4XI9A

Human ogt in complex with udp-5s-glcnac and substrate peptide (rbl2)
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
717
structure length
698
Chain Sequence
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title The active site of O-GlcNAc transferase imposes constraints on substrate sequence.
pubmed doi rcsb
source organism Homo sapiens
total genus 266
structure length 698
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xi9A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xi9A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4xi9A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4xi9A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xi9A03
4I2ZA 2VQ2A 1H5UA 1WUTA 2AW3A 4WHMA 3G2IA 2I6HA 2ONDA 4RG9A 1Y6GA 5HQ8A 4GA1A 9GPBA 2QN7A 3S29A 3CKBA 4XIFA 1FS4A 3COPA 3VUFA 3MEKA 5HXAA 1E4OA 2C1XA 3RJVA 3CEHA 2G9UA 5DU2A 4U0SA 3CUWA 3OKCA 2R4TA 4GPKA 3DDSA 5KJKA 3H4IA 3LCAA 1PSWA 4KQ2A 5FT9A 4J8EA 2PQRA 2KCVA 1SXPA 4GYOA 1EM6A 5JJ6A 3S7DA 4REMA 4HOQA 3T3HA 4N5CA 1NOKA 4YNDA 2JZCA 5LCWJ 1LWOA 3GYZA 1HH8A 4RIGA 1A8IA 3JYSA 2XCBA 5EKQD 1L5RA 3EDTB 1AXRA 3Q49B 3RKVA 4APOA 3BCSA 4GZ3A 4BT9A 2X6RA 4UQYA 3IA7A 2HYZA 4JA7A 3L7AA 1ELRA 1WAO1 3HBFA 1FTYA 3FWVA 2QFCA 2G9RA 1XL1A 4G23A 3QHPA 2X0FA 1NZNA 3KAEA 3C48A 2X0DA 2QZSA 3S7FA 3RIBA 1P2DA 3MV3B 1HLFA 5IKPA 3PDNA 5FZSA 4X7PA 3OKPA 4WNEA 2UWJG 3ZCUA 4RIHA 3OXGA 3WXXA 5JTUA 3RT1A 7GPBA 3LPZA 5D00A 1WV0A 1KLXA 3UQ3A 2AV6A 2QLMA 4CGVA 1B4DA 2PQNA 1NZDA 3VTXA 4U04A 3ASDA 3MKRA 3TOVA 3CVLA 2C0LA 5CCMA 2XA1A 3PE4A 2GEJA 1NVKA 1SXQA 2FBNA 4UI9K 1YGPA 4U0ZA 3RU0A 3L01A 5EX0A 2Q7FA 3UYLA 2HR2A 4WUYA 1L5SA 4N2SA 1M5RA 2QRQA 5G05J 2HO1A 1IIRA 2P58C 4NEQA 1KT1A 5KJLA 4KQ1A 1PC2A 5G04J 2IUYA 3OTIA 2KC7A 2KATA 4UQXA 2GM9A 3BCRA 1FTWA 2F3SA 3ZCSA 5CHEE 4GA2A 2HY7A 5DIZA 1PYGA 4AIFA 3MTBA 3GW4A 3MS4A 4F9FA 1XC7A 1F0KA 3TAXA 4EQFA 2QN9A 4RBNA 3L7BA 3IEGA 2C9ZA 2P6PA 3NP7A 5JJ7A 4YI3A 3T3GA 4EL5A 3WAGA 4MICA 4I9EA 5D0OD 3H4TA 3UYKA 1NLMA 4NC9A 1QM5A 1L5WA 3URZA 4N9WA 4WACA 2VGXB 3ZCQA 2C0MA 2ZB2A 4M83A 3OTGA 3RO2A 4UI9C 1FCHA 5ARFA 2VG8A 3D0RA 3GZ1A 3CK9A 1C50A 3OY2A 3U4TA 3BDAA 4AN4A 4BFCA 4U0UA 4GCNA 4W6QA 1ABBA 5LQDA 1TJCA 4Z5XA 1PNVA 1BX3A 4MHOA 3L7DA 1QZ2A 1NOIA 8GPBA 4H7YA 2BFWA 4MI3A 3GUHA 1GGNA 3MT7A 2Q6VA 5DLDA 4L22A 4AMGA 3L79A 3BD7A 1XL0A 3LY8A 1KT0A 4YUAA 2F3UA 3T3IA 1WUYA 1E1YA 4NQ0A 4RIEA 1Y6FA 1PN3A 4GYWA 3S28A 1XV5A 4J8FA 2L6JA 3QKWA 3DDWA 3NPAA 4QLBA 2XGMA 2SKCA 5KJMA 2F9FA 2ASVA 3NF1A 3FFLA 3EBPA 3IAAA 2R60A 3G2JA 1E96B 3CUYA 1YA6A 4G1TA 3RSZA 4GYYA 2ECPA 4FZRA 3OXLA 2FETA 5CCLA 2UY1B 3ZHEB 2WPVA 2UY1A 2BGUA 5GPBA 3T3DA 4EKYA 3SYMA 4G2VA 1JIXA 3UUXA 2BUGA 4BWRA 1P4JA 4PQGA 1FA9A 1L6IA 3RHZA 3AS8A 3SYRA 4M7PA 3MS2A 4KQMA 4YVQC 3MV2B 3C4QA 3MA5A 3CK8A 4AMBA 3HYMB 3S27A 5LCWC 3Q3IA 2QRGA 2QRHA 3MSCA 4HWGA 4WNDA 4GZ5A 1UZUA 4CTOA 3MTAA 1L5VA 3C4VA 4EKEA 3S7JA 2PRJA 4NRHB 2XCCA 1OUVA 4CTMA 5BW8C 3VDNB 4HORA 1Y8ZA 2IW1A 3ZFWA 3KS2A 2AVPA 3VTYA 4AY6A 1C8KA 3Q5MA 4GPBA 4HOTA 2FF5A 4JHRA 4W9RA 1UQTA 1Z6PA 2JJMA 5AYWD 3MBOA 3NB0A 4CTNA 1W3BA 5JTTA 3L7CA 2QLLA 1O6CA 3HBMA 2VYIA 2SKDA 2F3PA 2R5SA 2ATIA 1Y8MA 2IV3A 1JG7A 3Q3HA 1WV1A 3VUEA 2O6LA 3AS5A 4LDPA 1J39A 5TMBA 3OY7A 4MRAA 1YA0A 4RIIA 1GZ5A 2WTXA 4N3CA 2PRIA 5TMEA 1Z6QA 3ZPJA 2DBAA 4FKZA 3R9AB 2KCKA 1K08A 3E3NA 3BEEA 1JEJA 2X0EA 4GCOA 4N39A 3ZN3A 2X6QA 2PL2A 1Z8DA 5DXFA 3CVQA 1Z62A 3TSAA 4A1SA 5D0QD 3MQFA 3CEQA 3QKYA 1JG6A 5TMDA 2IEIA 3MRVA 1KTIA 4N3BA 4KXKB 2VSNA 3MRXA 3MRTA 3RSCA 1EXVA 2KCLA 3CEJA 1A17A 2IFUA 4O6FA 4HLNA 4G25A 2XCUA 4WADA 3OT5A 5FTPA 3D0QA 5FZRA 2JLBA 1IHGA 1NZFA 2ACWA 2FFRA 4GA0A 2AMVA 5G05C 3D1JA 1AHPA 2IV7A 1ELWA 2PYIA 5HI7A 5G04C 1WW2A 5A7DB 1WM5A 3CKCA 4RELA 2FI7A 4RIFA 4I1AA 1V4VA 3SZ7A 2XA2A 4J0UA 2VGXA 2G9VA 4J8DA 4MI6A 2R4UA 3CV0A 3BD6A 2IEGA 2LSVA 2YHCA 2V5FA 3Q4AB 4CGWA 2SKEA 2GW1A 2YJNA 2IF4A 2IYFA 2Y4TA 3ASGA 3GZ2A 2OFFA 1P2GA 3RO3A 2PQ6A 3MT8A 4HOUA 3S2UA 2C1ZA 3HBNA 1XOIA 4WNGA 1P5QA 3FROA 4G24A 1C8LA 1FU8A 1P4GA 2GPNA 2FF4A 3S0JA 3GPBA 1B89A 3LKUA 4CDRA 2GPBA 5ENZA 3QDNA 3CUTA 1GPAA 4BQIA 4F96A 3E3OA 3HBJA 5BT1A 1RZVA 3S7BA 3TGOA 2VCEA 4EJ2A 3VDMA 3CK7A 1VGVA 3G2NA 2QN8A 2XGOA 2NC9A 1WW3A 4U07A 2GEKA 2R68A 3G2HA 5TVGA 3TG4A 3CX4A 2C2LA 1RRVA 4JA9A 3ZCRA 4X7MA 4BQEA 1QKJA 3T7DA 3KD7A 2LSUA 4XI9A 1XNFA 4KBQA 3EBOA 3T5TA 1XKXA 3OKAA 3BD8A 3E3LA 3LYAA 3QWWA 5D01A 1P2BA 2H1HA 3QWVA 2QN1A 1NA0A 3ZHEA 3MTDA 3ZCPA 4RENA 2E2EA 4N2QA 4YVOA 2VCHA 2XA9A 4JL0A 3ESKA 3WADA 1NOJA 2PZIA 4I9CA 5I45A 3WC4A 1K06A 5A6CA 1JIVA 4Y6WA 5DBKA 3LY9A 2G9QA 1HXIA 3NAZA 3CVNA 4EL0A 2FEZA 5FZQA 2QNBA 5BNWA 1HZ4A 2BGTA 3CV3A 4I2WA 4MI9A 4YI5A 4BTAA 3QWPA 4G2TA 1FU4A 3OXFA 5KJNA 2XPIA 3LY7A 1NA3A 3ASHA 2AZDA 2F3QA 4ABNA 2WQHA 1L5QA 4H7XA 4BQFA 3N71A 3E4BA 3Q15A 3O3CA 1RZUA 4HOSA 1L7XA 4AY5A 3FP3A 3NCHA 1ZBPA 3CUVA 3CEMA 2XCIA 3AS4A 1GPBA 4XI0A 1C3JA 2GJ4A 2XGSA 2QRMA 2GPAA 1FU7A 2KS6A 4IN3B 2R66A 3AMVA 3BCUA 4MHSA 2J9QA 1P4HA 4F97A 4UQZA 1UQUA 3ZCTA 4N3AA 3SF4A 2OOEA 4AM9A 3NP9A 4KYOB 4X6LA 4Y6CA 3UPVA 2ACVA 2QRPA 1GFZA 5EX3A 1GG8A 2C4MA 4RG6A 4WNFA 3TG5A 2LNIA 5JJTA 3G2LA 2VGYA 3Q3EA 3BEOA 3U3WA 6GPBA 4M60A 3CVPA 3T3EA 2XEVA 2QN2A 1FC0A 4G26A 1P29A 2IYAA 2VSYA 4BTBA 2YQ8A 5C1DA 1F6DA 4LEIA 3MT9A 5IKOA 2PYDA 3O48A 3OTHA 2XMPA 5FJYA 1IXYA 1LWNA 1FTQA 2Y4UA 5M72A 4ME2A 3K9IA 4UI9J 5ARGA 3ULQA 3NC4A 1JIUA 2FO7A 4F3VA 4NESA 2QN3A 1ZU2A 3DZCA 3ZCVA 3MS7A 3QOUA 4I17A 4GZ6A 3PE3A 3G2KA 4B94A 1QQEA 1GPYA 2QLNA 2GT1A 3Q47B 2MHKA 3DD1A 3ZGQA 2BISA 2H1FA 4BT8A 3CUUA 3ASFA 1IYGA 4X7RA 4LEUA
