3ADJ A;  2MDR A;  1STU A;  4LF9 E;  3C4B A;  2UU9 E;  2ZM6 E;  4JI3 E;  4DV4 E;  4DR6 E;  2LJH A;  4DR1 E;  3T1Y E;  4DUZ E;  1RQ0 A;  1XMQ E;  2N3H A;  4M2Z A;  4JI1 E;  4DV0 E;  1GQE A;  2L2K B;  2LBS B;  2L33 A;  2UUB E;  1YYK A;  2EB1 A;  2B3T B;  1J26 A;  5BR8 E;  1N33 E;  3J7Y p;  4LF4 E;  4YHH E;  2N3G A;  3O2R B;  1T4O A;  2B7T A;  4KHP E;  4GKJ E;  2LUP B;  4DR7 E;  4OUN A;  4DV1 E;  3HTX A;  4JI8 E;  1YYO A;  5LMN E;  1U61 A;  4X8W A;  1EKZ A;  2F4V E;  2LUQ A;  2LTR A;  2UUA E;  2RS7 A;  4M30 A;  4NXN E;  4LFB E;  1HNW E;  2LTS A;  3VYY A;  1UHZ A;  3N3W A;  1DI2 A;  3LLH A;  2RS6 A;  4X62 E;  1IBL E;  4LFC E;  3P1X A;  1T4L B;  4GKK E;  1UIL A;  1HNZ E;  4LF8 E;  4DV3 E;  2LRS A;  2UXC E;  5IWA E;  4DR2 E;  1HR0 E;  3VYX A;  1N36 E;  2IHR 1;  4X66 E;  2YT4 A;  2EZ6 A;  2JY9 A;  2L2M A;  1YYW A;  4B3T E;  2UXB E;  2DIX A;  2E5L E;  1X49 A;  4LF6 E;  1FKA E;  4JI2 E;  2HHH E;  4OX9 E;  1ZBT A;  4JI6 E;  4NXM E;  3ADL A;  4DKK A;  1O0W A;  1WHN A;  2KHX A;  4B3M E;  2CPN A;  3RV0 A;  4DV7 E;  1N32 E;  4X64 E;  2NUE A;  4B3S E;  4OOG C;  1RC7 A;  5CFF E;  2VQE E;  1XNR E;  3ADG A;  2VQF E;  4K0K E;  2QVW A;  1XMO E;  1RC5 A;  1X48 A;  4JYA E;  2B7V A;  1N34 E;  4X65 E;  3RV1 A;  4YY3 E;  2L3J A;  4JI5 E;  4LFA E;  4DV2 E;  4DR3 E;  1PKP A;  2GSL A;  2L2N A;  1FJG E;  4JI7 E;  4JI0 E;  5LMU E;  4JI4 E;  4DV5 E;  4AQY E;  1I94 E;  3O2R A;  4LF7 E;  2FFL A;  1XNQ E;  3C4T A;  2NUG A;  1WHQ A;  1I4S A;  2JVA A;  4DR4 E;  2A11 A;  2UXD E;  2NA2 A;  4DUY E;  2DB2 A;  4WYQ B;  4DR5 E;  2L3C A;  2UUC E;  1JFZ A;  1IBM E;  4B3R E;  1J5E E;  4LF5 E;  2RTX A; 
#chains in the Genus database with same CATH topology
 2GPI A;  2EMF A;  3C6M A;  3ECR A;  3TQM A;  4WX9 A;  5KL6 A;  2ELZ A;  1IBK E;  4R2R A;  1SFE A;  2EM4 A;  2YRM A;  2EPL X;  4DR6 E;  4F9B B;  3J7A G;  2LJH A;  4RHB B;  3DJW A;  4DUZ E;  4M9V C;  4M2Z A;  2EP3 A;  1GQE A;  3EPK A;  2UUB E;  2KON A;  2B3T B;  3J81 C;  1T39 A;  1J26 A;  5BR8 E;  1N33 E;  1X6F A;  2R76 A;  1A1G A;  