4XI9A

Human ogt in complex with udp-5s-glcnac and substrate peptide (rbl2)
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
717
structure length
698
Chain Sequence
b'SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title The active site of O-GlcNAc transferase imposes constraints on substrate sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 266
structure length 698
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xi9A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xi9A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4xi9A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4xi9A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xi9A03
5DLDA 4X7RA 4JA9A 3MTBA 3BEOA 2X6RA 2PL2A 3ZCTA 4CTMA 4U0UA 4RELA 4F97A 4YUAA 2OFFA 2JLBA 3S7BA 1JIVA 2VSYA 3DDWA 2WTXA 1HH8A 2IYFA 2IV7A 3GZ1A 1Y6FA 1FC0A 3T5TA 3VDMA 2ACVA 4GYWA 3LCAA 3T3HA 2Q7FA 4LEIA 2XGSA 4WUYA 5BW8C 1NZDA 3QOUA 1P2DA 2J9QA 2QN2A 1GPAA 4GPKA 5LCWC 3OTIA 3Q4AB 3ASDA 2VCEA 2FBNA 2R5SA 4EKEA 2XEVA 1JIUA 4YVQC 1IIRA 3WC4A 4GZ5A 5JJ6A 4YI5A 1P2BA 2C1XA 1FU8A 4H7YA 5DU2A 5AYWD 4HWGA 2VSNA 4L22A 3ESKA 2QFCA 1IHGA 5CCMA 4XI9A 2UWJG 3G2HA 1HZ4A 4APOA 4HOSA 4MHOA 3PE3A 4X7MA 4FZRA 5DBKA 1XV5A 5CHEE 4GZ6A 4LDPA 1YA0A 3Q3IA 3LY7A 4BQFA 5G05J 4RG9A 5KJLA 1M5RA 2QRHA 2YQ8A 5D00A 1GPYA 2BISA 3NP9A 2HYZA 1AHPA 1FCHA 4GYOA 3MT7A 2QRQA 3SYRA 3DDSA 2LSVA 5HQ8A 4W9RA 3RO3A 2Y4UA 3EBOA 4XI0A 5FZRA 3BCUA 3GPBA 4FKZA 4HLNA 5TMDA 3CKCA 3AS5A 1L5VA 1NVKA 4QLBA 7GPBA 5D0OD 3HYMB 3HBNA 5DXFA 1HXIA 3OXLA 2LNIA 4N3BA 3RHZA 2UY1B 1E1YA 2QLMA 3Q3EA 3MEKA 1WW2A 3JYSA 3BD7A 4EL5A 2PZIA 2C2LA 3ASFA 4G25A 4N3AA 1WV1A 2QN9A 1KTIA 3CVQA 2X0DA 2BGUA 3Q3HA 1PNVA 4G26A 5ARFA 4AMBA 2SKEA 3RU0A 4EL0A 5DIZA 1RZVA 3T3IA 2ECPA 5M72A 4B94A 1JEJA 3LY8A 4MI6A 4ME2A 2GPNA 2O6LA 3S29A 3OY7A 3FWVA 5G04J 2G9RA 3QDNA 4GCOA 1HLFA 2XCUA 5JJ7A 1B4DA 2I6HA 1XKXA 1WUTA 1RRVA 2AV6A 1NOKA 2BFWA 4I2WA 2GJ4A 1FU7A 2XCCA 3MV2B 4JL0A 4AY5A 3MSCA 3NCHA 2QN7A 3HBMA 6GPBA 3H4TA 2PYDA 3CUWA 3CK9A 2GPAA 2QN8A 2R68A 2KCVA 3MS7A 1FTWA 5A7DB 2LSUA 3D0RA 2F3QA 4KQ2A 2F3PA 3MA5A 3Q47B 3HBJA 4WNEA 5D01A 1NA3A 2ONDA 5FT9A 1QKJA 3CV0A 4I9CA 5TVGA 1QQEA 4G23A 3N71A 3FP3A 3D0QA 5BNWA 4JA7A 2FI7A 2KATA 3CVLA 4GCNA 3QKWA 4RIHA 1GGNA 4EKYA 3S7DA 1FS4A 4Z5XA 1VGVA 2BUGA 3H4IA 4A1SA 4X6LA 3CV3A 4I1AA 2KCLA 3ZCUA 3EBPA 3BCRA 2VGXA 4U04A 5G05C 5GPBA 2ASVA 2NC9A 4RIFA 2FO7A 1OUVA 3MQFA 2IV3A 1C8KA 2XA1A 5EX0A 3RIBA 1XL0A 2QLNA 2X0EA 3NB0A 3MKRA 3IAAA 3Q49B 2WPVA 9GPBA 3ZCRA 1H5UA 1Y8ZA 2WQHA 4WADA 2SKCA 3ASGA 1IYGA 1JG7A 4GA1A 3ZGQA 3Q5MA 5JTUA 3QWPA 2KCKA 3G2JA 2R60A 3FFLA 2E2EA 3OT5A 1LWOA 4BT9A 2G9QA 3TGOA 2QZSA 2AZDA 2ATIA 3O3CA 4RIEA 3VTYA 5IKPA 5EKQD 1PSWA 1Y8MA 3Q15A 2Q6VA 3CVNA 4GZ3A 4LEUA 2PRJA 3L7AA 2XCIA 4O6FA 4NC9A 3E3OA 1W3BA 1GFZA 4NESA 2YHCA 4BTBA 5LQDA 4AY6A 3G2NA 2FETA 4MI3A 3DZCA 5CCLA 4CGWA 4YNDA 1C3JA 2VCHA 4F9FA 3KD7A 3ULQA 5JJTA 2ACWA 5G04C 1GG8A 3T3EA 2FFRA 3UQ3A 3KAEA 1AXRA 3OTGA 2IEGA 4XIFA 3COPA 4M7PA 3RSZA 4CTOA 3MRTA 3E3LA 3AMVA 2IW1A 3UYLA 4NEQA 1P5QA 3C4QA 3MT9A 4WACA 2C9ZA 2L6JA 1WM5A 1UZUA 3GYZA 3E4BA 3TAXA 2AMVA 1IXYA 3BEEA 4M60A 3OXGA 1KT1A 2QN1A 4J8EA 4GA0A 4UI9C 2IUYA 3LY9A 4F3VA 1Z62A 4G1TA 3L79A 1JG6A 2VG8A 4I17A 2VYIA 3QKYA 2X6QA 2G9VA 1FTQA 4MHSA 1JIXA 4J8FA 3ZHEB 1NZFA 3QWWA 2GM9A 2QNBA 3ZCVA 2QRMA 4KQMA 2QRGA 3VUEA 2YJNA 4HOUA 2V5FA 3UUXA 4RIGA 1XOIA 1QZ2A 3TOVA 4UQYA 1L6IA 1P4GA 8GPBA 2C0LA 4IN3B 2G9UA 1BX3A 5KJNA 5ARGA 2JZCA 4I2ZA 2PYIA 4EQFA 3RO2A 3ZCSA 4NRHB 4I9EA 2IYAA 2F3UA 3BCSA 3OKAA 3RSCA 2XPIA 4BTAA 2R4UA 3VUFA 3HBFA 1NZNA 3ZCQA 3CVPA 4UI9J 2VGXB 2ZB2A 3ZPJA 4U0SA 2R4TA 2H1FA 3URZA 3GZ2A 1NOIA 5KJKA 1F6DA 2VQ2A 3TG4A 4KYOB 1P4HA 1K06A 1PYGA 1SXPA 3NP7A 1Z8DA 2GEJA 3BD6A 4UQZA 2UY1A 3T3DA 1YGPA 3U4TA 2FF4A 2XGOA 4AMGA 3RKVA 3CEHA 2R66A 1SXQA 4N39A 2Y4TA 3SF4A 2P58C 2X0FA 1FA9A 2BGTA 4BFCA 3OXFA 3IA7A 1E96B 5D0QD 1GPBA 2XGMA 1L7XA 3SYMA 3L01A 3NAZA 2HR2A 3MRXA 1ELWA 4WHMA 4CDRA 5FTPA 4PQGA 1ABBA 1QM5A 4MI9A 2GPBA 3BD8A 4BWRA 4WNFA 3C48A 4REMA 2F3SA 4AIFA 4YI3A 2SKDA 3NC4A 4HOQA 3CEMA 2GT1A 1K08A 2H1HA 1C8LA 1NLMA 3DD1A 2PRIA 3IEGA 4GYYA 3LKUA 3OTHA 3QWVA 4KQ1A 3WADA 3L7BA 4U0ZA 3CUYA 5C1DA 4RG6A 1NOJA 2MHKA 4G24A 4GPBA 2PQRA 1O6CA 4N3CA 3S27A 1UQUA 3KS2A 2HO1A 1ELRA 2FF5A 5JTTA 4WNDA 3S7JA 1RZUA 5TMBA 3CX4A 3VTXA 1XNFA 1XC7A 2GEKA 3OKPA 4KBQA 2PQ6A 2OOEA 3PDNA 3S28A 3MBOA 3WXXA 3U3WA 3O48A 3G2KA 3MTAA 5FJYA 1ZBPA 3OKCA 3T7DA 1PC2A 4J0UA 3D1JA 1P29A 4J8DA 3CUVA 3NPAA 3MRVA 2HY7A 2FEZA 1WAO1 3TG5A 4NQ0A 1FTYA 1UQTA 4RENA 5A6CA 1L5QA 1WW3A 3S0JA 4BT8A 3GUHA 1GZ5A 2GW1A 4AN4A 4H7XA 1EM6A 4GA2A 2C1ZA 3CKBA 3MS2A 3GW4A 4KXKB 4WNGA 1LWNA 5BT1A 1V4VA 3VDNB 4JHRA 5HI7A 3SZ7A 4HORA 3G2IA 3OY2A 3TSAA 4AM9A 3WAGA 3CEJA 3ZN3A 1Y6GA 2VGYA 3NF1A 5LCWJ 4F96A 2QRPA 3CUUA 1KT0A 1WV0A 1F0KA 3LYAA 1FU4A 4EJ2A 1NA0A 2QLLA 4MRAA 3ZCPA 1L5SA 1WUYA 2C4MA 3MT8A 4MICA 4G2VA 4ABNA 3AS8A 3R9AB 4RIIA 3K9IA 2IEIA 4CTNA 2AW3A 3L7DA 3RT1A 3LPZA 4CGVA 4N2SA 1XL1A 3CK8A 4BQEA 1P2GA 3MV3B 3UPVA 2DBAA 1C50A 1E4OA 1L5RA 3C4VA 4U07A 3MS4A 4G2TA 5EX3A 3MTDA 1EXVA 4M83A 4N2QA 5HXAA 1A17A 4BQIA 1TJCA 5IKOA 3ASHA 3CEQA 3T3GA 2XMPA 3RJVA 3G2LA 2P6PA 2QN3A 3UYKA 5TMEA 1P4JA 1L5WA 3CK7A 2KS6A 3BDAA 1A8IA 3E3NA 5I45A 2IF4A 2KC7A 4RBNA 3AS4A 4Y6WA 1Z6PA 4HOTA 5FZSA 2IFUA 2PQNA 3CUTA 3S2UA 1PN3A 3L7CA 2AVPA 4YVOA 1ZU2A 2XA2A 3QHPA 1B89A 5ENZA 4UI9K 3S7FA 1KLXA 5KJMA 2F9FA 3FROA 5FZQA 4Y6CA 2XA9A 4W6QA 4N5CA 2XCBA 1YA6A 4UQXA 3ZHEA 2C0MA 1Z6QA 2JJMA 3PE4A 3ZFWA 3EDTB 4N9WA 1J39A 4X7PA