chains in the Genus database with same CATH superfamily
4K9OA 2D7JA 2G04A 3HGMA 3RW9A 1JQJC 2R00C 9GPBA 4K6GA 3W8EA 1KC1A 2PJDA 2G9UA 4TRMA 1QGAA 2CC2A 1E98A 2R79A 2HX1A 2QUHA 2W2QA 1L5FA 2N42A 1SXPA 2HJ9A 1L5JA 2H8GA 1XZHA 2SCUA 3QGMA 4DCNA 2XEXA 3I1FA 1K7CA 2OLEA 2DQYA 3DOHA 2Q9UA 3SFTA 2WMNA 1FJGB 1SMKA 3TSZA 4PYIA 1C0EA 1HG1A 2GGSA 3OFVA 3RCBA 4D8VA 3RTBA 1JQ3A 4R3UC 3OXGA 2QI9F 4BETA 3H5WA 4N54A 3GK3A 3AI3A 4R05A 2KLBA 5EXTA 2PVPA 1UEXC 3TLXA 2XNHA 3RU0A 5CVCA 4WUYA 1BGWA 3HJBA 3AR6A 4FB4A 4TXHA 3TLAA 2C07A 1O3YA 3DBHB 3EQZA 1TYBE 1UANA 3VR5H 2G28A 4K6OA 1NMQA 3TAXA 1KI2A 1GGKA 4CW7A 5EIBE 1R6UA 2WZBA 5AM3A 3IQIX 5EEGA 3RVSA 3PA8A 4GMGA 4JXKA 2ZT6A 3AJ8A 5J59A 1TJCA 3FH8A 4M2LA 3IUYA 1MAHA 2PXHA 4JUFA 3VH3A 1XNGA 3B7UX 1XDWA 3T9AA 3WRYC 3IKTA 4RH0A 4J1SA 2I9PA 4DDUA 3LPDA 3NWJA 2H1CA 1LPNA 3ZDYB 2Z6UA 2Q9BA 4G5FA 1WKVA 4QGHA 4W5JA 5FQNA 3R40A 3SG0A 4U7FA 4J0DA 5I3CA 2LO6A 1UKYA 4ZT7A 1QF9A 4XXHA 1ZJWA 4U9IS 3Q3IA 4FFVA 3R1IA 3L0DA 1NU6A 3CINA 2QVZX 5K5EA 1Z5SC 3ZUGA 2GRMA 3N5CA 1ADCA 4C9BA 1O6CA 3TFOA 2LCFA 4IEIA 4DNFA 1IHYA 3SX0A 4RK1A 1H0HA 1FP1D 1TK2A 1L7OA 4D8XA 1FP6A 2EWVA 3GGCA 5HBGA 1L7RA 3BL6A 4TS1A 2C83A 4LXUA 4AQ7A 2AW6A 3W2EA 4IIGA 2HRCA 4XLZA 2GSDA 1XDUA 3MRXA 2VDNB 2KE5A 4HRNA 1OBFO 2PUFA 1ESDA 4RV9A 3PNBA 1BDBA 4I5FA 4KDCA 3DFMA 2VRWA 4EMSA 2YC4C 3FWPA 2D5IA 4JLMA 2NYRA 5C8YA 1NXVA 2AF3C 3HCAA 1CEEA 1YK0A 1XXHE 1TKCA 3ASGA 4DRXA 1NFRA 1GUYA 3LBFA 3HI4A 3ASVA 4BVFA 2CZQA 2WILA 1BFDA 1CIJA 2IYOA 1Q1QA 2C2WA 4V3BA 3SZ3A 1VFNA 4BO0A 2DIWA 5BRAA 1POXA 4ZV9A 4DBVO 2C2LA 1UBNA 3HDXA 2EJVA 2V5UA 4QNMA 3DZ8A 1KXJA 3U4QA 1IJBA 5F9HA 4IDCA 1NVGA 2FSIA 5FIOA 4D4JA 5HVNA 4DSTA 1VPVA 3TEFA 4GI5A 1LK5A 4DV5B 1PHRA 5FWXB 2CUTA 1HXIA 3TSOA 1A7JA 2Q2NA 1JHUA 1FDIA 4G2TA 5IP5A 5KYTA 1QYIA 3SZRA 1HPLA 3R7LA 1J09A 3PZ4A 3ZXIA 4LSGA 4CLOA 1H0RA 1PE0A 1CZOA 4RTLA 5DBFA 1T3HA 4JJIA 4J0QA 2CEKA 4YRQA 3N6XA 4YDOA 5B1DA 1S7CA 2P65A 2J3DA 1MEOA 3QXCA 5MN5A 3V79K 1XELA 1ADJA 3HSYA 3K0SA 3SLKA 4D97A 2E55A 4BMCA 1ISPA 4F60A 1EBBA 2CJWB 3FIJA 3H1AA 3FNHA 3B7TA 4J0IA 2XE6A 5LCXA 5IVDA 2Q3JA 2GWRA 1NPDA 3AGPA 3ACDA 5KNDD 1GADO 4I2ZA 1U0HC 3RHTA 1DRJA 1FMCA 2MSWA 3F9IA 4D96A 3UG6A 1E9EA 4U63A 1HYGA 1USVA 2F7SA 2P1DA 3OZRA 5ANRB 4P0QB 5A4JA 2GDJA 5CG2A 1XCMA 2NUPA 1CDZA 2NO4A 1NWHA 2UVQA 3JVVA 3LCAA 1PCXA 1NJFA 2X58A 4RLFA 3QU7A 4IMPA 5JY1A 1Y4DE 3RVDA 2XCBA 4UHCA 5CDUA 2RBGA 4KREA 1B6SA 1J25A 2ZANA 2ZSIA 2QZSA 2RBKA 4IHKA 4EABA 1PS8A 3ICPA 3L7JA 4HDMA 2ACKA 2RC6A 1TUBB 2EKBA 2IOFA 5F9MA 3SMVA 3A4IA 5BNZA 1BCSB 1G4HA 3KCQA 1V1RA 2HR2A 2WPDA 2F48A 3A9UA 4M49A 1JJVA 2WHPA 1M2KA 3M1YA 5C1BA 3RJ9A 1UBHS 1M5UA 3GFBA 1E0JA 2QW1A 4LQ4A 1IM5A 4TZ0A 4LWZA 1SBZA 3LC7O 4KSYA 4ZCMA 2I4TA 3PNTB 1BH6A 2WR8A 3V2GA 2A78A 4JLPA 4OGFA 2YS6A 2HQRA 1SU6A 5FEMA 4Y2TA 1ITZA 1MIOA 3BWEA 5JAHA 1XJWA 1P4RA 1L7BA 4M6WB 5DYNA 4PBRA 1YR3A 2Q1TA 4XSHA 4WKNA 3QHQA 4MPJA 1ZWLA 4BS9A 1KT0A 4PZYA 1Y6FA 4YIHA 4DMGA 5AHKA 3ENVA 3FTXA 4DJTA 4DB2A 1DRKA 3BTOA 2G40A 4TKVB 2R2LA 1W0CA 3A04A 3UXYA 3EUWA 1T8UA 5JZVA 4RTKA 5CLIA 4WRRA 2QE7A 2FAXA 5HTOA 2R6DA 4G4SP 4NFHA 4M1YA 3FUNA 3N7AA 1JPLA 2HPZA 2O1XA 4V0ME 2F62A 2H2AA 2QQ5A 3D2BA 1RXSA 3ZBTA 2VS1A 1KR2A 3BWVA 5BO5A 2Y1EA 1YA0A 3GRCA 4REQB 4NJMB 2CXTA 5EZSA 5KNHD 3ZN3A 4D9CA 3TSAA 1OAKA 4HP8A 1IOVA 4EG5A 3RSCA 4AKTA 3N6RA 3T3NA 3JQBA 2HIAA 5LQUA 1FPMA 1FSSA 3ZPXA 3IT0A 1OAOA 1Q0SA 5IH3A 4X3OA 1CEQA 3CV0A 2LSVA 4R9UC 4WK0B 4TUUA 2Q3MA 3JD4A 3JQPA 4JLAA 5A5GA 2ZCVA 2O50A 3UBMA 4Q15A 1DFIA 3N76A 4L5YA 1UJKA 4UDYX 4F96A 1JYEA 1Y1SA 3RTCA 4WOJA 4AG6A 5AVXA 1WD5A 3OAAD 3H2HA 5KWDA 2V96A 4Z7JA 3HFSA 1EAYA 4RMHA 3FHLA 2D1TA 5D01A 3A14A 1Q2UA 1V41E 2E5WA 3NDRA 4R2IA 3NBQA 3B5EA 1PGQA 3LSTA 5L6LB 4Y1RA 3VYRB 5GZ6A 1ZNZA 4KPUB 1N0UA 5KSPA 3VPAA 4V2UA 3EY4A 1KYIA 5BORA 4FR5A 5HDQA 3TKLA 2UYGA 3K09A 1L3IA 5I9SA 3NUQA 1RCUA 2J7PA 1WXDA 5EXDA 1JYSA 2MMCA 1BROA 1GPBA 3TWQA 4LX0A 3GDWA 3FMFA 4OP3A 1YDHA 2P9CA 2ARKA 3BIXA 3ORFA 4ZCPA 3THYB 3DOFA 3RAGA 3BEDA 4EB6A 1GGHA 4YCLA 3S7ZA 3Q3JB 3QB2A 5ALHA 1INLA 3OE4A 3L8HA 1L2TA 5CX4A 1BVYF 4N3GA 2I1JA 5DN6D 1YVEI 3FTFA 4FZJA 5BQOA 1R4NA 3V30A 1IYGA 4AX4A 4MWCA 1IY9A 5KYNA 1GTZA 4LYFA 3T1NA 2GJAA 2HBRA 1MO5A 5AXBA 1RWQA 2DMRA 3F49S 4S05A 4JJ6A 4BNDB 3C6BA 3CUWA 1SVUA 4EIWA 3OKCA 4F3CA 2PX3A 3A1FA 1PBNA 4J8EA 3MPOA 2Q4DA 2PWAA 4E1BA 1NBIA 2DF8A 2WFMA 2JW5A 5JNRA 3LTNC 3AU4A 3T7IA 4LE0A 4P7GA 4JJAA 4RKEA 4R1TA 4LQDA 2KX7A 2A5EA 3SC2A 3RG8A 3U2QA 4P7FA 2VKTA 3GRVA 5FZSA 5AM0A 1DDOA 4RIHA 1ZMXA 1K7EB 1XA0A 2WMYA 4XPIA 2VA8A 3JASB 1AMNA 4P33A 2LXLA 