1TN9 A;  4HEI A;  4KHP E;  4GKJ E;  5AC4 A;  1ZTD A;  5DNY A;  4DR7 E;  2LO3 A;  4JI8 E;  1P47 A;  1G2D C;  1NCS A;  2EM6 A;  2L8T A;  1L4S A;  4BBY A;  1EKZ A;  2LTR A;  2EPA A;  1MEY C;  2RS7 A;  3KWR A;  1A1F A;  2YTE A;  3VYY A;  3JAM C;  2DLQ A;  1PJT A;  2YTO A;  1A1J A;  2EMG A;  3JU0 A;  5LLQ A;  2E72 A;  1ZBQ A;  4GEQ B;  5A69 A;  1X6H A;  2YTD A;  2YWQ A;  1HNZ E;  2YSP A;  2A25 A;  4HTG A;  2PRT A;  1HR0 E;  2NAB A;  4F54 A;  1A1I A;  1N36 E;  2EE8 A;  3HPZ A;  2JY9 A;  4B3T E;  4NZV A;  4WXC A;  4N4R B;  3DF6 A;  1GTK A;  1X49 A;  2YU5 A;  1FKA E;  4OX9 E;  3EPH A;  4JI6 E;  2WCC 3;  2J7J A;  2B9D A;  2CPN A;  1KYQ A;  5TSE A;  2EM2 A;  4OOG C;  1RC7 A;  2EPM X;  2VQE E;  2EPO A;  4MLV A;  3ADG A;  4DMI A;  1IQS A;  4GZN C;  4JYA E;  1X48 A;  4ZYH A;  1PJQ A;  4X65 E;  3RV1 A;  4BHB A;  2JXP A;  2WBT A;  4YY3 E;  4LFA E;  4DV2 E;  3ZOQ B;  2EN4 A;  4BCA A;  4NHR A;  1BBO A;  2M1S A;  4LF7 E;  2Q8U A;  3C4T A;  2A11 A;  2EOI A;  2FTX B;  2NA2 A;  2UXD E;  2V87 A;  4WYQ B;  4DR5 E;  1IBM E;  3BGH A;  1HNX E;  2EN7 A;  4DV6 E;  4JV5 E;  4LU9 A;  2ODR D;  1X47 A;  2RSM A;  2EPX A;  3OML A;  2EN3 A;  3IWB A;  2EL5 A;  5KL4 A;  4R2E A;  3C4B A;  2EMH A;  2JYA A;  2M7Q A;  4JI3 E;  2EPK X;  2KOU A;  1RMD A;  4DR1 E;  3T1Y E;  5A6A A;  2DGC A;  2EM9 A;  2EWL A;  2N3H A;  4JI1 E;  4DV0 E;  5FLX C;  2CSH A;  2L2K B;  2LBS B;  1EH6 A;  2L33 A;  1YYK A;  4IS1 C;  2JPA A;  3J7Y p;  3O2R B;  1T4O A;  2EPU A;  2EN2 A;  4R2Q A;  4R8O A;  1AH5 A;  3THN A;  2EOM A;  1YYO A;  1SR9 A;  1U61 A;  5T6J A;  2EJ4 A;  4X8W A;  2EL4 A;  2UUA E;  5AE1 A;  4L5N C;  2K7I A;  3BID A;  1DGC A;  1X3C A;  4NXN E;  4LFB E;  4IJD A;  3UK3 C;  1UHZ A;  3N3W A;  2RS6 A;  1MGT A;  5IT9 C;  4LFC E;  2RPC A;  3P1X A;  4F6N A;  3J80 C;  1BBG A;  4R2C A;  4DV3 E;  2LRS A;  3HXL A;  2BB8 A;  4DR2 E;  3LML A;  3VYX A;  1IMU A;  5AE2 A;  2YTJ A;  1JK2 A;  2ENH A;  2EOY A;  5F3W A;  2EMI A;  4JI2 E;  2HHH E;  1ZBT A;  1ZAA C;  2LJU A;  4NXM E;  4O4K A;  1WHN A;  2HC5 A;  