1RC7A

Crystal structure of rnase iii mutant e110k from aquifex aeolicus complexed with ds-rna at 2.15 angstrom resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
220
structure length
220
Chain Sequence
MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFKALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Noncatalytic Assembly of Ribonuclease III with Double-Stranded RNA.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
molecule keywords 5'-R(*GP*GP*CP*GP*CP*GP*CP*GP*CP*C)-3'
total genus 83
structure length 220
sequence length 220
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 1rc7A01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1rc7A02
2UXBE 4JI2E 2RTXA 3RV1A 3O2RA 5CFFE 1ZBTA 2L33A 1N33E 4OOGC 3J7Yp 4NXNE 2N3HA 2EZ6A 3ADGA 4LF5E 2NUGA 2UUCE 5IWAE 4JI3E 2VQFE 4B3SE 3ADIA 4K0KE 4DR7E 2UXCE 4X8WA 2LTRA 1IBME 1HNXE 4DR2E 2L2KB 1EKZA 3HTXA 3VYXA 1XMQE 2F4VE 1RC5A 4M30A 4JV5E 2L2MA 2LRSA 4X64E 4X66E 2UU9E 2LTSA 2JVAA 2LBSB 1UHZA 2B7TA 1IBKE 1YYWA 4WYQB 1HR0E 1RC7A 4DV7E 2YT4A 2N3GA 4YHHE 4JI4E 2E5LE 4OX9E 4YY3E 1I94E 2EB1A 1IBLE 1JFZA 2RS7A 3T1HE 2L2NA 2L3JA 1N34E 4DR4E 4GKKE 2LUPB 1HNWE 4DR3E 1U61A 2UUBE 2RSMA 4B3RE 4AQYE 1FKAE 1X48A 1YYKA 1XNRE 4DV1E 5BR8E 4JI1E 4X62E 2DB2A 2MDRA 4GKJE 1J5EE 4JI8E 4DV2E 4NXME 4WFTA 1X49A 2NA2A 1QU6A 4DR5E 4DV3E 4JI5E 3N3WA 3C4BA 4LF8E 1T4LB 4DR6E 4LFAE 1HNZE 4DV0E 2FFLA 4DV5E 2DMYA 4B3ME 3P1XA 1N36E 4LF4E 1GQEA 4DKKA 2L3CA 3C4TA 1YYOA 3O2RB 1X47A 1WHNA 4LF7E 4JI0E 1T4OA 3RV0A 2UUAE 2B3TB 2LJHA 4DV4E 4KHPE 2UXDE 1UILA 3LLHA 1O0WA 1DI2A 1FJGE 4JI6E 4JI7E 4DR1E 1XNQE 4OUNA 5LMNE 1PKPA 1I4SA 1N32E 4M2ZA 4X65E 2CPNA 2DIXA 3OTOE 2A11A 1T4NA 4LF6E 2NUFA 2GSLA 2KHXA 4B3TE 3ADJA 4DV6E 4DUZE 2VQEE 3VYYA 4LF9E 2JY9A 2NUEA 2LUQA 2IHR1 2ZM6E 3T1YE 1XMOE 2B7VA 4JYAE 1YZ9A 1WHQA 1RQ0A 1STUA 3ADLA 2QVWA 4DUYE 4LFCE 2RS6A 5LMUE 4LFBE 1J26A 2HHHE
chains in the Genus database with same CATH superfamily