chains in the Genus database with same CATH superfamily
4Q9IA 2XLCA 4L2IB 3QKSB 3I2JA 3OETA 4ZMSA 2SBTA 3A14A 1P5HA 4JQYA 1ADGA 4MMYB 1K7FB 4UVDA 2KZTB 4HZIA 1MX6A 4FR0A 4PZUA 4LF9B 1FUYB 3H87A 3B20A 4YECA 3PE3A 1BJTA 4OJQA 1H4QA 4FMDF 3I53A 1OWMA 3OOWA 4J0QA 4R1OA 5FUWA 2ETXA 5CCEA 1EGHA 4L74A 5D0OD 1AV6A 1X8KA 2GYYA 3L9TA 1JQ3A 1X9GA 1E8OB 1U02A 2HMWA 1FDWA 2DR3A 4TV9A 4O25A 2F43B 2N75A 1PNOA 3SJAA 4DIFA 4AJJA 1G19A 4UWGA 3DTNA 2IZ7A 3SBDA 2BMWA 3ZLBA 4HYEA 4C07A 4TZ6A 2IH5A 4JQOA 3DMRA 4ZC8A 1CYEA 5BXOA 1Q16A 2AG6A 4DBLC 5E8RA 3ZLJA 4FFLA 1KZ4A 1E2PA 2VF2A 3P9ZA 3VAZA 3TOXA 4JODA 3WYFA 5IJAA 4O5OA 3REQB 5HVNA 1YAHA 3QUBA 1H5QA 3HE3A 1VKOA 3IV7A 1C8KA 3KYDB 3ZCRA 4PLVA 5J1TB 1HFAA 3QY0A 1EG7A 3SO8A 2NQ2C 4LDRA 1MENA 4DADA 2ADOA 1Q11A 4EFMA 3IC5A 1P7VA 3G2NA 3PDHA 3DZCA 3H9QA 2MYTA 3PEUB 4JROA 3RC7A 2IYQA 2VP0A 2BLNA 4J8SA 2FPIB 3QU4A 3LX8A 2EG9A 3PDIB 1F8YA 3DDHA 4GR9A 4QIHA 1ZUNB 1M76A 4EY7A 3F97A 2A88A 3ZYLA 1L6IA 1R7RA 3KVOA 2UUPA 4DY4A 2ZI4A 1KEEA 3DE2X 1AURA 4V1CI 3AINA 5BW5A 3PKZA 3QPBA 3RABA 4H3VA 1MO5A 3SWWA 1DAMA 4C2UA 2Y66A 3WFIA 1XDDA 2LE0A 3FYUC 2CNLA 3QNMA 2CLOB 4HWSA 1CY7A 3U9LA 2ZRMA 1UWCA 2GM3A 2B83A 4HI8A 1O5TA 1NASA 4FILA 1LPNA 4HAZA 4U6QA 1JJFA 1SUEA 5AOXA 4LIPD 3FZQA 3DCIA 2FCRA 3LT1A 1K2WA 1BJKA 5G0UA 3D59A 5FI3A 2W48A 5FAKA 1K5HA 5JC8A 4Z53A 1MU0A 3UENA 4BV8A 4QPCA 3E9ZA 1FFEA 3QKSA 2AIRA 1YL5A 4Y7DA 1A5SB 3IPRA 3UINC 5DT9A 5K0FA 4L1KA 3QP9A 3CZCA 3FBWA 3DLTA 1CHNA 3ZJUA 2XNJA 3KWFA 3AL0C 5E6SB 1T3LA 4BP9A 521PA 2WG0A 4WLNA 4EPVA 3K9QO 3L1UA 3BRWD 2Q6TA 4JZYA 4UMFA 1KI9A 1WPXA 2JVKA 4FOPA 4ZDIA 2Y9MB 4Z0HO 1U2DC 2FZLA 1ADCA 5AMXA 3GDOA 4RBNA 2KC7A 2ONYA 4A6XA 1MAVA 3QSGA 2ATEA 2HDOA 3GGCA 3E18A 1E8OA 2IIQA 4EYGA 3A2LA 1NQVA 2I7DA 3BGIA 1U7IA 3ZWPA 5JJLA 3FHEA 1XTSA 2DPLA 3AU8A 5DLDA 3FEXA 2CK3A 3DE5X 4CEIA 2OFFA 2P7HA 4LTNA 2ZSEA 2PU7A 4GS5A 4CG0A 4OI0A 3CNNA 4NYJQ 1RDFA 3DFZA 2CFZA 2HF8A 5HOQA 5FV4A 16PKA 4DK5A 2WFMA 1IRIA 4NAVA 4C2BA 3AJ8A 4CF7A 1XK7A 4D82A 5EXSA 4CT5A 1NXWA 2V7QA 1QFJA 3O3OB 4O1PA 1IHGA 3C3WA 1N25A 3RYIB 4C0SA 3R6WA 3KTAB 2D7CA 4AEZC 4ZODA 3QKRB 1ZD1A 1GFWA 1YJXA 3B2QA 2X6JA 5KJLA 3GLIB 5DWDA 2LSVA 5AQ1A 2HA5A 5TPZD 1UBTS 2IF2A 3NM6B 1F1BA 2FEWB 2AWNA 1GPH1 3BD7A 3SN6A 2IYUA 1AZSC 3S55A 3EIQC 3KEZA 3RLFA 3UT4A 1N2IA 4MKTA 4OBXA 1VDYA 1VPTA 3PEUA 4DMMA 2Z4SA 2ZJAA 1VJGA 2CF5A 2XCUA 5EJ5A 1TM1E 2VH2A 3LUDA 2BSAA 1K86A 4YT5A 2FZWA 3GPDG 1G3NB 2FPIA 3H5RA 2Z3ZA 1J1UA 1ZMOA 6GPBA 2VVTA 3PDIA 2E6KA 2DY0A 4G56A 1JWBB 1D2EA 1GYPA 1E5TA 3Q1KA 3NWPA 5C1OA 2P4UA 3RIGA 4F6RA 1P6XA 2JARA 3FRIA 2IDJA 3I64A 1MAAA 2X2EA 3BC1A 3JZIA 4H3HB 3OIFA 2OXRA 2LIVA 3ICOA 5TARA 1X1SA 4HP8A 5GPBA 2C0QA 3QLUC 3KYBA 1P81A 4OQMA 3KNZA 2X6HA 3RH0A 3H13A 1J2UA 3QWPA 4U7GA 1PWXA 1XJCA 3MAGA 4O6FA 1ZITA 3UKOA 2YHCA 3QC1A 1UP7A 3ITKA 2NIPA 3LTEA 3QXXA 1W0JD 1F8GA 5AKZA 1NI3A 1TJ3A 3ZVLA 2A0XA 1TX4B 1K9SA 4JJGA 5FWXB 4YCCA 1GZVA 2GBCA 2JC3A 2XMZA 2O7QA 3BFPA 3GJXC 1LRKA 2GQ0A 4GA0A 2WAOA 3ZYQA 1YKGA 1NKTA 1MNAA 3OLYA 4QYIB 4IPTA 3QWWA 2QD2A 3IALA 1W52X 3GAZA 4FHJA 2BKVA 4GP9A 4W8HA 4FT4A 2OT3B 5K2OA 4XIYA 1A8PA 1W36C 2RD2A 2FF7A 3USZA 1RAFA 3OQ6A 5JDIA 4Q4AB 4IDDA 1OA1A 1X7YB 4PONA 3QNWA 4KU4A 5E6SA 4C1NA 5GAJA 3JV7A 2P90A 1OOEA 1T9GS 1AJEA 2WJAA 2AZ4A 1A7JA 2ABWA 1TA9A 4DF3A 2D06A 1QIDA 3BDIA 3TG2A 1ID1A 4HOQA 2A6PA 3DWLG 2AEJA 4D9IA 1TL7C 3A70A 4W5WA 5IJXA 3EU5A 1XEXB 4AECA 1SQSA 1XAGA 3RTDA 3S5JA 3F6RA 4JI7B 3U3XA 1AA9A 5J4HA 3EQZA 1FT2A 4KAAA 2O19A 1UPXA 1ZBPA 2CL7X 5E4YA 4EGFA 1G8YA 2HY7A 5B55A 1JEYB 4MAMA 2ZRLA 2Y99A 2P9YA 1FOEB 1QGDA 2EJCA 2ES4A 2PD6A 3RM3A 3OEWA 4EGSA 1EX1A 4MKHA 4B9AA 2FJ0A 3DE3X 3CF0A 1C7ZA 3AVWA 2ZJ5A 1WKCA 3GDWA 2OFWA 2X5NA 3ZGVA 4EUHA 3RYIA 2I2AA 1T2EA 3KTAA 1UJBA 1R0BA 1E4OA 1TYDE 2CJXA 3QMPA 1EXVA 5AESA 4KFCA 1G8PA 3ZQ4A 4MARA 1Y6IA 3GLIA 1DARA 3NBMA 5BNTA 5C81A 4Q00A 2C5FA 2PV7A 4ZT6A 3IXLA 4PPGA 1VKZA 3VMMA 1Z6YA 3BM5A 1TYZA 4EZKA 3NTUA 4R5HA 2GO7A 4JSRA 1M2OB 4MUIA 4N9WA 5CEFA 1EXDA 3EZ2A 4RKWA 4PCVA 2FLWA 3TZEA 4N5NA 4S2EA 2FCAA 4YO8A 2WTXA 2IODA 4DDHA 3B12A 5I7FA 3M6MD 3M4NA 1JSLA 4U9HS 3EYWA 4YMLA 5IC6A 2NU8B 1N8NA 3ZX4A 3PNLB 2QRNA 1DCMA 1CS4C 4BO5A 3TLKA 5IBPA 1Z29A 4E4YA 1AM4D 4F71A 3AFIA 4BRWA 3DPDA 3B9RA 4WK4B 2PA3A 4TMTA 1JZSA 1N7IA 1CVRA 4RG9A 2DRIA 3KBBA 1J49A 4ARZB 3R4VA 2AEMA 1JFTA 4KBFA 3I1YA 4PHFA 2B69A 3MGKA 4LHZA 1FW6A 1XCBA 3ZHOA 1SVNA 4Z0PA 2H5JA 2Z2IA 4P7JA 1ZKDA 4DKJA 3U31A 3A3PA 4Z7NB 2L6BA 2Q45A 1JXMA 4YJKA 1SULA 1NY5A 3MCUA 2FTKE 3A1DA 3RFVA 5EPEA 1PR6A 3FF1A 2EXXA 5DASA 1Y1SA 3G0DA 4TWRA 1U8XX 2WP8J 3A1SA 