1RC7A

Crystal structure of rnase iii mutant e110k from aquifex aeolicus complexed with ds-rna at 2.15 angstrom resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
220
structure length
220
Chain Sequence
MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFKALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*GP*GP*CP*GP*CP*GP*CP*GP*CP*C)-3'
publication title Noncatalytic Assembly of Ribonuclease III with Double-Stranded RNA.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
total genus 83
structure length 220
sequence length 220
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 1rc7A01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1rc7A02
3O2RA 2DIXA 2LTSA 4WFTA 3T1HE 4OUNA 4DV7E 2N3GA 2VQEE 4DR6E 1UHZA 4LFBE 4JI0E 2LJHA 1I4SA 4LF9E 2L3CA 4NXNE 4M2ZA 4DKKA 4JI4E 4JI7E 2RS6A 2HHHE 4DR3E 1IBME 4B3ME 4JYAE 1N32E 1RQ0A 1WHNA 1FKAE 5CFFE 1N34E 4NXME 1XNQE 3ADLA 2F4VE 4K0KE 2DB2A 2L2NA 4DR7E 4WYQB 2QVWA 3C4BA 4YY3E 4DV4E 1XNRE 2UXBE 4JI8E 2L2KB 1T4OA 2NA2A 4JI5E 4DR2E 3ADIA 1X48A 4X8WA 4DR5E 4DV6E 1HNXE 2MDRA 1RC5A 1XMQE 4JI2E 3O2RB 5LMUE 3ADJA 2ZM6E 4KHPE 4JI6E 1IBKE 3HTXA 4X62E 2EB1A 1YYKA 4B3TE 2VQFE 1QU6A 5IWAE 4LF8E 2UXCE 1YYOA 2LTRA 1HR0E 1N33E 2JVAA 2UXDE 2B3TB 4JI1E 1O0WA 2NUEA 2N3HA 2L2MA 4DR1E 1PKPA 4DR4E 2B7TA 2NUGA 1ZBTA 4OX9E 4M30A 4DV1E 2UUCE 2A11A 2YT4A 4DV0E 2L3JA 3OTOE 4GKKE 2EZ6A 4X64E 3N3WA 1EKZA 3RV0A 1J26A 2RTXA 2L33A 4X66E 4B3RE 2NUFA 3LLHA 4B3SE 1GQEA 5LMNE 1HNWE 2UU9E 1STUA 1DI2A 4LFCE 1IBLE 3C4TA 1X49A 2GSLA 4LF6E 2RS7A 4LFAE 4DV2E 1FJGE 3VYXA 1T4NA 2IHR1 4DUZE 2DMYA 4DV3E 2LBSB 1T4LB 2UUBE 1J5EE 4OOGC 4DUYE 2LUQA 5BR8E 3P1XA 4JV5E 1RC7A 1I94E 2LRSA 2CPNA 1HNZE 1U61A 1WHQA 2FFLA 2LUPB 1YZ9A 1YYWA 1XMOE 2B7VA 1UILA 4JI3E 4YHHE 3T1YE 3ADGA 4DV5E 4LF4E 4GKJE 2KHXA 2UUAE 4AQYE 3RV1A 4X65E 3J7Yp 1JFZA 1X47A 2E5LE 4LF5E 1N36E 2RSMA 4LF7E 3VYYA 2JY9A
chains in the Genus database with same CATH superfamily