2EMCA 2JR1A 2EN3A 3RV1A 2EOQA 2YTIA 2EM5A 5LL6R 2K7IA 4BHCA 2ELZA 3UK3C 3F6GA 4NXNE 2EN6A 1ZBQA 3OMLA 3ADGA 1G2FC 2ELYA 2NUGA 2UUCE 4ZYDA 2V8QB 2DSYA 4X8WA 4N4RB 1SFEA 1HNXE 4DR2E 2L2KB 4O4KA 4BC7A 2ENAA 2ENCA 4JV5E 1WJPA 2WBUA 2FTXB 2BB8A 1TF6A 3THOB 1SR9A 2YTDA 2EWLA 2YTNA 4R2CA 1UN6B 4YY3E 2WZOA 4P7DA 4RHBB 1N34E 2L3JA 4R2SA 1WRJA 2EMIA 4B3RE 4AQYE 2EL6A 2EPLX 4BBYA 4DV1E 1PDAA 1BBGA 5AASA 1X6HA 4WXCA 1J5EE 2EOJA 4MLQA 2NA2A 1NEIA 1T4LB 1P47A 2EPMX 5LLQA 1TN9A 2FFLA 4DV5E 2LO3A 4IS1C 2EMKA 4BHBA 4WSGA 1BBOA 4B3ME 2YPNA 1GQEA 2L3CA 3C4TA 3LMLA 2VF1A 3RV0A 2M1SA 5AE3A 1FJGE 1X3CA 4R2EA 4OUNA 2EJ4A 1I4SA 1BB8A 1N32E 4M2ZA 4X65E 2KONA 3C6KA 2V87A 3RMPA 2R1FA 2I13A 4B3TE 4Q35B 4DUZE 4F6NA 1ZU1A 2VQEE 3C6MA 4P78A 2MC5A 4TUGA 4GEQB 2NUEA 2EP3A 3F6HA 2LUQA 3BGHA 2IHR1 2YTQA 4WXDA 1YZ9A 3ADLA 4LTYA 4WPYA 2V85A 2UXBE 2EL5A 4JI2E 1F2IG 2RTXA 2YRKA 2EMXA 3O2RA 5CFFE 2JYAA 1ZBTA 2L33A 3JU0A 4R03A 2EN8A 3IWCA 2M4IA 1L4SA 1A1LA 2ENHA 2FGGA 2EPZA 2DLQA 4R2DA 5A6JA 4JI3E 4B3SE 2EPCA 2EMZA 2EOEA 2EOSA 1YPNA 4KWYA 4BS9A 1EH7A 1N3GA 2YU8A 2F4VE 2EM4A 4M30A 1AH5A 5A2QC 2LRSA 2H36X 5AC4A 2EM6A 2LE2A 2JVAA 3BIDA 4M9VC 4WYQB 1HR0E 2JOBA 4I8OA 3HXLA 2N3GA 2EOMA 2EB1A 2RQLA 1JFZA 2EL4A 4GKKE 2LUPB 1U61A 4F9AB 2UUBE 2E72A 2R76A 1X48A 2EPOA 1X6FA 2YWQA 4BCAA 2YRHA 2YTGA 2MDRA 4GKJE 3KZYA 2EPKX 4JI8E 4NXME 4WFTA 1X49A 1IQSA 3EPJA 3N3WA 3C4BA 4LU9A 1A1GA 1EH8A 2RPCA 1A1JA 2DMYA 3P1XA 4DKKA 4ZYEA 3O2RB 2I9IA 3BBGA 5IV8B 1T4OA 2UUAE 3J7AG 2LJHA 4DV4E 1UILA 3AUZA 3HQ1A 1O0WA 4JI6E 1EH6A 2V88A 2YZTA 2L92A 2EQ0A 1XNQE 2EOYA 2GPIA 2EMLA 3J81C 2DIXA 4TUIA 2A11A 2EQ3A 1DGCA 4NHRA 2NUFA 3L00A 3DJWA 2EPNA 3HPSA 1A1FA 3VYYA 1IQOA 4LF9E 2Q8UA 2ZM6E 2B7VA 1Z1BA 1WHQA 1YFHA 2EN7A 1J26A 2HHHE 3THNA 2EPAA 2GHFA 4OOGC 5KL2A 2N3HA 4Q28A 4BMJA 4J8ZA 4LF5E 2YTEA 2YU5A 2EPPA 1PJTA 2EMBA 2VQFE 2DMIA 2JOXA 3ADIA 4K0KE 1YSAC 3QG5C 2HGHA 2EOXA 2UXCE 2VRDA 1X6EA 1IBME 2EM8A 3IWBA 1AAYA 2KOUA 1EKZA 3HTXA 3VYXA 1KYQA 3ZOQB 1XMQE 1YUJA 2EN4A 2EMYA 5FLXC 5F3WA 3DF6A 5KL6A 1QNTA 1WXRA 2YSPA 2LTSA 4FK5C 2LT7A 2WBTA 2LBSB 1UHZA 2B7TA 4GZNC 4R2AA 1IBKE 2HJJA 2EPRA 4R2QA 2EM7A 4YHHE 2E5LE 4OX9E 3ECRA 2D9HA 4KZSA 4R2PA 2EN1A 2RS7A 1HNWE 2WCC3 2JPAA 2MKNA 2RSMA 1YYKA 2LVHA 4O24A 3HPZA 2E1MA 5A6BA 4NZVA 1B69A 4BC9A 2DB2A 1ZTDA 2EQ1A 3K6QA 4LF8E 4DV3E 1YUIA 4DR6E 3JAMC 4LFAE 1HNZE 4L8NA 5T6JA 2YRMA 4F6MA 5A6AA 1N36E 3MHSC 2N8XA 2NABA 4F54A 1YYOA 1PJQA 1X47A 2EE8A 4LF7E 2UXDE 2YTPA 4KHPE 2EMHA 2V86A 4O5GA 4DR1E 2YTJA 3H09A 4MLVA 4WSPA 3TQMA 1A1KA 2G7HA 2GLIA 2FV4B 2EPUA 4LF6E 2M9AA 2J7JA 3ADJA 