5FWXA 1TCVA 5K8LA 4V1CB 3L41A 4PPNA 4PS0A 3UAVA 3NHSA 4MUJA 3EUAA 2R7LA 1TT7A 3B7RL 2JL1A 4KQ2A 2UAGA 1O95A 3A3OA 4MPTA 4Y8VA 1QR6A 3A06A 4GOMD 3ET5A 1MX2A 4AJPA 1VRWA 1Q57A 1F51E 5K3OA 3GFOA 3CSTA 4Q7EA 4Q4AA 1OUVA 1U1CA 1VFPA 2CVPA 1GV1A 5HRYA 3DZDA 4EF5A 2I55A 4RF2A 4WADA 5DI3B 1H93A 4DA0A 5DTEA 3GC6A 4KVGA 3TPZA 1Y7LA 3QBVA 2W2PA 1T8YA 1JXAA 4RQBA 2PVSA 1ZD4A 1K1EA 3CJTA 1XWIA 2AJAA 1C9JA 1RR6A 1HFJA 2BBTA 3PHHA 3AY7A 3JYLA 1QLWA 4BNVA 4FMCF 5HK8A 4YALA 5DGCA 3W5HA 5CECB 4RKFA 5FTLA 3AUAA 3ZU5A 2JK1A 4JDUA 4HMQA 5I4BA 4CMHA 4J8EA 2C29D 2UUCB 1Z62A 4I4LA 3NT5A 1EK6A 1PL6A 2EJBA 3EK2A 1JEYA 4NYIR 2PLFA 3DFFA 3UCXA 1WF3A 1VG1A 2A9QA 4WK6A 4EHIA 2GHIA 4W4TA 3E3MA 5I47A 1XNHA 3TS1A 2XT0A 5A2QA 4X00A 3DXFA 2VBFA 4GLFA 2MMCA 1QGUB 2ACKA 3WP0A 5DYTA 4JLSA 3T1QA 1V1MA 4O29A 2CK3D 4M9RA 1I36A 2V6FA 2ZBEA 3WHPA 5F9HA 1JZTA 3TIXB 4RAOA 1PZXA 2P27A 2ERCA 4DNXA 4C88A 4G1UC 4GM1A 5JNVA 5JVDF 5BURA 3B7UX 4PSVA 5JRJA 3KQPA 2YMMA 2V4ZA 2VNHA 1LDEA 4BX3A 1NOJA 1I10A 1Y3HA 2V7QD 2FXIA 2VHEA 3LHIA 4G85A 3C3KA 4KSCA 1J1ZA 2JIBA 3VNAA 4JT2A 1I3LA 4QNRA 1M2OA 4J0DA 4YRNA 1MUUA 4I14A 1I1HA 1B26A 3K1YA 4ARUA 4AXXA 1BDBA 4MHTA 4C7BA 1R15A 1KI6B 2ZU0C 4MI1A 2X6TA 3ZW9A 5EKDA 4UPVA 5HPYB 2Z4TA 2ZE8A 2Z8YA 2NU8A 3TSAA 4HNAB 3PNLA 2VSOA 3V3TA 4DA6A 1QMGA 4O6VA 3DSRA 1CU1A 1SRRA 3R5JA 3IEXA 5EE3A 3FWKA 1WUYA 5TQVA 4DTCA 3AK4A 1SY7A 4NABA 3EY9A 5CB0A 2NZJA 1WMAA 2P4HX 4B4VA 3K70B 1BKYA 1CDDA 1U0HC 4HCJA 2KWIA 3JVVA 2V8OA 2BFBA 2M32A 5ENVA 2PRZA 5FFFA 3BJMA 3LHKA 2ZS8A 3IMCA 1GG5A 4F6RD 4MTLA 2KBXA 4GE0A 2R44A 1MXFA 4RE6A 2I3ZA 5E2IA 3HIZA 3PB3A 2LW7A 2X19A 3FSRA 3SKYA 5B30A 1MB2A 2WVHA 4C5BA 1GV0A 1SXJB 2ID8A 4Z7QB 1RWPA 2F4VB 1D2RA 3DAPA 4V1CA 5JSFA 3S7BA 4FHZA 1UDCA 4J3FA 1X9IA 3E58A 4J94A 4MLCA 1KY5A 4FBGA 5F3RA 3MJ4A 1GUZA 1XF1A 2FRDA 4QE3A 2PX4A 1PL0A 3ICCA 3PXXA 3PS9A 4IICA 4BV2A 1KMCA 4BV9A 5GZ6A 1G2OA 1XUOA 3VYSB 2M63A 4EHFA 3FDXA 3FSEA 4G9BA 5DHPA 2CLIB 3KBOA 2Z83A 1X3SA 2UYOA 4MW2A 3DW1X 1OXKB 2GEFA 4EH1A 4GD3Q 3K9HA 3PFHA 3CISA 3M6VA 1E1LA 4I36A 4CLRA 5JZBA 4R68A 6CHYA 1OGJA 2B1GA 4HWOA 1C4XA 5CMYA 2PANA 4GMFA 2NZVG 3OP1A 3IRVA 5I9TA 1K6XA 1E61A 2OMKA 1ZK1A 1GSAA 2PAAA 3IKLA 3V46A 2WA2A 3OZGA 2JABA 3IDOA 1FL9A 4OP1A 5FEUA 2PU5A 4B4UA 3FTCA 3EGDB 1MOSA 1Z6GA 3M6XA 4O3MA 1GDDA 2APJA 3PNQA 3HJCA 3IT1A 2XRMA 5BQOA 4GSKA 2J4BA 2ODTX 3KCQA 3DBSA 2AUMA 1TQ8A 4X1OA 5CRIA 3RV4A 2VPIA 2Q9BA 1HTTA 5F3DA 4F11A 1IULA 1EP3B 4AO6A 1KP9A 3T38A 3O7WA 4YV2A 1QGUA 2JIZD 2C4HA 1W48A 3I9LA 5IDVA 3SI7A 3ZU3A 3DS8A 3WIUA 2Y3AA 4RJKA 4DT1B 1N7GA 4E12A 2ATIA 1BFDA 2NAPA 1UKBA 1D03A 3FVWA 4JASB 2QNRA 4FGZA 2X1LA 5J4VA 5FUVA 1DO2A 2V7GA 1NC1A 4X93A 3QV2A 1K2VN 3KEAA 1GY8A 5K8VA 5HX7A 3COPA 5F51A 1J0BA 1P5QA 1YO6A 3C4QA 3R0IA 3SX4A 1S4QA 3URMA 4YA6A 8OHMA 4PUCA 2QUZA 1CJKC 3MEQA 2NYAA 1U94A 3IQZA 3WYBA 1DQRA 1NUHA 3MLEA 3E2PA 3EGCA 1P75A 2QTVB 2F9LA 4RTRA 2FPPB 2QEQA 2XH8A 2C2GA 4HNAA 4EO9A 1W8IA 1FNBA 1RPNA 4P82A 2H1FA 1O2DA 4X62B 2WJJA 3NX4A 2OLEA 3CRNA 1CLUA 2BGTA 4OHBA 1L8LA 4G9EA 1VJRA 2VHTA 4B2YA 3V4VB 2ZZMA 3SK0A 3BD8A 4TTVA 2VYQA 3UB4A 5SY9A 1VIVA 4ZQBA 4JJFA 3HJFA 1KZ6A 4DX6D 5DPMA 3SY2A 5F7ZA 4DMGA 4YUYA 3KKKA 4DG9A 2YMLA 2HIHA 2BEWB 3ICWA 4OQNA 1WPRA 2C7QA 3NM4A 2JLCA 1SXJA 4NNJA 1YVUA 2EX0A 2J4FA 2W9XA 3GEBA 1GPKA 3VYVA 1ZIOA 3DGEC 1FXWA 3B6IA 1JP7A 2VAPA 3R0ZA 3WLFA 1T0IA 4M8NE 2PD3A 1N32B 4QOHA 4RD4A 3STHA 4LG6A 2ECQA 5CG2A 2CHFA 5LNK6 3DDZX 4Y6QA 2AW3A 4PTYA 3A9UA 1XDUA 3GMIA 5BUQA 1BHQ1 3ASHA 1G9SA 1UXKA 1ZH2A 3R9MA 4BVBA 1TO6A 1YBVA 3E1KA 1CEEA 2Y2VA 5EZ6B 3CUKA 1O95D 5ALGA 1W0KD 4UWLA 3WK8A 1JEQB 1RHJA 5KQGA 4MV3A 1J00A 4K1LA 2OAEA 4ERNA 4JB8P 5ALFA 4NOMA 1LNQA 3TL5A 4YP6A 4TRNA 1XD8A 3GF4A 4JI5B 2HUPA 2YYSA 1P1JA 2GBFA 1THZA 1I9GA 2R87A 2VJPA 3EGDA 5HCUA 3HXCA 2X6RA 3ZWNA 3TM4A 2RGNC 2GEBA 4J1TA 5EHIA 2PXXA 3CZPA 1XTIA 1R4NB 5TJ9A 1YZQA 2BDUA 4WI1A 1E1CA 3ITDA 5F5NA 5CJPA 2VCEA 4KPGA 3EIOA 2CL6X 3DXMG 3LUJA 5JJ6A 4Q34A 4GAEA 4CKWB 5B2ZA 5C31A 4WDQA 1AV7A 3T7CA 1PVVA 2HLPA 3BJEA 1T4CB 1OVMA 5IBRA 5T3YA 1J7KA 2CGEA 5B1YA 4L75A 2ZYGA 1BRTA 5AI6A 1HXIA 1POWA 1HOXA 4DA8A 5DBGA 4LBYA 1ZS9A 1IZ7A 2MYUA 5CEAA 4WFIA 2ODWA 3NANA 3MUFA 3OD5A 1ZD8A 2AG1A 3KZCA 5LQMA 3P52A 4RE5A 2BI7A 1K6JA 4XM1A 1NURA 3SIRA 4DMKA 4HFMA 1DP4A 1NKVA 3GLHE 3DG9A 2VAXA 1H2AS 3EZ9A 1DQNA 4MP8A 3OQPA 2C07A 1L4MA 1M2EA 1ICEA 1KP2A 2HPAA 3M2PA 5DB4A 5ELLA 2VHJA 4N3GA 4XEIG 2HK6A 4DEYA 3NWBA 1PSZA 3ELUA 5C1IA 1JHMA 1Q0ZA 4PS7A 2QTVA 2F17A 2FPPA 3GDHA 1O6ZA 4AP2A 3SSAA 4YR9A 4MRPA 2RHLA 4F93B 1ZL2A 5JNSA 1XALA 4A0HA 4HLUC 2OOSA 4M1EA 5EOVA 1XZEA 3O3CA 4I19A 3CNQS 3O0DA 1V5EA 3BPSA 2JJQA 4CIWA 1IN6A 4MI3A 3U4QA 2Y1XA 3ZUGA 1ADJA 4L4YA 2B8JA 2GRLA 2OV3A 3HUEA 4BO9A 4DBLE 3O1LA 2BEWA 3IE2A 1CUWA 4RCZA 4NULA 5I7EA 2VQ3A 4DL9A 1QRSA 3V1UA 3A2NA 1MOPA 2VZLA 2YN0A 1AZTA 2VDNB 5EYPB 2L9BA 2PYIA 4P86A 3DFKA 3CRQA 3VTKA 2P0EA 3NW9A 2OBNA 4DJEC 2HIAA 3VNSA 2AFIA 5AVQA 1KQ3A 2QU8A 2PLAA 2PRYA 2NMVA 1SEVA 2GRAA 2EL7A 5IUKC 3T9FA 2OZLB 2HLDA 3MTEA 4IY1A 3QU2A 5FQ7A 2QTTA 1W4BA 2R7NA 2XHEA 1KR2A 3W7AA 4U0JA 