5LL6 R;  4L8N A;  5KL3 A;  2YU8 A;  2I9I A;  4B3S E;  2FGG A;  2K4V A;  2EN1 A;  1UBD C;  2EQ3 A;  2V89 A;  2EQ1 A;  3MHH C;  2EMA A;  4TUI A;  2YZT A;  1N34 E;  2R1F A;  4JI5 E;  1PKP A;  4JI7 E;  2I13 A;  1Z1B A;  4JI4 E;  4AQY E;  1AAY A;  1I94 E;  1X5W A;  2FFL A;  4BS9 A;  1XNQ E;  2JOB A;  2DMI A;  2DB2 A;  2ELY A;  4X9J A;  5A6J A;  3IWD A;  2L3C A;  2UUC E;  1JFZ A;  4B3R E;  2MKD A;  2EM0 A;  3EPL A;  1B69 A;  3QG5 C;  3ADI A;  2DMY A;  2V86 A;  1UN6 B;  2YTF A;  2EOZ A;  3HPS A;  1QU6 A;  4MLQ A;  2ENC A;  2EMZ A;  1DQ3 A;  2JOX A;  2NUF A;  4TUG A;  2GLI A;  1YPN A;  2EN8 A;  4WFT A;  3ADJ A;  2F8B A;  4LF9 E;  5A6K A;  1WRJ A;  2ZM6 E;  1EH7 A;  1YUJ A;  2VF1 A;  5AE3 A;  2N8X A;  1RQ0 A;  2EB1 A;  1A1H A;  1TF3 A;  2B7T A;  4R2D A;  2V83 A;  2LV2 A;  3L00 A;  3VHT B;  5LMN E;  4O24 A;  4BC7 A;  2LUQ A;  5AC5 A;  2DSY A;  2EL6 A;  2YSO A;  4WXD A;  4M30 A;  2EM3 A;  1HNW E;  1PJS A;  2LTS A;  1WXR A;  1DI2 A;  1IBL E;  1ZR9 A;  1BB8 A;  2MC6 A;  3C6K A;  4GKK E;  1UIL A;  2UXC E;  4F2J C;  1YSA C;  5IWA E;  4WSP A;  5AAS A;  2IHR 1;  4X66 E;  2H36 X;  2EZ6 A;  2DLK A;  2L2M A;  5A6B D;  2BBG A;  2RQL A;  2D9H A;  1YYW A;  2EOX A;  2EOR A;  5A6B A;  2DIX A;  4LF6 E;  2LT7 A;  2EMY A;  4P7D A;  2WBU A;  2ADR A;  2EMX A;  3RV0 A;  2NUE A;  2EMC A;  5KL7 A;  2VQF E;  2HJJ A;  4K0K E;  4F9A B;  2M4I A;  2L92 A;  2YTP A;  2WZO A;  4P78 A;  2L3J A;  4R2S A;  2EPC A;  2GSL A;  4DV5 E;  3F6G A;  2EMK A;  4LTY A;  2EPR A;  3JTZ A;  1WHQ A;  2JVA A;  4DR4 E;  3K6Q A;  2EQ0 A;  3F6H A;  1F2I G;  4R2A A;  2EOH A;  1J5E E;  1YZ9 A;  4ZYE A;  3OTO E;  1A1L A;  2CTD A;  2YRK A;  3EQ1 A;  3T1H E;  4WSG A;  2YTG A;  1T4N A;  2MDR A;  1STU A;  2UU9 E;  1EH8 A;  2M9A A;  2VRD A;  1YFH A;  3EPJ A;  4DV4 E;  1GZ6 A;  3RMP A;  2EOQ A;  2MC5 A;  2LCE A;  2CT1 A;  1XMQ E;  2EPN A;  2LMZ A;  2MDG A;  5KL5 A;  1A1K A;  4LF4 E;  4YHH E;  2N3G A;  2YTN A;  2JP9 A;  2V85 A;  1WJP A;  4OUN A;  2LUP B;  3KZY A;  4DV1 E;  1KJK A;  3HTX A;  3BBG A;  2LE2 A;  2WBS