4XI9A

Human ogt in complex with udp-5s-glcnac and substrate peptide (rbl2)
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
717
structure length
698
Chain Sequence
b'SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
molecule tags Transferase
source organism Homo sapiens
publication title The active site of O-GlcNAc transferase imposes constraints on substrate sequence.
pubmed doi rcsb
total genus 266
structure length 698
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xi9A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xi9A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4xi9A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4xi9A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xi9A03
3N71A 4BTAA 4AY6A 3ZGQA 3GW4A 3G2HA 1QQEA 5C1DA 3EDTB 3RO3A 4Y6CA 3K9IA 2FO7A 4KBQA 5KJLA 3MT8A 5DLDA 4W9RA 5EX0A 4UI9J 1L6IA 5G05C 2BFWA 2FEZA 3PE4A 3URZA 1ELRA 4GA0A 4EL0A 3S27A 4F3VA 2R60A 2UY1A 1ABBA 3S7JA 3L79A 2WPVA 4YI5A 3ZPJA 2FBNA 2XGMA 4J8EA 1HZ4A 2KS6A 2IFUA 1SXPA 3JYSA 2GEKA 1Y8ZA 1XL0A 2GM9A 4KXKB 2IW1A 3MS4A 5TMDA 2E2EA 1FTYA 2AV6A 3Q49B 9GPBA 4Y6WA 1NOKA 3Q3IA 2DBAA 4GYYA 4N3CA 3S7FA 1UQUA 4CTMA 1WUYA 3OTGA 5A6CA 1KTIA 4LEUA 2L6JA 2KATA 3QWPA 1C50A 4KQMA 6GPBA 1A17A 1PC2A 2X6RA 2BUGA 3NF1A 4G26A 1IYGA 3E3LA 2Y4UA 2VG8A 2G9VA 2QRPA 1IIRA 2F3PA 1EM6A 3SYMA 3IAAA 3O48A 3RO2A 5AYWD 2IF4A 4WNEA 2C0MA 1QM5A 3MBOA 3G2KA 3ASFA 3C48A 5D00A 3RKVA 3LY7A 1L5RA 3OKCA 3S7DA 1F6DA 4RELA 2VSNA 3UPVA 1XOIA 3T3IA 4ME2A 1P4HA 4U04A 3CVLA 5HI7A 2VYIA 3VUEA 1SXQA 2J9QA 1Z6PA 2Q6VA 3GUHA 2PQNA 4U07A 3BEEA 3WC4A 3G2LA 3TG5A 3MT7A 1GGNA 5CCLA 4FKZA 5I45A 3MKRA 3OTIA 3T5TA 3OT5A 4RIFA 3QKYA 4HOQA 2P58C 1Y6FA 2QLNA 4KQ2A 4REMA 3LY9A 3CX4A 3RJVA 1K06A 1E4OA 2KCKA 5EKQD 3WADA 1FCHA 2HO1A 1YGPA 1JIVA 2FFRA 3LCAA 3CV0A 2ACWA 1QKJA 2FF5A 1FC0A 3MQFA 4EL5A 5JJ7A 4XI9A 3H4TA 1NZDA 2PQRA 2X0DA 3VTXA 2BGUA 4MHSA 4MI3A 5G04C 2XGSA 3LY8A 3G2IA 2X0EA 1FTWA 4U0ZA 4WNFA 1JG7A 1PSWA 3D0QA 3DDWA 2GW1A 1M5RA 2UY1B 4MRAA 2QN2A 2XEVA 2ACVA 5BT1A 4NQ0A 1JEJA 2QRGA 1HH8A 3T3EA 3SF4A 3L7CA 3S7BA 4WHMA 4GYWA 2PRIA 3C4QA 4X6LA 3OY2A 7GPBA 1E96B 3CK7A 3BEOA 2OFFA 3RT1A 1WW3A 1XL1A 2IV7A 3Q4AB 3E4BA 4HOTA 2XA1A 3BD6A 5KJMA 2JZCA 4NRHB 4YUAA 3NP7A 2PYDA 4J8DA 1Z8DA 3CV3A 4IN3B 4UQYA 3CK9A 2OOEA 5TMBA 4GZ5A 2C1ZA 4GYOA 4ABNA 3BD7A 2R4TA 4L22A 2HYZA 1C3JA 1FU8A 4X7MA 3RIBA 4G1TA 3KS2A 5M72A 4A1SA 3VTYA 2GJ4A 5TVGA 1FU7A 4BQIA 1NZNA 2IUYA 1P4GA 4HLNA 2HR2A 2ASVA 2Q7FA 3LKUA 1GZ5A 3ZCSA 1KLXA 1RRVA 3D1JA 4HWGA 3R9AB 5KJKA 1RZUA 2G9RA 3AS4A 1GPAA 2LSVA 3PDNA 2ATIA 3L7AA 1PNVA 1V4VA 2AW3A 3SZ7A 2C4MA 1TJCA 5FZQA 1E1YA 3ZCVA 2QZSA 4U0SA 3RU0A 4I2ZA 4YNDA 3C4VA 1NZFA 3QHPA 3GZ2A 3VDNB 4UQZA 4G23A 1XNFA 1EXVA 