3NC4A 1TAHA 1JEQA 1JI0A 2Q99A 5ENRD 1NBMA 1GNPA 1UT5A 5FX2A 3G82C 1J70A 2HDWA 4XFDA 1UBKS 4I55B 3EVCA 3D9LA 2OHFA 4NECA 4DHEA 1CUZA 4LK2A 1ZEMA 1RZ4A 5LZ2A 1KSGA 1IBKB 3JZMA 5LMNB 3PNSA 4S1VA 1R4NA 3Q9SA 4ZYVA 4V3CA 3ZHVA 3AFMA 2UZ4A 2EKQA 5BSFA 3ESDA 4UC0A 4MS3B 2LRHA 1JEDA 3G8AA 4UBKA 1QUFA 4TLBA 3DLBA 3R6GA 4LUCA 5BYBA 1NKSA 2DBAA 1T4CA 4HF7A 5D2CA 2C97A 2W2LA 4HH4A 3EDCA 2RKWA 1K7SN 3OE7D 3KS9A 5A5GA 4GBMA 1AQJA 2D1SA 2OV4A 2AI1A 4ALNA 5EWMB 4UCFA 2WY2D 4FU3A 4U7HA 2AZTA 1B8UA 5EZ5A 4INAA 3NYQA 5I7RA 4TYQA 1NTRA 4IDNA 5T4YA 1Q92A 1HBJA 1QYCA 3NBFA 3ZHYA 3G8YA 4TMZA 1BWPA 3OIGA 2FI1A 5TC4A 4CT0A 2IV7A 2O8VA 2OCGA 3MMSA 1R50A 2P6NA 3HDVA 4ZPXA 1QH0A 1HURA 3GJ0A 4MSUA 4Z1MA 4MWOA 3W8EA 5JDCC 4DILA 3ZTWA 4N9QA 3G9TA 3C70A 4APFA 1IOWA 1HDOA 2O7VA 2IUSA 1MZCA 5LYJF 1QDLB 1HQDA 1JYEA 3GR6A 4DWVA 4QXQA 3LHFA 5B1HA 4IQ0A 2ZR9A 4FOTA 2B3DA 4NNOA 5D3ZA 1Q7TA 2RCNA 1AF4A 4Y1RB 1RFLA 3PQ2A 5ERYA 4ZU1X 3ASFA 2Y3IA 3DEHA 2HL6A 3EUVA 1M2HA 2LUOA 2I2FA 3LDZA 1KYYA 2YYYA 3TKAA 4Q82A 4LXTA 4HNHA 3EXAA 2XX3A 3QDNA 1AIPA 3G9QA 4Y9UA 3LP6A 1LI5A 4ZOBA 3BS4A 5IM4F 1CIPA 1MC4A 3ILVA 3TR5A 3NTQA 1P5RA 2PEZA 3FCXA 3MCAA 2H11A 2X3MA 2OHVA 4BB9A 1XP5A 2OCBA 1NJGA 3ZS9A 5K7SA 2FI7A 3ORYA 2ZJBA 5IAKA 3G2PA 1D4ZA 4Z4CA 2AVNA 5KVQA 2I6QA 1QP8A 3ILYA 3DAHA 4RIFA 2YVAA 4XEUA 5ESRA 1SA5A 3DE7X 4NCJA 2C5EA 3FGZA 1SXJD 4F9EA 4R1PA 4BKQA 5NULA 3VYWA 1EE2A 3IKJA 1DFIA 4UVGA 4JNCA 3H1FA 1X1BA 4RIEA 2C98A 2NO6A 2OZLA 2FG6C 4OJTA 3SZGA 5FORA 4ED9A 1AXEA 1L5MA 3CNHA 5AW0A 2FMKA 3VFDA 3CGWA 2VJOA 2V7XA 3PK0A 3RSZA 2IP4A 3E3LA 2C2OA 3HXFA 2ONJA 5FTJA 3FFXA 5EC8A 3DSWA 4PIVA 4XYLA 2J0EA 3TTWA 1T5BA 1XAHA 2R65A 3G2QA 1U2GC 4LY9A 2VG8A 4I55A 2DPXA 3DMGA 2DWUA 3H17A 3R75A 4W5RA 4LZOA 3AZPA 3BMXA 4LRZA 1VHWA 3IPLA 1KFBB 1PT5A 3DBLA 2XQJA 3T1OA 4AICA 1IZYA 5ITVA 1Q0HA 1T1GA 2F3UA 4ZTBA 1GNRA 1IHOA 2VZEA 2IW3A 1N0RA 4TSRA 4IOKA 4PAOA 4M9XA 1NOIA 3S44A 1KAHA 4MVJE 5H0IA 1THTA 5DLEA 3RKVA 2NPOA 4KUHA 3LZDA 1NMEA 3ONEA 2GROB 1SOVA 3PC3A 4CLDA 1MJHA 4EG6A 3GGDA 4L5IA 2XKBA 4MVJG 3M9LA 4LBZA 4PG7A 5F4BA 2LR0A 3LQ1A 4KAXA 4B9EA 3CH7A 3NIWA 2BFNA 2VNAA 1NLMA 1H1TA 4U0ZA 4XKCA 3JS5A 3SOPA 1WCXA 2NLOA 1IPFA 1QQAA 4C48B 1RCTE 4KO3S 3IP9A 4X9XA 1AHHA 1IATA 2HDNB 4FZJA 4P4LA 4DSUA 4LHXA 2BTDA 4YRAA 3HXDA 2BTEA 2WF7A 1O97D 5BT8A 4GFDA 4CRWB 3KKOA 3J5PA 2Q4EA 2HE0A 3AF3A 1L6RA 2NSHA 2CT8A 1NWHA 1T2FA 3THWB 1J09A 4UAGA 5L4NA 1QE5A 3HQ4O 2YJ6A 3O2NA 1FS6A 4LDNA 1JQKA 3NHKA 3NATA 1XPUA 2NXJA 2VNKA 1P2UA 2WHEA 4D02A 1LEHA 3ZXYA 4YONB 1S6YA 4YVFA 2AOUB 1P4SA 2XCLA 4Y1RA 1JU4A 3CIOA 1Q7GA 2BGNA 1ZQ9A 1ZRSA 2Y1CA 4Q3AA 4P29A 4ZHQB 3TLMA 1M2WA 4DLVA 1A4XA 1ZBQA 3HVKA 4M7OA 4QQNA 1TTPB 1ESDA 3MMNA 2W2TA 5DHUA 1K97A 2GZ1A 4RLQA 3I61A 1HDYA 1SVSA 2X5JO 4BAGA 5F9FA 1M2FA 1V6AA 1V4NA 2B6CA 5GMOA 3IODA 2X4LA 2E4AA 5EAIA 3NLLA 4O08A 2HFKA 5AM0A 1FP1D 3OPMA 2BFDB 3R3SA 3H2KA 4R0NA 5C3MA 4OGLA 1Z6AA 3GT4A 2ZVPX 2ZWPA 1UFVA 5EMMA 1G1AA 2Q41A 3IOEA 4K5QA 3GP5A 2DUJA 3R09A 1P0FA 1W96A 3LA6A 4O2AF 4NYJR 4DX5D 4PRZA 2V1UA 1RC0A 1NL4A 2R7MA 2NUPB 5J2TA 1ORTA 2O2IA 3AF4A 1QIKA 2GJ4A 3MK31 3UUEA 2I6TA 3A10A 1GGVA 5E2BA 2O5CA 2HLDD 4DM7A 5TPWB 1PGOA 4JXJA 4CIDA 4NY1A 2PFKA 3AJIA 5D01A 1L5NA 4XGQA 4JBNA 4B3GA 3P0FA 3UZUA 1DZIA 2ILTA 4LDZA 1T6ZA 1XRJA 4KTVE 5KTSA 4Q24A 2YR0A 3BMOB 2A5UA 5DTRA 1QRAA 2CV0A 2BJHA 4LWOA 2P9JA 5K0JA 4GI7A 3O1JC 2WQZA 4MIYA 2Z2KA 3DVQX 1JXOA 1X13A 4LRUA 2J5RA 5IJ9B 3ZGQA 4PLZA 1NMSA 1M5TA 5K03A 3MMXA 4FTWA 2WKPA 3BT7A 5FV7A 3O3NB 2YWGA 3HVRA 2BKAA 4XYEA 1JJ7A 2ECOA 5FOUA 4YMIA 2ERYA 4QPPA 5CIYA 1ADFA 3D6AA 4XE5A 2Q4BA 1ZJJA 5C7LO 3QXSA 4O4LF 4K9KA 2C1EA 2QZJA 2GXQA 3E4BA 5CXSA 3QPUA 4E22A 1LCIA 5SYAA 2W2LD 1MZVA 4OSOA 3ZHTA 1L1RA 1YVEI 2YQ4A 2A5JA 1GQFA 2WV7A 2V5FA 4OBWA 2J46A 1QO7A 3T3NA 4CRWA 4KC0A 5KUTA 2QSJA 3TLCA 2MDTA 3TTTA 4B09A 4LZJA 2CWWA 3ZXIA 1ZWKA 1Q1AA 1C30B 3ON5A 1U0TA 2I7VA 2Q6IA 4B6EA 1V7CA 2BYTA 1PG0A 1T2AA 3DQPA 4S12A 1E2DA 3PQDA 5FQ6A 1O0CA 4REQB 4Q03A 2AG5A 2XWQA 1NSTA 4E2ZA 2P4SA 3E30A 3VLEA 1GG9A 2YJ5A 3QOFA 4D9BA 3H8SA 4Z1MD 2BJWA 4KQEA 3GVIA 3DD1A 3MFYA 3UGJA 1PV2A 4II2A 5L40A 4JQZA 4IUBS 4XUGB 2JLQA 3IR6A 3P0RA 1XDWA 3NKFA 1UMDA 4PSDA 4ZHQA 2AXVA 4C43A 3H65A 1YI0A 2G63A 3OEHA 3RAGA 4NG4A 1KBZA 1QB8A 1PJSA 1B43A 3HWWA 1RMTA 2Y92A 3B6MA 4RLYA 1WW3A 2R59A 4HVTA 4OTZA 3MS2A 4FJ1A 3R3VA 5J63A 5BUCA 1U9CA 1CUIA 1M10A 1Q7RA 3V79K 4C3VA 3ZCPA 5A9SB 1D2MA 2AEFA 3RRNB 1M2NA 2X3FA 3AF2A 4IMPA 3DZBA 2O2HA 4UEOA 4G2TA 4RL6A 2F8XK 2G06A 2EJWA 1NW7A 3WMFA 2D5AA 5FQ8A 3EIXA 3D9KA 3EZXA 2IPOA 2AW6A 1F6WA 1YONA 4WLOA 2B61A 3TNFA 4OEHA 3I5YA 2MHCA 3ZVNA 2EKLA 2AYZA 1X8JA 4FW9A 3MXOA 1DVRA 4DW8A 3PCXA 1TQ4A 3KPVA 4RK5A 4LCJA 4KODA 2FRVA 1LF8A 5ABPA 2NUPA 3THOA 2I87A 3ZDDA 1WMEA 4YYEA 6LDHA 2PZ8A 3DMDA 2D74A 4ENTA 5LMCA 3I6BA 1ABEA 2H9AA 3M3DA 4LNUB 3ISTA 2ZS9A 3IKOB 2HPHA 5FTMA 5TPWA 4DKXA 3EY4A 2IU0A 1PZGA 3NHMA 5AXBA 4JBHA 5KX5F 1I4EB 5CDGA 2FNAA 5DU2A 3BMOA 4KYVA 1R27A 5CNKA 1SBIA 4BQFA 2BONA 1M6YA 3I8SA 2R2LA 4R0MA 1LLCA 4L16A 3KRTA 4BKMA 1TQ6A 3L02A 5IJ9A 3WISA 5B3AA 1QB7A 1YK1A 