A;  3FIG A;  2F4V E;  2E1M A;  1N3G A;  2EMB A;  2EOO A;  1IQO A;  2GHF A;  1ZU1 A;  4RH8 A;  2ODR C;  3THO B;  4ZYG A;  2EM8 A;  2EOF A;  1LLM C;  3LLH A;  4R03 A;  4X62 E;  5IXM B;  4Q28 A;  2G7H A;  4BHC A;  1T4L B;  2EN6 A;  2EOS A;  4LF8 E;  2LVH A;  1QNT A;  1T38 A;  2JR1 A;  2FV4 B;  4M0V A;  2EOJ A;  3MSW A;  5IV8 B;  2YPN A;  2YT4 A;  3HQ1 A;  1G2F C;  3AV0 A;  2VE7 C;  4J8Z A;  1NEI A;  4O43 A;  3M99 B;  1TF6 A;  5ADZ A;  2EML A;  2UXB E;  2E5L E;  2EMW A;  2EPP A;  4F6M A;  2HGH A;  2RSI A;  3H09 A;  4ZYD A;  3BF2 A;  3IWC A;  4BC9 A;  3ADL A;  2YRH A;  4DKK A;  1O0W A;  2KHX A;  4F9C B;  4B3M E;  4KWY A;  2ENA A;  4Q35 B;  4DV7 E;  1N32 E;  4X64 E;  2EOE A;  3VK6 A;  5CFF E;  4R2P A;  1XNR E;  4KZS A;  2QVW A;  4O5G A;  2EPZ A;  1XMO E;  1RC5 A;  2B7V A;  2V88 A;  1PDA A;  4DR3 E;  2L2N A;  2EM7 A;  1YUI A;  1FJG E;  2MKN A;  4JI0 E;  4WPY A;  5LMU E;  1JK1 A;  2L6M A;  3O2R A;  2JWO A;  2NUG A;  1X6E A;  3KZZ A;  1I4S A;  2V8Q B;  4BMJ A;  2EM5 A;  4FK5 C;  2DRP A;  2YTI A;  4DUY E;  3AUZ A;  3MHS C;  5A2Q C;  2YTQ A;  4I8O A;  5KL2 A;  4LF5 E;  2RTX A; 
#chains in the Genus database with same CATH homology
 1HNX E;  3ADI A;  1YZ9 A;  2DMY A;  2V86 A;  4DV6 E;  4JV5 E;  3OTO E;  4LU9 A;  2ODR D;  1QU6 A;  1X47 A;  2RSM A;  3HPS A;  3OML A;  3IWB A;  1DQ3 A;  2JOX A;  2NUF A;  4TUG A;  3T1H E;  1IBK E;  1T4N A;  4WFT A;  3ADJ A;  2F8B A;  2MDR A;  1STU A;  4LF9 E;  3C4B A;  2UU9 E;  2M7Q A;  2ZM6 E;  4JI3 E;  4DV4 E;  4DR6 E;  2KOU A;  2VF1 A;  1GZ6 A;  4F9B B;  3RMP A;  2MC5 A;  3J7A G;  2LJH A;  4DR1 E;  3T1Y E;  3DJW A;  4DUZ E;  5AE3 A;  2EWL A;  1RQ0 A;  1XMQ E;  2N3H A;  4M2Z A;  4JI1 E;  4DV0 E;  1GQE A;  5FLX C;  2LMZ A;  2L2K B;  2LBS B;  2L33 A;  2UUB E;  1YYK A;  2EB1 A;  2B3T B;  2KON A;  3J81 C;  1J26 A;  5BR8 E;  1N33 E;  3J7Y p;  4LF4 E;  4YHH E;  3O2R B;  2N3G A;  1T4O A;  2B7T A;  4KHP E;  4R8O A;  2V85 A;  5DNY A;  4OUN A;  2LUP B;  2V83 A;  4DV1 E;  4DR7 E;  3HTX A;  4GKJ E;  4JI8 E;  1YYO A;  1SR9 A;  2LE2 