1A4IA 3PNLB 2F55A 2MINB 2ODPA 4PSDA 3MWEB 1E2BA 4DLNA 4PRZA 4UUNA 5LJIA 3QNKA 4YRNA 4FFNA 3SF8A 1EQAA 1W29A 4IY1A 1IEXA 4O5AA 3JQAD 3ZVNA 3U4GA 1E6WA 3SK0A 4EDHA 3FU6A 1PT8A 2X3FA 3N2NA 3G0OA 2VG8A 1I7PA 4CM9D 3OY2A 3WP1B 3SBDA 3PGVA 4DS3A 4GOOD 1FSZA 3LHIA 4JZYA 4QTZA 2W6NA 2ZUUA 2HYDA 1D7OA 2OORA 4Z1OA 5ICSA 3IBSA 5GP1A 4J6EA 2BONA 4JW1A 5DI9A 1Q1BA 1JJFA 1N2BA 4WI1A 2ECPA 2ZM5A 3IHLA 3MIZA 3HDVA 4NXNB 1XK6A 4BWRA 4O1OA 4B3FX 4JQYA 2W6ID 4Q9KA 5DBGA 5B64A 2IU6A 5JV5A 3WOVA 4QOGA 4N5LA 2DTEA 5JJCA 1M75A 4LJ6A 5LC1A 4RA9A 1XMIA 2NO1A 1PDWA 2R8PA 3E70C 4IO1A 2H08A 3MAAC 2EZ8A 1YHNA 3R9AB 1K3ZD 5B57C 3FHOA 5L3SA 5F7XA 4RMGA 1DRUA 4XOIA 2IFUA 2D5BA 4QXPA 1J2JA 1JECA 4QGGA 1T3SA 4K86A 1AF4A 4B6OA 4MQEB 2AC7A 2R4UA 1V6AA 3QU9A 3T61A 3TW4A 2CNWA 5CBKA 2ZJ6A 3RVQA 1SQ0A 4O0MA 1LC0A 4J49A 1WB5A 1UBFA 1DC6A 2IYWA 2IZ1A 4FW9A 4JN6B 2YJZA 5EINA 3G2NA 3K70D 1K88A 4PZ9A 5LLTA 2OHGA 1BCRB 1CERA 3NDPA 4KLNA 3I2FA 3IXMA 3LYAA 4BEWA 1QFJA 1PV4A 3URKA 1N52A 5H82A 2ZYVX 3DA8A 3ECCA 1S0PA 4DMRA 5B2ZA 2YXLA 3B1ZA 1J8MF 4J16A 3KKPA 5FQ4A 2BGWA 2ZROA 4DLQA 2XBUA 5LD2B 3GLGE 1G3UA 2ZE6A 3UH0A 1EWYA 4KFCA 3KV1A 4U5QA 3CLUC 3IHTA 2GCIA 5JCOC 4QJIA 5KUTA 5BXYA 1WXIA 4B47A 1CNEA 1M1NB 5DO9A 3KZMA 4PUCA 3HMKA 2BM0A 2DHEA 4TOIA 2XEDA 2Q4TA 5FQOA 1DHTA 3O03A 2QUZA 3I4RB 1U2PA 4ALIA 1B8UA 4MGYR 2I22A 2QZPA 1J8YF 3LIIA 1YOVB 3KNZA 2O8EB 4MQFB 3SBSA 1HBJA 5BWNA 1B7GO 5LVAA 4AJ9A 2WUWE 4LE1A 1P5JA 2REXB 1S2OA 2QR3A 2XNKA 4NABA 3LUPA 2GOYA 4JQZA 2LD4A 4RZUA 1MVNA 2RHMA 1XVLA 3G8BA 2DHCA 5F21A 1X1DA 3FM9A 4NYMR 2DUUA 3WLLA 4KJXA 1CXZA 2ZJYA 2DJIA 3AHFA 4PS1A 4MLPA 3P0RA 5C51B 3HEMA 4A36A 2QEQA 4LWPA 5LIRA 3R5TA 3DWIA 3H83A 1D8DA 4G37A 1JDUA 3G2WA 1TD9A 2JFFA 2P2GA 1Z6XA 1H9CA 3I4CA 1KZHA 1P2DA 4TYPA 4EHNA 3FUIA 1YI8A 1E3WA 2DHRA 3ILVA 1SUFA 4RXUA 1WG0A 4CIAA 4LNUA 4RTMA 3GGPA 1XMJA 3TPZA 1IG0A 1RACA 3T5PA 2JIBA 1DQSA 2V7BA 1YZLA 3Q1LA 1CRPA 4YNBA 1JFFA 3D9KA 2ZWAA 1H23A 3HXMA 1EK1A 2GXUA 1DSSG 1WHSB 3T3GA 3OLZA 3P9PA 1RPJA 2BGGA 2X1VA 3V34A 1GNQA 4HF7A 1C1XB 3JQ8A 2OCLA 3MJTA 3GH3A 4RIEA 1QVVA 1Y5LA 1OC4A 3QHAA 4OX9B 1IFXA 2FZWA 4G5SA 3HDTA 2Q2QA 3DXMG 5DRTA 2YZGA 1SUCA 1H6OA 3GUZA 4OUDA 3Q7QA 2V7VA 3IUSA 5GGXA 5LMNB 1P1FA 4D8WA 3AF5A 3HB4X 3LT0A 3PC6A 3P0JA 4WZAE 3ZZTA 4UREA 1FP7A 5LXTF 3MSCA 5ICCA 1NF3A 4B33A 3OQBA 4V0NA 1XZCA 3P2JA 4W9RA 3A6DA 3DAFA 4F5YA 4J7XA 2I76A 2VUSA 1GTMA 3RODA 4G2NA 3TLGA 3FNEA 4A8JA 1Z4QA 2ZXEA 4LYYA 3BX1A 5JNVA 4F45A 3B3AA 7REQB 2IOYA 3H2SA 5CW2A 3S40A 1CUJA 1BQ4A 4DLWA 4EVSA 1K5GA 2VH2A 2A9OA 3GI1A 5CFOA 1H65A 1N36B 4CWAA 2KCLA 3CEJA 1RHMA 2E6UX 1H6DA 3CLJA 1T5SA 1PQWA 2VTKA 4NV1A 2XVMA 3HO6A 3QPCA 4PFKA 3BWCA 5E9JA 1ZNYA 2WD8A 3FUDA 3ZWDA 3LAWA 2WSSA 3FRHA 2YINC 1NJ2A 1YT5A 3KFXA 5DMHA 1GPUA 3IAM1 2NIPA 3R4VA 4ANUA 5B3KA 3LUDA 2FR1A 2E85A 1CF4A 3N2KB 1Z0IA 4D9JA 5IN4A 3WV5A 1XRNA 3EBOA 1BD4A 1XKXA 1M1YB 3D3QA 3RUCA 1FPPA 5G2OA 5GWXA 1JEYB 2ZPUA 2Y9MB 4ZO9A 4HNRA 3ZKWB 2XEEA 2V65A 3WJ7A 2P6UA 1LX7A 2CFIA 1Z0AA 4CQLA 3HFRA 2PUTA 5CLGA 3JATA 3NCHA 2A33A 3P9SA 4YUXA 2R1TB 3EXG1 5E2IA 5LDHA 4NCIA 4ZTUB 2Q5IA 3CVJA 3EA4A 5EG5A 2CL6X 5IBCA 1ST2A 3OLXA 1P0MA 3S8MA 1XZDA 5JBIA 5KHLB 5LM3A 4E6PA 3LKZA 1Z7EA 2VP0A 3DVRX 1J8QA 3OTHA 4B3BA 2HOQA 2IEAA 3PUHA 1NWCA 1P8AA 4X8QA 3E5HA 3O74A 3Q79A 3SR0A 2H18A 5J5CA 1O1RA 5BSWA 1SPXA 1Z82A 2EU8A 2OZKA 5EWJB 3DF9A 2XZDA 3KT3A 4BT8A 2VT6A 5C52B 1XEWY 1A8SA 2Q5OA 2ZTMA 5AJLA 3IDOA 1KC3A 4B7ZA 3NT5A 2C04A 1YU9A 1DARA 3GFGA 2V45A 3UAVA 3BJRA 4LN1A 3V9PA 3JCKC 2J45A 4KVGA 1FUKA 3TYXA 2IYRA 1KZ9A 1VE7A 1NUHA 4LXQA 1B23P 1N5OX 2JEZA 2Q46A 3QXGA 2V7QD 1UC9A 1ZD4A 4MZXA 5LCWJ 4DUPA 4NX2A 3LCVB 2X0IA 2QRNA 1L5RA 1ZCJA 2Y05A 3PJFA 4AD8A 4RJIA 4ER7A 1QZXA 5GVSA 3AI7A 4RDCA 3THWA 3CNOA 4HQLA 1OFHA 4HBZA 4NBWA 1Y6IA 1J5XA 3RTDA 3PQ4A 6PFKA 3T5MA 4J3FA 1ZJ5A 4C7BA 4U3JB 5DNWA 4MBGA 2RIRA 4MR7A 3SJCA 1AQUA 3B7RL 3L0ZA 2FDCA 3NM4A 1I0LA 1EDBA 1T4CB 5AOXB 4F06A 1U0BB 1DTWB 3F7TA 4K6HA 4I1MA 2RK3A 3G0BA 4OVUA 1P74A 2BHSA 3MJHA 2A0UA 1B1CA 3CRNA 4NS1A 1P0CA 1Y7HA 3P2YA 2GM9A 2G7ZA 3I6YA 4XWKA 3O8CA 2W6MA 3K2BA 4EQFA 1OH6A 4Q94A 1O95A 3CSSA 5EE5B 3IKJA 1LSSA 1YCGA 2XMZA 2AC2A 4N9WA 1HZZC 3FTEA 3FDFA 4A2QA 1V16B 3AHGA 2RARA 5BR7A 4YH1A 2P9NG 3AL3A 5F4ZA 3PUZA 3QSGA 2FRDC 1TYCA 2JKYA 4NBVA 3VJMA 2C96A 4OATA 2W6JD 4J2TA 4B8WA 3BORA 1Z68A 1O87A 1R64A 4H27A 2JBHA 4R2MA 2IYZA 2XUHA 4U0KA 3L7NA 2EL7A 4C20A 2Q6KA 1T9DA 2R6AA 2IDMA 3M83A 4RPGA 2Q5QA 2RGNA 2B36A 5ALPA 3NXKA 1E1RD 3SHTA 5JSZA 3E4CA 4AUEA 3JVEA 3RANA 5AVWA 2ZIWB 1TKRA 2JAQA 1P44A 1HLGA 4C4AA 4P3KA 4Q1FA 1BE6A 4BIMA 4ZI2A 3ESBA 1RCFA 1A9RA 4LERA 2XPZA 2E48A 4MS1B 1RWVA 4BNZA 4KQ6A 1A7AA 4ANFA 4XYLA 2WG1A 2R84A 4B7XA 3GJ4A 1F1BA 2AD5A 3AFGA 2PL2A 4PX2A 2NV6A 2L19A 4K8OA 3G1WA 3TL3A 2BCJQ 3IT1A 1EXVA 3AG6A 2AW5A 1QH8B 2CL0X 4UHDA 4CEMA 4G01B 4IJMA 1O57A 2P0EA 3L41A 2XSZD 2YJNA 1GTSA 3ONLA 3RE1A 1KH3A 5F98A 3DHYA 4R6WA 1MZPA 2EIHA 3ZJ4A 1C1DB 2QM3A 3SQLA 1VPWA 1HFEL 1XYVA 4BP3A 3VNVA 1YONA 3I4LA 1HG5A 3CX4A 1IQPA 3QPVA 4UPVA 1NP3A 3IYLW 3ED1A 4AUMA 3DT6A 1WSAA 4I4NA 4X0EA 