1RMDA 2LMZA 2V83A 4ZYGA 3EPLA 2JY9A 1NCSA 2ADRA 2CTDA 2CT1A 1XMOE 2L6MA 2EOIA 1GZ6A 2ODRC 2QVWA 1X5WA 4LFCE 5LMUE 4LFBE 4F9BB 2EM2A 4L5NC 2LCEA 1N33E 3J7Yp 1PJSA 2PRTA 1KJKA 2JXPA 2VE7C 2EZ6A 1JK1A 2ODRD 1MGTA 5IWAE 3EPHA 4ZYHA 5DNYA 5A6BD 2EMGA 4HTGA 4DR7E 3BF2A 2EM3A 4DMIA 2JWOA 2LTRA 3MSWA 4R8OA 2V89A 3J80C 1RC5A 2B9DA 2L2MA 2EPXA 4X64E 4X66E 2UU9E 3EPKA 2EOFA 3VK6A 4M0VA 2EOZA 5KL4A 2MDGA 3JTZA 2YTOA 2EMAA 1YYWA 4IJDA 2EM0A 1RC7A 4F9CB 5ADZA 2YSOA 4DV7E 2YT4A 4JI4E 1T38A 2JP9A 1I94E 1G2DC 1GTKA 1IBLE 3AV0A 2L2NA 3T1HE 1ZR9A 2EOHA 4DR4E 4O43A 4DR3E 2MC6A 1A1HA 3KZZA 1FKAE 1XNRE 2HC5A 4WX9A 3VHTB 4HEIA 2M7QA 5AE1A 2EMFA 1T39A 1JK2A 2F8BA 2BBGA 2CSHA 5BR8E 4JI1E 4X62E 1A1IA 2EM9A 5KL7A 4DV2E 2DRPA 2A25A 4DR5E 1QU6A 4JI5E 2EORA 2MKDA 4DV0E 5TSEA 5A69A 4LF4E 1DQ3A 1MEYC 5KL5A 5IXMB 1WHNA 4JI0E 2B3TB 1ZAAC 2DLKA 4F2JC 3LLHA 1DI2A 5A6KA 4JI7E 3FIGA 1LLMC 1UBDC 5LMNE 1PKPA 4X9JA 3IWDA 2EMWA 4R2RA 2EOOA 3M99B 2CPNA 3OTOE 2DGCA 1T4NA 4RH8A 2GSLA 2EN2A 2KHXA 1TF3A 5IT9C 2K4VA 4DV6E 2L8TA 3KWRA 2LV2A 5KL3A 5AE2A 1IMUA 2RSIA 3T1YE 4JYAE 3MHHC 1RQ0A 1STUA 3EQ1A 5AC5A 4DUYE 2RS6A 2WBSA 2LJUA 2YTFA
chains in the Genus database with same CATH topology
2UXBE 4JI2E 4L5NC 2JR1A 2RTXA 3RV1A 3O2RA 5LL6R 5CFFE 1ZBTA 2L33A 1N33E 4OOGC 3J7Yp 3JU0A 4R03A 3F6GA 4NXNE 2N3HA 3IWCA 4Q28A 2M4IA 2VE7C 2EZ6A 3OMLA 1ZBQA 4J8ZA 2FGGA 3ADGA 4BMJA 4LF5E 2ODRD 2NUGA 2UUCE 5IWAE 5DNYA 4JI3E 2VQFE 4B3SE 2V8QB 2JOXA 2DSYA 3ADIA 4K0KE 4DR7E 2UXCE 4X8WA 4DMIA 2JWOA 2LTRA 1IBME 3MSWA 3IWBA 4BS9A 1HNXE 2KOUA 2L2KB 4DR2E 1EKZA 3HTXA 3ZOQB 4R8OA 2V89A 1XMQE 2F4VE 3VYXA 4BC7A 3J80C 1RC5A 5FLXC 4M30A 2B9DA 5A2QC 2L2MA 2LRSA 5F3WA 3DF6A 4X64E 4X66E 4JV5E 2H36X 2UU9E 1WXRA 3VK6A 2FTXB 2LTSA 2LE2A 2JVAA 4M0VA 2LBSB 1UHZA 2B7TA 3JTZA 1SR9A 1IBKE 1YYWA 2EWLA 2JOBA 4WYQB 1HR0E 4I8OA 1RC7A 3HXLA 4F9CB 5ADZA 4DV7E 2YT4A 2N3GA 4YHHE 4JI4E 2E5LE 4OX9E 4YY3E 4KZSA 2WZOA 4P7DA 1I94E 2EB1A 1IBLE 1JFZA 2RS7A 3AV0A 2L2NA 2L3JA 3T1HE 1N34E 4DR4E 2LUPB 4GKKE 1HNWE 4DR3E 1U61A 4F9AB 2UUBE 2MC6A 2RSMA 4AQYE 4B3RE 1FKAE 1X48A 1YYKA 1XNRE 3HPZA 2E1MA 4BBYA 2M7QA 5AE1A 2F8BA 4DV1E 4BCAA 5BR8E 5AASA 4BC9A 4JI1E 4X62E 2DB2A 2MDRA 4GKJE 1J5EE 4JI8E 4DV2E 4NXME 4WFTA 3K6QA 1X49A 2NA2A 1QU6A 4DR5E 4DV3E 