4F96A 1ELWA 5LQDA 2VQ2A 2PZIA 3ASDA 1C8KA 1YA6A 1IHGA 2G9UA 3COPA 5GPBA 3OXLA 2KC7A 3Q15A 2QN1A 5JJ6A 4RENA 1NLMA 3NPAA 2GPAA 3ZCTA 2XCCA 2QN8A 2XMPA 3G2NA 2VGXB 4NEQA 4M7PA 4AN4A 3ULQA 2VCEA 5JJTA 3CUVA 2I6HA 3E3OA 2VGXA 3NP9A 2FI7A 3S29A 2ONDA 1Z6QA 4N2SA 4UQXA 3UYLA 3FP3A 1NOIA 2HY7A 3EBOA 3BCSA 3RSZA 2WQHA 3S0JA 3OKAA 2PQ6A 2AZDA 4EJ2A 5HQ8A 2VGYA 2XGOA 3QDNA 5D01A 5LCWC 3CVNA 1P5QA 3ASGA 4XI0A 4XIFA 1NOJA 3CEHA 2X0FA 4BFCA 3DDSA 3GPBA 1LWOA 1C8LA 3MRTA 4W6QA 4F9FA 3QOUA 2GPNA 4G2VA 4M60A 3FWVA 2C1XA 2QN7A 3MRVA 3CUWA 1RZVA 1B4DA 4AY5A 3MV2B 1PN3A 4G25A 4JA7A 4BWRA 1NA3A 1J39A 1UQTA 5BW8C 3AS5A 2PRJA 1Y8MA 3PE3A 3ZCPA 3QWWA 3Q47B 3HBNA 3ASHA 5JTTA 1YA0A 1NVKA 4RG9A 2XCBA 4BQEA 4WADA 2F3QA 2QFCA 3OKPA 4GA2A 4FZRA 4EQFA 1KT0A 2H1HA 4HOSA 2LSUA 4RIGA 3OXGA 5G05J 1P4JA 5IKOA 3MT9A 3MRXA 5FZSA 2QN9A 3O3CA 4Z5XA 8GPBA 2R5SA 1WUTA 3S28A 2YQ8A 3E3NA 2BISA 1P2GA 4GA1A 3BDAA 4QLBA 2C2LA 3T3HA 3KAEA 4I9EA 4F97A 1P29A 3CEQA 2SKEA 4JL0A 5BNWA 3IEGA 2X6QA 3CKBA 2IYAA 3NB0A 4AIFA 3U3WA 3MTBA 3CVPA 4YI3A 4M83A 2YHCA 1W3BA 1NA0A 2XA2A 2QRMA 4LEIA 4MI6A 3ESKA 1FA9A 5JTUA 5FT9A 2Y4TA 1O6CA 2IV3A 5EX3A 4YVOA 3AS8A 2JLBA 1XKXA 4BT9A 3DD1A 2C9ZA 4HOUA 3H4IA 5DU2A 3RHZA 3CEMA 3MSCA 3Q5MA 4KYOB 1OUVA 4GZ6A 2XCUA 3HBJA 5TMEA 3MA5A 4X7RA 5FTPA 3NAZA 2JJMA 1AHPA 4J0UA 4GPBA 3UYKA 5ARFA 1F0KA 2ZB2A 3VDMA 4CTNA 4RIIA 3CUYA 1JIXA 1UZUA 3MTDA 1HXIA 2FF4A 4GPKA 1JG6A 2SKCA 3L01A 3WXXA 1P2BA 3CUUA 2XPIA 4WNGA 3ZCQA 4O6FA 1L7XA 4JHRA 4WNDA 3UQ3A 2G9QA 4BTBA 3MEKA 3CK8A 3Q3EA 3TOVA 1WV1A 5LCWJ 3RSCA 2R66A 4X7PA 3CVQA 4G2TA 1WV0A 4N9WA 1FS4A 2H1FA 4J8FA 1L5WA 1K08A 4CTOA 4RG6A 4BT8A 3BCUA 3NC4A 3L7DA 4UI9K 3U4TA 3T3DA 4EKEA 4H7YA 1WAO1 3ZN3A 4I9CA 1GPYA 3ZCRA 1FU4A 2O6LA 1GFZA 2F3UA 4AMBA 4NC9A 3FROA 1QZ2A 2R4UA 3ZHEB 1VGVA 1HLFA 4N3BA 3CKCA 1Y6GA 1BX3A 1GG8A 1ZBPA 2QRHA 4APOA 4AMGA 2SKDA 4WACA 4GCNA 1JIUA 2QNBA 5ARGA 2R68A 3QWVA 3EBPA 5KJNA 1GPBA 5DIZA 1LWNA 2VSYA 3T3GA 2GEJA 4H7XA 5DXFA 4KQ1A 3Q3HA 5IKPA 4G24A 4N5CA 3WAGA 2YJNA 2PYIA 4MICA 2V5FA 2KCVA 2IYFA 1Z62A 4JA9A 4CDRA 5D0QD 3LYAA 2PL2A 3TGOA 2QLMA 4RIHA 1L5VA 3BD8A 4RIEA 2P6PA 4I17A 1XC7A 1H5UA 5HXAA 5G04J 5FJYA 2XA9A 4GCOA 4I2WA 2UWJG 3KD7A 1P2DA 2BGTA 4MI9A 3T7DA 2LNIA 2F9FA 5A7DB 5D0OD 3TAXA 4N3AA 3ZCUA 4BQFA 1L5SA 2MHKA 2NC9A 3MV3B 5CHEE 3AMVA 3MS2A 4B94A 4PQGA 4RBNA 2GT1A 1FTQA 3QKWA 1AXRA 3GYZA 3IA7A 3DZCA 2GPBA 2QN3A 2VCHA 3VUFA 4HORA 5DBKA 4LDPA 1XV5A 3L7BA 1PYGA 4WUYA 3OXFA 3ZFWA 3HYMB 2AMVA 3CUTA 3G2JA 1A8IA 3HBFA 3TSAA 5CCMA 4MHOA 3ZHEA 1IXYA 2XCIA 5ENZA 4U0UA 3UUXA 3GZ1A 1ZU2A 3HBMA 3NCHA 4CGWA 2AVPA 3MTAA 3S2UA 2KCLA 3OTHA 4AM9A 3FFLA 4N39A 4GZ3A 3LPZA 3TG4A 4CGVA 2IEGA 3MS7A 4I1AA 4NESA 1L5QA 3CEJA 3BCRA 2QRQA 4EKYA 1WW2A 3SYRA 2F3SA 2C0LA 1WM5A 4N2QA 5FZRA 4YVQC 1B89A 1KT1A 2ECPA 4UI9C 2IEIA 2QLLA 2FETA 2WTXA 3D0RA 3OY7A