5FYQA 2JGFA 2RKOA 1E89A 2WWYA 1M1ZA 4L4UA 5I5EA 4ARBA 1RWXA 5L53A 1PNRA 5FOTA 1ZC3A 3MYRA 1XD2A 2H1CA 1Z15A 3P2MA 1UM9A 3RTAA 1TQHA 4JR2A 1Z08A 4AJEA 5EIXA 2W6IA 4ZI7B 3DBHA 4MUHA 4JAVC 4XLTA 4LCEA 4B31A 2HSWA 1ILEA 2EKPA 2H29A 1XZJA 3SE0A 5FUYA 1GQYA 2TSYB 5ICGA 2X1HA 2MOKA 3DJFA 1BEZA 3DYVA 1ZWLA 4KTTE 2MSWA 1H23A 4NDAA 3HMKA 4FLEA 1RP7A 3LZCA 4DDWA 2HV9A 1YJCA 3UF0A 4BPRA 1QE0A 4JEUA 4QPZA 4KWIA 1C30A 1RLUA 3IDAA 3W6NA 4RESA 2O5EA 3FUCA 3G1UA 3HCWA 5DGDA 3KO8A 2XF8A 4REQA 3OLCX 2MRIA 4OIMA 1DWUA 1TF2A 2EQAA 2GJSA 3KIPA 2H8GA 2M1XA 4LW8A 4NESA 5FD8A 1R5NA 1XRMA 1RJ9B 5HS0A 1U0SY 5B1AE 3GGSA 3PJFA 2HX1A 4L2IA 2FFRA 2PY6A 1XDGA 4YK7A 5A0VA 3LPCA 2JDIA 4KWCA 4DDKA 1G66A 4B8CB 1P5FA 1NDHA 3DE6X 3K2IA 3VX3A 1Z9BA 4P2GA 4FZVA 3HA2A 4K0RA 5DNWA 2KZTA 1K5PA 3IHYA 5I9MA 1XVUA 3AV3A 5CDUA 1SAYA 3EH2A 4AMUA 5DNEA 1IB6A 3K1TA 4C0AC 4E32A 4KMSA 1DC7A 1NVAA 4X3CA 4ZD6A 2HCBA 4R8KA 2XTMA 4F91B 3LGSA 3ZCQA 2RHRA 3CC8A 3AR8A 1SIOA 1V8BA 3PQ7A 5A9SA 5COBA 5AKHA 1H9BA 3RRNA 4F5WA 3ND8A 3TWRA 3Q8LA 4RSRA 3N70A 4NURA 2X0JA 4CDRA 4NICA 2F43A 5ALSA 1QWSA 4PQRA 1Z5VA 2PM6A 3GV0A 4WNFA 1AK1A 1ZHOA 4XTCS 3KSLA 3BTSA 1OZFA 3C6MA 1Z8FA 3L8DA 2GVNA 2IHJA 1E32A 4XLZA 4HGNA 4UTRA 3CLKA 5FBWB 2QTAA 3BA1A 1T0BA 1ZOOA 3R7BA 2FPWA 2REOA 3GPLA 5HIJA 4IUYA 2Q21A 3AM4A 2L42A 4FWIB 3REQA 3CEAA 3AVUA 4S0ZA 3BF8A 4LNUA 1YQWA 2ZBPA 4HVAA 4MXDA 4HNUA 2BF0X 2FMXA 2Q2WA 3KYDA 2ZUDA 3RUDA 4YAKA 3EWIA 1N3LA 4ZQCB 1ZA2A 5CT4A 4G2VA 3N8IA 4LNGA 3TN7A 1D09A 4AIIA 1U7PA 5K2MA 5ULLA 1PZFA 5AJVB 3HNOA 2ATVA 4NH4A 3QUAA 2XZOA 1A8IA 5JIBA 4MS6A 1OZHA 2PQNA 5SV2A 3W2EA 5B2EA 4YVOA 1FQJA 3EF3A 1R9JA 1C3VA 3NH6A 3ZI7A 3QLVC 3I1IA 2VNIA 5MDHA 4BP8A 1IJBA 3DD5A 1ZUNA 1DG9A 1VKJA 3NVKI 1ZR2A 6AT1A 2TMYA 1H2RS 2H07A 5EIBD 3ZYMA 1K5DA 1KZPA 3VTAA 5ANRB 5LR6A 2X15A 1B3BA 1RC8A 1JYSA 4BE9A 4EG0A 5C4IA 2C03A 4TWJA 1BE8A 1DDIA 1QJCA 2XQVA 3JWJA 2OCKA 3AJDA 2VZ8A 3WGLA 4GZ5A 1Z4KA 2BFFB 2F55A 1QHGA 2HIGA 2IP1A 1R1DA 1L4LA 1WZIA 1NE7A 4TL6A 4FDVA 1IJFA 1PJCA 4R2LA 1EJ0A 2X22A 4LHVA 4B3MB 4UUOA 4IJ5A 1XQ1A 3E8MA 1FCHA 4GYOA 3HDTA 5F73A 2OENG 3RO3A 3R3HA 3WSWA 3V1TC 3OG9A 2PUCA 9MHTA 1U7TA 4NBNA 3GGOA 4BNXA 2WNIA 1KVUA 5JJIA 4KNYA 5DIZA 3LY8A 4H16A 1RJ9A 3DVSX 5B1IA 4AJ4A 1JNZB 2HQRA 4R1QA 4PO9A 2J5XA 2PH3A 2I6HA 1VE9A 3A11A 1XZGA 4JVLA 3NR2A 3JATB 4ANXA 5K0ZA 2JFQA 1S3GA 3CUWA 3TDMA 2GZHA 2XGJA 3DYBA 1F3OA 1Z8HA 4X6UA 4QVGA 3AG3E 5ALPA 4GWLA 4KYUA 1DAKA 3ZS8A 2R6FA 4PPYA 3LLMA 4RA6B 2Z8ZA 3ZCUA 3H9EO 5IXYA 4X94A 5KJEA 4F0JA 3OEHD 2P5YA 1J06A 2IZOA 1INLA 1VCIA 3U3MA 1J5PA 4TUYB 1H3FA 4KR7A 4NH0A 3VH2A 3FVQA 3AG1E 4D3ZA 5K01A 5H02A 5F1YA 3F71A 1GCOA 3B70A 1F8XA 3Q8MA 3WNZA 4J03A 1GFZA 2ZAOA 1QH8B 1JDNA 1TMGE 4UUMA 3MB8A 2VCHA 2HM8A 1Z5ZA 2YC4C 3OMWA 3UQ3A 3A6EA 4H7KA 4BN4A 1DPFA 3WVNA 2YRWA 4MIEA 3L0OA 3VKFA 3SS9X 5G1OA 4TYYA 5JBQA 1O95C 3ENWA 2J67A 3R5HA 1J8FA 5AJYA 2Y4NA 3M4ZA 3S3TA 3T99A 2RGCA 4U2GA 3U17A 1T2CA 1E6KA 3AFOA 3L7YA 4A1FA 2IU1A 4O1IA 3QKRA 4R2IA 1ZW1A 4CR8A 2VP9A 3SYKA 1ZIDA 3ETLA 4CVNA 2Q9AA 1NFQA 4P4TA 1PV4A 1KEPA 4PLFA 1ZICA 1IUOA 2BY4A 3HZHA 3V7FA 2YW9A 2Z57A 3U3RA 1RQRA 3ZQKA 3NAGA 5FBKA 1ORHA 1YZHA 3AJRA 1VYTA 4RHYA 4BO0A 3I05A 4L08A 3WKEA 4I9NA 2LPMA 2X38A 2WJZB 3ZHQA 3F8SA 3W6PA 3S81A 2VJ8A 4FQ5A 1MB4A 3D8NA 2PSSA 1LQTA 4NACA 3MHPA 3IEVA 3KS2A 5H9WA 1QGZA 2CXOA 4ND1A 2FR0A 3W9UA 1FXSA 3QHAA 4D46A 1B6RA 5AH0A 3RKRA 3D1VA 2ONZA 2YJ4A 3DL0A 5ANRA 1VPEA 2VGEA 1E77A 1HDXA 5TSDA 1H2YA 4PCAA 3E9DA 1OSNA 3IEKA 1I6WA 4MW6A 4HJRA 1LBQA 4UHKA 4R2HA 5INTA 2PUFA 4EI7A 4E94A 5IANA 2CLFB 2OO7A 2W6ID 4PYNA 2ZI7A 3H8VA 3AV0B 1EUCB 1MORA 4LZWA 4ZZ2A 5J5CA 5B3LA 5EHXA 1E79A 5BT9A 2A1IA 1B1AA 1JKJB 3R8XA 1H0AA 1KI3A 2GI4A 4JGBA 2BFPA 4NL4H 2ZJ8A 3HL4A 2HXGA 4FJYA 1LZKA 2IK8A 4Q5IA 3H5IA 2A9KA 4HLEA 2F9FA 4U2DA 1PK9A 4BMSA 5G02A 1SU7A 3BSFA 4QYIA 3ZHUA 3T7IA 4LOHA 2RC5A 5AW3A 3OMSA 4B45A 3P9RA 4NEHB 4BDSA 4MOWA 2ATCA 3VPFA 4N03A 3JATA 3ZU6A 4RO0A 4JJKA 1IZ9A 2A94A 3SXPA 1H2BA 2VT6A 1XWWA 2D0IA 1BO6A 2YBEA 2QBYB 2C7GA 4HXFB 3KR9A 1X7YA 1NRXA 3LO5A 3RCBA 1P8JA 5K20A 3B51X 2BRUA 4X71A 1E3JA 3SBTB 1GKUB 4HWGA 2G83A 4CQNA 1VC2A 4LKRA 3BTUA 4Y2QA 4CKXA 4RA6A 4IYPA 1E3IA 1WF6A 5LLSA 4F3TA 4TQ9A 1IXZA 3D7MA 2CHZA 4Y0NA 2G5TA 1HDIA 7GPBA 2UY1B 1XEXA 5I7HA 3TXYA 3KR2A 2O8BB 1W8DA 3OCZA 1Z88A 1QH8A 3V8BA 1UFKA 4UMDA 3KFXA 4UHDA 1TNYA 5EP1A 3HP4A 1SUAA 2G1KA 2EJVA 2VXOA 3LQRA 2GTIA 1PT7A 5B6IA 2FRDC 2C3MA 4WNCA 3CJRA 1RJGA 2LSUA 3EG9B 5F5XA 3JD4A 3DMFA 4BNIA 2BBOA 4A8TA 4D9HA 2ZB7A 1VECA 5ENPD 2J08A 2FQYA 3JQGB 1OFVA 1DBSA 1T5SA 4TZ0A 1JDPA 4YCAA 1YZNA 4G0VA 2SKCA 3R2JA 4IKEA 3GBVA 4QECA 4YEDA 3ZK7A 1HG2A 1DX9A 4BO6A 2QLTA 2LCFA 2OHGA 2ZUCA 3MBIA 2XYQA 4LNUD 1E3SA 2I4TA 3GLGE 1MJGA 1DKLA 1VSVA 5EIHA 4M0MA 2IHVA 1OXMA 3A9TA 1KU0A 1I0LA 3KXDA 2X77A 3GA7A 3SC6A 2IUYA 4ETNA 2C7OA 1J07A 2OA0A 3ITEA 4MHSA 1C4WA 3EMDA 1JDBC 3KV1A 2EF0A 5BV8A 3NKLA 3UUXA 5H68A 3S2AA 1T5IA 2ODPA 3M6LA 3MPUA 1F4LA 4MLPA 2G07A 2VXYA 3KLOA 1NUSA 3ADBA 3QF4B 1IOLA 1P77A 5JUWA 2FXVA 4ARZA 4TTPA 5F78A 4FGKA 2IIVA 4FS3A 2LAIA 1SJ9A 5F2EA 3WWYA 