3COJA 3TLMA 5K6AC 4Q3AA 2NTNA 4HO1X 3NRBA 2AT1A 4JJ4A 2UZ4A 4XB2A 1MX1A 3DH0A 2FB9A 2Q3LA 4DL9A 4HX5A 2QY7A 4YUVA 2JATA 3EEOA 2GZDA 2WLSA 2WTMA 3QEOA 3EAFA 3SJAA 4CFZA 1GCIA 1VPTA 5BN5A 2OXTA 2FPGA 3SS8A 4ABNA 1NMZA 1E2EA 4Q39A 3HXLA 3T9CA 1URPA 3QPBA 5DN9A 3ACCA 4WH0A 1B26A 1COWD 3H5LA 2I0FA 4BVAA 1PEDA 2PGIA 1I1OA 2NSLA 1ATZA 3PHGA 3L82B 2RDMA 4RWEA 3KVVA 3VZPA 2GEVA 2HQBA 4ZVQA 3TG5A 3KO8A 4V02A 2ZJ5A 3H75A 4NE9A 3Q40A 1FC0A 2JCVA 1ZN9A 2ZRJA 2HRZA 5K8TA 4WWHA 1ZMBA 4OLAA 1QHSA 1D8EA 4DB4A 2W48A 1PEKE 4UNNA 5EE3A 3W05A 2GK4A 1MJHA 2QA5A 1TNZA 4OYRA 3ANYB 4OM8A 3B5JA 4Z9XA 2GYYA 3GZ4A 4HQ0A 5CLFA 3EIJA 3UMYA 4IUDS 5CX1B 3TMKA 4ARBA 1BWRA 4KO1S 3H0KA 2OWDA 2NYVA 1Q0LA 3TLKA 4ZP1A 4NL4H 2Q99A 4MQLA 1Z6AA 1KDTA 4EI9A 1Z39A 5EVJA 1WJGA 1QRRA 1BMFD 3P27A 2FPOA 2MOKA 1OAAA 1TK3A 3GLUA 3AAAC 1QJ4A 1XEXA 3E15A 2WWHA 3T9EA 1UXOA 3ZIUA 1RWKA 1QWSA 3IJEB 2C42A 3BH6A 1QBQA 1WXWA 4REOA 3R3ZA 1G98A 2FFHA 4OHXA 2XS8A 2PT5A 5DH9A 3EGWA 2GEJA 3CR3A 1ZINA 3ADOA 3AESA 4FE7A 4NEQA 1KT1A 1YI0A 4YP7A 3T8MA 5E4TA 3INYA 5THQA 1PVVA 4N5IX 2JA1A 3NP7A 3NTLA 2DUWA 1K8RA 4I9EA 1UOPA 2EFEB 3JQFC 1AKTA 2GQ0A 3PSHA 4Z0PA 3TMYA 1RAIA 5I48A 3TF5A 1ZSYA 3RT9A 3DMFA 4WCVA 3COVA 1VE6A 3R7FA 2L17A 1HQKA 1JR4A 5BSMA 3TWOA 5KYXB 2VJ8A 1Y3IA 1V95A 2ETAA 2ZP1A 2GHIA 2ZI3A 3PDWA 2JARA 4Q00A 4NZOA 5BV2P 4O4LB 3OQJA 3QVLA 3VDXA 5CCLA 4BLSA 2BGUA 2IWHA 5K8IA 3VNAA 1XCLA 1X8KA 4J9VA 1RAFA 2QJWA 5IULC 3KEZA 1NV9A 5ALJA 5DP2A 3T41A 3BXXA 2GLUA 4PGHA 1MJGM 4RTRA 1RAAA 1DIBA 3Q78A 3BH7A 1XG5A 3C7AA 3EZLA 4S0ZA 2PUCA 5E0OA 1TVMA 2GSWA 4L3VA 4MKGA 2F1HA 3NHJA 2DH6A 2W83A 1FYXA 2X76A 4EG4A 1R74A 2H1OA 3KPYA 4BN0A 1U1FA 3AL0C 2G5GX 2YWEA 3FXAA 2PRIA 3E9QA 3ZJVA 1FDOA 2ZSFA 2UZ3A 1J2UA 3QIVA 3UWPA 2DEUA 1V3UA 2WWYA 1CQXA 4ZARA 5LZ4A 1ZJ6A 1TA0A 2LW7A 4QBIA 4LXXA 4GO1A 2X1MA 5FBVB 4PWZA 3GJXC 1MRZA 1A9XB 1FNCA 4KFRA 3D4IA 3TTXA 1KWGA 2Q62A 4ETMA 3KYBA 3ORYA 1PFKA 3O1JC 2CD9A 1SY7A 5A5FA 5LMZA 2FSSA 1XRLA 4IJUA 3DB2A 1G4AE 3LC0A 5HR5A 4Q69A 2VYCA 1P3JA 1Y3HA 1B41A 4ZYXA 3AR4A 3N87A 3DR5A 3MTQA 5AJZA 2LUHA 1QANA 3PITA 3DT8A 2CK3A 1A9SA 4D3XA 3R0ZA 5CAEA 2H06A 4XDHA 4MQMA 1LPOA 2A0WA 2IHNA 4HOYA 3X2FA 2W58A 3R4CA 3KZKA 1CWUA 2GFQA 3SOZA 1UT8A 3FBWA 4B75A 2AS0A 3KSBC 2BY4A 4CU2A 2I54A 1HO3A 1W47A 3OHPA 2CT8A 5LP6C 4DX7D 1R6XA 3BMOB 4JLDA 4IRXA 1XU7A 4QJ4A 3W1WA 3HVIA 5CJPA 3O1LA 1SM4A 1YZNA 1FYWA 1X77A 1GOTA 3C3XA 5SZJA 2OCDA 2DLCX 3OTQA 1M6WA 1RYMA 2VGYA 4LY0A 3AEKB 2Z2KA 4X44A 1E1MA 1CB7A 4EPTA 2XT0A 1R4ZA 3FZQA 5JJ5A 1VYUA 3VSEA 5EILA 3RSOA 1RYDA 3OVMA 2RHBA 3FPJA 4K5AB 4TMWA 3G2KA 1Z5VA 3K73O 1AQLA 3PK0A 2NLOA 3CGGA 1JALA 5H4HA 5LOZA 3GMIA 3U3KA 1IOLA 1C4XA 3V8VA 3CF0A 5FKJA 5FLEX 1W4LA 3W3AH 1ATIA 4G1UC 3VPXA 1CUEA 3TK1A 1KEZA 5I7EA 2YYSA 5AQBA 1Y5RA 1TMOA 3DV9A 2HXYA 1T91A 2X4GA 2FDRA 4MSUA 1Z2CA 2JFVA 4PXSA 4NENA 4RKFA 1YMPA 5EKQD 5JNLA 3HU1A 3K70B 1EDDA 4RD0A 3HC7A 3OE5A 5TE9A 5FD8A 3GDGA 3V1LA 2QLBA 4ZAVA 4RK0A 3W5SA 4FADA 4U6NA 5DM60 4IIEA 3M5CA 3G9QA 5E0KB 4I08A 3PPWA 4A2WA 3U1VA 3EUEA 1EVKA 2B1IA 4CMAA 2OAGA 1ZVMA 1M5RA 3H42B 2CFRA 2EOAA 1P5HA 2HR1A 1CRZA 1R18A 4IINA 1KJIA 3U9TA 2WSLA 3GYGA 5DGHA 3H4TA 3AUAA 4UULA 2JAOA 3QLUA 1D2MA 2W2NA 2WMOB 4IDOA 5B3LA 2V4LA 4O4LF 1OWNA 3IODA 4ZHQA 1G38A 4FC6A 5KU7A 2P9LG 4LWOA 2WWTA 1Z17A 4LFCB 3HSKA 4R8LA 2Z2ZA 4QQ8A 5DV9A 3AWIA 2DBZA 2F8YA 2QTMA 2PV7A 4JD5A 3SD7A 1X8JA 3HB9A 1X8XA 4QUAA 2XMQA 2TSYB 3PFFA 3G0IA 4QPZA 4CIBA 1QHGA 3PQDA 1EK0A 3OM8A 3V2HA 1Y1KE 1FRFS 5C46F 2C88A 1NKTA 4KX3A 1FL9A 3OQIA 1NDUA 1LV7A 1VBMA 3USES 1E79A 3QSYA 3QU2A 1R27A 3T9DA 4RO0A 4IJ6A 4H4DA 2AHRA 3FUFA 4I50F 4NFYA 2PBRA 5JMTA 2O2IA 4LDPA 3KL4A 3FSRA 4QASA 3RV4A 3M6FA 1UJCA 3A32A 2X0EA 4KXKB 3MRTA 2HB6A 2WXRA 1XJCA 1YRBA 1HTBA 1UC4B 5JCXA 4BX3A 1T5OA 4NDNE 3BDIA 1YZTA 2Q9CA 1TZJA 2A6PA 4NZPA 3W5BA 1TT5A 3OSZA 1H1LA 4YP9A 1D6NA 3HFJA 3MT8A 1ULTA 2XMRA 4IKOA 4ZPJA 4U8YD 2HA0A 2HPVA 1C8LA 1BXRA 1FU8A 1H1DA 4FUTA 1HR0B 2AH5A 3QQPA 4UEQA 1IK4A 2JZNA 1I5RA 1ZK1A 2NC9A 3OCCA 3D9QX 1F14A 1NI3A 6CHYA 5T57A 5BSVA 1V7ZA 4PPFA 4ZZ2A 3PS6A 3FJOA 4JQSA 4IDFA 1UPXA 3HDJA 1TCUA 2BFCA 4KQFA 3FE2A 3ORRA 3D7SA 2OKGA 3M3PA 3ZTWA 1PQYA 2OE2A 1WUHS 1YQTA 2O48X 3UW1A 5J40A 2BFEA 3ONVA 1NQXA 3PE6A 5TV2A 2HHJA 2P2YA 2X8LA 1X80A 4B8ZA 3UOWA 3PDJA 4TUMA 1I4EB 4UJ5A 4PYNA 3JAWB 2XCLA 3CIOA 4LF7B 3ZNPA 2P6MA 3RC9A 1KERA 4NU6A 2QC9A 3QEJA 3B13A 4G9GA 1XTJA 4E70A 4K03A 2GBPA 4ARZB 1F0NA 2WFLB 2RG8A 3NOXA 2ZSKA 4L0QA 4YV2A 3PQFA 4H7EA 1O0CA 1Y4ZA 4ZVTA 5KPJA 1JLRA 2J87A 2IRWA 3MD9A 2LKDA 4HYTA 5TNXA 1U7XA 2MSNA 2O14A 2JK0A 3BHMA 2CW5A 2OGSA 2QNRA 4JKOA 2FRXA 4HADA 2CN1A 1MW9X 4OKNA 2WY2D 1P7CA 2XYPA 4KRXA 1Z8HA 1X38A 4HPXB 5JFGA 1WZ2A 2VPIA 2C20A 3ZLBA 1RQNA 4ZD6A 4TLMB 4GG1A 1NF2A 2IYTA 2B21A 1YUBA 3ANLA 5A1JA 4MQ4A 3S7FA 1Z5WA 2I8AA 5FPQA 4E03A 5LSAA 1Q1GA 3P0IA 4IOKA 2VHXA 4YN3A 3QMMA 1ZS9A 1EZZA 3S5JA 5IZ4A 3CHMA 4J0FA 4UU1A 1M2JA 1B8VA 2BC9A 3L6EA 4DTIA 5KNBA 4JC5A 2X1LA 1PG5A 5JPIA 1EBUA 1F5NA 1EFVA 4I81A 4CBVA 4F8JA 5D87A 1MQSA 1J9ZA 1QLHA 1JEOA 1JZQA 5FPKA 2B1JA 5GMOA 2EFHB 4QQFA 2ZRAA 