3O2RA 2JYAA 2YTDA 2WZOA 1ZU1A 3T1HE 4DV7E 4LFBE 1N3GA 2L3CA 2ELYA 2EM6A 4JI7E 2EN4A 4IJDA 1IBME 2ADRA 3HXLA 2EOSA 2EOHA 4M9VC 5IV8B 2FGGA 2A25A 1JK2A 3ADLA 2HC5A 1T39A 2EMKA 1T38A 4DR7E 4WYQB 4Q28A 2EPRA 2QVWA 1PJTA 4RHBB 4DV4E 2EMIA 2FTXB 2UXBE 1X5WA 4JI8E 1A1LA 5IT9C 2NA2A 3VK6A 3ADIA 1ZTDA 1X48A 4HEIA 2ODRD 4X8WA 4LTYA 5AE3A 2EM9A 2MDRA 3EPJA 1XMQE 4FK5C 5LMUE 4WPYA 4GZNC 2G7HA 1EH8A 4JI6E 3F6HA 1QU6A 3QG5C 3IWBA 2EPZA 4R2SA 2LV2A 1AH5A 4JI1E 2EM2A 2LJUA 5A6BD 3J7AG 2Q8UA 2L2MA 4BCAA 2E1MA 3MSWA 1PKPA 2EMLA 4R2QA 2EPNA 1ZBTA 3ECRA 5KL4A 2M7QA 2JPAA 2RQLA 3C6MA 4NZVA 2V86A 4X64E 1EKZA 1J26A 2EN7A 4B3SE 4BS9A 1TF3A 4BC9A 2EQ0A 1P47A 2EN3A 1STUA 5KL5A 3ZOQB 2N8XA 5F3WA 2WCC3 2BBGA 3J80C 1YFHA 1BB8A 5KL6A 1KJKA 4LFAE 2YTFA 3HPSA 2EP3A 1FJGE 4O24A 2EE8A 3HQ1A 2DMYA 1T4LB 3KZYA 4OOGC 1MGTA 5KL7A 1X6EA 4WXDA 5KL3A 1RC7A 2EPLX 1I94E 2EOJA 2EPKX 1U61A 2WBSA 4JI3E 4R2DA 3VHTB 2KHXA 4DMIA 2WBUA 4BC7A 2B9DA 1BBGA 4P78A 1N36E 2MDGA 5BR8E 2GLIA 4TUIA 3BIDA 4F9AB 2LTSA 1UN6B 1PJSA 4O4KA 4OUNA 3BGHA 1UHZA 2EL5A 4JI0E 4LF9E 1I4SA 2M9AA 1G2DC 2I13A 3EPKA 4JI4E 2EM7A 2FV4B 2RS6A 4DR3E 1MEYC 4B3ME 1FKAE 2L8TA 2YTPA 2EN2A 3K6QA 4IS1C 4NXME 1L4SA 1BBOA 2CT1A 2DB2A 3L00A 3C4BA 2PRTA 4YY3E 1XNRE 1A1FA 2L2KB 1T4OA 3RMPA 1AAYA 2EOXA 4DV6E 1HNXE 4BMJA 4L8NA 1NCSA 2E72A 3ADJA 5A6AA 2LO3A 2EOMA 3H09A 1GZ6A 3HTXA 1YYKA 1RMDA 2VQFE 4LF8E 1YYOA 3MHHC 2CSHA 2UXDE 3UK3C 2EMFA 4ZYDA 1X6HA 4WSGA 3KWRA 4DR1E 4R2CA 2GPIA 3JU0A 4F9CB 2NUGA 4ZYGA 5IXMB 4R03A 1YSAC 4OX9E 2YWQA 2EM0A 4DV1E 2UUCE 2A11A 4F9BB 5AE2A 4MLQA 3OTOE 3LMLA 4KZSA 1WXRA 2L33A 2KOUA 3LLHA 2YU5A 2MKDA 4F6NA 2UU9E 4LU9A 1IBLE 3THNA 1UBDC 2GHFA 2EMYA 1A1JA 5FLXC 2EQ1A 4DV2E 1A1KA 5AE1A 3OMLA 2EM8A 5A6BA 3VYXA 1LLMC 2EM3A 1EH6A 2LUQA 1IMUA 3P1XA 4WXCA 4HTGA 1DGCA 2EMHA 2ODRC 1ZBQA 2LRSA 2ENHA 1WHQA 2FFLA 3F6GA 2R1FA 1B69A 2B7VA 1UILA 4J8ZA 2JXPA 5TSEA 3AV0A 2YTGA 4LF4E 4AQYE 3RV1A 4P7DA 2LE2A 2EMCA 2V85A 4DR4E 5LL6R 2DIXA 1PJQA 4DR6E 2EPOA 4RH8A 4BHCA 4R2RA 2HJJA 2NABA 4M2ZA 2YTJA 4WSPA 4DKKA 2EPXA 1RQ0A 2ENAA 2L92A 5CFFE 4MLVA 2LCEA 2YTNA 1N34E 2K4VA 4ZYEA 3DF6A 4K0KE 2EQ3A 3THOB 4O43A 2YRMA 2LMZA 3AUZA 1TN9A 4Q35B 2YRKA 2EMAA 4DR5E 1A1HA 4R2EA 1YPNA 1RC5A 4JI2E 2H36X 2YU8A 2ENCA 2EORA 2VRDA 2JP9A 4KWYA 2EN1A 2EL6A 5IWAE 2UXCE 1HR0E 2YTQA 2EOIA 2I9IA 1O0WA 2NUEA 1A1IA 1QNTA 3BF2A 2EOOA 2EM4A 2YTEA 2EMZA 2VF1A 2EM5A 2DGCA 2M1SA 2KONA 2YSPA 2EZ6A 2V89A 3N3WA 2YZTA 3RV0A 2RTXA 2V87A 2EMWA 4X66E 1GQEA 1IQOA 2CTDA 5AASA 2EN6A 2LVHA 4LFCE 1SFEA 3C4TA 2M4IA 2GSLA 5A2QC 4LF6E 2RSIA 4F2JC 2L6MA 2EOYA 4I8OA 