3CRZA 3TWWA 3B53X 3SF4A 3V2XA 5B1BE 3C72A 4G07A 1MT3A 3ESCA 2A5EA 1NF3A 5CB4B 2ENUA 2ZKIA 1JZQA 1E9BA 4DB4A 1N5OX 3QWBA 2HCRA 3V6MA 4FHGA 1EK1A 3ZDBA 3LKUA 1B23P 4WQMA 5IMBA 4LCTA 3FNHA 1ZM9A 4KX3A 3B7SA 3N2KB 2YS6A 2HV8A 4LJKA 4EEKA 3GRUA 3JQCA 1CZUA 2DQSA 3KT0A 4EFNA 5BWBA 4RSGA 3CHSA 1WWKA 4IDPA 4DCUA 3N75A 2GW1A 2B20A 3RHFA 4AJ9A 1J0CA 2QBYA 2ZRAA 3VKUA 4KACA 5FWYB 5CDYA 5BV1A 3NF1A 5CXXA 1PV1A 3C5WP 1ZISA 3T3OA 4RHUA 5DI3A 2B82A 3LCRA 3KKMA 2ZIVB 4CQLB 3BX1A 5JYEA 3K92A 4KWEA 3M83A 1J56A 1E7WA 2ZXEA 4ZCQA 2E2WA 4MP6A 1BU9A 3FUJA 5E6RB 1Z6XA 1NP6A 3EHEA 3FTQA 4M6WB 4WEOA 1LB1B 2V6BA 2F3TA 1L3CA 3AF6A 3FMVA 2O8BA 2GAOA 1YZ3A 2O3TA 3O74A 3DLIA 1D8AA 1I2BA 2JI8A 2XCBA 1AF7A 4X41A 4QQRA 1XTUA 3QSYA 3EDTB 4X90A 3WGTA 4U7FA 3W4KA 3HKEB 4LZZA 3DDWA 2G36A 3RREA 3KVRA 1OLOA 1WD5A 2CLSA 4WN9B 3T5AA 5JWRA 1A2KC 3EG9A 2JJ2A 3SFYA 4H0NA 5JG7A 1X7XB 4IYRA 3I9JA 2QVZX 5ICEA 2J3KA 3U7EB 3GYGA 1GUFA 1GA6A 3E9EA 4LSZE 1KI2A 1ST3A 3AI7A 4EATA 1AKYA 3C3AA 4H77A 4DV6B 1KQOA 3R41A 2Q3LA 3EIWA 1U90A 4DLAA 2PT7A 1OVGA 5G4LA 3G5LA 3DONA 4IEFB 3C5RA 4E5UA 5M34A 3STVA 2ZRPA 4Z3OA 2FN9A 5LDHA 4EF4A 1KK3A 5ARFA 3X1WA 5DWVA 5CEDB 3TCNA 4JLUA 4J1TC 3K8OE 1A82A 3OZVA 5AFSA 3AUFA 1B4DA 2FHPA 1KI6A 3TNDA 2EBFX 1FDTA 1KJZA 1VE5A 1WDWB 3ML9A 1Z6TA 1TR4A 1HDZA 2D8MA 3K73O 1HTBA 3B78A 1JBEA 1CBUA 4NIMA 3HKCB 2Y1DA 1E99A 1EWTA 5IAEA 4PBRA 2F3QA 4OGGA 5JJCA 3UXHA 4PQEA 3AVQA 4PYKA 3OLZA 5HFNA 4P7KA 3GHYA 3C7AA 3G9ZA 3CU5A 4RZXA 4GQAA 4G97A 3WBKA 5A3JA 4K9NA 4OHOA 3PGLA 2E85A 3KTFA 3IAAA 4TKMA 1H6CA 4B44A 1O97C 2EU8A 4L9SA 4Q94A 1U3UA 5GP1A 5HRUA 4EB3A 1NF2A 2IS2A 2TECE 1XPJA 1HL7A 1SC9A 3LA8A 3CVXA 5KVVA 2FEMA 4PSUA 1KI7A 4Y1EA 4X5OA 4EW2A 4ZCIA 1AX9A 1CQZA 3TJMA 3FPKA 1Z0IA 3FZEA 3I4FA 2E4YA 3GJZA 5IKXA 1E79D 3N2KA 1MC5A 2IOSA 4ZGBA 1S1MA 4E15A 2P2CA 4BMCA 3OAAA 3I4RB 4QARA 3FH8A 2IRWA 1VBKA 1Z39A 4TXMA 3FA2A 1YZLA 2DBRA 1QFYA 4AWXA 1C0PA 1JG3A 3QPCA 2QTNA 1QX4A 2BMVA 5FWYA 2GM4A 4F7WA 2AEEA 3L8FA 4XW2A 5DNDA 3OZCA 2AFHE 4Q9DA 1GUAA 1CIVA 5IFLA 2NN3C 1F2TB 2J9XB 1BKSB 3OX3A 2QY6A 4JL5A 3WMGA 4RSHA 2O2EA 1XKLA 4TKLA 4KXMA 3I4LA 2HO4A 1K08A 1P0MA 4IIHA 4A10A 1GSOA 2Z1NA 3WLSA 3P45A 3TQHA 2K7ZA 4O2BB 3O93A 2VWQA 3DXKG 5K3DA 5JD6A 4WUVA 5TMBA 3U4IA 3DOUA 2JCVA 5CNJA 5ALTA 1JWLA 1Q0RA 4R2XA 1DJPA 4G0WA 1K98A 4X54A 1U3VA 1NWCA 2OEVA 3HJTA 1JXQA 5JCJA 5GGYA 3VPXA 2WAAA 4RCYA 3SZ7A 2ZT6A 4WN9A 3E9MA 4WJKB 4DT1A 1X7XA 4XX1A 2IZ0A 4RM3A 2VI5A 3AB8A 3FJYA 5T8IA 2DYSE 1HNWB 1PDOA 4G2NA 1O4VA 4K6OA 3MTDA 2VZ0A 2CLDX 3UYKA 2VH1A 4CXMA 4G0UA 3ROKA 1K1AA 2WMYA 4EHMA 1D6MA 1DRUA 1ZINA 4ZEMA 4DLSA 4MJXA 3NBAA 5MN4A 2FAXA 4EJ6A 2HQSA 1AO3A 4HQNA 3IP8A 4UYKB 2ZUWA 2GK4A 3LWNA 4RKYA 1NULA 4PAMA 1PWEA 3EG5A 5AW8A 1MAHA 3UAYA 2IYFA 2QQEA 2B4KA 3ESQA 3MJEA 1N78A 5HJ5A 1JTFA 5FKJA 3WTCA 2ZXWE 4RHCA 4G4SP 1EDDA 5KTKA 1YJ5A 3F5MA 2OCPA 2Q5LA 4AROA 2ZTHA 1ECGA 2Q2QA 4QO8A 4LE2A 2YXEA 1PJ8A 2CD7A 1JX6A 2VJBA 1T0UA 5I51A 2HM7A 1U3WA 3ICEA 2VATA 3WKCA 5JSZB 1YHYA 3LWZA 4AF6A 1DWQA 4JY7A 1MNQA 3ZWMA 1FB5A 5K8CA 1XMOB 2ETAA 1GQOA 2RIRA 1WW2A 1KH3A 2Q7XA 2QN9A 3C3XA 1P8AA 1DADA 4MW0A 1N9GB 5JAIA 3T0GA 1W46A 4GKAA 2XMBA 3E23A 3JQ9A 2IDKA 2OYSA 1IOZA 1NXTA 1Z25A 4ZICA 4H1UA 2GFIA 2GMWA 4J07A 5KCMA 4QU5A 2JGDB 3RVOA 5H8WA 1GJRA 4H1VA 4PAGA 3QVOA 3IBSA 4BNKA 3SC2B 3EVAA 2Y05A 3I92A 2FW1A 3TI9A 3JY6A 3A7DA 1SQ0A 1HFWA 5DEIA 5D86A 3QWHA 4C6HA 1FS4A 4LF7B 3RC1A 5DHFA 1JUDA 5K0GA 5SYMA 3SJZA 3NBNB 4UUNA 3H1TA 5AKXA 5JTUA 4UOEA 2R60A 5ADUS 2BKUA 1NM5A 2OK8A 2IHUA 2VSXE 2A7XA 5AO9A 3EWAA 3O4HA 1WS6A 3K72B 4RVSA 1RMYA 3CUSA 1EFRA 4HZGA 4O4HF 1G4HA 3GFSA 3QA9A 1YRBA 1PS8A 4KKVA 3BWXA 1N6OA 1YQXA 3L7NA 4O2BA 5LVAA 4WLVA 3T94A 4HRYA 5L3VA 1GN8A 1QNLA 2AW5A 2DE0X 2WE8A 2DFLA 3GCDA 1FCJA 4F3VA 1WMBA 5TLSA 2ZDQA 2PM8A 3GVCA 3Q85A 4GNKA 2RGDA 3E7XA 1XXHE 3EGXB 4CKWA 3SXJA 5K0CA 4QYWA 1VSBA 2EFGA 4RH3A 3KYCB 3GCZA 3K5WA 4GYJA 3MBKA 2RONA 4KV7A 4YRZA 2AFRA 1O57A 3HXKA 4DTIA 2NXWA 2P9LG 4GVLA 3UJHA 3O2SB 4LQLA 2GBPA 1J23A 4KGZA 1P33A 2AUNA 5P8WA 3QE0A 4OAQA 5JPDA 4AAYA 5DULA 2ZE6A 5JALA 2CHUA 5ENSD 1V0JA 4N76A 2Q3DA 2YUTA 2JJ2D 2WZBA 2ZBDA 4Q4JB 5DKFA 1DCTA 4CEMA 1UPCA 4DJ5X 3EEFA 1HEIA 2QJTA 1VHQA 2XEHA 2PBZA 3EXG1 4ROTA 3CW8X 2VKTA 2Z5LA 2WLSA 4WASA 5EA2A 1EBFA 3G2KA 3EVBA 3L04A 4H6XA 3SEQA 3RR2A 3G8CA 1EFLA 1Z13A 4AN4A 2XUGA 2BDEA 3PNMA 2PZGA 1LTQA 2JCGA 5HRCA 1ZUHA 2BHNA 3UA4A 2D6FA 4EJ2A 3QEJA 2ZTLA 1HWYA 1T8PA 4HEQA 4URUR 1SGWA 4Y1GA 5GONB 1F5NA 1XDZA 3AF1A 1QIEA 1UDWA 2YC2C 4RUKA 1WMSA 5EQFA 4HNAD 3LUFA 4ILEA 1GAQA 4L6CA 5JSZA 2O2SA 2QKYA 2G67A 1Y3AA 3E3NA 4L7VA 2VRWA 5H1YA 2X2PA 4HPJB 3HXBA 1PN3A 3L7CA 1Q0SA 2WXMA 4F7AA 3PEVB 3K70D 1Y81A 3R0QA 4C04A 1N9GA 1PU2A 4EY3A 3DEIA 1E9FA 4N5CA 4B8WA 3Q40A 3FKJA 1LD8A 1Y5LA 4N7RA 4DQ0A 4QBFA 3FPJA 3JCZA 4QHYA 3E48A 5EYPA 3AH8A 4CGYA 4EUEA 4YRFA 2JGDA 1KYVA 3W5CA 1KMIY 4EA6A 2W6OA 1NW5A 4UOQA 3BQ9A 1UXIA 3H2IA 2XZDA 3V4PB 4OVVA 4F4DA 3L0YA 2WINI 4BFZA 1AS3A 1JIUA 3KQLA 5JPCA 2QC9A 1E0DA 3ZWQA 5JFOA 2W2QA 1V3UA 1JLKA 4WEQA 1K3ZD 3VPDA 3SSNA 3KHSA 1MABB 3EZLA 3IULA 3N3AC 