2LRHA 5FP0A 1L4NA 5L8VA 5JJ7A 1R6BX 5D5QA 4KVOA 5LU9A 3N0VA 4GH5A 3T7RA 1KEUA 2XLBA 2A1TS 3R5FA 3NVKI 1JHDA 3OPYB 1DEHA 2OBXA 1PGJA 1GYQA 4RWZA 5FUXA 4E5SA 5J1TB 4W5HA 3QLTA 3ZNOA 1UXGA 1UDAA 3UT6A 4B44A 4G1TA 2P79A 3A9CA 3ZHEB 3FDHA 5CH8A 3CRRA 3B6JA 1P1KA 2CXNA 3UANA 2FNAA 1XMVA 4H17A 2P62A 1XCPA 3TL5A 1U3CA 1OVMA 3MUNA 3LTEA 5JMWA 1XWFA 4G5QA 3T7AA 5KWEA 3OICA 4GOND 2BT4A 3AP2A 2JJ1A 4I99A 4ND2A 1MUUA 2XB6A 5LBTA 2F3PA 1HDYA 4YYEA 5DW3A 1JEQB 1TQ8A 4MMZB 4E4YA 4K2HA 5FH9A 3AG5A 2WJ6A 1T13A 1G1MA 1G5RA 5JCZA 1Z8DA 2BMDA 4BUJA 2NTJA 4Q66C 1GRRA 1OB2A 1JDTA 4HD8A 2JLYA 3IALA 3KZCA 2E1RA 1AGNA 4HY3A 4TRRA 4HQOA 4HEA6 3WIDA 2HDHA 4YWHA 4JYCA 2J1LA 3UG7A 4ZQFA 2QU8A 1ODIA 2SKEA 1WOMA 1DWQA 1X7XB 2H2IA 3MJDA 2J0UB 1WPGA 3EA5A 4P58A 5ICMA 4DGQA 2OBFA 4GF5A 4YPFA 1N9GA 2KQUA 3GA5A 3HA5A 1SC6A 5IW8A 1IATA 2CFSA 3QWWA 4AP9A 3QWVA 1NA0A 2P0YA 4RVDA 3RVKA 4ZQHA 4LBZA 3O3NB 2O7QA 4JKYA 1U31A 1XNJA 2WVAA 3GP3A 3HRHA 1FLNA 3L9XA 1ZFNA 2XWSA 2J9FA 4I2WA 3OESA 1HQDA 1HRKA 1R0KA 3ADKA 5EHQA 3V7YA 1O6GA 4ML3A 1QBKC 2BSAA 5CBOA 2ZJFA 2ZS7A 1U3UA 3GNLA 4LY3A 2W43A 1V35A 4R8VA 3AM1A 1HFWA 3LPMA 3H9EO 4YQEA 3RK0A 4Q18A 5FR2A 2RJNA 3HE3A 1OH5A 2GEBA 1Q1NA 2CXUA 4BWFB 2W4QA 4UQLA 1ZHHA 5FJYA 3C3PA 3E9YA 4JHLA 4U6SA 4IVPA 2Z6QA 1GSHA 4YRGA 2VF5X 3L54A 3V3LA 1YUMA 3TVYA 2BISA 1ZJYA 3EF0A 1PAQA 2J3HA 4MUIA 1XWIA 1NXXA 3F73A 5H1YA 5I7WA 4AAYA 5HRAA 4Q7EA 2CLHB 3VTFA 2CLDX 1NR7A 3L8MA 3HQ4O 4KYTA 3VAAA 1G6Q1 3B9RA 2QB5A 3EIWA 2OSVA 1FT1A 4INJA 3ZQ4A 2D1YA 1CRLA 1XEWX 2FWNA 2AJAA 1E8ZA 1UJ2A 1NLFA 4RFLA 2QFCA 1XBTA 3R7NA 4BVJA 3R0XA 1YYHA 4GXQA 1HLFA 3NNSA 3BJMA 3AZQA 5DNAA 4RPKA 4L5BA 3RD5A 1KH1A 1WQ3A 5ANLA 5B1SA 1N5JA 2AOTB 1R0SA 1MENA 4FYYA 5HKAA 3U3ZA 3MYRA 1ZGCA 1AV6A 1LBQA 1OT8A 2AQHA 3PRHA 3RS9A 3I5YA 2WP8J 2WSIA 5FOTA 4DR6B 2CNBA 4MWTA 1IIRA 2P58C 2IBSA 5KJLA 4MS6A 5FFNA 5A3JA 3E48A 3BCRA 4YMUA 2PR2A 4HZUA 2JANA 4Y98A 3R3VA 3EHMA 4RTNA 2Z09A 4RJJA 4DLAA 2XIJA 3DVLA 4JNKA 1QR2A 4B2YA 2ZJ7A 1YL6A 2A8YA 1SQ6A 3Q7IA 3SBXA 4JLNA 3SXUB 3P2OA 1ILEA 4HXFB 1WSWA 4EW3A 3UOAB 5ED4A 3C3AA 3GA7A 4QLBA 1NXQA 1GPMA 1QCDA 2SKCA 3FFLA 3OZUA 2C7VA 3O91A 4UHBA 1O8BA 3OIFA 5CDFA 3V4RA 2FHPA 3ZE0B 5I4BA 3KCNA 2MSCB 4DAEA 1XGWA 3QEMA 4D4LA 4YROA 2VZLA 5A1TA 3FKQA 5HF8A 4HWGA 4M46A 1XXLA 3ZHBA 4DV4B 3LUGA 1DJQA 4WLNA 1QP4A 1SCUB 1KMHB 2O2SA 2EWMA 5ENNA 2M2IA 2QVLA 2I9KA 4DNXA 5FB3A 2EBFX 4HJRA 3SVTA 2QL7A 1B8OA 5CU7A 3RDPA 3KIPA 3C7KA 4UU0A 1XTRA 1JHYA 2RGYA 3S1LA 1Z62A 3RS3A 4N3BA 4R2HA 4Y1FA 2P6RA 4NF2A 3NHYA 4A23A 4ZWNA 4DLPA 2IEDA 1O08A 1PZXA 3A1EA 2A5JA 3ZIDA 1FCJA 1AGPA 4Y2QA 4BQNA 1PW5A 2IEGA 5DM0A 4N6NA 1ADBA 2AG1A 4LDRA 3E18A 2R44A 5ESRA 2EEZA 2Q1SA 3DTVB 5IPFA 1XA3A 4YASA 2M63A 2WNHA 1MZVA 5K0TA 3DQPA 1Z2EA 1P3DA 3QX9A 3ZY3A 2XEHA 3IOBA 3KKZA 3R0VA 2QTVA 3QWHA 2V03A 1P2UA 4ZCSA 1T8YA 5DK4A 3ANMA 1U11A 3DSUA 1TE2A 1P61B 1TZMA 3QKRA 1QTNA 4U2KA 3AVWA 3ELUA 8ABPA 4FOSA 4RHEA 2WTNA 3NM6B 3RRXA 4FA6A 4EF5A 2UV8A 3FBTA 1NP6A 2HNBA 2GARA 2QD4A 3U48A 2IEJA 5IXJA 3OMLA 2JLXA 2DP4E 4UYKA 1ZCAA 3KT8A 1MNQA 5KJFA 3DSWA 4D3DA 1X87A 4Y67A 4OHUA 3VBEA 1IJKA 3JQ1A 2QT1A 1YIAA 5B6JA 2HZ7A 5T3UA 1YB1A 4AM8A 3UMFA 1JHXA 4HVCA 4WFIA 3MGKA 4WZZA 2VGEA 4MW5A 3K96A 1IN6A 2HAEA 2Z6VA 4B0PA 1UBKS 4ME2A 1CRWG 3IMFA 1JCSA 3UXEA 2B37A 2AGVA 5THXA 4DCGA 3L17A 1GT6A 3QF7A 5EP2A 3I3NA 1AO3A 4IQFA 4P8RA 2JIZA 5GM1A 1A8PA 1WSBA 4OYLA 2CVZA 4IHJB 2XUAA 4W5TA 2PO7A 4R2LA 2LKCA 3COPA 4PPNA 5ALIA 1NNSA 2OBMA 2OENG 3HO1A 2QTWB 4PYRA 4U0SA 1JDNA 2EX0A 4HRYA 4MDYA 3K32A 4N40A 4EYQA 3D3WB 1D4ZA 3PLAE 1NM5A 1V6CA 3HP4A 1VDMA 4B83A 1R0ZA 4ERNA 4NBNA 1Y9ZA 4CKXA 7MHTA 5K2MA 3SS7X 3MB8A 1W48A 2XTJA 4XVCA 1V1JA 3FTPA 3D5TA 5KSYA 1DAHA 4CDGA 3TOCA 4BFSA 4BXOA 4S3MA 2FZ4A 4O4HA 2C58A 5KTNA 3MIIA 3PXDA 1LK0A 2WXQA 1O97D 2CNLA 3Q2KA 4L0DA 1ACJA 4O4JA 2G3YA 5FULA 1EGAA 4X8LA 1OCOE 5IVIA 4PBSA 4F4UA 2VSOA 4G36A 4JUCA 4NBKA 4NCBA 1ZGBA 2VNAA 1T36B 3VR3D 2KATA 1FTWA 1IEVA 1N1DA 3P9XA 2RCNA 4J2HA 2GESA 3EQ8A 4HYQA 4HZGA 3FTSA 2J5RA 2WZDA 2G0TA 1XTIA 1DEKA 3PWZA 2L82A 3LUJA 4GUDA 3F8TA 5TQJA 1YBVA 4EK9A 5AXAA 5FPSA 4Z5XA 4H7YA 4YRRA 1V1MA 4A0SA 4AZWA 1M8GA 3TH5A 3KQKA 2TS1A 3L7KA 4L6CA 3I9V6 5JXHA 1NDQA 1G18A 4QUGA 3W8RA 2ZIUB 2NACA 3UMSA 2DYRE 1X9IA 4I7EA 4KXWA 3I6ZA 4EPYA 5A4IS 3KXPA 1YI1A 1DUIA 1V48A 4YVQC 4HDQB 1Q0PA 2M1ZA 2W6ZA 1P2TA 1Q7CA 1RXCA 5I7OA 3P71T 4QBKA 4FHKA 4RTSA 2B4YA 3ZLJA 4AV7A 4HNHA 3U3OA 4B85A 3RS2A 3S2EA 1EUDA 2GZ1A 3W4IA 3HV2A 4JB3A 5F2EA 1W36D 1KNQA 1FP4B 1JAZA 3KUDA 3F5QA 3C70A 4LHSA 4GTSA 3CXRA 5E3IA 3P19A 4AS2A 4KEAA 4ZV4A 4M1KA 5JDIC 4Q3EA 1BC5A 4MR8A 4CMEA 4ZT5A 3DG9A 4NURA 2AYXA 1SUAA 3CS3A 3MAGA 1DJMA 1FRQA 3AM5A 3BGIA 4CGWA 2ZIXA 2QVBA 1F2DA 2CDNA 2MDTA 4WNGA 3DDOA 2EJTA 5BR8B 2C59A 4YO7A 4DPRA 1PY1A 3KTAA 3JPYA 4GMXA 1QV9A 3NIGB 1JG3A 4UMVA 3AVPA 3FMOB 5GJVC 5HCUA 3H9GA 4S1OA 4F72A 5EIXA 3BD8A 1SOMA 2TMDA 1SXJB 3LHFA 3PR2B 2ES4A 1U28A 4NATA 3WWEA 2ATCA 4X24A 3KE9A 1MDBA 4TTTS 3MHPA 3DZGA 3DOEA 5G55A 4BB6A 4G67A 4RPIA 3LQQA 5KJ6A 4IJ5A 4KPYA 4ZZ1A 3KT6A 3RUPA 3LM8A 4P0TA 2Y6VA 4S1VA 