2JOBA 4BHBA 4DUZE 4DV3E 2YTIA 2UUBE 3JTZA 3C6KA 1J5EE 1WJPA 2BB8A 2EOQA 2EPAA 2K7IA 2YPNA 3IWCA 4JV5E 2EMGA 3EPHA 2YSOA 5A6JA 1IQSA 3HPZA 4M0VA 2CPNA 1X6FA 2MC6A 4TUGA 2LUPB 1Z1BA 1YYWA 1YUIA 2JR1A 2EPMX 4YHHE 5AC4A 2EOFA 3ADGA 2EPCA 4DV5E 1EH7A 4GKJE 4L5NC 4X65E 2DRPA 3J7Yp 3J81C 1X47A 2E5LE 4LF5E 2V8QB 3JAMC 3FIGA 2JY9A 2DMIA 1ZR9A 5KL2A 4WFTA 2RPCA 2N3GA 2LT7A 2VQEE 3MHSC 2EMXA 5DNYA 2LJHA 2HGHA 1YUJA 2EN8A 2EPPA 4NXNE 2ELZA 2MC5A 2HHHE 1NEIA 4N4RB 4JYAE 1N32E 1WHNA 4F6MA 1XNQE 5ADZA 2F4VE 2L2NA 2EOEA 1A1GA 2EL4A 4JI5E 4DR2E 2DLQA 4F54A 1TF6A 1PDAA 3O2RB 2ZM6E 4R2PA 1F2IG 1GTKA 5AC5A 1IBKE 4X62E 2EB1A 4B3TE 1G2FC 1SR9A 2J7JA 2LTRA 1N33E 2JVAA 2B3TB 1ZAAC 2N3HA 4WX9A 2MKNA 2VE7C 2B7TA 4M30A 2D9HA 1JK1A 2V88A 2YT4A 4DV0E 2L3JA 2JOXA 3KZZA 4GKKE 4X9JA 2EMBA 4B3RE 2NUFA 2EOZA 2F8BA 5T6JA 5LMNE 1HNWE 1X3CA 1DI2A 2YTOA 3EQ1A 1X49A 2RS7A 3DJWA 1WRJA 4R2AA 4GEQB 4ZYHA 3IWDA 4O5GA 1T4NA 2IHR1 4NHRA 2DLKA 2V83A 1KYQA 5A6KA 2LBSB 4DUYE 4BBYA 5A69A 2R76A 5LLQA 2EWLA 2EJ4A 2YRHA 1HNZE 4KHPE 1XMOE 1YZ9A 3T1YE 2EPUA 2WBTA 2UUAE 2DSYA 3M99B 4R8OA 3EPLA 3TQMA 2JWOA 3BBGA 1JFZA 4LF7E 2RSMA 3VYYA 1DQ3A
chains in the Genus database with same CATH topology
3O2RA 5LL6R 2WZOA 2DIXA 4F9AB 4TUIA 2LTSA 4WFTA 3T1HE 4OUNA 4DV7E 2N3GA 2VQEE 4DR6E 1UHZA 4LFBE 4JI0E 5DNYA 2LJHA 1I4SA 4LF9E 2L3CA 4NXNE 4M2ZA 4WSPA 4DKKA 4JI7E 4JI4E 2MC5A 2FV4B 2RS6A 2HHHE 4DR3E 1IBME 4B3ME 4JYAE 3HXLA 1N32E 1RQ0A 1WHNA 2L92A 5CFFE 2L8TA 1FKAE 3K6QA 2FGGA 1N34E 4NXME 1XNQE 5ADZA 3ADLA 2K4VA 2F4VE 3DF6A 2DB2A 4K0KE 2L2NA 4DR7E 4WYQB 4Q28A 2QVWA 3C4BA 4YY3E 4DV4E 2FTXB 1XNRE 2UXBE 2LMZA 4JI8E 5IT9C 2L2KB 1T4OA 2NA2A 3AUZA 3VK6A 4JI5E 4DR2E 3ADIA 1X48A 3RMPA 2ODRD 4X8WA 4LTYA 4F54A 5AE3A 4DV6E 4DR5E 1HNXE 2MDRA 4BMJA 1RC5A 4L8NA 1XMQE 4JI2E 3O2RB 5LMUE 3ADJA 2H36X 4WPYA 2ZM6E 3H09A 4KHPE 2G7HA 1GZ6A 4JI6E 1IBKE 3HTXA 4X62E 2EB1A 1YYKA 4B3TE 3F6HA 1SR9A 1QU6A 5IWAE 2VQFE 3IWBA 4LF8E 1YYOA 2UXCE 2LTRA 1HR0E 1N33E 2JVAA 3FIGA 2B3TB 4JI1E 2UXDE 1O0WA 3J7AG 2NUEA 2N3HA 2L2MA 4BCAA 2E1MA 3KWRA 1PKPA 3MSWA 4DR1E 4DR4E 2VE7C 2B7TA 2VF1A 3JU0A 2NUGA 1ZBTA 4F9CB 4R03A 4M30A 4OX9E 2M1SA 2M7QA 4DV1E 2A11A 4F9BB 2KONA 5AE2A 2UUCE 2V88A 2YT4A 4DV0E 2L3JA 2JOXA 2V86A 3VYYA 3OTOE 3LMLA 4KZSA 4GKKE 