chains in the Genus database with same CATH superfamily
1UWCA 4OFWA 2HT1A 1TT5A 1QCYA 1WEKA 3K9LA 2FSVA 1E6CA 4PAMA 4L75A 5C1DA 1FS5A 2EX1A 1ZIDA 3FFXA 2OOSA 1SG6A 1NFFA 3A36A 4G5SA 2V4MA 1X14A 1K6MA 3N2GB 1UZLA 2EJBA 1PR4A 1Y9EA 4M37A 1U7HA 3UWMA 2XMQA 3N0WA 5F78A 4ZAFA 3SVZA 4B87A 5AJYA 3UG7A 2GASA 4MKTA 2VDNB 3M6VA 3RFVA 4CF4A 2J1LA 2VJMB 3F1KA 1G2PA 5B3JC 5G4LA 5AVYA 1ORHA 2KBEA 3KTAB 4P8RA 3ONLA 4P5EA 5JYBA 1E2KA 3U7FB 1HKHA 3T1QA 3R0ZA 4YUWA 1L7VC 1V8PA 4R7ZA 3OQIA 5A04A 1AV6A 3LT2A 3TZLA 3HDGA 2PKYX 4NARA 3W1VA 3I2FA 5IAJA 2NVBA 3KZKA 2JFYA 1O94D 4DILA 3HB0A 3FJ1A 1C81A 4N49A 4FFBA 2J5QA 4C5BA 3S5JA 3PC8C 3F46A 2ZB4A 3OIVA 3JD3A 5CDUA 5I7RA 4GT1A 4WESB 3T41A 1G6OA 5DSXA 2OBXA 3FNRA 1OWMA 1SXJC 1RMQA 1T0PA 4CLHA 4GRAA 2IELA 3OM0A 1I3LA 3IQHX 2OGUA 4EFNA 1EG7A 4Y0VA 2GM9A 4GF5A 2E5FA 1XZCA 3VMMA 4ZZ3A 4KIGA 1NSFA 2O2DA 4DA8A 3BXGA 5I9TA 4M6WA 4O1HA 1PR6A 4LMPA 4GYYA 4A0RA 1M2FA 1ZD3A 4FMBB 3AG3E 4A3VA 2EARA 3T5XA 3DC7A 3BBPA 1CR1A 1WUYA 4XWTA 3BHIA 2BVNA 1PJ8A 1N2OA 3IBFA 1MVOA 2CB0A 1Y5MA 3V2XA 1RWNA 5C5CA 4FVTA 3TXNA 1SOAA 4N5IX 3FHOA 4U8HA 1O5MA 1JAHA 1XGWA 4LYHA 1IPHA 1V35A 1XFAA 2W22A 2QTFA 3F5QA 2YIVX 4RZXA 4XB2A 3UAYA 2LRHA 1QS0B 3KPWA 4LGMA 1MC1A 4KYTA 4R1OA 5AJWA 2C0MA 1CZOA 1X7YA 4RHEA 3BJMA 2AJAA 1WXIA 1HLGA 4AZSA 5KWSA 4DUYB 3RKVA 3DZKA 3P52A 4WPGA 4MVJF 1ARZA 3PPXA 3BA1A 4QNRA 3WLKX 4LYYA 1RD4A 1BA3A 4G56A 1ONPA 4LCEA 3Q0EA 2W2KA 5LBIA 3HG7A 3M5WA 1Y3IA 4JVNA 5C34B 2DKNA 4FW9A 1STOA 2CJWB 4AUNA 3B82A 4IF6A 3CIAA 3DMDA 4IO0A 5EY5B 4J8PA 2NZJA 2WDPA 3E2MA 5IARA 3SNKA 4NNPA 1UAYA 1AQJA 3IJPA 4MW0A 4BTVA 4U07A 3PT9A 5FTLA 3K0SA 3I9FA 3FH5A 3MT7A 2RI6A 3UAOA 4BLSA 5CFMA 5KTMA 2LXNA 4F2DA 2FPUA 3ESLA 4A8JB 3RFTA 2MSDB 2E2WA 3P2EA 4KO1S 4ZI7F 1ZI6A 3QKYA 2FW0A 5DK6A 3MCAA 2OECA 5KSYA 1RKQA 3WNBA 2XQJA 1KI6B 1L4UA 1YCFA 4WKOA 1F7VA 4NMWA 5EKQD 4WINA 3WADA 3NGLA 2IDZA 4QDOA 4WFJA 5FNVF 4JT9A 5BXYA 4CKXA 5HP4A 1L3BA 3IJ5A 1D8AA 3R0VA 3QE3A 3S8MA 1GGEA 3A11A 1Q0PA 2QSUA 3B6EA 3TECE 1WD5A 4XI9A 3GEGA 4KV7A 3VR4H 2FRVA 1KU0A 1HNZB 5AKYA 3K5HA 5HF8A 4B6QA 2ZG6A 1V16B 3KYDA 3KHSA 3O75A 4MI3A 4PXYA 4GTVA 2ATEA 3F96A 3OP1A 4BWFB 1JG7A 4F3RA 3CSUA 4H7PA 3LTNC 5EJMA 5CLHA 3CG4A 3K6SA 1EPUA 1P33A 2PSHA 4Z8YA 1CE8B 3TMKA 4X85A 2GVZC 1DKUA 1EX9A 3GRZA 1P9OA 3I52A 1QP7A 3CINA 1U0EA 1PG2A 3OT1A 5F12A 1J25A 2V1UA 3R3SA 2ZIUB 2YUTA 4URHA 4FQ5A 2NPOA 1SG9A 5BV8A 4WHMA 4MGZR 1Q1AA 2ATXA 4UMDA 3GCDA 1J7JA 2JGMA 4KODA 5LDGA 3BEOA 1LPSA 2D5AA 5KJMA 4FYIA 3NIDB 3T9BA 1WP4A 3B20A 2VQ6A 9MHTA 1ZM4A 3GJZA 1BPOA 2DWCA 5TMBA 3KBBA 2KB0A 1MVLA 4GYOA 2QN6A 4UE2A 1CUJA 3QVGB 4KXFB 3DTNA 4AU1A 1O1YA 4KNYA 1UPAA 