4JI5E 3N3WA 3C4BA 4LF8E 1T4LB 4DR6E 4LU9A 3JAMC 4LFAE 1HNZE 4L8NA 4DV0E 2FFLA 4DV5E 5T6JA 2DMYA 4B3ME 3P1XA 1N36E 4LF4E 1GQEA 1DQ3A 4DKKA 2L3CA 3C4TA 1YYOA 3O2RB 1X47A 1WHNA 3LMLA 4F54A 4JI0E 2VF1A 1T4OA 3RV0A 2UUAE 4LF7E 2B3TB 3J7AG 2LJHA 4DV4E 4KHPE 2UXDE 2M1SA 1UILA 3LLHA 5AE3A 2V86A 3AUZA 3HQ1A 1O0WA 1DI2A 1FJGE 4JI6E 4JI7E 4DR1E 3FIGA 2V88A 2YZTA 3H09A 2L92A 1XNQE 4OUNA 5LMNE 1PKPA 1I4SA 3IWDA 1N32E 4WSPA 4M2ZA 4X65E 2KONA 2G7HA 3J81C 2CPNA 2DIXA 4TUIA 3OTOE 2A11A 1T4NA 2FV4B 2V87A 3RMPA 4LF6E 2NUFA 2GSLA 2KHXA 4B3TE 3DJWA 3ADJA 2K4VA 2LMZA 2L8TA 3HPSA 4DUZE 2VQEE 3VYYA 4DV6E 5IT9C 2V83A 2MC5A 3KWRA 4P78A 4TUGA 5AE2A 4LF9E 2JY9A 4GEQB 2NUEA 3F6HA 2LUQA 2IHR1 2ZM6E 3T1YE 1XMOE 2L6MA 2B7VA 1YZ9A 4JYAE 1WHQA 1GZ6A 1RQ0A 1STUA 2ODRC 3ADLA 2QVWA 4DUYE 4LTYA 2RS6A 4WPYA 5LMUE 4LFCE 4LFBE 2HHHE 1J26A 4F9BB 2V85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXB E;  4JI2 E;  2RTX A;  3RV1 A;  3O2R A;  5CFF E;  1ZBT A;  2L33 A;  1N33 E;  4OOG C;  3J7Y p;  4NXN E;  2N3H A;  2EZ6 A;  3ADG A;  4LF5 E;  2NUG A;  2UUC E;  5IWA E;  4JI3 E;  2VQF E;  4B3S E;  3ADI A;  4K0K E;  4DR7 E;  2UXC E;  4X8W A;  2LTR A;  1IBM E;  1HNX E;  4DR2 E;  2L2K B;  1EKZ A;  3HTX A;  3VYX A;  1XMQ E;  2F4V E;  1RC5 A;  4M30 A;  4JV5 E;  2L2M A;  2LRS A;  4X64 E;  4X66 E;  2UU9 E;  2LTS A;  2JVA A;  2LBS B;  1UHZ A;  2B7T A;  1IBK E;  1YYW A;  4WYQ B;  1HR0 E;  1RC7 A;  4DV7 E;  2YT4 A;  2N3G A;  4YHH E;  4JI4 E;  2E5L E;  4OX9 E;  4YY3 E;  1I94 E;  2EB1 A;  1IBL E;  1JFZ A;  2RS7 A;  3T1H E;  2L2N A;  2L3J A;  1N34 E;  4DR4 E;  4GKK E;  2LUP B;  1HNW E;  4DR3 E;  1U61 A;  2UUB E;  2RSM A;  4B3R E;  4AQY E;  1FKA E;  1X48 A;  1YYK A;  1XNR E;  4DV1 E;  5BR8 E;  4JI1 E;  4X62 E;  2DB2 A;  2MDR A;  4GKJ E;  1J5E E;  4JI8 E;  4DV2 E;  4NXM E;  4WFT A;  1X49 A;  2NA2 A;  1QU6 A;  4DR5 E;  4DV3 E;  4JI5 E;  3N3W A;  3C4B A;  4LF8 E;  1T4L B;  4DR6 E;  4LFA E;  1HNZ E;  4DV0 E;  2FFL A;  4DV5 E;  2DMY A;  4B3M E;  3P1X A;  1N36 E;  4LF4 E;  1GQE A;  4DKK A;  2L3C A;  3C4T A;  1YYO A;  3O2R B;  1X47 A;  1WHN A;  4LF7 E;  4JI0 E;  1T4O A;  3RV0 A;  2UUA E;  2B3T B;  2LJH A;  4DV4 E;  4KHP E;  2UXD E;  1UIL A;  3LLH A;  1O0W A;  1DI2 A;  1FJG E;  4JI6 E;  4JI7 E;  4DR1 