2B1GA 3OEHD 3IKVA 1ULBA 4HAZA 3G7UA 2ABWA 2O2EA 4R8SA 5CGQB 1NX6A 1X7WA 7ABPA 4R1LA 2Z08A 1SQSA 4M8IA 4HXGA 3G3EA 2A9QA 1NG1A 2HM7A 3CG4A 1MOQA 3PRJA 2O3JA 3VPFA 4U9HS 1PD1A 4M54A 3KYDA 4TTIA 2WK1A 3QVXA 3A4NA 4RKQA 4NHOA 1RWOA 1G8GA 5BR1A 5JSUA 2Y1LE 4RY9A 1JLKA 3BGDA 1VYHA 3OPNA 5J2UA 4ZO8A 2WUEA 3CUEF 1VXRA 3KQQA 2ALJA 1Z4NA 4BTEA 4UUOA 1TGVA 1VHLA 3D3EA 2A0YA 2AJBA 1OA1A 3ER6A 3AIOA 3OQPA 4DCSA 2X7JA 1FMTA 2EIXA 3UHAA 1TZBA 4LXHA 1U04A 2VHTA 3UKUG 4DV3B 1QIMA 3KDAA 4PZCA 3VR5A 1UOEA 4BB9A 4FLBA 2XE4A 1QGUA 1VJRA 3F3YA 4L2YA 3PTLA 1C7EA 2Y68A 4OLHA 1TLLA 4LHVA 1J8VA 3AP1A 5CM2Z 2WABA 2C2HA 2WP0A 3LJKA 1NRXA 5SZKB 1RADA 4B35A 1Z29A 4ZDJA 1IBKB 2H9AA 1VMAA 4O25A 4P3XA 3WS7A 5MN6A 4EQ6A 3PGA1 2OBYA 1XZPA 2O1EA 4WVFA 3DYVA 4RD1A 4GPD1 1A5ZA 4G0XA 3PH0C 4H08A 3DW3X 1E2FA 4GBGA 2I7VA 3L7BA 1ULSA 4QHYA 1OW3B 2CWDA 2KMLA 1DZ3A 3QEAZ 2FG5A 4WACA 1K2WA 4TMYA 3RO2A 1RFLA 4KACA 1NG9A 1KDYA 3ETLA 4HGQA 1UFVA 1GG2A 1QIJA 1XD2A 4WPGA 4AF6A 2B83A 3VSAA 3GBPA 1WPXA 4K9PA 5K45A 1ZH6A 3WK9A 4EHBA 4G0NA 2JG3A 3Q8WA 2IYUA 4J76A 1IDN1 3EGXA 1I80A 4P98A 4MLDA 4D79A 4ZQIA 3S2IA 2BUGA 4RA6A 1REQA 1KA9H 3PTAA 3CEAA 1YQQA 2OQ2A 3HJHA 4CZ2D 2GVNA 2ZVDA 2NU9B 1Y5MA 4YIKA 4X6XA 5H68A 4HORA 3TLEA 1ADYA 2DULA 4TMXA 3P7MA 1RZRD 3VQTA 3RAEC 1CY1A 4KE9A 5J9FA 1NR5A 3MM4A 2R8BA 4I4TA 2C4WA 2IIQA 3HR7A 1Q12A 5TMBA 1I6WA 4OB7A 4LOAA 2WD7B 3ZJUA 3QOFA 1SHZA 1JKXA 3M6LA 4DX2A 5AWFC 1KYYA 4LZZA 5J4KA 1XTPA 3DEAA 3ENWA 3PC4A 2HA7A 4H0FA 3AL2A 3H9UA 3O9MA 2WJPA 2IYEA 3V8PA 3I05A 1SA0A 3N3BC 4O2AA 4GL2A 3RREA 1DG3A 2PD4A 1KZPA 4N65A 4KR3A 4LSMA 4IJKA 2ZYGA 5SV2A 4P5DA 1S8AA 2IYLD 2OFFA 4JJ7A 4HAUA 5TRTA 2QSJA 1X1EA 3IPLA 2EHJA 3KLMX 3KM0A 5C3MA 3PWTA 4GPIB 5L9AA 1I0ZA 4UWLA 4IRUA 2WHEA 3FCSB 4MKFA 3B9PA 3V4ZA 1NONA 4YUYA 3DOJA 4YMGA 4L73A 4XGKA 3FNQA 4XEIG 3B38A 3ND8A 3JRXA 3WADA 2ZUTA 1NUQA 4FFDA 1FQJA 1V3VA 2QD5A 2AN5A 1NVXQ 3TJRA 1Q50A 1JS1X 2W2KA 4Z4GA 1QIKA 5AVVA 1ZHFA 2A1TR 2EQXA 4FMPA 4WQMA 2QSUA 1TEHA 4YAEA 4D2IA 1GL6A 1H6CA 1SXGA 5I5EA 4TLAA 3OZSA 3I64A 3L0CA 4B3JA 2IOHA 5IY5E 2JGIA 3SZGA 3TGLA 1D2CA 1E0SA 1OH7A 2HIGA 4YRAA 1T10A 2V9CA 3I4GA 2P9EA 5JI3E 4KN8A 4ZCQA 4L9AA 2ZATA 4GMKA 1B8NA 5A0VA 1N8NA 2Z3WA 1T5HX 1UBLS 3X44A 4ZMSA 2ZW9A 4FEYA 2OHFA 4R2WA 2QUKA 1KQFA 3D4LA 5EN4A 1CJTC 1M2VA 5B30A 4A26A 4NAHA 3KJQA 4KXLA 2YOFA 1DIGA 1MEEA 4HI0E 1SCNE 3GGDA 3SD5A 4J6IA 3ORHA 2HXSA 1BMQA 3ELYA 1PFVA 3I34X 3BUSA 5UKDA 1UOOA 4AKEA 3RYTC 1TECE 4I1YA 2KLHA 4NARA 2HO4A 1MFZA 5I9BA 2Q41A 3ESLA 3ONWA 4HAIA 1L8LA 2VPQA 4ZAYA 1OX5A 4MDFA 4XM0A 1CZHA 4E5KA 1NXOA 1B15A 4EO9A 3LVQE 4J8SA 5T3YA 2OV8A 5IG2A 3L1VA 2ZBQA 2FVXA 4HJXA 3IOYA 5JLAA 3R7DA 4N03A 2RD2A 3ZUVB 1OLOA 3AGQA 2ZR9A 4D0NA 1JAIA 4QDTA 3B48A 2WWGA 1ABEA 3Q2IA 1LBEA 4ZFNA 2QRUA 1BLXB 3WYEA 3B8EA 1E3MA 4X65B 1YGPA 5K0GA 4BO1A 3LQYA 3WLFA 3FLAA 3UJ7A 2OYSA 4R31A 3UAOA 4G0WA 4YONB 1W88A 3EFOA 4KQ1A 1ESEA 3BSYA 5CHEE 5F12A 4BMXA 1HXHA 2TMGA 4RU1A 4ND6A 5IF9A 3HLTA 5EKTA 4JLUA 2O54A 2G06A 4CL3A 2R5FA 1QAOA 1UMBA 4CKBB 4BP1A 4KMSA 3MJVA 4BEJA 1DXQA 4JHXA 1N0QA 2EWWA 4Q4AB 5D6NA 3B1XA 2GCOB 5FPYA 3Q3VA 2R8EA 4IMRA 1SCQA 2WTUA 2QRZA 2XOKA 5C5EA 1X74A 2NXWA 1QGDA 2NWQA 2DOKA 1KEEB 1E3IA 1EVZA 1ES9A 4PCAA 2MJLA 4RZIA 1T6ZA 3IE0A 4X1YA 3G68A 4OBXA 1ZGGA 1QIDA 1TU4A 1ZGJA 2D54A 4QBGB 2FRVA 1VECA 1TM1E 4R4JA 3CK8A 3FF4A 3EC1A 4KFTA 3U3JA 4A0HA 1DB3A 1ISMA 4DCJA 3K0AB 2GH1A 1Y8RB 4RY8A 1Z0UA 2GF2A 2F1IA 1MXHA 2V55B 1RM4A 2AUMA 3DNPA 2O6LA 4QUDA 2JCSA 1SHKA 4TSKA 3WTCA 4IVNA 3HPRA 2WMDA 3B95A 4QICA 5KHAA 1IN5A 1JEJA 5BNFA 1KFKB 4L2IA 3IQGX 3STTA 4GTPA 4I9UA 4CKWA 1HOXA 2O2XA 3AG4E 4PIVA 4Q1AA 1SN7A 3JQ9A 4UM9B 4L0CA 1I3MA 3ONEA 3G8CA 2CL5A 2IF0A 4YJFB 1TNDA 1HDIA 4J29A 5A3SA 3USCS 2GXSA 5G4KB 4YO8A 4OP1A 1H93A 1W5TA 4QOEA 3H6KA 2WJJA 1DGQA 3D8BA 5GZ3A 4HDRA 5KTSA 5AKLA 4KBQA 2CHXA 1VPDA 5EJAA 1ZH4A 5COQA 3V2OA 5FTMA 1ISFA 3U26A 3EZ6A 1CQWA 1SXIA 2XUIA 4PC1A 1TNUA 4TL8A 3LY9A 3CVNA 1EUZA 4CG1A 3TWRA 1IPHA 1X94A 3EDYA 3RSQA 1IXRC 1H85A 2YVQA 3E5RA 1C30B 3E32A 1KI3A 2AOVA 3N71A 5LA6B 3GNQA 1Y4SA 2WE8A 1LX6A 4W1RA 3A9SA 1ZC3A 4ENTA 2RAFA 5IT4A 2VJCA 3K0FB 4RPCA 4IPTA 2ONZA 1MV5A 1GTRA 3KXIA 2VZ8A 4ENSA 1EESA 3HB0A 4XX0B 3PXBA 2QN2A 2EFYA 3K8ZA 3ZYLA 5A05A 5HQ3A 1WXFA 2EG9A 4E2ZA 4R41A 4I9HA 4Y1EA 3Q9NC 2GAFA 1JIUA 4YECA 2R7MA 3DTVD 4RGQA 4G1BA 3WG9A 4UWHA 1LI4A 1UFOA 1BZYA 3UM1A 1SK8A 3FG9A 4XWAA 2D2XA 3LX4A 2O8VA 1D4FA 4FI3C 5KSZA 4LFBB 3JAKB 1HM5A 1U8ZA 1D3AA 3TLYA 2WWIA 3K05A 3M0EA 3HKCB 2BTOA 3BXZA 3N2ZB 2GJ9A 1A8UA 1AGYA 2ZTHA 2L0XA 3PPIA 2QQGA 2PQRA 1ND5A 4M89A 2ILTA 1H2BA 3G0HA 2B69A 2BL4A 4HEQA 5A9SA 2EP5A 1YZQA 1AT1A 2WZQA 3HBFA 2W6QA 3V7WA 5GONA 3SLRA 3HJUA 3NEPX 3GQBA 1EYZA 1ZR2A 2P9KG 4XTCS 3ONDA 5AW9A 2Z9CA 4AMUA 3W6UA 2J59A 2FQYA 2ODTX 4J0GA 2XCSB 3A1TA 1DKQA 1V5EA 4TS4A 4DA8A 4YBRA 1TEZA 2V0GA 3Q7FA 3VNQA 3FKSA 3AHEA 3QPAA 1HQYE 2ZITA 4CMHA 1I2ZA 4DMLA 2VDWA 5ENOD 2QORA 2O2ZA 4HS2A 4RETA 2HSDA 3EASA 4GGOA 1G8JA 4L8FA 1NRJB 4CMIA 2YYAA 3IEIA 4ZVSA 2VK8A 5SYAA 3WAGA 3HUTA 3MCAA 3MILA 3SO8A 3OPVA 4ON9A 2QPTA 2XPYA 3U19A 