1WXRA 2EZ6A 2V89A 3N3WA 2YZTA 3RV0A 4X64E 1EKZA 1J26A 2RTXA 2L33A 2KOUA 2V87A 4X66E 4B3RE 2NUFA 3LLHA 4BS9A 4B3SE 1GQEA 4BC9A 2F8BA 5T6JA 5AASA 5LMNE 1HNWE 2UU9E 1STUA 4LU9A 5F3WA 3ZOQB 4LFCE 1DI2A 1IBLE 3J80C 3C4TA 1X49A 2M4IA 2GSLA 5A2QC 4LF6E 2RS7A 3DJWA 2L6MA 4LFAE 5FLXC 4DV2E 4I8OA 3HPSA 5AE1A 2JOBA 1FJGE 3OMLA 4GEQB 3IWDA 3VYXA 3HQ1A 1T4NA 2IHR1 4DUZE 2DMYA 2V83A 4DV3E 2LBSB 3JTZA 1T4LB 2UUBE 1J5EE 4OOGC 4DUYE 4BBYA 2LUQA 5BR8E 3P1XA 3IWCA 4JV5E 1RC7A 2EWLA 1ZBQA 2ODRC 1I94E 3HPZA 2LRSA 2CPNA 2MC6A 4M0VA 1U61A 1WHQA 2FFLA 3F6GA 1YZ9A 1YYWA 2LUPB 2B7VA 1UILA 4J8ZA 2JR1A 1XMOE 4JI3E 4YHHE 3AV0A 3T1YE 3ADGA 4DV5E 4LF4E 4TUGA 4GKJE 2KHXA 2UUAE 2DSYA 4DMIA 4L5NC 4AQYE 3RV1A 4R8OA 4BC7A 4X65E 2B9DA 4P7DA 3J7Yp 2JWOA 3J81C 1HNZE 1JFZA 1X47A 4P78A 2LE2A 2V8QB 2RSMA 2V85A 3JAMC 1N36E 2E5LE 2JY9A 4LF5E 4LF7E 1DQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O2R A;  2DIX A;  2LTS A;  4WFT A;  3T1H E;  4OUN A;  4DV7 E;  2N3G A;  2VQE E;  4DR6 E;  1UHZ A;  4LFB E;  4JI0 E;  2LJH A;  1I4S A;  4LF9 E;  2L3C A;  4NXN E;  4M2Z A;  4DKK A;  4JI4 E;  4JI7 E;  2RS6 A;  2HHH E;  4DR3 E;  1IBM E;  4B3M E;  4JYA E;  1N32 E;  1RQ0 A;  1WHN A;  1FKA E;  5CFF E;  1N34 E;  4NXM E;  1XNQ E;  3ADL A;  2F4V E;  4K0K E;  2DB2 A;  2L2N A;  4DR7 E;  4WYQ B;  2QVW A;  3C4B A;  4YY3 E;  4DV4 E;  1XNR E;  2UXB E;  4JI8 E;  2L2K B;  1T4O A;  2NA2 A;  4JI5 E;  4DR2 E;  3ADI A;  1X48 A;  4X8W A;  4DR5 E;  4DV6 E;  1HNX E;  2MDR A;  1RC5 A;  1XMQ E;  4JI2 E;  3O2R B;  5LMU E;  3ADJ A;  2ZM6 E;  4KHP E;  4JI6 E;  1IBK E;  3HTX A;  4X62 E;  2EB1 A;  1YYK A;  4B3T E;  2VQF E;  1QU6 A;  5IWA E;  4LF8 E;  2UXC E;  1YYO A;  2LTR A;  1HR0 E;  1N33 E;  2JVA A;  2UXD E;  2B3T B;  4JI1 E;  1O0W A;  2NUE A;  2N3H A;  2L2M A;  4DR1 E;  1PKP A;  4DR4 E;  2B7T A;  2NUG A;  1ZBT A;  4OX9 E;  4M30 A;  4DV1 E;  2UUC E;  2A11 A;  2YT4 A;  4DV0 E;  2L3J A;  3OTO E;  4GKK E;  2EZ6 A;  4X64 E;  3N3W A;  1EKZ A;  3RV0 A;  1J26 A;  2RTX A;  2L33 A;  4X66 E;  4B3R E;  2NUF A;  3LLH A;  4B3S E;  1GQE A;  5LMN E;  1HNW E;  2UU9 E;  1STU A;  1DI2 A;  4LFC E;  1IBL E;  3C4T A;  1X49 A;  2GSL A;  4LF6 E;  2RS7 A;  4LFA E;  4DV2 E;  1FJG E;  3VYX A;  1T4N A;  2IHR 1;  4DUZ E;  2DMY A;  4DV3 E;  