2DFKB 4L4SA 3TLYA 1A5ZA 4V24A 4A1SA 1TM2A 1RVV1 4DDUA 2A3NA 3IQEA 2ZXEA 1NF2A 4CCAA 2JLAA 4UNQA 2XZTG 3VCXA 1AKVA 3RUEA 1D4ZA 3NIGB 5F7ZA 1WP9A 3JD1A 3LKUA 4HDSA 1RC0A 4RHUA 3E9CA 1HG2A 3LS8A 1XVTA 2RFLA 3EH1A 4P3KA 2R8EA 5DHFA 2Y0BA 4F4HA 4KZPA 1GQQA 4X8QA 5AUNB 2O8CB 2QZJA 3WIEA 2W8BB 3DTTA 3UKUG 3ANXA 1POWA 2G76A 2V7BA 3OQHA 4NL4H 5FADA 1T8SA 1P9NA 2ONYA 3PWTA 5L7TA 5B3SE 3EVGA 3H87A 1CUDA 1KSJA 3AR6A 3OPXA 5DNVA 3KCNA 1YR7A 3HR7A 4MUNA 5FV7A 3TOXA 3VO9A 3ZZNA 2Q0QA 1MNAA 4M3NA 3ZNOA 3A6JA 4MDEA 5C8VA 3GZ2A 1MPXA 2IU6A 1SCNE 1N0VC 5LXTF 1X9HA 4UQZA 3KU4A 4KE7A 5E7IA 4C7BA 3O8QB 1WTCA 2FZKA 2VPXA 3TSZA 5LQMA 3OIYA 5KC8A 5EIFA 1QCDA 4N12A 4QBFA 3U7IA 2WWXA 2RJNA 3F67A 3U17A 2GJSA 3FF1A 4GBJA 4CCSA 1QJ4A 5JD6A 1AA9A 2CLLB 1NLMA 1WA5A 2CXQA 2HM8A 1JG4A 1ADYA 3GLHE 4KXMA 4OF4A 1JF8A 5DMHA 1DUIA 2FFQA 5JFGA 1SVSA 2EEZA 4MV4A 3ZZ1A 2R1VB 1MW9X 1N5MA 5EZYF 2I6HA 1DB3A 1O6BA 4YK7A 3FCEA 2AI1A 3M2TA 1RABA 3T8KA 2WJZB 3S29A 1N2IA 2WILA 3FAZA 2YWCA 4OU4A 4GZCA 5FWQA 2D2EA 3FKQA 1U8CB 1ZD8A 3AG4E 3NBYC 1H19A 1S3SA 2A9VA 2WQHA 1ZNQO 2BMAA 3KLPX 1NYLA 2E4VA 2GZ3A 3COZA 3ONVA 1W1WA 1U2QA 3C3PA 5HQ8A 5TPWB 5JJ5A 5C4MA 1TGYA 3RVRA 4LZAA 4KX3A 2VGEA 3ZBUA 3PDUA 1WDLA 1WL8A 1TUEA 1XFDA 4GPIB 5BSTA 5EL0A 5E9QA 4MVXA 3B2NA 3FMOB 1N4AA 2WTBA 2ZYWX 4RVBA 3N0RA 1RPJA 3D6TB 3QXHA 3TINA 5KINB 5I3CA 4MGIR 3SZUA 3KKMA 5DHRA 4NBTA 3WNVA 1CIVA 4BYMA 2XUDA 2WP0A 2P7HA 3MRTA 2H85A 3WHIA 5TARA 1ZOOA 1AU9A 5ALKA 5GGYA 1QYIA 4K5BA 4Q3BA 4UATA 4ALJA 1D6SA 3PDIA 5C7LO 2VDKB 5CDTA 1J2UA 1RKXA 2FWRA 1TB4A 3D9QX 3RS4A 3L0CA 3K30A 1MJFA 1QVZA 4PNZA 4R0VA 1B6GA 1N6RA 4RV4A 4HBDA 2PG3A 1IWBB 1NA3A 2RSFA 1AKRA 3TLEA 1NRWA 3AS5A 3RVDA 3WNCA 4CIYA 1M7GA 3KQLA 2BGGA 1W4CA 1YZYA 3H2IA 1AKMA 2VNJA 2A9KA 3AP1A 3B8EA 4XQ9A 3U5ZB 3S2GA 3JASA 4M99A 2NUTA 1HTBA 1H6AA 4Q18A 3QYAA 1IZYA 3RRZA 4KVZA 4HRNA 3T1NA 1FMLA 3OVMA 1IY0A 2JANA 2P9FA 1TX4B 4L15A 4RIGA 1NRXA 3RG8A 4JI0B 4GOMD 4ZCIA 1YR8A 4GBED 3D8BA 3DUFA 3E9QA 5DK4A 3QLEA 4H6VA 4AM8A 4WFKA 5LN1A 4HDSB 2ZS8A 2A5JA 3SFYA 2BJWA 4EABA 3HR4A 2QNRA 3S28A 2G82A 3BRWD 1TPZA 4GXTA 5D7NA 2PTHA 5A1TA 3DSSA 5CFRA 4HXGA 5BV7A 3DONA 5EYPF 1MPTA 1WABA 2YJTD 3NOOA 4XARA 5DCWA 1UDCA 2R6DA 3VJMA 2JGDB 2VXYA 1GVNB 4ZI7A 2WLTA 1NXSA 3M4ZA 2B99A 4YCBA 1CULC 3U3WA 3B9BA 4XQGA 4X90A 4D4KA 1KO7A 3VJRA 1GNLA 4NP6A 4HNGA 4OQDA 5KYYB 5DLYA 3G0IA 1GVHA 1RPNA 4N0DA 4OP3A 3UOAB 3VR6A 3ZC3A 3DEPA 1SC9A 5ALSA 3ZE0B 4CGYA 5BW4A 2JFGA 2ISSD 3NOCD 4GMRA 2QA5A 1WRBA 3EVEA 1Q74A 2A7QA 3KQVA 1QE5A 4KX5A 4LV6A 3S55A 1XQWA 2O8EB 3HXPA 2N75A 1CZHA 2XOEA 2Z5GA 3LD9A 1GSAA 5D85A 1XLWA 2FX3A 3KJFA 4AZ0B 2DPHA 1GPMA 3GUZA 3I92A 4RORA 4E11A 1LF0A 2P6NA 2BR3A 3RHZA 4GTSA 4IOMA 1PK7A 1L7MA 5BVHB 1EFVB 3LKBA 1Q84A 3ZVMA 