A;  1U61 A;  5LMN E;  5T6J A;  2L8T A;  4X8W A;  4BBY A;  3FIG A;  1EKZ A;  4BC7 A;  2F4V E;  2LUQ A;  2E1M A;  2LTR A;  2UUA E;  5AE1 A;  4L5N C;  1HR0 E;  2DSY A;  2RS7 A;  4M30 A;  4NXN E;  2ODR C;  4LFB E;  1HNW E;  2LTS A;  3KWR A;  3VYY A;  1UHZ A;  3N3W A;  1WXR A;  3JAM C;  2RS6 A;  3LLH A;  4R03 A;  4X62 E;  5IT9 C;  1DI2 A;  1IBL E;  4Q28 A;  4LFC E;  3JU0 A;  2G7H A;  3P1X A;  2MC6 A;  1ZBQ A;  1T4L B;  4GKK E;  1UIL A;  4GEQ B;  3J80 C;  1HNZ E;  4LF8 E;  4DV3 E;  2LRS A;  3HXL A;  2UXC E;  5IWA E;  4WSP A;  4DR2 E;  2JR1 A;  2FV4 B;  3LML A;  4M0V A;  4F54 A;  3MSW A;  5AAS A;  1N36 E;  3VYX A;  2IHR 1;  4X66 E;  2YT4 A;  3HQ1 A;  5AE2 A;  2H36 X;  2EZ6 A;  3HPZ A;  2JY9 A;  2L2M A;  3AV0 A;  2VE7 C;  4J8Z A;  1YYW A;  4B3T E;  5ADZ A;  2UXB E;  2DIX A;  3DF6 A;  5F3W A;  2E5L E;  1X49 A;  4LF6 E;  1FKA E;  4JI2 E;  2HHH E;  4OX9 E;  3H09 A;  1ZBT A;  4P7D A;  4JI6 E;  4NXM E;  3IWC A;  4BC9 A;  3ADL A;  4DKK A;  1O0W A;  2KHX A;  1WHN A;  2B9D A;  5LL6 R;  2CPN A;  4F9C B;  4B3M E;  4L8N A;  3RV0 A;  4DV7 E;  1N32 E;  4X64 E;  2NUE A;  4B3S E;  3VK6 A;  4OOG C;  1RC7 A;  2FGG A;  2K4V A;  5CFF E;  2VQE E;  1XNR E;  3ADG A;  2VQF E;  2V89 A;  4DMI A;  4KZS A;  4F9A B;  2M4I A;  4K0K E;  2QVW A;  1XMO E;  1RC5 A;  1X48 A;  2L92 A;  4JYA E;  2B7V A;  4TUI A;  2YZT A;  2V88 A;  1N34 E;  4X65 E;  3RV1 A;  2WZO A;  4P78 A;  4YY3 E;  2L3J A;  4JI5 E;  4DV2 E;  4DR3 E;  1PKP A;  2GSL A;  2L2N A;  4LFA E;  1FJG E;  4JI7 E;  3ZOQ B;  4JI0 E;  4WPY A;  5LMU E;  4BCA A;  2L6M A;  4JI4 E;  4DV5 E;  3F6G A;  2M1S A;  4AQY E;  1I94 E;  3O2R A;  4LF7 E;  2FFL A;  4LTY A;  4BS9 A;  2JOB A;  1XNQ E;  2JWO A;  3JTZ A;  3C4T A;  2NUG A;  2JVA A;  1I4S A;  1WHQ A;  2V8Q B;  4BMJ A;  4DR4 E;  2A11 A;  2FTX B;  2NA2 A;  3K6Q A;  4DUY E;  2UXD E;  3AUZ A;  5A2Q C;  2V87 A;  2DB2 A;  4WYQ B;  4DR5 E;  3F6H A;  4I8O A;  3IWD A;  2L3C A;  2UUC E;  1JFZ A;  1IBM E;  4B3R E;  1J5E E;  4LF5 E;  2RTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...