E;  1XNQ E;  4OUN A;  5LMN E;  1PKP A;  1I4S A;  1N32 E;  4M2Z A;  4X65 E;  2CPN A;  2DIX A;  3OTO E;  2A11 A;  1T4N A;  4LF6 E;  2NUF A;  2GSL A;  2KHX A;  4B3T E;  3ADJ A;  4DV6 E;  4DUZ E;  2VQE E;  3VYY A;  4LF9 E;  2JY9 A;  2NUE A;  2LUQ A;  2IHR 1;  2ZM6 E;  3T1Y E;  1XMO E;  2B7V A;  4JYA E;  1YZ9 A;  1WHQ A;  1RQ0 A;  1STU A;  3ADL A;  2QVW A;  4DUY E;  4LFC E;  2RS6 A;  5LMU E;  4LFB E;  1J26 A;  2HHH E; 
#chains in the Genus database with same CATH topology
 2EMC A;  2JR1 A;  2EN3 A;  3RV1 A;  2EOQ A;  2YTI A;  2EM5 A;  5LL6 R;  2K7I A;  4BHC A;  2ELZ A;  3UK3 C;  3F6G A;  4NXN E;  2EN6 A;  1ZBQ A;  3OML A;  3ADG A;  1G2F C;  2ELY A;  2NUG A;  2UUC E;  4ZYD A;  2V8Q B;  2DSY A;  4X8W A;  4N4R B;  1SFE A;  1HNX E;  4DR2 E;  2L2K B;  4O4K A;  4BC7 A;  2ENA A;  2ENC A;  4JV5 E;  1WJP A;  2WBU A;  2FTX B;  2BB8 A;  1TF6 A;  3THO B;  1SR9 A;  2YTD A;  2EWL A;  2YTN A;  4R2C A;  1UN6 B;  4YY3 E;  2WZO A;  4P7D A;  4RHB B;  1N34 E;  2L3J A;  4R2S A;  1WRJ A;  2EMI A;  4B3R E;  4AQY E;  2EL6 A;  2EPL X;  4BBY A;  4DV1 E;  1PDA A;  1BBG A;  5AAS A;  1X6H A;  4WXC A;  1J5E E;  2EOJ A;  4MLQ A;  2NA2 A;  1NEI A;  1T4L B;  1P47 A;  2EPM X;  5LLQ A;  1TN9 A;  2FFL A;  4DV5 E;  2LO3 A;  4IS1 C;  2EMK A;  4BHB A;  4WSG A;  1BBO A;  4B3M E;  2YPN A;  1GQE A;  2L3C A;  3C4T A;  3LML A;  2VF1 A;  3RV0 A;  2M1S A;  5AE3 A;  1FJG E;  1X3C A;  4R2E A;  4OUN A;  2EJ4 A;  1I4S A;  1BB8 A;  1N32 E;  4M2Z A;  4X65 E;  2KON A;  3C6K A;  2V87 A;  3RMP A;  2R1F A;  2I13 A;  4B3T E;  4Q35 B;  4DUZ E;  4F6N A;  1ZU1 A;  2VQE E;  3C6M A;  4P78 A;  2MC5 A;  4TUG A;  4GEQ B;  2NUE A;  2EP3 A;  3F6H A;  2LUQ A;  3BGH A;  2IHR 1;  2YTQ A;  4WXD A;  1YZ9 A;  3ADL A;  4LTY A;  4WPY A;  2V85 A;  2UXB E;  2EL5 A;  4JI2 E;  1F2I G;  2RTX A;  2YRK A;  2EMX A;  3O2R A;  5CFF E;  2JYA A;  1ZBT A;  2L33 A;  3JU0 A;  4R03 A;  2EN8 A;  3IWC A;  2M4I A;  1L4S A;  1A1L A;  2ENH A;  2FGG A;  2EPZ A;  2DLQ A;  4R2D A;  5A6J A;  4JI3 E;  4B3S E;  2EPC A;  2EMZ A;  2EOE A;  2EOS A;  1YPN A;  4KWY A;  4BS9 A;  1EH7 A;  1N3G A;  2YU8 A;  2F4V E;  2EM4 A;  4M30 A;  1AH5 A;  5A2Q C;  2LRS A;  2H36 X;  5AC4 A;  2EM6 A;  2LE2 A;  2JVA A;  3BID A;  4M9V C;  4WYQ B;  1HR0 E;  2JOB A;  