2LBS B;  1T4L B;  2UUB E;  1J5E E;  4OOG C;  4DUY E;  2LUQ A;  5BR8 E;  3P1X A;  4JV5 E;  1RC7 A;  1I94 E;  2LRS A;  2CPN A;  1HNZ E;  1U61 A;  1WHQ A;  2FFL A;  2LUP B;  1YZ9 A;  1YYW A;  1XMO E;  2B7V A;  1UIL A;  4JI3 E;  4YHH E;  3T1Y E;  3ADG A;  4DV5 E;  4LF4 E;  4GKJ E;  2KHX A;  2UUA E;  4AQY E;  3RV1 A;  4X65 E;  3J7Y p;  1JFZ A;  1X47 A;  2E5L E;  4LF5 E;  1N36 E;  2RSM A;  4LF7 E;  3VYY A;  2JY9 A; 
#chains in the Genus database with same CATH topology
 3O2R A;  2JYA A;  2YTD A;  2WZO A;  1ZU1 A;  3T1H E;  4DV7 E;  4LFB E;  1N3G A;  2L3C A;  2ELY A;  2EM6 A;  4JI7 E;  2EN4 A;  4IJD A;  1IBM E;  2ADR A;  3HXL A;  2EOS A;  2EOH A;  4M9V C;  5IV8 B;  2FGG A;  2A25 A;  1JK2 A;  3ADL A;  2HC5 A;  1T39 A;  2EMK A;  1T38 A;  4DR7 E;  4WYQ B;  4Q28 A;  2EPR A;  2QVW A;  1PJT A;  4RHB B;  4DV4 E;  2EMI A;  2FTX B;  2UXB E;  1X5W A;  4JI8 E;  1A1L A;  5IT9 C;  2NA2 A;  3VK6 A;  3ADI A;  1ZTD A;  1X48 A;  4HEI A;  2ODR D;  4X8W A;  4LTY A;  5AE3 A;  2EM9 A;  2MDR A;  3EPJ A;  1XMQ E;  4FK5 C;  5LMU E;  4WPY A;  4GZN C;  2G7H A;  1EH8 A;  4JI6 E;  3F6H A;  1QU6 A;  3QG5 C;  3IWB A;  2EPZ A;  4R2S A;  2LV2 A;  1AH5 A;  4JI1 E;  2EM2 A;  2LJU A;  5A6B D;  3J7A G;  2Q8U A;  2L2M A;  4BCA A;  2E1M A;  3MSW A;  1PKP A;  2EML A;  4R2Q A;  2EPN A;  1ZBT A;  3ECR A;  5KL4 A;  2M7Q A;  2JPA A;  2RQL A;  3C6M A;  4NZV A;  2V86 A;  4X64 E;  1EKZ A;  1J26 A;  2EN7 A;  4B3S E;  4BS9 A;  1TF3 A;  4BC9 A;  2EQ0 A;  1P47 A;  2EN3 A;  1STU A;  5KL5 A;  3ZOQ B;  2N8X A;  5F3W A;  2WCC 3;  2BBG A;  3J80 C;  1YFH A;  1BB8 A;  5KL6 A;  1KJK A;  4LFA E;  2YTF A;  3HPS A;  2EP3 A;  1FJG E;  4O24 A;  2EE8 A;  3HQ1 A;  2DMY A;  1T4L B;  3KZY A;  4OOG C;  1MGT A;  5KL7 A;  1X6E A;  4WXD A;  5KL3 A;  1RC7 A;  2EPL X;  1I94 E;  2EOJ A;  2EPK X;  1U61 A;  2WBS A;  4JI3 E;  4R2D A;  3VHT B;  2KHX A;  4DMI A;  2WBU A;  4BC7 A;  2B9D A;  1BBG A;  4P78 A;  1N36 E;  2MDG A;  5BR8 E;  2GLI A;  4TUI A;  3BID A;  4F9A B;  2LTS A;  1UN6 B;  1PJS A;  4O4K A;  4OUN A;  3BGH A;  1UHZ A;  2EL5 A;  4JI0 E;  4LF9 E;  1I4S A;  2M9A A;  1G2D C;  2I13 A;  3EPK A;  4JI4 E;  2EM7 A;  2FV4 B;  2RS6 A;  4DR3 E;  1MEY C;  4B3M E;  1FKA E;  2L8T A;  2YTP A;  2EN2 A;  3K6Q A;  4IS1 C;  4NXM