2C0QA 2AL7A 1MX3A 2E18A 1RQNA 5BR4A 2Q3BA 4K5CA 4DM4A 1OFHA 1U0SY 4IIYA 1K0UA 4GPBA 5CR9A 3C6ZA 3A9VA 4FYKA 3O8RA 4B3JA 3LSTA 4JBGA 1EA7A 2X42A 2ZB2A 4LJLA 3UJCA 1CQZA 4QBTA 1W19A 1XVIA 2GXSA 3GLUA 5J23A 1HXIA 2CXOA 5EZYB 1ZJ6A 5DLQC 3L4SO 4F5YA 1HT0A 1M2VB 3U49A 3JQ1A 4K8OA 5LWHA 5DFAA 5L3QB 4NOLA 2KI5A 1RYYA 3L7OA 2IU0A 1HUQA 2Y3IA 5J5AA 3R8XA 1I7LA 2F8MA 3MJRA 3UHAA 3T99A 1B8VA 3Q75A 2J9XB 2PRKA 3WLSA 2DZOA 4BTBA 1H3FA 1YRHA 3Q3EA 4MW6A 1XZPA 4P38A 5DCUA 4NYJR 1YD7A 2FULA 3PZ1A 1ES9A 1KI2A 1KZ4A 1TLTA 1WXWA 2FZVA 2X5JO 3RJTA 2JFBA 1E3WA 4QBIA 4CLXA 4GU5A 1FJ2A 2H1FA 5TY0A 1CUXA 2P4SA 1ZVJA 5FOTA 2VQDA 4FCVA 4CTOA 1XNJA 1BSVA 4YP5A 1E6LA 3DBHA 2AHRA 1PUJA 3A6GA 3CNNA 4UDNA 2AQKA 1Z2OX 1D2EA 1ENOA 3H1AA 3EFHA 5IZCA 2I2BA 1ODCA 1XTJA 2ZCJA 4EY4A 1NLUA 3HBLA 1GV1A 3L9WA 2FF7A 2F3UA 1AXGA 1J8QA 4IR7A 5IAEA 3T3EA 4MOWA 1T3TA 1SA5A 3WV5A 4CMGA 1VLMA 3K31A 1W36D 4QASA 5BW8A 3D3EA 1QYRA 4H6PA 2DUWA 3I1JA 3IP7A 4Q37A 3RG2A 2I5PO 4WZZA 5E2IA 5D86A 1ZMOA 1YTLA 2XLCA 4QYMA 1GTRA 5DWQA 4MQFA 1SIWA 4DV3B 1TVKA 1MRNA 2WJIA 3OKFA 4ZAXA 3UK0A 3M1IA 4JYBA 4ARBA 3QWVA 2QZZA 4YRMA 4N82A 1GPBA 1M72A 2XT9A 2DR3A 3AEYA 1GPJA 4H7XA 1EZZA 1ZWKA 3CS3A 5DXFA 1WX1A 4B3DA 1JCRA 2J5BA 2RONA 4FOTA 4KN9S 1U0OC 2Q6OA 5DE3A 2C2HA 2YRXA 1ORWA 4KQ1A 4ZVKA 1XZ8A 5LM3A 3U7GA 4ZAYA 5A9SB 4ZARA 4ND2A 3TTUA 3VHXA 5HEKA 1GKYA 4CKCB 2YNMC 3IUBA 4A2WA 4ZEVA 3G2SA 3ZGLA 5CLFA 1PNRA 3RC3A 1BROA 4TQGA 2PQMA 3QAQA 3DPIA 3EWNA 3SSAA 3UF0A 2QLMA 2VL7A 5DHTA 2QRZA 5HE9A 4A91A 2CXSA 5FLYA 4AJ9A 5ICCA 3CQGB 4GMFA 1KO5A 1LW6E 1XZBA 1Z12A 2J4FA 2B61A 2SNIE 3EQ6A 3IR7A 3QVKA 3QWAA 4HAYA 3WVNA 2VJBA 5I7HA 3K70C 3WWCA 4Q02A 2QQEA 4FHJA 1XTPA 2VXOA 4WJZA 3A8TA 5EQJB 2IV2X 4DLSA 1THZA 4GLLA 4A0SA 1E3IA 2VF8A 1D7AA 3CHRA 1UFRA 1OLXB 2P4HX 4J0KA 4ZQHA 3R9MA 2BF4A 4G9GA 1TNUA 3ONKA 2HMSA 3OCYA 1AVTA 3CPHA 3VH4A 7YASA 4N3AA 1CUAA 1ODFA 3H9CA 3JAKA 3LP5A 3OC6A 4JOBA 3UHFA 3WMEA 1UK8A 4E7OA 2OQRA 4A15A 2NSJA 3OEHA 2MT9A 2CE2X 2B2NA 1B8PA 1KXZA 1S6YA 2QYJA 4K9LA 4NTZA 5EZ5A 5FBHA 4E46A 4YT4A 6REQB 5H80A 1E2PA 2GPBA 5K5EA 1KERA 4QX6A 3SR0A 1YMQA 3AM1A 1H1LB 4KGXA 3B95A 3TWSA 3R6GA 3S40A 1E5VA 2CNNA 3ICPA 1FNBA 3IMEA 5A4FS 2NVUB 3FSJX 2BTDA 1MFZA 3QPVA 4MWZA 1LLDA 3ZOKA 4BMCA 2DLCX 2O23A 1VPWA 1GZUA 3LPDA 4FJ1A 3MCXA 1MO2A 2WMNB 3CLSC 3H8SA 3HSYA 2R05A 1DC8A 2X23A 4H6WA 5FYQA 5LOVA 1RR6A 3WA6A 3ZHEA 5L3QA 3RKRA 1Z47A 4K5QA 3K5WA 1L3CA 1DELA 1E4VA 1IQUA 3TLGB 1DINA 2KM4A 1HH4A 1RCTE 1YB2A 3HBMA 2IYVA 2XB9A 3UM2A 1IDN1 3KQPA 3PK0A 1EFTA 1TCBA 1R6TA 2JW5A 2Y0CA 4CDMA 2BKGA 2COUA 1JB9A 4MR8A 4P98A 2GYUA 4V1CI 4JBYA 1TTTA 3FUKA 1YZGA 3KSRA 4QVIA 2PT6A 2FSFA 2IEGA 2NTVA 2OGWA 3CRNA 5EI5A 3TQRA 4AY4A 5AW4A 4GXQA 4EKYA 2QRQA 2LTAA 1WW2A 1ZSYA 2Q21A 1SXGA 