4I8O A;  3HXL A;  2N3G A;  2EOM A;  2EB1 A;  2RQL A;  1JFZ A;  2EL4 A;  4GKK E;  2LUP B;  1U61 A;  4F9A B;  2UUB E;  2E72 A;  2R76 A;  1X48 A;  2EPO A;  1X6F A;  2YWQ A;  4BCA A;  2YRH A;  2YTG A;  2MDR A;  4GKJ E;  3KZY A;  2EPK X;  4JI8 E;  4NXM E;  4WFT A;  1X49 A;  1IQS A;  3EPJ A;  3N3W A;  3C4B A;  4LU9 A;  1A1G A;  1EH8 A;  2RPC A;  1A1J A;  2DMY A;  3P1X A;  4DKK A;  4ZYE A;  3O2R B;  2I9I A;  3BBG A;  5IV8 B;  1T4O A;  2UUA E;  3J7A G;  2LJH A;  4DV4 E;  1UIL A;  3AUZ A;  3HQ1 A;  1O0W A;  4JI6 E;  1EH6 A;  2V88 A;  2YZT A;  2L92 A;  2EQ0 A;  1XNQ E;  2EOY A;  2GPI A;  2EML A;  3J81 C;  2DIX A;  4TUI A;  2A11 A;  2EQ3 A;  1DGC A;  4NHR A;  2NUF A;  3L00 A;  3DJW A;  2EPN A;  3HPS A;  1A1F A;  3VYY A;  1IQO A;  4LF9 E;  2Q8U A;  2ZM6 E;  2B7V A;  1Z1B A;  1WHQ A;  1YFH A;  2EN7 A;  1J26 A;  2HHH E;  3THN A;  2EPA A;  2GHF A;  4OOG C;  5KL2 A;  2N3H A;  4Q28 A;  4BMJ A;  4J8Z A;  4LF5 E;  2YTE A;  2YU5 A;  2EPP A;  1PJT A;  2EMB A;  2VQF E;  2DMI A;  2JOX A;  3ADI A;  4K0K E;  1YSA C;  3QG5 C;  2HGH A;  2EOX A;  2UXC E;  2VRD A;  1X6E A;  1IBM E;  2EM8 A;  3IWB A;  1AAY A;  2KOU A;  1EKZ A;  3HTX A;  3VYX A;  1KYQ A;  3ZOQ B;  1XMQ E;  1YUJ A;  2EN4 A;  2EMY A;  5FLX C;  5F3W A;  3DF6 A;  5KL6 A;  1QNT A;  1WXR A;  2YSP A;  2LTS A;  4FK5 C;  2LT7 A;  2WBT A;  2LBS B;  1UHZ A;  2B7T A;  4GZN C;  4R2A A;  1IBK E;  2HJJ A;  2EPR A;  4R2Q A;  2EM7 A;  4YHH E;  2E5L E;  4OX9 E;  3ECR A;  2D9H A;  4KZS A;  4R2P A;  2EN1 A;  2RS7 A;  1HNW E;  2WCC 3;  2JPA A;  2MKN A;  2RSM A;  1YYK A;  2LVH A;  4O24 A;  3HPZ A;  2E1M A;  5A6B A;  4NZV A;  1B69 A;  4BC9 A;  2DB2 A;  1ZTD A;  2EQ1 A;  3K6Q A;  4LF8 E;  4DV3 E;  1YUI A;  4DR6 E;  3JAM C;  4LFA E;  1HNZ E;  4L8N A;  5T6J A;  2YRM A;  4F6M A;  5A6A A;  1N36 E;  3MHS C;  2N8X A;  2NAB A;  4F54 A;  1YYO A;  1PJQ A;  1X47 A;  2EE8 A;  4LF7 E;  2UXD E;  2YTP A;  4KHP E;  2EMH A;  2V86 A;  4O5G A;  4DR1 E;  2YTJ A;  3H09 A;  4MLV A;  4WSP A;  3TQM A;  1A1K A;  2G7H A;  2GLI A;  2FV4 B;  2EPU A;  4LF6 E;  2M9A A;  2J7J A;  3ADJ A;  1RMD A;  2LMZ A;  2V83 A;  4ZYG A;  3EPL A;  2JY9 A;  1NCS A;  2ADR A;  2CTD A;  2CT1 A;  1XMO E;  2L6M A;  2EOI A;  1GZ6 A;  2ODR C;  2QVW A;  1X5W A;  4LFC E;  5LMU