E;  1L4S A;  1BBO A;  2CT1 A;  2DB2 A;  3L00 A;  3C4B A;  2PRT A;  4YY3 E;  1XNR E;  1A1F A;  2L2K B;  1T4O A;  3RMP A;  1AAY A;  2EOX A;  4DV6 E;  1HNX E;  4BMJ A;  4L8N A;  1NCS A;  2E72 A;  3ADJ A;  5A6A A;  2LO3 A;  2EOM A;  3H09 A;  1GZ6 A;  3HTX A;  1YYK A;  1RMD A;  2VQF E;  4LF8 E;  1YYO A;  3MHH C;  2CSH A;  2UXD E;  3UK3 C;  2EMF A;  4ZYD A;  1X6H A;  4WSG A;  3KWR A;  4DR1 E;  4R2C A;  2GPI A;  3JU0 A;  4F9C B;  2NUG A;  4ZYG A;  5IXM B;  4R03 A;  1YSA C;  4OX9 E;  2YWQ A;  2EM0 A;  4DV1 E;  2UUC E;  2A11 A;  4F9B B;  5AE2 A;  4MLQ A;  3OTO E;  3LML A;  4KZS A;  1WXR A;  2L33 A;  2KOU A;  3LLH A;  2YU5 A;  2MKD A;  4F6N A;  2UU9 E;  4LU9 A;  1IBL E;  3THN A;  1UBD C;  2GHF A;  2EMY A;  1A1J A;  5FLX C;  2EQ1 A;  4DV2 E;  1A1K A;  5AE1 A;  3OML A;  2EM8 A;  5A6B A;  3VYX A;  1LLM C;  2EM3 A;  1EH6 A;  2LUQ A;  1IMU A;  3P1X A;  4WXC A;  4HTG A;  1DGC A;  2EMH A;  2ODR C;  1ZBQ A;  2LRS A;  2ENH A;  1WHQ A;  2FFL A;  3F6G A;  2R1F A;  1B69 A;  2B7V A;  1UIL A;  4J8Z A;  2JXP A;  5TSE A;  3AV0 A;  2YTG A;  4LF4 E;  4AQY E;  3RV1 A;  4P7D A;  2LE2 A;  2EMC A;  2V85 A;  4DR4 E;  5LL6 R;  2DIX A;  1PJQ A;  4DR6 E;  2EPO A;  4RH8 A;  4BHC A;  4R2R A;  2HJJ A;  2NAB A;  4M2Z A;  2YTJ A;  4WSP A;  4DKK A;  2EPX A;  1RQ0 A;  2ENA A;  2L92 A;  5CFF E;  4MLV A;  2LCE A;  2YTN A;  1N34 E;  2K4V A;  4ZYE A;  3DF6 A;  4K0K E;  2EQ3 A;  3THO B;  4O43 A;  2YRM A;  2LMZ A;  3AUZ A;  1TN9 A;  4Q35 B;  2YRK A;  2EMA A;  4DR5 E;  1A1H A;  4R2E A;  1YPN A;  1RC5 A;  4JI2 E;  2H36 X;  2YU8 A;  2ENC A;  2EOR A;  2VRD A;  2JP9 A;  4KWY A;  2EN1 A;  2EL6 A;  5IWA E;  2UXC E;  1HR0 E;  2YTQ A;  2EOI A;  2I9I A;  1O0W A;  2NUE A;  1A1I A;  1QNT A;  3BF2 A;  2EOO A;  2EM4 A;  2YTE A;  2EMZ A;  2VF1 A;  2EM5 A;  2DGC A;  2M1S A;  2KON A;  2YSP A;  2EZ6 A;  2V89 A;  3N3W A;  2YZT A;  3RV0 A;  2RTX A;  2V87 A;  2EMW A;  4X66 E;  1GQE A;  1IQO A;  2CTD A;  5AAS A;  2EN6 A;  2LVH A;  4LFC E;  1SFE A;  3C4T A;  2M4I A;  2GSL A;  5A2Q C;  4LF6 E;  2RSI A;  4F2J C;  2L6M A;  2EOY A;  4I8O A;  2JOB A;  4BHB A;  4DUZ E;  4DV3 E;  2YTI A;  2UUB E;  3JTZ A;  3C6K A;  1J5E E;  1WJP A;  2BB8 A;  2EOQ A;  2EPA A;  2K7I A;  2YPN A;  3IWC A;  4JV5 E;  2EMG A;  3EPH