3B1VA 5CFQA 1HU3A 3AU8A 1HLDA 4N2QA 2IHJA 4NDAA 1B89A 3LFTA 4RZHA 3FOBA 3FU0A 1GQRA 4LGYA 4JLAA 3W78A 3X44A 4BVKA 1JECA 3T7AA 1OBHA 3T54A 1E8DA 3N2KB 4KBYA 4KPYA 4X1YA 1X5BA 2ZSFA 4W1PA 3RSFA 3EYAA 3MWEA 3U7RA 1T4CA 3S7ZA 4NHOA 1NJ8A 1WG0A 2NSDA 1ZJ5A 4OJNA 1KBOA 2A1IA 4FU0A 3PFFA 2FO7A 1KVSA 5KSZA 2J3DA 3OZUA 4PZ0A 2Y1LE 2VP5A 3SU8A 1WXHA 3ZI0A 5A3RA 1KPSB 4AIIA 4U95D 5EX0A 1G64A 1SBIA 3IERA 3K9CA 3LLVA 4HDNA 4J90A 2GN9A 1F0YA 2UUPA 4OYRA 4TKLA 3UB3A 3WGJA 1P72A 4LYAA 4CXMA 3BX1A 5DVZA 2UY1A 3ND7A 2PD3A 3JALA 4O3FA 5L4LA 3DSUA 3A2NA 2BONA 3AY0A 5EIBE 2QZPA 4MROA 1FUUA 1SUSA 5F98A 4KJZA 4MQEA 3ANSA 3FRHA 4EX6A 3BWMA 3C39A 3BREA 4ENRA 5MFZA 4YNBA 2XZTA 1YC5A 3GAAA 3LGXA 1KZ7B 1IY9A 2HCBA 1LBHA 5CHEA 3JQBC 3Q6MA 3FCYA 3AKYA 2G1PA 4CDGA 3IXMA 4CM5A 2PBLA 1YZLA 2WEKA 2XI4A 3L0IB 3I9NA 1OZGA 1P80A 3FEYA 5HJ2A 5KYWA 4FJ2A 4JJFA 3BRSA 1SCIA 3IEIA 4B2IA 2Q1XA 3A4LA 3HABA 3RV4A 1AB5A 1DC4A 3A37A 4RE5A 5KJCA 1OXJA 4UULA 2OESA 5ALUA 1DZ3A 2R751 3M6IA 4DIBA 1PL6A 3RU9A 2ZWIA 1RMTA 3THRA 2YHAA 3V4LA 4DJEC 2O7QA 2YCBA 4KNWA 1DQNA 2BBOA 3DAPA 4MS4B 4OGFA 3GV0A 4KPFC 3RUCA 4O4IB 1FFWA 4N0PA 3D2BA 3QY0A 2RGBA 2QRPA 3U0BA 1ORIA 2R8XA 4TYYA 1OAOC 2YC2C 1ECLA 2G5CA 3UB4A 5FI1B 3JD0A 4K0RA 1JB1A 1UKCA 1WMEA 1XE3A 4FMDB 4UHCA 2P77A 4RDXA 3VAAA 4PVCA 2A67A 5M04A 3SVLA 1NFRA 2BSXA 2OLJA 2C4HA 2ORYA 4CU2A 5CIYA 3DOEA 1NN3A 2JB9A 2Y92A 3WRVA 4O8CA 3ZXPA 1MEOA 2GCIA 3F8WA 3Q1LA 3FI0A 1HF3A 2JRLA 3HYCA 4KUGA 3ZDQA 1X1AA 5K0GA 1JSRA 2NZXA 4ME2A 4RZ2A 3VR5A 3ZTWA 3OCVA 2NZYA 5COAA 3BIFA 4RK5A 2VYVD 3G9UA 3EZLA 1X1RA 2OEWA 3QXGA 1Q57A 4IWXA 4OQEA 3WGQA 3TWWA 1BW9A 1TNBA 1OV4A 1J8MF 2H18A 4C0MA 2PQNA 2VRBA 3WGKA 2A84A 3LM8A 1RW2A 1J0BA 2W9XA 4N18A 3WMWA 4B6JA 5D87A 4DNFA 2BMEA 1Q1GA 1E5XA 2C98A 2PFGA 1VJ1A 3H5VA 1FVFA 2B0JA 4IX1A 4A92A 1KK0A 4FD2A 5JJBA 2BKAA 1KI6A 4V2UA 5HBRA 4F21A 5JAOA 1EP3B 2FR1A 5HKKD 1MFPA 4REMA 3PDWA 4OGGA 5KDDA 1AZWA 1LA2A 4A55A 3N76A 5UKDA 1UFVA 5F1KA 3U4AA 4YPOA 1T4MA 1Y8QB 1ZJJA 3CV0A 1NPYA 3CWQA 3EQZA 1HL3A 4LKRA 5C5IA 4YJ2A 4DCOA 2H7VA 3LUCA 3DAHA 2V74B 1ESEA 4EUNA 1A9PA 4WE3A 5ENOD 3O0DA 2AQIA 4Q9NA 3RYCA 3C14C 1CP2A 2WTUA 1H6BA 3C72A 4YJGA 3OMWA 2XBMA 3FTQA 2V0CA 4TWRA 3TOCA 3C8UA 3A9SA 4ISCA 3H2GA 1FLDA 3DFKA 3K6SB 3FRJA 1XPOA 1M0SA 1MOSA 5HFNA 3OAAD 5FTNA 1E9AA 3L8EA 2BUAA 2PPVA 1CQJB 2ZI6A 1LLUA 3VR3A 1Z5UA 4C0LA 2NNWB 1FXSA 5BR1A 2PUFA 2OORA 4AYTA 3HDQA 1TFUA 3E58A 4NV1A 2XDYA 3SF4A 1CJTC 3ZU6A 2CLFB 3PLRA 4I55A 1BGVA 4WN9A 3DBSA 2YVKA 1IAVA 2DWUA 2WYOA 3E27A 1N6OA 1DRUA 1P9WA 5KTPA 2ZJOA 1NBAA 2FTKE 4MHTA 1JIQA 2ETBA 1L4GA 3CK7A 2JIRA 4FIDA 2OFFA 4EJSB 1G0NA 1T5IA 1AD2A 1K88A 2ZIRA 1VBKA 2PHZA 4G0NA 1M6EX 1M1NB 4MPTA 3DXYA 4R2HA 4MV5A 4EZIA 2JLQA 2GEDA 3A05A 1QG4A 3PHCA 