3FU6A 4K9LA 4R2WA 1MX4A 1L5VA 1RYHA 4NMHA 1F7UA 1DAPA 3QNUA 2ETCA 4EL5A 4BNUA 3F46A 4Y7CA 4CMEA 1OLUB 4HUJA 3ORRA 1NVBA 2ZANA 1PWHA 4UE3S 4W5QA 3OF3A 1GCUA 3A3KA 4BS9A 1I5OA 4QT4A 2VBGA 3BXPA 4RFLA 4ZJPA 1EWRA 4YAEA 2YWJA 1MIHA 4MQMA 1YB2A 7MDHA 2HBYA 5DYYA 3RYCB 4FYPA 3ZDQA 2HSDA 4MS3A 4DUGA 3PI7A 1Q12A 1I94B 3GXBA 4C4TA 1ULUA 3AONB 4WNAB 1VP3A 4LTMA 1IMJA 2A78A 2ZJ1A 4RIHA 1UT6A 3HVHA 1EH5A 4U2CA 3IP1A 1M2VB 1UJ5A 4J1SA 4LF5B 3HJNA 1L5JA 2P67A 3QMVA 1G18A 5CFRA 5EWMA 3RIBA 4HRNA 3ZK8A 1B8OA 2YNQA 2C9MA 3MRSA 2FW7A 2Q3FA 4FM9A 3FPGA 5JCJD 3ANLA 3JQPA 2H31A 4FFRA 4R7LA 5FI0B 3ZPXA 3EODA 1E5DA 2H4HA 3H16A 5ESXA 4Q4JA 4W99A 3LQFA 1O54A 4R5MA 3KQMA 4BBJA 2DY1A 3AR9A 3G6WA 2PNNA 1S8OA 5LIPA 4C89A 1K63A 3WY9A 4CM7A 1NYRA 4Z7OB 3EARA 3DYIA 2L0IA 4BAUA 1Z7BA 1JUQA 2DKOA 1CWUA 4NOJA 4MCIA 4K9RA 5EIBC 4C7JA 3GOQA 2M1ZA 3NP7A 4XYMA 1M1UA 4WN3A 2D7JA 5DBIA 4A6EA 5GONA 3C45A 3A27A 4Q1FA 2SHKA 5AOVA 3SYMA 4DPKA 1X8LA 1ORVA 1W94A 3X2FA 1NW4A 3VU8A 4MVXA 2YRXA 1PEYA 4I55F 5AI4A 3T0IA 3PEVA 4GX1A 2COUA 1ZK0A 3BFVA 4OU4A 4GNRA 1XTTA 3W7BA 2V0GA 1TM2A 4KVOA 1GLVA 1RM3A 3OZAA 2V9ZA 2ZBQA 3AOGA 1WB5A 1T43A 4BLUA 2Q3HA 4AT1A 4UBJA 4KXQA 3O2JA 2EEZA 2NO0A 3NPAA 2X5TA 5L9AA 2QUAA 1WAO1 1KZGB 1RMQA 4R7GA 2FN3A 2C00A 3GW4A 3ONWA 4IRMA 4Q02A 5LJIA 2ZUFA 2JAPA 3ASYA 1EK0A 4NRDA 4ZVVA 4K7JA 3RANA 4ZXPA 5JXHA 2CVQA 4FU0A 1PJ2A 3DMTC 2H2GA 5LN1A 1FPMA 4BQEA 5ARDA 2VK2A 4OL0A 3SMVA 3V48A 4M83A 5CVCA 2JAXA 2FMIA 5CRUA 1MABA 5FQNA 1N77A 4BMOB 1K3UB 4BX0A 3U6BA 4RJTA 1QG6A 4YMUA 2JH9A 5LBIA 1RXWA 1RHKA 3EOAI 4ECAA 5IEJA 1SBCA 2ZS7A 1J2EA 1Y42X 2OFXA 4RVOA 1OLUA 5FB3A 1KO8A 3C3JA 4RWZA 1CUEA 2OUIA 4LG1A 1Z28A 4JJ7A 2IXAA 2DUWA 3TE7A 3E82A 3SDZA 3LM8A 1QTIA 2A9VA 3C6YA 2DH6A 3CW2A 4L02A 4JHXA 1CK4A 1KOJA 1NBMD 1N36B 3OJXA 5JCOA 4GYWA 4IVNA 2XGSA 5G2NA 1OXTA 2J9QA 3EJ6A 1ORWA 1WUHS 4D8UA 4ARSA 1JG1A 1EFRD 3UTCA 3Q3GE 4E2XA 4A82A 1M9NA 3TX2A 4WNAA 3B38A 4EMBA 2YIJA 5HR5A 3ZVRA 4BERA 3Q7PA 2AMFA 3PSAA 2V3CC 3C2QA 1MH9A 5DT2A 3Q3IA 1NL3A 2VCYA 2QRHA 3H9BA 3WX0A 2D5BA 3DDSA 3ROTA 5HQ8A 1OE0A 1HXHA 1V71A 4YQYA 4PGGA 4C4RA 3Q5DA 2I4MA 3TD2A 4JL6A 5CFZA 3K32A 4OHZA 4BTLA 1MHPA 5BSUA 1HT3A 4UM9B 1QYXA 4MYHA 4QPJC 5EEHA 2HHLA 5HZHA 1M83A 2BFWA 2CSUA 4ZDWA 2ZSBA 3B48A 4AY5A 4EVRA 2DWCA 1E3WB 2FZVA 3JQ7B 4KLZA 3THWA 3QQPA 2RB5A 3TTXA 2FQWA 5TF4A 3HG0D 3OH8A 2VPQA 3RIHA 2BE7A 3LX5A 1R12A 5K8JB 2KB0A 4YAGA 4HXIA 2WMNB 2EP7A 1NGSA 4H27A 5CCXA 5A71A 1PFQA 2AOUA 4CV2A 2IHNA 3SVLA 4B40A 5J2TF 1PFGA 3OT5A 1DBQA 3MCZA 3O9ZA 5KYKA 1RI4A 2R00A 4Q39A 1V35A 3LFTA 1K7XB 3P9YA 1U2VG 1I3NA 3K5HA 2RGAA 4BTBA 3QBTA 5BQ5A 3GBSA 4F2GA 2J33A 1FMLA 5EJ8A 2YZ7A 2PMWB 2OCYC 2CXRA 1UJRA 2EZ9A 4L15A 1ZRHA 3KUXA 2OL4A 1WY6A 1AGYA 3Q2IA 2DZOA 3KAPA 1Z5UA 2HU5A 3ZCVA 1ZUD1 1AMUA 2Z2JA 2BFDA 1G21E 1GPMA 4NBTA 2YFHA 2AI3A 2ACEA 2ZVQX 2HMVA 5DYNA 4FUQA 3DHNA 5A3VA 1RAIA 1XTJA 3T34A 3KTOA 4D0RA 2J3QA 3SYLA 1DJLA 4BEBA 1E5XA 3PFFA 4NOLA 3FMGA 3WGYA 4EHBA 3V8MA 4OXQA 2FSVA 2D7DA 4FFSA 3KJIA 1HL3A 5EXEA 1PYOA 2YV1A 4AJIA 1OFIA 4KIFA 3CR7A 3FTZA 3FUMA 3ER9A 4HLLA 1NXSA 1RXIA 3KUKA 2P9HA 2PSEA 4BQSA 3SS7X 1PJBA 1RPTA 3IT2A 1ZUIA 3U37A 4C0HA 2B4AA 2IDZA 4PR0A 5BY2A 4EI9A 2PX3A 4IQFA 4J0GA 1NLUA 2EVWX 3SQLA 1QVWA 1EE9A 3E34A 1MA3A 3T1NA 2WWVD 5NLLA 2PH1A 3VJLA 4IV0A 4ANFA 1Z0DA 4AKTA 4AM9A 4AZ3B 4KBYA 4B33A 1CJVC 3KQWA 1N3IA 3VTZA 5H4GA 1VIAA 2JS7A 1T9HA 3QEAZ 3RIXA 5TB5A 1G0NA 2LO6A 4GLLA 3T5XA 1XA0A 3ENVA 1KMMA 3M5PA 4MVWA 4MUKA 4R9SA 4M9CA 4MBGA 4E09A 3NAWA 2GEDA 3PUZA 4B6QA 1TJCA 3WLLA 3QMMA 3FX2A 5TMEA 2CN1A 3QFRA 4ZHQF 2MCFA 4DUGD 2Q27A 2IYLD 4Y6WA 1Q1NA 1QGED 2A5LA 3NC0C 5A4AA 1NU6A 1YNOA 3INGA 3QVWA 3I2YX 5EZYB 4MGIR 4JLAA 3R7DA 5KJMA 2OZPA 4TLLB 3EDQA 2SCUB 2ZPTX 6ADHA 1U8ZA 1DEHA 1E9AA 3WRVA 1UDAA 2AC2A 3BD9A 1YACA 3K31A 2ENWA 4YC7A 1AKRA 2LIPA 4UUPA 4PZYA 3IQIX 3RF7A 2Y1EA 3O26A 1TRHA 2D2FA 2ZBGA 4TV9F 1PR5A 4R3UC 4JX9A 3KQHA 3P9IA 4BNHA 5EPUA 5B3JA 1IHYA 1IIRA 1MHTA 1P2BA 3ZGNA 4J2TA 2CMGA 4Q1VA 4PC2A 4EJMA 1P31A 4PBTA 3NP9A 2FWNA 5BMVB 5CX1B 4LXGA 4AKXB 3E2MA 2YQ5A 1YDFA 3AW8A 3T5BA 1U7HA 4TL8A 4EUSA 2PT5A 1F38A 1JEJA 4EEZA 5DGTA 2OGTA 2VZ9A 4R8RA 2IYEA 1E2NA 4XUCA 1W25A 2I3BA 1M54A 3D9PA 4A0QA 4RGBA 3P1UA 1N8TA 1CY0A 1GSHA 5T64A 3ULYA 2WTBA 1KJ8A 1ZLXA 2ZJ7A 1CR2A 4CUKA 1B7GO 4RVNA 2KSQA 4YV1A 4QWWA 1U6KA 1XVLA 4LNHA 4BNYA 4BMNA 4IIEA 2II6A 5KSWB 4I46A 4NMXB 2FMFA 3L06A 2AXQA 4OB7A 5EHGA 1V2GA 5JLJA 2C82A 3AVVA 3LDHA 3R9WA 3CVYA 3TSWA 3U2QA 4H3SA 1XLTA 4ZEWA 2CJPA 2XZTG 3IAFA 1S8AA 4XWTA 4IJVA 4EA9A 3CX6A 4C7OB 1VCNA 4BJ6A 2WXRA 1OR8A 2BSQA 2PDAA 2JD2A 4KIWA 1TZKA 1DG1G 1ULHA 1NJFA 1PQWA 5TV2A 2DTEA 4IHQA 1WA5A 1NUQA 1KARA 4X3OA 1SB8A 1W4AA 2O52A 5EINA 2ZUSA 2RARA 1WM5A 5JDIC 4WVLA 1RNLA 4PH4B 1FMFA 1N8SA 4MAFA 1XMJA 3HR8A 1N4PA 4XX5A 4QTUB 5KWEA 2H00A 1Q3KA 3UJNA 2O5VA 4Y9SA 3DB2A 2JLRA 3BWEA 1YZFA 2G25A 4I5DA 3ZKJA 2G9UA 2WHRA 5AXCA 1XAJA 1Y82A 2C77A 4U95D 4AZ3A 3I04M 2RH8A 4KGDA 3PREA 3A6HA 4QO7A 4QOGA 1DCKA 4V0NA 2CG3A 2J49A 4ZK2A 3LXRA 5T3RA 4BFLA 3WSTA 3PS6A 1H8EA 5I7UA 4YWJA 2RBGA 3V4SA 1N3BA 