1U61A

Crystal structure of putative ribonuclease iii from bacillus cereus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
127
structure length
127
Chain Sequence
IDAKQLNSLALAYMGDAVYEQYIRYHLLQKGKVRPNQLHRLGTSFVSAKAQAKVVYHLLETAFLTEEEEAVLRRGRNANSGTVPKNTDVQTYRHSTAFEALIGYHHLLNNRERLDEIVYKAIAVLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title X-ray crystal structure of conserved hypothetical protein from Bacillus cereus
rcsb
source organism Bacillus cereus
molecule tags Structural genomics, unknown function
total genus 46
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2004-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 1u61A00
3C4TA 2QVWA 2NUFA 1YYWA 1U61A 4OOGC 3RV0A 1JFZA 1YZ9A 4M30A 3O2RB 3C4BA 1YYOA 2NUEA 1O0WA 2FFLA 3O2RA 1RC7A 2GSLA 1RC5A 1YYKA 3RV1A 2A11A 2EB1A 2NUGA 4M2ZA 1I4SA 3N3WA 4OUNA 2EZ6A
chains in the Genus database with same CATH superfamily
1ZTDA 3C4TA 2QVWA 2NUFA 1YYWA 1U61A 4OOGC 3RV0A 1JFZA 1YZ9A 4M30A 3O2RB 3C4BA 1YYOA 2NUEA 1O0WA 2FFLA 3O2RA 1RC7A 2GSLA 1RC5A 1YYKA 3RV1A 2A11A 2EB1A 2NUGA 4M2ZA 1I4SA 3N3WA 4OUNA 2EZ6A
chains in the Genus database with same CATH topology
3C4TA 2QVWA 2NUFA 1YYWA 1U61A 4OOGC 3RV0A 1JFZA 1YZ9A 4M30A 3O2RB 3C4BA 1YYOA 2NUEA 1O0WA 2FFLA 3O2RA 1RC7A 2GSLA 1RC5A 1YYKA 3RV1A 2A11A 2EB1A 2NUGA 4M2ZA 1I4SA 3N3WA 4OUNA 2EZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C4T A;  2QVW A;  2NUF A;  1YYW A;  1U61 A;  4OOG C;  3RV0 A;  1JFZ A;  1YZ9 A;  4M30 A;  3O2R B;  3C4B A;  1YYO A;  2NUE A;  1O0W A;  2FFL A;  3O2R A;  1RC7 A;  2GSL A;  1RC5 A;  1YYK A;  3RV1 A;  2A11 A;  2EB1 A;  2NUG A;  4M2Z A;  1I4S A;  3N3W A;  4OUN A;  2EZ6 A; 
#chains in the Genus database with same CATH topology
 1ZTD A;  3C4T A;  2QVW A;  2NUF A;  1YYW A;  1U61 A;  4OOG C;  3RV0 A;  1JFZ A;  1YZ9 A;  4M30 A;  3O2R B;  3C4B A;  1YYO A;  2NUE A;  1O0W A;  2FFL A;  3O2R A;  1RC7 A;  2GSL A;  1RC5 A;  1YYK A;  3RV1 A;  2A11 A;  2EB1 A;  2NUG A;  4M2Z A;  1I4S A;  3N3W A;  4OUN A;  2EZ6 A; 
#chains in the Genus database with same CATH homology
 3C4T A;  2QVW A;  2NUF A;  1YYW A;  1U61 A;  4OOG C;  3RV0 A;  1JFZ A;  1YZ9 A;  4M30 A;  3O2R B;  3C4B A;  1YYO A;  2NUE A;  1O0W A;  2FFL A;  3O2R A;  1RC7 A;  2GSL A;  1RC5 A;  1YYK A;  3RV1 A;  2A11 A;  2EB1 A;  2NUG A;  4M2Z A;  1I4S A;  3N3W A;  4OUN A;  2EZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...