1HWYA 2QYTA 4OHVA 3VI4B 5BQ3A 1NJ1A 4UVDA 1XHLA 2PX3A 1S3IA 1T4GA 4QPNA 2OO5C 3DBIA 4PLGA 4U8GA 2VC2B 3PQ2A 2PBRA 1QHHA 4MPDA 4X7MA 5FQ8A 4G1TA 4PWZA 1CUYA 2QX8A 1SJ9A 1RAGA 1T24A 4YDRA 4DDMA 1RQXA 1VB5A 1KJYA 3K0KA 4KLCA 4DC9A 5JI3E 1DKLA 1VRVA 1EJ0A 1B14A 4HQDA 4FLHA 1W5EA 4LBVA 3I3SR 3UFXA 1GZ5A 1RRVA 3IHYA 1AUOA 5FBWB 4EEXA 5KJKA 1KI3A 4OG2A 3D3JA 2D2VA 3O31A 3ZHRA 1D2AA 3AS4A 1H8HA 2ZIVB 1SA0B 1T3LA 2PXAA 4N5MA 3PRKE 4ITVA 3TCXB 1CYEA 3IUMA 3D7KA 4GAAA 2R3SA 2ORVA 3LPNA 4Q82A 3TDMA 4Z0NA 5J2TA 3ZVNA 1D8DA 1UJ6A 1IWPB 1I1HA 1K8XB 3FPGA 3QMMA 1SHTX 2R7AA 4FCTA 1JLLA 1E1YA 2A86A 2DBVO 2IZZA 2LUOA 2J7PA 3STXA 3IMKA 4TROA 4Q3EA 4U0SA 3DKRA 3KVYA 4Y2TA 3GCWA 3AEKA 2YKGA 3MVEA 4D3SA 1DO2A 1MO3A 1N1DA 2OHHA 2Q7XA 2ERYA 2RHMA 3VDNB 3I64A 4S05A 1IE3A 1UBUS 4QJ5A 1XNFA 2QW0X 4OH1A 4MQ4A 4XIGS 5K0BA 3FHTA 4Z4EA 2WTNA 5AJHA 4C4AA 4XQEA 4AKEA 2QZ4A 1LV8A 3K0AB 1FDRA 1L8QA 3DAOA 3C3QA 3FHEA 4JY7A 1NBMD 4BX2A 3ZUGA 3VKVA 2B8WA 2DZDA 5AUQA 4DT1A 4QC2A 4QQKA 4F91B 4P29A 4BKMA 1E1QD 5AKGA 1NW7A 3QK0A 1TMYA 5A62A 3F8TA 1J21A 3ZNQA 1E3QA 3UUGA 1SC3A 4BFTA 4NV0A 821PA 3CHOA 2JGNA 3ULQA 1K6XA 4JC4A 3WMRA 4RTJA 3F6PA 2XODA 2Q5EA 3ZEFA 3B6IA 3UV3A 2VGXA 1TO1E 4S04A 5DX0A 3MK31 3SHWA 4YMTA 4BQQA 2FW8A 2WRZA 2AG5A 2IXEA 4NYIQ 4N2SA 1NUTA 1UC8A 3JSAA 4P4UA 3AG1E 3SHOA 3T61A 3K09A 3WJ7A 1VJGA 5BR7A 5K3BA 2E5LB 1ZXXA 3IKOB 2CSUA 3QOWA 4TUYA 3KEAA 4J3FA 5BW5A 1A9ZA 1U3UA 4BSZB 3LLUA 1G6KA 2RDMA 4QKQA 1QZXA 3R24A 3UNXA 3PPWA 3A06A 2KZTB 2O3TA 3LC1O 3UATA 5HOEA 2WQ6A 1GAJA 2VZLA 3L0BA 4IHJA 2CLEB 3OICA 3HXBA 4HEA6 2RAFA 5EERA 3FUDA 2C9MA 3SOPA 1N4DA 3EFOA 3QXSA 2P9IG 3T7CA 1MGOA 1IHXA 3NHAA 1TJ3A 3E8SA 3KYCA 3MJVA 3F3MA 2SICE 1W76A 4OA5A 2AJBA 4E22A 4LG1A 3AF4A 4G2VA 4I55B 1GCGA 5BQFA 5CMYA 4YO7A 2CG3A 2CDBA 2ZBEA 3GBPA 1JEYB 4JXZA 1AS3A 3BM5A 1RZVA 3NHRA 5JVDF 5EXXA 4Z4QA 2FMTA 4OGKA 1HX7A 4U5XA 2QDXA 3NBFA 3L8ZA 1WF3A 4PC2A 3ADBA 2QNIA 1U63A 4C08A 2ZKIA 4L74A 1H2AS 1MD9A 1UPFA 3KUXA 4TQUS 5EXDA 3WB9A 1WBDA 2JI4A 3C7TA 4Z53A 1P7PA 1OYOA 3F9RA 3MINB 4H3VA 1B6SA 1Z13A 1A5AB 2PZ8A 4MW1A 4ENSA 3BQNB 3AZQA 3X2FA 4Z4IA 3HYSA 2HIHA 1GCUA 5FUYA 2Q4DA 5KU1A 5D3MA 1JTVA 2GRPB 3DV0B 4J0QA 5DJ5A 3OXGA 3GZNA 2R2GA 4BASA 4DDKA 3AIIA 1FFEA 2C2XA 4DT1B 1I2CA 4YO8A 4URWR 3WR5A 1E8OA 4PLZA 2BKXA 1E3MA 5AI0A 4ZOEA 2ODWA 3SKYA 4DA9A 3D64A 4ETMA 2BM9A 4IKPA 1JR6A 1YDWA 3CMMA 2O59A 1N6LA 3BMNB 3ONFA 3OZTA 4CG1A 3E9ZA 1A71A 3Q4GA 3HADA 3MHTA 4ENVA 1EQAA 2YZ7A 4M83A 5HNKA 1EVZA 3R7RA 1V6SA 3U3MA 1BQ4A 1I7NA 3QQPA 3ZE6A 3VA7A 4Y2SA 2X5KO 3ACBA 1GKKA 2B7BA 1TCAA 3NANA 3B52X 2IP1A 2V7XA 3Q10A 4YVOA 3TL3A 1WZ2A 4NONA 4IL5A 2ECQA 2CXNA 2RK6A 4DE5A 5JH7F 3MSCA 4KYOB 4N03A 4EELA 3RQSA 5KKCA 1OXBB 2QAGA 4X7RA 4OSEA 1SW6A 2W83A 2XZOA 