A;  2YSO A;  5A6J A;  1IQS A;  3HPZ A;  4M0V A;  2CPN A;  1X6F A;  2MC6 A;  4TUG A;  2LUP B;  1Z1B A;  1YYW A;  1YUI A;  2JR1 A;  2EPM X;  4YHH E;  5AC4 A;  2EOF A;  3ADG A;  2EPC A;  4DV5 E;  1EH7 A;  4GKJ E;  4L5N C;  4X65 E;  2DRP A;  3J7Y p;  3J81 C;  1X47 A;  2E5L E;  4LF5 E;  2V8Q B;  3JAM C;  3FIG A;  2JY9 A;  2DMI A;  1ZR9 A;  5KL2 A;  4WFT A;  2RPC A;  2N3G A;  2LT7 A;  2VQE E;  3MHS C;  2EMX A;  5DNY A;  2LJH A;  2HGH A;  1YUJ A;  2EN8 A;  2EPP A;  4NXN E;  2ELZ A;  2MC5 A;  2HHH E;  1NEI A;  4N4R B;  4JYA E;  1N32 E;  1WHN A;  4F6M A;  1XNQ E;  5ADZ A;  2F4V E;  2L2N A;  2EOE A;  1A1G A;  2EL4 A;  4JI5 E;  4DR2 E;  2DLQ A;  4F54 A;  1TF6 A;  1PDA A;  3O2R B;  2ZM6 E;  4R2P A;  1F2I G;  1GTK A;  5AC5 A;  1IBK E;  4X62 E;  2EB1 A;  4B3T E;  1G2F C;  1SR9 A;  2J7J A;  2LTR A;  1N33 E;  2JVA A;  2B3T B;  1ZAA C;  2N3H A;  4WX9 A;  2MKN A;  2VE7 C;  2B7T A;  4M30 A;  2D9H A;  1JK1 A;  2V88 A;  2YT4 A;  4DV0 E;  2L3J A;  2JOX A;  3KZZ A;  4GKK E;  4X9J A;  2EMB A;  4B3R E;  2NUF A;  2EOZ A;  2F8B A;  5T6J A;  5LMN E;  1HNW E;  1X3C A;  1DI2 A;  2YTO A;  3EQ1 A;  1X49 A;  2RS7 A;  3DJW A;  1WRJ A;  4R2A A;  4GEQ B;  4ZYH A;  3IWD A;  4O5G A;  1T4N A;  2IHR 1;  4NHR A;  2DLK A;  2V83 A;  1KYQ A;  5A6K A;  2LBS B;  4DUY E;  4BBY A;  5A69 A;  2R76 A;  5LLQ A;  2EWL A;  2EJ4 A;  2YRH A;  1HNZ E;  4KHP E;  1XMO E;  1YZ9 A;  3T1Y E;  2EPU A;  2WBT A;  2UUA E;  2DSY A;  3M99 B;  4R8O A;  3EPL A;  3TQM A;  2JWO A;  3BBG A;  1JFZ A;  4LF7 E;  2RSM A;  3VYY A;  1DQ3 A; 
#chains in the Genus database with same CATH homology
 3O2R A;  5LL6 R;  2WZO A;  2DIX A;  4F9A B;  4TUI A;  2LTS A;  4WFT A;  3T1H E;  4OUN A;  4DV7 E;  2N3G A;  2VQE E;  4DR6 E;  1UHZ A;  4LFB E;  4JI0 E;  5DNY A;  2LJH A;  1I4S A;  4LF9 E;  2L3C A;  4NXN E;  4M2Z A;  4WSP A;  4DKK A;  4JI7 E;  4JI4 E;  2MC5 A;  2FV4 B;  2RS6 A;  2HHH E;  4DR3 E;  1IBM E;  4B3M E;  4JYA E;  3HXL A;  1N32 E;  1RQ0 A;  1WHN A;  2L92 A;  5CFF E;  2L8T A;  1FKA E;  3K6Q A;  2FGG A;  1N34 E;  4NXM E;  1XNQ E;  5ADZ A;  3ADL A;  2K4V A;  2F4V E;  3DF6 A;  2DB2 A;  4K0K E;  2L2N A;  4DR7 E;  4WYQ B;  4Q28 A;  2QVW A;  3C4B A;  4YY3 E;  4DV4 E;  2FTX B;  1XNR E;  2UXB E;  2LMZ A;  4JI8 E;  5IT9 C;  