The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
33
|
sequence length |
169
|
structure length |
160
|
Chain Sequence |
AHAVSVWEFESRGKWLPYSPAVSQHLERAHAKKLTRVMLSDADPSLEQYYVNVRTMTQESLTIGVRRMFYAPSSPAGKGTKWEWSGGSADSNNDWRPYNMHVQSIIEDAWARGEQTLDLSNTHIGLPYTINFSNLTQLRQPSGPMRSIRRTQQAPYPLVK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure and Notch Receptor Binding of the Tandem WWE Domain of Deltex.
pubmed doi rcsb |
| molecule keywords |
Deltex protein
|
| molecule tags |
Metal binding protein
|
| source organism |
Drosophila melanogaster
|
| total genus |
33
|
| structure length |
160
|
| sequence length |
169
|
| ec nomenclature |
ec
2.3.2.27: RING-type E3 ubiquitin transferase. |
| pdb deposition date | 2005-07-10 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02825 | WWE | WWE domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Signal recognition particle alu RNA binding heterodimer, srp9/1 | Signal recognition particle alu RNA binding heterodimer, srp9/1 | ||
| Alpha Beta | 2-Layer Sandwich | Signal recognition particle alu RNA binding heterodimer, srp9/1 | Signal recognition particle alu RNA binding heterodimer, srp9/1 |
#chains in the Genus database with same CATH superfamily 2A90 A; 2RSF A; 2DK6 A; 1UJR A; 3V3L A; 1X4R A; #chains in the Genus database with same CATH topology 1914 A; 3TU3 B; 4N39 A; 4GYW A; 2FJA B; 4UYK B; 4GYY A; 1UJR A; 5AOX A; 2FJE B; 2X5T A; 1JNZ B; 5AOX B; 2FJD B; 4AY6 A; 4GZ5 A; 1QMO E; 4AKX B; 1U7I A; 4N3A A; 2FFG A; 3OMS A; 4N3B A; 1X4R A; 4GZ3 A; 2A90 A; 4UYJ A; 2RSF A; 2K4N A; 4AY5 A; 1E8O A; 2W9J A; 2KJZ A; 2X5G A; 3BT3 A; 4XIF A; 4UYJ B; 3PE4 A; 3GYX B; 4XI9 A; 1E8O B; 3ITW A; 3SK1 A; 4CDR A; 4N3C A; 3PE3 A; 3VCX A; 2FJB B; 2DK6 A; 2X5H A; 3TAX A; 4UYK A; 1JNR B; 5BNW A; 4GZ6 A; 3V3L A; 5C1D A; #chains in the Genus database with same CATH homology 1914 A; 3TU3 B; 4N39 A; 4GYW A; 2FJA B; 4UYK B; 4GYY A; 1UJR A; 5AOX A; 2FJE B; 2X5T A; 1JNZ B; 5AOX B; 2FJD B; 4AY6 A; 4GZ5 A; 1QMO E; 4AKX B; 1U7I A; 4N3A A; 2FFG A; 3OMS A; 4N3B A; 1X4R A; 4GZ3 A; 2A90 A; 4UYJ A; 2RSF A; 2K4N A; 4AY5 A; 1E8O A; 2W9J A; 2KJZ A; 2X5G A; 3BT3 A; 4XIF A; 4UYJ B; 3PE4 A; 3GYX B; 4XI9 A; 1E8O B; 3ITW A; 3SK1 A; 4CDR A; 4N3C A; 3PE3 A; 3VCX A; 2FJB B; 2DK6 A; 2X5H A; 3TAX A; 4UYK A; 1JNR B; 5BNW A; 4GZ6 A; 3V3L A; 5C1D A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...