2O59A 4M9ZA 1OLSB 4JWTA 2WFAA 2FN8A 1CS0A 3ZBUA 4E5NA 1XFDA 4QUEA 2BDEA 4RS4A 5JASA 3L8DA 4L07A 2QAIA 2R85A 3WLQA 1KY5A 4F8EA 2VF4X 2P40A 1HORA 4C7OA 6NULA 3EDRA 4GYYA 1J00A 4OAPA 3IJ5A 1VL1A 3BFKA 2ZI7A 3MA5A 2WKPA 1YZVA 3FFBA 1G6OA 2A9PA 1ZMRA 1CEYA 2DC1A 3WB1A 2PSEA 3SQXA 3FYCA 1AKWA 1T4BA 5CCEA 1XMSA 4BX9A 4BSZB 3AF6A 2AWNA 3CNBA 2XTMA 13PKA 4YUZA 3T1YB 2OG1A 1U4SA 5KOJB 3Q15C 2L0IA 1XB2A 4A7PA 5B37A 3BKXA 4B3XA 5JR3A 1TCBA 3PRKE 2DHQA 2CFTA 2QXUA 3T5GA 2QL5A 2B1RA 1TA4A 4L9SA 2AG5A 4L4YA 3QVGB 1KXZA 4ZI3A 3G5UA 1H2AS 4UCQA 3PP8A 3ZE8A 3GN2A 4DWWA 4RJ2A 3PC7A 3VRHA 2FI7A 4N47A 4DX5D 5ILOA 2G72A 3GMDA 4GKBA 3GRRA 1EXDA 3DMTC 3RJ5A 4B6RA 5T5QA 4GSLA 2ZAOA 1CIVA 4OBBA 2O3RA 4BQIA 1Y9JA 2JLCA 4E21A 4LSZA 3WBFA 5EAIA 4ALJA 1HKHA 2Q7XA 1TTTA 1ML4A 4WOBA 1QGED 2BJWA 2NSJA 3O4HA 2QM7A 4BJHB 4KN9S 1QOPB 4LCTA 2A9FA 4QLAA 3SYKA 2OA0A 2QQEA 4GAEA 3TL2A 3W9UA 3VVBA 1XQWA 2Z1MA 2P2ZA 3CLTC 1AXGA 3B3GA 1QPGA 1EG2A 4XUCA 4CEHA 4MB0A 1V0JA 1K8YB 3VYWA 2DECA 1RQRA 1XZLA 3IAS6 5ALUA 1JH9A 3NHZA 3WB0A 3G9ZA 4QG3A 4F6RA 4L23A 1SUDA 2YQZA 3VU9A 2WU8A 1P72A 1C3VA 4YQFA 4DLTA 5HFNA 3FTNA 3WIBA 4B71A 3T1HB 3RGGA 1CW2B 5JWHA 1ZZGA 4BTBA 4KBGA 3GLIB 1FTQA 3NU1A 1HKUA 2O8DA 4KCGA 1W36B 3M4XA 3P2BA 1OBOA 3UATA 2RG1A 1SKAA 2VBGA 4EKDA 2VN8A 3U4DA 3FULA 1SXJD 3AJDA 4FYPA 4MO2A 3T0FA 2XUPA 3WNQA 4OJQA 5ALZA 3L5OA 1U65A 1X3LA 4HUQA 3CWQA 4BATA 3TKAA 4WCFA 2GCGA 4M1WA 3ZU2A 1B6GA 3VUFA 1E4OA 3M4JA 5E4YA 3SEZA 3EF1A 4RYLA 1JXQA 4MVJP 3PREA 3PF8A 4IIBA 3UIOC 2C7BA 1GGFA 4REMA 1SXHA 1LS1A 2HPHA 4MV3A 4Z9BA 4J07A 3FD8A 2O5VA 1T2EA 4D8TA 2X0FA 2V3VA 1QB8A 2ZRIA 4NYMQ 2BZSA 1YQDA 2QJTA 2N1BA 2QTLA 3AQ4A 2OM6A 1Y8QA 7GPBA 4YT5A 1U02A 4K1XA 1VDZA 2X42A 4Q37A 3ZWVA 1MTOA 3D7LA 3NBKA 4UI9K 3H04A 2ZR7A 3DVQX 4JBNA 3LRTA 2PUEA 1RZ3A 1M6VB 4D0SA 3TLZA 1OT5A 4M83A 1M10A 4MQBA 4WY2A 4MS3B 3WMGA 3KUCA 1JMKC 4P4SB 3PQ3A 3LQ4A 1DHRA 4IJQA 4OHZA 3RQIA 2GPYA 1WDWB 1V37A 5C4MA 3QKWA 4URVR 3AXSA 1XP8A 4FDVA 4G8BA 4OQDA 4HDSB 1J7KA 3AJ9A 4WVLA 4LYHA 4YGYA 2BPOA 3TQRA 4CM7A 3O8RA 1HQCA 3FTCA 5EHZA 2A1UA 1L3BA 4QQKA 4JMLA 1Y89A 3EHDA 2QBYA 1YB4A 2KBFA 3AEQA 1KPHA 4H1VA 3G6WA 4WE3A 4E4TA 4WDQA 1PEAA 2QRHA 2PX6A 3K0CA 4CR8A 1QMPA 3Q85A 1WXHA 1HNXB 4NQRA 1XLTC 2AVPA 4PAMA 3GVIA 3FOEC 3URMA 4HOTA 2NSHA 2ILVA 4XYGA 4C9BB 1F48A 2C9YA 4ONEA 1E63A 2UUPA 4O5OA 5IFKA 4GLOA 1NYLA 4RZXA 1KBOA 3HNOA 5BWOA 3VR1A 1T2FA 3F5MA 5CB0A 3A2LA 1CJSA 3EXAA 3M3HA 3IOMA 2QZ4A 2GGFA 1E7RA 3H11A 1M34B 1G9TA 3U49A 1CKEA 1ZR4A 5CXSA 2VF2A 2H4XA 1XZQA 5ALLA 5H7XA 5ESDA 3TRIA 3EMDA 3QM1A 1ZW1A 1SBIA 3C24A 1CU1A 4RFSA 3UJ9A 2PKQP 4YJGA 2A90A 5A6SA 1Y48E 3BMCB 3C6YA 2VCYA 3G0CA 5C3UA 3GRPA 2V5QC 2ORIA 2BEDA 1G8PA 1YF3A 4KYUA 4ARCA 4I0WB 2HCJB 4RH1A 3WQQA 4RSHA 4LTDA 1C81A 3ZDBA 2ZSDA 4GS5A 1XNFA 1TQ6A 5FA5A 2Z43A 3U4QB 3OCVA 2XWBF 4NNPA 4HATA 2QN1A 3ELDA 3EBLA 4CT0A 2I99A 4DUYB 3DZIA 4D8UA 4JI7B 1Y81A 4FJ2A 3HCDA 3ZDFA 4Y2PA 3RS8A 2H7CA 4IIFA 3REQA 3FHJA 2XV1A 1LNZA 4U2CA 4GI1A 4EY5A 1NXPA 3I28A 1ONOA 3LLCA 2X9GA 4OGLA 3OE7D 5CHYA 3ZYZA 1S2IA 5LB4A 4PSAA 1S8NA 1SCKA 3PNOA 2VJQA 3CUVA 1EUCA 4IN3B 3HR4A 5BSGA 2BSQA 1ZD3A 3QW4B 4AJEA 1CNMA 1Z4IA 1NJ8A 2I55A 4DWVA 5IK2D 5JSQA 3NASA 3DTTA 1RE1A 2Z4RA 3PS9A 4NFLA 2I65A 5ICEA 4C0LA 3RVPA 2QV7A 3WIUA 3RYIB 5I9NA 2QN3A 3C98A 2CCGA 4E5PA 1JB9A 3BE5A 2G17A 1N6RA 2QLNA 3L7YA 2P9PG 2CV2A 4FQ7A 2CSXA 5ICFA 4YRKA 2GI4A 2YOHA 4YYZA 1QUFA 1K5PA 4LOIA 4D9BA 4DT1A 1HE3A 1XCGB 5GIOE 1YZYA 2ZJOA 4ROSA 2EJBA 5CPBA 1HL7A 4GA1A 4RCVA 2YIJA 1C7RA 1G0OA 3UUFA 3L7OA 4OUKX 3PFHA 3MJFA 4CQNA 1I8TA 5IJWA 3OX4A 4TV9A 2JJ2D 2CWWA 4GI3A 1SEPA 3ZHCA 1Q1EA 3IXLA 1Z7BA 1M54A 4NBLA 1B0AA 3R5XA 2CMGA 1G2PA 1QE3A 2GDZA 3ULYA 4N7BA 2OD7A 2GJKA 2DH5A 3BPSA 3QNMA 1V8FA 5KBYA 3L0IB 1F20A 1SCIA 1QYMA 2FBNA 2XNDD 4AJHA 2R1ZA 1V1RB 1YE8A 3SHFA 5I01A 4Y6GB 2Y0CA 4DV0B 3PYLA 1HFKA 1KY3A 4NNJA 3Q8MA 4RTJA 4OK5A 1QG6A 4Q12A 4HNSA 5DWVA 3OM0A 1G2IA 3HCRA 4I5GA 1QPZA 3FNRA 1A5AB 3FNBA 3TRKA 4RTPA 1W0KA 2CY0A 1RLMA 2CV0A 1VCMA 4L8VA 5BQPA 2H48A 5A6VA 4ZJPA 1MIOB 2CHEA 4DLOA 3AKZA 1J5PA 1T8WA 1W9HA 2OGWA 3WNDA 1IXKA 2IKQA 4QXAA 1W7AA 2CB0A 1HDRA 2H92A 3GLHB 3OT1A 3NI2A 2JHGA 1WUYA 4TXLA 5C80A 3ERCA 4OGKA 3UJ8A 5J5AA 3FPBA 1PFYA 3G2JA 1KIMA 2C7GA 4GP9A 5LBUA 1U9IC 4P4GA 2L2QA 3Q9UA 2JIOA 2C5FA 4EHAA 2ZRBA 3E5MA 2Z5LA 2Y3AA 1U2DA 2WSYB 1DWOA 3F6QA 2UVPB 3QTTA 4R1UA 5J47A 3ZFWA 3Q5MA 4E31A 2P9YA 1QZ3A 4IV5A 4HB4A 2A14A 1U8CB 2V6FA 3LH5A 4P32A 1FVFA 1WV1A 3JZAA 1PT7A 1Q7EA 4E13A 3I5AA 2O1WA 4MRAA 4XD2A 1T15A 2IUUA 3GOQA 2QZ9A 1VYTA 1DBSA 3E3NA 4B82A 1U2GA 1YRHA 1N6KA 4IZOA 2SHKA 3R9XA 3GGGA 4LGCA 3TX6A 5LUBA 2YIMA 1JHVA 4Z8XA 5IC5A 4U7DA 2QTFA 2GRJA 5ALVA 4L95C 2P4QA 2EKZA 1XYGA 4I5EA 5JDCC 3B12A 4RESA 3PICA 1Q19A 2IBMA 1JHAA 3CO0S 3S2UA 2IC5A 2WJYA 2YJ3A 1XRRA 3V1KA 1RYEA 4FZ3A 1KI4A 3E9EA 1UJ5A 3Q5DA 5CB6A 3NYQA 3UWDA 3OKAA 2ZISA 2I6GA 5EJIA 2DWPA 5GQSA 2IFTA 4UMDA 4Y1RB 2WTBA 4ZAZA 5FOQA 1P75A 2VH1A 3FKJA 1PS9A 3AX6A 2VQEB 1WMAA 1I4OA 2GERA 2PMCA 1D4AA 2GA9A 3I30X 3OBBA 3ZWPA 2PGNA 2QTGA 3M4YA 2IODA 4HH1A 2NOAA 2QRMA 5D2MC 