4KKXB 4I43A 2AWOA 2HR2A 2PZFA 4X44A 2ATXA 2GOYA 4OHVA 2P9CA 4RF4A 1N2CE 4ZI7A 3ZWWA 3V00A 3SFXA 1NYTA 1XTPA 2NO4A 4WKOA 3WADA 5C1DA 1QWOA 1ZOSA 5EZYA 2E4XA 4OHCA 3A6DA 3ZNNA 2SCUA 2VBIA 2YXNA 1TJYA 3IDZA 5LB2A 4KBQA 2PQ6A 4HQFA 1FFCA 2R8PA 4EFKA 2Y68A 1QYDA 3V8EA 4AF8A 1H9AA 2FEZA 4ZVPA 2X3UA 2HK8A 2PPVA 2BVNA 4UQLA 3GUHA 1DVPA 3U62A 2V97A 1UOOA 2QJRA 2V6IA 5A7GA 2PZLA 4H35A 4DV5B 4JQCA 2M6RA 2AXZA 1Z0FA 3N5KA 2UYGA 3L2OB 4DB2A 3G59A 2I1WA 1I3MA 3NCTA 3ZNQA 4DDTA 4Y2YA 3DDCA 4EG5A 2O54A 1E9CA 2H6FA 2ZB4A 2FUKA 1VE1A 1SG9A 4XVUA 5BMVA 3V1YA 3D2CA 5CX1A 2QW0X 1Z6PA 5KINB 1HU3A 2JGLA 3I3NA 2CHQA 4FNAA 1YMQA 1QP7A 4PC3A 3RIYA 1RW4A 3RU9A 1AUOA 1EB9A 5JROA 3IL2A 3RS5A 1SG0A 3FAZA 1U2QA 4X7RA 3M1IA 4ZU6X 3MTBA 4GTQA 2AFIE 1OTHA 2P9IG 2P4QA 3EXFB 4PG5A 2PKEA 1Y6FA 5EJFA 3VDMA 4EBAA 4GU5A 1T35A 4BP3A 1EQAA 4U2BA 3EDMA 1EYHA 3QAQA 5LP1A 4I8XA 1OC4A 2PUTA 2D1FA 5AARA 2VXBA 1X81A 4LVCA 3H1EA 4MKRA 1MX1A 4IDOA 1KDTA 1KDZA 2CXHA 1NQTA 3JQ0A 2CVFA 4GL4A 2NXNA 2DFNA 2HWKA 1EB8A 1U3TA 3U3DA 3GJTA 4YXWA 2XD9A 5JASA 5ENQD 3ITWA 3R4CA 1ONOA 3CLSD 2OC9A 1KJIA 3H2SA 2OZEA 1U9JA 1VHDA 5E9AA 1ZNYA 2BEDA 2GBGA 2PX2A 2KLHA 2XUOA 5GV7A 5ECYA 3FNRA 4Q12A 3TI7A 3QFFA 2WWXA 4DRZA 2F1HA 3KKPA 4CE6A 3L77A 3VYUB 4ZO8A 3K4QA 3LD9A 1UBEA 5DYWA 4J7UA 1NV9A 3RB8A 4CCSA 3WFZA 2OE2A 2BRUC 4M7RA 1EFTA 1CJCA 1KS2A 1BLXB 1B0PA 1IY1A 1A7UA 4KN9S 4IQ4A 3WNCA 5T3UA 4R84A 2AN3A 2I6XA 4L9WA 5J1SB 3OM1A 5ES4B 4UM8B 3GHHA 1EUYA 1YFKA 3WLRA 2CKDA 5IBCA 1H2UA 5HA5A 1AKNA 4WWOA 3I8XA 2PLNA 4J49A 1PGQA 2AZXA 3KD7A 1GG8A 1C3LA 3GUCA 3BH6A 4E1AA 2NUBA 1AUXA 5JE8A 4UU0A 3QMWA 3WKBA 4P4UA 4D10C 1Q7CA 4MB6A 4X85A 3FHTA 1HFEL 3VHXB 1N2ZA 5TT1A 2HNKA 1JHPA 2PGNA 5KYTA 5DNYB 4DPRA 3TVYA 1PG2A 3QBEA 5F2OA 2BFFA 4KQMA 3K0CA 2BWJA 4JC0A 4X8OA 4X1KB 4NQRA 1RRFA 4BO7A 3MGCA 4MV8A 1R8QA 1C29B 1WPQA 1T91A 3IUNA 2GDJA 2C95A 4X97A 3ZEFA 2BF7A 5DX8A 5LWQA 4YASA 4JN6B 2M6LA 4IIVA 3PITA 3E0QA 3C74A 4UTXA 1Q6ZA 4JC4A 2K7FA 1RI5A 4AVYA 1KR5A 4BFCA 1U65A 2OESA 2GRNB 3KQYA 4RPIA 3MUEA 4BNZA 1HO3A 3DAYA 2OB2A 2VL7A 4Y9RA 1EJ6A 1JHQA 1IG3A 2VSFA 1USUA 3ASZA 5KYWB 5C53B 1QCZA 2H48A 3CS3A 1JB1A 1PHPA 5FBHA 5H80A 1JHDA 5BW6B 4YNBA 1O94A 3WDSA 1TCCA 3HJHA 1CQPA 1Z75A 1J22A 4LE1A 5CR9A 3OKPA 1DHTA 5JZVA 5BWLA 1UWLA 1VJ5A 1GQSA 5LPNA 2VA9A 1CZLA 2B5OA 2D3TA 3M7IA 3UBTA 2JDID 3STYA 3BZBA 2NUTB 3ZH2A 2JLUA 5JNLA 1HZJA 4XVRA 3NWOA 2R85A 1KZ9A 4R0VA 2P0AA 1X77A 1SU6A 1MOZA 4TUYA 4AJKA 3MWJA 4L9AA 2QGZA 1WZNA 2O3QA 1O5IA 1PVDA 3RSLA 4ZVNA 1DBIA 2J3IA 2YFQA 3GVHA 3EVZA 3KXPA 3TZ6A 3T4XA 2J0QA 4AJOA 5CT5A 3FLBA 4IWNA 4JBXA 3U3KA 3ZVMA 4LMRA 2A86A 2LCIA 3AEXA 1WO8A 2ODBA 4L6AA 1GCIA 1R8YA 1TLLA 3TPFA 4FBMA 4YDEA 4YDHB 1OI2A 3JU3A 3K9BA 3FTYA 3DC7A 1QS0B 3G1TA 5JU6A 4UQPA 4OJNA 3R7LA 1B14A 3RVSA 1WULS 1XCMA 3AI3A 4CF5A 3BE8A 5K99A 3L9XA 4F7DA 3NEPX 1AS0A 2DHQA 2WYHA 4FZRA 1K0FA 3WS7A 1NA5A 2JFGA 5D00A 1XCLA 5CDHA 1KNXA 4YHHB 2I34A 3RVQA 2YWBA 2WE7A 1ZN8A 4QOEA 5F7XA 4PZ0A 2NZWA 1SUCA 2PUVA 1OI4A 1UXGA 2RIPA 2O0JA 3P8ZA 4EG8A 1ZGGA 3ELBA 3H99A 1BMFA 3KPWA 1ACMA 2BN4A 5AW9A 2VYNA 4CGZA 4DCOA 4KH1A 4XRRA 5EEGA 2I1KA 3W4JA 1H8ED 4I2WA 4EAAA 1DFGA 3FN4A 3CVVA 3PZDA 2P2CP 3H4TA 2FSHA 2UVPB 1QJ4A 3D3MA 1KAEA 4FDAA 4DANA 4ZJYA 1YT5A 2VS1A 2A0YA 1L7BA 1EUCA 5D7NA 4X1KA 4CCWA 2ODNA 2G40A 2Q3MA 1J24A 1UODA 4P7FA 2YV5A 1JKJA 2QJOA 2XKKA 4QPDA 5AW7A 4PZLA 1Q2UA 1LJ8A 2FG5A 3NOGD 5EN5D 1N4DA 2RHJA 2BHTA 3JZDA 1E6EA 3VJKA 5JD4A 2C7BA 3OQMA 2H2IA 5IC5A 4MPPA 3T8YA 3VYTB 2QX9A 1GU1A 4L73A 3PJGA 5A3SA 5KDOA 3IAS6 4F5ZA 5IKPA 3ZK9A 1RZRA 2HPVA 3H2YA 3ORFA 3L7AA 4JBIA 1Y3CE 3ER6A 3OCJA 3WTBA 1XELA 1E63A 2R4QA 3JQEA 4ZEOA 5A4DA 1RKVA 3V34A 5JH7B 1YA4A 2X9VA 3ME5A 3PRZA 3S2GA 3ILHA 3EB9A 5D5PA 3WBFA 3U60B 5EQJB 2WDPA 3ZU7B 2H1VA 3L79A 1Y1LA 2P65A 4YX9A 1DIBA 2RK6A 3K70C 2B4TO 3WWOA 2B78A 5EMKA 5DNCA 3N8KA 7MHTA 2NUTA 5FA6A 1VI5A 4UASA 3CPSA 1M7GA 1PQ4A 1KTVA 3FYTA 1SXPA 4Z9YA 4O2RA 4ZALA 5J47A 2UY1A 4I50B 4L0CA 2UVDA 4YIHA 4AG5A 1EZ1A 5KQLA 2GZSA 3UAWA 1ZP6A 1SXJC 2GPWA 1U1IA 3I62A 2QSZA 1CUYA 2GESA 1J90A 4RCVA 5G2OA 4RW0A 5DSTA 2GT1A 3HSYA 3IEGA 1S0UA 1Z7WA 4EBBA 1TA0A 4C5CA 2HTEA 1HORA 3O83A 4YGXB 2EATA 6ABPA 4C6SA 3X1YA 3ZDXB 2CVOA 3MD0A 2XCQA 1G2QA 4ILHB 1F14A 2NYUA 1JFRA 5BWMA 2P9SG 4ONEA 3VKWA 1Z5GA 4XRGA 3CUVA 5KSYA 1Z0JA 4GI3A 5EIBE 3B82A 3JQGA 1U0FA 3ABME 1QS0A 2L0TB 4UZEA 3LSYA 4JLOA 1KSFX 4K86A 5JSUA 4E7PA 4Z51A 3HWSA 4WE3A 3CO0S 3ZE0B 2R0QC 1K5GA 4PYLA 3PXBA 2GEUA 2HW8A 3ZKAA 3T52A 4CNBA 1HSZA 4G4JA 3BDVA 3HKDB 5C46F 2HHCA 1F7VA 4ZVKA 2O1SA 3MS4A 4XVHA 1SC1A 2WJGA 4X95A 1U98A 2GZMA 4YHBA 1J97A 3FOEC 5LBTA 3NQ41 2NT4A 3P96A 5BR8B 1J2YA 3GY0A 3O4ZA 1E0JA 3QIAA 4Y6CA 5EP4A 1AGXA 3GT0A 5LP0A 1GWNA 1YA6A 2W5UA 3H2JA 4PRYA 3AG2E 4PX2A 2Q28A 3ZG6A 4J8PA 1AOXA 1T1IA 3R5XA 1PT8A 5JANA 3WGGA 2J48A 2R6GA 2OBXA 2XT6A 3QF4A 3AR5A 1XMSA 4LEIA 1XRSB 3O4GA 2ZSAA 2UVPA 1PDVA 1VL2A 2DC1A 2GYVA 3PZ4A 3F49S 3ZE9A 2HA3A 3FYSA 5GWXA 2GK7A 2MSKA 2B5VA 4Y18A 5CBNA 4C0MA 2J6HA 1XR3A 5CB4A 3FUTA 4P0TA 3RSSA 4B2PA 4EUKA 1DJOA 2FW9A 4UPDA 1QHIA 4PQYA 1X9HA