E;  4LFB E;  4F9B B;  2EM2 A;  4L5N C;  2LCE A;  1N33 E;  3J7Y p;  1PJS A;  2PRT A;  1KJK A;  2JXP A;  2VE7 C;  2EZ6 A;  1JK1 A;  2ODR D;  1MGT A;  5IWA E;  3EPH A;  4ZYH A;  5DNY A;  5A6B D;  2EMG A;  4HTG A;  4DR7 E;  3BF2 A;  2EM3 A;  4DMI A;  2JWO A;  2LTR A;  3MSW A;  4R8O A;  2V89 A;  3J80 C;  1RC5 A;  2B9D A;  2L2M A;  2EPX A;  4X64 E;  4X66 E;  2UU9 E;  3EPK A;  2EOF A;  3VK6 A;  4M0V A;  2EOZ A;  5KL4 A;  2MDG A;  3JTZ A;  2YTO A;  2EMA A;  1YYW A;  4IJD A;  2EM0 A;  1RC7 A;  4F9C B;  5ADZ A;  2YSO A;  4DV7 E;  2YT4 A;  4JI4 E;  1T38 A;  2JP9 A;  1I94 E;  1G2D C;  1GTK A;  1IBL E;  3AV0 A;  2L2N A;  3T1H E;  1ZR9 A;  2EOH A;  4DR4 E;  4O43 A;  4DR3 E;  2MC6 A;  1A1H A;  3KZZ A;  1FKA E;  1XNR E;  2HC5 A;  4WX9 A;  3VHT B;  4HEI A;  2M7Q A;  5AE1 A;  2EMF A;  1T39 A;  1JK2 A;  2F8B A;  2BBG A;  2CSH A;  5BR8 E;  4JI1 E;  4X62 E;  1A1I A;  2EM9 A;  5KL7 A;  4DV2 E;  2DRP A;  2A25 A;  4DR5 E;  1QU6 A;  4JI5 E;  2EOR A;  2MKD A;  4DV0 E;  5TSE A;  5A69 A;  4LF4 E;  1DQ3 A;  1MEY C;  5KL5 A;  5IXM B;  1WHN A;  4JI0 E;  2B3T B;  1ZAA C;  2DLK A;  4F2J C;  3LLH A;  1DI2 A;  5A6K A;  4JI7 E;  3FIG A;  1LLM C;  1UBD C;  5LMN E;  1PKP A;  4X9J A;  3IWD A;  2EMW A;  4R2R A;  2EOO A;  3M99 B;  2CPN A;  3OTO E;  2DGC A;  1T4N A;  4RH8 A;  2GSL A;  2EN2 A;  2KHX A;  1TF3 A;  5IT9 C;  2K4V A;  4DV6 E;  2L8T A;  3KWR A;  2LV2 A;  5KL3 A;  5AE2 A;  1IMU A;  2RSI A;  3T1Y E;  4JYA E;  3MHH C;  1RQ0 A;  1STU A;  3EQ1 A;  5AC5 A;  4DUY E;  2RS6 A;  2WBS A;  2LJU A;  2YTF A; 
#chains in the Genus database with same CATH homology
 2UXB E;  4JI2 E;  4L5N C;  2JR1 A;  2RTX A;  3RV1 A;  3O2R A;  5LL6 R;  5CFF E;  1ZBT A;  2L33 A;  1N33 E;  4OOG C;  3J7Y p;  3JU0 A;  4R03 A;  3F6G A;  4NXN E;  2N3H A;  3IWC A;  4Q28 A;  2M4I A;  2VE7 C;  2EZ6 A;  3OML A;  1ZBQ A;  4J8Z A;  2FGG A;  3ADG A;  4BMJ A;  4LF5 E;  2ODR D;  2NUG A;  2UUC E;  5IWA E;  5DNY A;  4JI3 E;  2VQF E;  4B3S E;  2V8Q B;  2JOX A;  2DSY A;  3ADI A;  4K0K E;  4DR7 E;  2UXC E;  4X8W A;  4DMI A;  2JWO A;  2LTR A;  1IBM E;  3MSW A;  3IWB A;  4BS9 A;  1HNX E;  2KOU A;  2L2K B;  4DR2 E;  1EKZ A;  3HTX A;  3ZOQ B;  4R8O A;  2V89 A;  1XMQ E;  2F4V E;  3VYX A;  4BC7 A;  3J80 C;  1RC5 A;  5FLX C;  