1NBME 2HXGA 1USIA 3LP6A 5AQ7A 4XM1A 4GNKA 4UM9D 1E9FA 1FFXA 3CVOA 4HAXA 5FUQA 4OL0A 2JGMA 3NNDA 2NM0A 5G53C 1USWA 3VCXA 2JAUA 1GU0A 3M70A 3OHSX 3A1UA 3GGSA 2LBPA 2ZRDA 2IZ6A 2FU5C 2EBUA 5WRFA 5EPUA 3MC1A 1JKJA 2O5RA 3LQ1A 4Z7NB 1A4RA 1DPGA 4X1KA 3LXXA 2AZXA 4B87A 4WECA 3DJYA 2INGX 3ZYCA 5FWYA 1EI9A 4JOSA 5CFPA 1ZCZA 2BEUB 2JGJA 3Q5GA 4O33A 2W6PA 2XQGA 3MLAA 1OX4A 2FEMA 5I47A 4WWOA 4URKA 3WGHA 2C2YA 4EZJA 3G5AA 1N5MA 1OILA 2R7NA 2HA2A 2OB2A 3MSXA 4G5XA 1NGSA 2VO1A 3OKPA 4M22A 2RFMA 4YR7A 3SY8A 3NR2A 3RAJA 4M0EA 3H1EA 1T43A 4WFQA 1YL7A 3TZEA 4K2AA 2PH5A 3ELWA 3MPUA 2KHZA 3G2MA 3P2KA 3VU3A 4S0XA 3TCNA 4X90A 4A6EA 1J06A 2E7ZA 1U2RA 1AHNA 1LQ2A 4F53A 4KG7A 1OU4A 2ZTUA 4OJNA 2OB1A 3ZDXB 3AI1A 1U7HA 1DKMA 1MQAA 3PXCX 5L53A 3LPCA 3QWIA 5BV0A 4FILA 4CPDA 1KAEA 1X7YB 1EP3B 4YJHA 3OURA 2W6CX 4IIVA 2RB4A 1TAQA 3UV7A 2A0FA 4PS0A 2FJEB 4LYJA 2Y92A 2OT3B 3I9MA 3QFFA 1WDMA 1BW9B 3ZVLA 3N2IA 2YHEA 4IAOA 2AR9A 2JI4A 4TTSA 3JYOA 1UODA 2ETXA 3BMQA 1OPRA 1JTEA 3Q0IA 4L9PA 4ZZ0A 3U6BA 3K1TA 2VSXA 1Y33E 3U61B 5E9WA 2IU0A 1WZEA 5REQA 4EO4A 2H6HA 2WYUA 4BL5A 2ZYHA 4A6PA 4Y2XA 4F9TA 2VQ6A 3L7CA 3DV0A 4CF4A 4N0DA 5FL3A 3WGGA 4W63A 3RSGA 1RAEA 4BEBA 1TEVA 4F92B 2C92A 3WHIA 4IULA 1ORRA 4D74A 1NNUA 1MZCA 5B53A 5EJFA 2X6TA 2I7CA 3WYFA 4D3FA 2WIKA 3DVAA 3WGQA 2WAAA 5L3SB 2IOSA 4N7MA 5L3QB 2VNKA 3FGOA 4Y1GA 2ZR8A 2QIPA 4JEHA 3VOSA 3G79A 3D1JA 3EZ9A 1O94D 2AYZA 2AD1A 2FK8A 5FNZA 3D4BA 1EQ2A 4BFZA 4MIOA 2XZOA 4D57A 4CJXA 3EVCA 3PJGA 3FSGD 2AFVA 4C04A 2I6FA 3M8KA 1GPAA 2RHGB 1T2DA 1RZVA 3D9IA 3GLQA 3I53A 2EJUA 1LLDA 5HA5A 1OXTA 1DX4A 2WPNA 1UT6A 4LJLA 5LZ8A 1JDSA 1NFQA 4DLBA 3V4PB 4XDGA 4ZODA 3QW2A 3FBGA 3LUFA 1JI0A 3ESKA 1OXMA 4NBSA 3L46A 1OI3A 2QAGB 4B2IA 4N5DA 3UWKA 4LK2A 2BGKA 1PWEA 5DBKA 3KHKA 2QDKA 1THZA 3CZRA 3EZNA 3PNQA 4RNCA 4MCIA 1IB6A 3TQOA 1A72A 1ECGA 5DCLA 1GILA 2C54A 3H5AA 1ST3A 3L8CA 2R02A 4OHYA 4DKJA 2I66A 3KHTA 1I2BA 5EZYA 2ATXA 3W3AA 3DHEA 4ZOBA 4XD7D 4UBLA 1P8JA 3FYUA 1WCYA 5IAKA 4CMGA 1EE9A 1WRBA 4BNNA 1DCKA 3X2QE 4NOJA 1KDRA 1G63A 3IP8A 1SVLA 4LGYA 3DEPA 1ZISA 3WLOA 3JD3A 1I7DA 2YV1A 3N0RA 3G49A 3OOWA 1B6RA 1L5OA 1EF1C 3L8EA 1RQLA 3IBCA 4GLFA 1CY4A 5IAGA 2LGJA 1L5MA 1Z47A 4ICIA 2B8TA 3U39A 1AUQA 4FGJA 4I1OA 4FHGA 4MVJD 2C1XA 3GZNB 2O2YA 1I2DA 1F06A 4CMJA 3O8OA 3TCXB 3HVJA 2ZXUA 5DJ5A 3L22A 4JLKA 3P2IA 3HWSA 1FX0A 1V5WA 1HLDA 3JQQA 1XO1A 2W42A 4ZVRA 1CY0A 1YVUA 3OOJA 4K5CA 1JWBB 4L85A 1E3WB 5KDDA 3WG7E 1J90A 5A7GA 3ZV4A 5KNGA 2D5AA 1ZESA 3C3KA 2B2CA 4ID3A 1WV0A 2NZVG 1T0HB 5JD4A 4F6LA 3E82A 1T8TA 2BHTA 4MAFA 5C18A 1W49A 2D1QA 1GG9A 1GU7A 1GVNB 5JJIA 4E1AA 3TSCA 1Y63A 1XZIA 4MPTA 2VSFA 2I1VB 2JVIA 4PTZA 1NQUA 3NJRA 5K4GA 2OQIA 1ZM4A 3FJYA 1S4QA 2HY7A 2CKDA 1MJ0A 1THMA 2QN9A 1FFAA 1BH2A 4WUTA 4FBGA 4UHFA 1SZCA 3LYUA 3KEAA 5NULA 4F12A 5LPNA 3V55A 3AT1A 4ESOA 5K0LA 3HG0D 3I01M 4IX1A 2MTBA 3MMXA 4GE0A 4YGXB 4OYSA 1W5SA 3K5PA 1TFRA 2AJLI 4MQ6A 4OUDB 1OVGA 2JK1A 4XKCA 4GTRA 2HKIA 2EF1A 3BJEA 1V55E 2HLHA 1A50B 2Y1CA 4LI3X 2R6CA 3KB8A 2XVYA 5KEIA 1XHFA 3TIXB 2OCPA 5CH3A 1LPPA 2H1LA 1Y8ZA 4EFKA 4E12A 2O8FA 2YXEA 2GFIA 4A8JB 2AN1A 2W98A 1R5NA 3IRVA 1RI4A 3M82A 3EFHA 1LF0A 5IAEA 3VGJA 2PUVA 1VB3A 1Z5PA 1ZC4A 3LA8A 4YALA 3QKYA 2BTQB 3ZGOA 2WSBA 2JBAA 2OK7A 2Q3DA 4UBKA 3QPDA 4IHJF 3CPHA 2RGWA 1JLLA 4RGVA 1R6DA 1E94E 2X41A 3B52X 4JIMA 1ZKMA 3VR4H 4C08A 4US0R 1XLVA 4B4UA 3DBLB 1K63A 3AU9A 4G24A 4OHVA 4KLZA 2H2FA 3TN7A 4F3RA 3K71B 1EK2A 4P93A 1V25A 4Y6PA 4QGAA 3SI5A 1G7CA 4MH0R 4RDIA 2FMIA 3T7DA 2ZUFA 3QOWA 3U9SA 2C7PA 5HTKA 4Q1CA 1V6SA 4X9XA 4WOCA 3I1JA 2JGLA 3KRTA 1CUHA 2ZQ5A 4URFA 3OQ6A 1YVPA 1QHHA 4PWYA 3DLPX 3QWPA 1P7ZA 4EPWA 3NOGD 1F3OA 4I8DA 1L9KA 2FG7C 4EPZA 4AJ1A 3THSA 1QONA 3WE7A 1Q92A 2ZUWA 2YHSA 5B7NA 1YA8A 1Q0RA 1PZMA 1Y4UA 3OEYA 2IONA 4EDFA 3BHNA 3AR5A 4UVHA 1I3KA 1VA5A 2K6GA 3ZK9A 4HR7A 2Y0PA 2I67A 3Q10A 2JDID 3RNOA 5J2TA 1ZQ9A 1F6DA 4YRIA 1FYEA 4OKIA 3MYVA 4GMDA 3OZVA 2XRFA 3EVZA 4TXQA 4G8LA 5KDOA 3EZXA 2VBIA 3A2NA 1Y42X 2GS9A 2IY0C 1EWKA 3TDNA 3UTCA 5TIIA 4RAOA 4BO4A 4KXMA 3K94A 4NNOA 4R54A 4NY1A 4EECA 1DC4A 4K6MA 2E4WA 3G2IA 1VMEA 1QGZA 2LPMA 4C4XA 4FUQA 3FDXA 4LZOA 4HG2A 1FVHA 1MN6A 3G2PA 4D9EA 3KLPX 3LF2A 1W59A 1JQDA 1FFGA 1ZRNA 2H57A 5G4LA 5K0ZA 3PX3A 3NYWA 1O7JA 3IA7A 3L7AA 4WLUA 3UO8B 4Q4LA 3IVCA 4P54A 1W46A 1J2EA 4EB3A 1K6IA 4EGQA 4G8DA 1ODCA 3QYFA 3LNCA 1RWWA 3WK8A 4JBXA 4PCUA 4Y6RA 3CVLA 2RJ3A 3FGNA 4M87A 1SXQA 5JCJD 1G8SA 2PLNA 2DPHA 4PAQA 3U5ZB 3A6HA 3AF3A 3F7MA 1B42A 4JYPA 4ETWA 3IBGA 4LBVA 2ZSUA 5KTTA 4U7GA 2AJDA 3MHTA 3AJRA 3JD0A 2VKQA 1BHO1 3O47A 3KT0A 3LQ2A 2FI1A 2RHJA 3T6KA 3KSDO 3SBTB 1FXWF 1NIPA 1ZD1A 4YRCA 4IIJA 1DQRA 4GM0A 2QTBA 4C6HA 4QD3A 4Q7MB 3GUHA 3C7TA 2Q6VA 3RUEA 3MJRA 1EFRA 4Q7JB 4QZVA 3CX8A 2FSHA 4P4NA 5E6RB 4CLEA 5B2EA 5IHXA 3KYCA 1LF8A 4QFCA 4NIKA 3EZFA 1YIDA 4FLEA 4LY6A 4TL6A 2BEVB 3UT5A 2F59A 2EW2A 2HFKA 3MUFA 2XTAA 2NQTA 2R6R1 3NHLA 1WUJS 5HS6A 4YXFA 3PX7A 3CW2A 3E7XA 1RMTA 3DKIA 1COZA 3O2SB 5KSOA 3A2KA 5F1PA 4LRXA 2W2PA 2WPDD 1GZHB 3QEBZ 3A6GA 5BN3B 4JFAA 4JLVA 4FHJA 4O0LA 3WJ2A 4Q24A 3DFZA 4R2JA 1PR4A 4UNRA