2L2K B;  1T4O A;  2NA2 A;  3AUZ A;  3VK6 A;  4JI5 E;  4DR2 E;  3ADI A;  1X48 A;  3RMP A;  2ODR D;  4X8W A;  4LTY A;  4F54 A;  5AE3 A;  4DV6 E;  4DR5 E;  1HNX E;  2MDR A;  4BMJ A;  1RC5 A;  4L8N A;  1XMQ E;  4JI2 E;  3O2R B;  5LMU E;  3ADJ A;  2H36 X;  4WPY A;  2ZM6 E;  3H09 A;  4KHP E;  2G7H A;  1GZ6 A;  4JI6 E;  1IBK E;  3HTX A;  4X62 E;  2EB1 A;  1YYK A;  4B3T E;  3F6H A;  1SR9 A;  1QU6 A;  5IWA E;  2VQF E;  3IWB A;  4LF8 E;  1YYO A;  2UXC E;  2LTR A;  1HR0 E;  1N33 E;  2JVA A;  3FIG A;  2B3T B;  4JI1 E;  2UXD E;  1O0W A;  3J7A G;  2NUE A;  2N3H A;  2L2M A;  4BCA A;  2E1M A;  3KWR A;  1PKP A;  3MSW A;  4DR1 E;  4DR4 E;  2VE7 C;  2B7T A;  2VF1 A;  3JU0 A;  2NUG A;  1ZBT A;  4F9C B;  4R03 A;  4M30 A;  4OX9 E;  2M1S A;  2M7Q A;  4DV1 E;  2A11 A;  4F9B B;  2KON A;  5AE2 A;  2UUC E;  2V88 A;  2YT4 A;  4DV0 E;  2L3J A;  2JOX A;  2V86 A;  3VYY A;  3OTO E;  3LML A;  4KZS A;  4GKK E;  1WXR A;  2EZ6 A;  2V89 A;  3N3W A;  2YZT A;  3RV0 A;  4X64 E;  1EKZ A;  1J26 A;  2RTX A;  2L33 A;  2KOU A;  2V87 A;  4X66 E;  4B3R E;  2NUF A;  3LLH A;  4BS9 A;  4B3S E;  1GQE A;  4BC9 A;  2F8B A;  5T6J A;  5AAS A;  5LMN E;  1HNW E;  2UU9 E;  1STU A;  4LU9 A;  5F3W A;  3ZOQ B;  4LFC E;  1DI2 A;  1IBL E;  3J80 C;  3C4T A;  1X49 A;  2M4I A;  2GSL A;  5A2Q C;  4LF6 E;  2RS7 A;  3DJW A;  2L6M A;  4LFA E;  5FLX C;  4DV2 E;  4I8O A;  3HPS A;  5AE1 A;  2JOB A;  1FJG E;  3OML A;  4GEQ B;  3IWD A;  3VYX A;  3HQ1 A;  1T4N A;  2IHR 1;  4DUZ E;  2DMY A;  2V83 A;  4DV3 E;  2LBS B;  3JTZ A;  1T4L B;  2UUB E;  1J5E E;  4OOG C;  4DUY E;  4BBY A;  2LUQ A;  5BR8 E;  3P1X A;  3IWC A;  4JV5 E;  1RC7 A;  2EWL A;  1ZBQ A;  2ODR C;  1I94 E;  3HPZ A;  2LRS A;  2CPN A;  2MC6 A;  4M0V A;  1U61 A;  1WHQ A;  2FFL A;  3F6G A;  1YZ9 A;  1YYW A;  2LUP B;  2B7V A;  1UIL A;  4J8Z A;  2JR1 A;  1XMO E;  4JI3 E;  4YHH E;  3AV0 A;  3T1Y E;  3ADG A;  4DV5 E;  4LF4 E;  4TUG A;  4GKJ E;  2KHX A;  2UUA E;  2DSY A;  4DMI A;  4L5N C;  4AQY E;  3RV1 A;  4R8O A;  4BC7 A;  4X65 E;  2B9D A;  4P7D A;  3J7Y p;  2JWO A;  3J81 C;  1HNZ E;  1JFZ A;  1X47 A;  4P78 A;  2LE2 A;  2V8Q B;  2RSM A;  2V85 A;  3JAM C;  1N36 E;  2E5L E;  2JY9 A;  4LF5 E;  4LF7 E;  1DQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...