4M30 A;  2B9D A;  5A2Q C;  2L2M A;  2LRS A;  5F3W A;  3DF6 A;  4X64 E;  4X66 E;  4JV5 E;  2H36 X;  2UU9 E;  1WXR A;  3VK6 A;  2FTX B;  2LTS A;  2LE2 A;  2JVA A;  4M0V A;  2LBS B;  1UHZ A;  2B7T A;  3JTZ A;  1SR9 A;  1IBK E;  1YYW A;  2EWL A;  2JOB A;  4WYQ B;  1HR0 E;  4I8O A;  1RC7 A;  3HXL A;  4F9C B;  5ADZ A;  4DV7 E;  2YT4 A;  2N3G A;  4YHH E;  4JI4 E;  2E5L E;  4OX9 E;  4YY3 E;  4KZS A;  2WZO A;  4P7D A;  1I94 E;  2EB1 A;  1IBL E;  1JFZ A;  2RS7 A;  3AV0 A;  2L2N A;  2L3J A;  3T1H E;  1N34 E;  4DR4 E;  2LUP B;  4GKK E;  1HNW E;  4DR3 E;  1U61 A;  4F9A B;  2UUB E;  2MC6 A;  2RSM A;  4AQY E;  4B3R E;  1FKA E;  1X48 A;  1YYK A;  1XNR E;  3HPZ A;  2E1M A;  4BBY A;  2M7Q A;  5AE1 A;  2F8B A;  4DV1 E;  4BCA A;  5BR8 E;  5AAS A;  4BC9 A;  4JI1 E;  4X62 E;  2DB2 A;  2MDR A;  4GKJ E;  1J5E E;  4JI8 E;  4DV2 E;  4NXM E;  4WFT A;  3K6Q A;  1X49 A;  2NA2 A;  1QU6 A;  4DR5 E;  4DV3 E;  4JI5 E;  3N3W A;  3C4B A;  4LF8 E;  1T4L B;  4DR6 E;  4LU9 A;  3JAM C;  4LFA E;  1HNZ E;  4L8N A;  4DV0 E;  2FFL A;  4DV5 E;  5T6J A;  2DMY A;  4B3M E;  3P1X A;  1N36 E;  4LF4 E;  1GQE A;  1DQ3 A;  4DKK A;  2L3C A;  3C4T A;  1YYO A;  3O2R B;  1X47 A;  1WHN A;  3LML A;  4F54 A;  4JI0 E;  2VF1 A;  1T4O A;  3RV0 A;  2UUA E;  4LF7 E;  2B3T B;  3J7A G;  2LJH A;  4DV4 E;  4KHP E;  2UXD E;  2M1S A;  1UIL A;  3LLH A;  5AE3 A;  2V86 A;  3AUZ A;  3HQ1 A;  1O0W A;  1DI2 A;  1FJG E;  4JI6 E;  4JI7 E;  4DR1 E;  3FIG A;  2V88 A;  2YZT A;  3H09 A;  2L92 A;  1XNQ E;  4OUN A;  5LMN E;  1PKP A;  1I4S A;  3IWD A;  1N32 E;  4WSP A;  4M2Z A;  4X65 E;  2KON A;  2G7H A;  3J81 C;  2CPN A;  2DIX A;  4TUI A;  3OTO E;  2A11 A;  1T4N A;  2FV4 B;  2V87 A;  3RMP A;  4LF6 E;  2NUF A;  2GSL A;  2KHX A;  4B3T E;  3DJW A;  3ADJ A;  2K4V A;  2LMZ A;  2L8T A;  3HPS A;  4DUZ E;  2VQE E;  3VYY A;  4DV6 E;  5IT9 C;  2V83 A;  2MC5 A;  3KWR A;  4P78 A;  4TUG A;  5AE2 A;  4LF9 E;  2JY9 A;  4GEQ B;  2NUE A;  3F6H A;  2LUQ A;  2IHR 1;  2ZM6 E;  3T1Y E;  1XMO E;  2L6M A;  2B7V A;  1YZ9 A;  4JYA E;  1WHQ A;  1GZ6 A;  1RQ0 A;  1STU A;  2ODR C;  3ADL A;  2QVW A;  4DUY E;  4LTY A;  2RS6 A;  4WPY A;  5LMU E;  4LFC E;  4LFB E;  2HHH E;  1J26 A;  4F9B B;  2V85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...