3WMFA 3JQFC 2G80A 2GBPA 2LPMA 2JJMA 3QI2A 4HMPA 4L4ZA 3STVA 4YV2A 3TYXA 3RIEA 1F60A 2QJRA 2Z8YM 1KAEA 4JJ6A 1SEVA 1RRMA 3H0KA 4QXMA 4RZ3A 3FHCB 4P08A 1OZHA 4RIIA 4EVSA 2XUAA 4F3TA 2O2GA 3N7AA 3FUVA 1LI7A 2VJKA 3FWNA 3KHUA 4J2OA 2QE7D 5BV2P 2WD7B 3CKLA 2NTEA 3CUUA 4E6PA 2R96A 3KQWA 5F23A 521PA 1NW4A 4D4JA 3U16A 1NNUA 4OB6A 3JD2A 4R1LA 4XJVA 2FRDC 3ZWQA 1T36B 5F5LA 1RXYA 2MIIA 2P1DA 5FFMA 4ZJZA 3JQGB 3FAKA 3UTDA 3TDKA 2JLXA 2ZSUA 3CVQA 1T5OA 1DAIA 2GCEA 1IONA 2IEYA 3DJFA 3ETLA 3KJIA 4H60A 3SX0A 5IF3A 1U8ZA 4AP6A 2P65A 4PG7A 5KNBD 4BT8A 1S4QA 4RSRA 1SFRA 4KC0A 3IGFA 4FFNA 2R11A 1HORA 4PHHA 4B71A 2Q29A 3U4TA 1JI3A 1L7AA 2NADA 3EHRA 1JP7A 2QM3A 1TQ6A 1XGKA 2RHOA 4CCYB 1UXHA 5BSFA 3SM3A 2B1RA 5BUCA 2Z6AA 3BZUA 5KWJA 5KYUB 4AMBA 2JIMA 5TMPA 4DM7A 1RAHA 5JPCA 4TZ0A 3THWB 2ZATA 1O0CA 4L28A 3TWVA 1KQNA 3LLMA 1G5RA 1L9KA 1C7IA 1OA0A 4DLRA 2DJ5A 3P4XA 4LIPD 3L1IA 3P2IA 5ITZA 5BT8A 3QVGA 4AI6A 4DA4A 2R6R1 4PSDA 4AMGA 3HCNA 5IJ9B 4HI9A 1TUBB 4GKBA 2FPWA 3WBKA 2BLNA 3AYZB 3V8QA 3NU1A 4NAVA 3AF3A 3T52A 3A1CA 1PKEA 3NFYA 4CF3A 4JH0A 4MQ5A 2O2CA 1QOQB 4IG9A 5AWFC 8ADHA 1QDLB 1YMVA 4JYCA 5CNJA 2I2DA 3ZH9B 2QSJA 4R2IA 2HHCA 4LZWA 2WXIA 1V8BA 3WNQA 1SPBS 2VQ3A 3QG5A 4TKZA 1BEUB 1RI2A 2JHAA 2HMWA 4TXMA 1AWCB 4WGGA 4B47A 1E99A 3WK4A 4YHBA 3FZNA 3ONDA 3FGZA 1E8OB 1V54E 1E1DA 1EHYA 4ACBA 1ZEJA 1KMQA 3VZPA 3CF0A 1QV9A 1QH8B 1H0RA 2CCKA 2WR8A 2XDQB 4C6TA 4RIEA 3DC2A 3IBYA 4GKKB 5JHAA 3KQUA 4MWGA 1NLZA 2QRVB 1H3EA 4COOA 5BN1A 4UMFA 1YS1X 5GZ6A 1TCVA 2HSJA 3NHUA 2HJSA 3RNLA 4AS1A 3LHFA 2GOYA 2QMZA 4JDUA 1G2OA 5EXEA 3I5PA 5H70A 3WDSA 3NT2A 1Q83A 4D43A 4IUBS 4HNUA 1FQJA 1WULS 4EZLA 4PHCA 1SU4A 2WIKA 3MTQA 4QA9A 3PUYA 4LXTA 5GZ3A 5JZMA 1MB4A 1XNHA 5G4KB 1V6CA 4P4TA 4PZYA 2MMCA 3PX7A 3N1UA 1IOWA 3VYSB 3QKWA 2QYOA 5K0FA 1QPBA 4WV3A 2L0XA 1QO9A 3DE7X 1K6IA 4FZ5A 2JVKA 1V1RA 4Z68A 1R2QA 3R7DA 3HVIA 3TXYA 4BZPA 2H7XA 2PX0A 3QUAA 3MKQA 2AI2A 4XVHA 4B3SB 3WMGA 3A4VA 4CRWB 3M3PA 4FMPA 4AJKA 5DGIA 4RXMA 4UHJA 3HIZA 2QGFA 4X84A 1I5OA 1CY8A 3HYMB 1N75A 2HKIA 4DL9A 4DDWA 2H0AA 2CBZA 3H2ZA 1DEHA 2TRSB 4RY0A 4ZCRA 4ZJPA 1Z5OA 1A8IA 3NBMA 2V8BA 2GERA 2NAFA 4WH0A 5DWDA 3LL4A 3TSYA 3WK6A 2OVFA 1LBSA 1MA3A 4LNGA 3NRBA 1T0HB 4LQ4A 4MLCA 1VHQA 1NNI1 3JZMA 2XB4A 1Z63A 1YUBA 2UZ4A 4TL8A 1A2KC 3I09A 1Q3HA 2P3QA 3GFFA 4GOLD 4MRVA 3PQFA 3WGHA 4BP3A 2Y2VA 5I9IA 3H5RA 1N1EA 2FXIA 3BRQA 4W1RA 1ZXBA 2PIAA 4ZQCB 4EITA 5G55A 5KJ1A 2IYUA 1GRRA 2C7QA 1OWLA 3TG4A 3W8FA 3JALB 2X6HA 4G1BA 5HK8A 3UK1A 5A2GA 5DOVA 3V2IA 3RJMA 2I67A 2R6GA 3CEJA 3ZV3A 2EP5A 2Z6VA 2ZROA 1LRKA 4U9IS 1QVVA 1MO4A 2Q6IA 1IG0A 4FC6A 2HPAA 1QAMA 2VK8A 1YOVB 2OHXA 4R1UA 4GI3A 3RDPA 1NDQA 1JHXA 1EUZA 4IJ5A 1W9MA 3O8OB 3PD0A 4DN6A 4FADA 2EWVA 3TRIA 2BR4A 1ECPA 1HZZC 1SRQA 2BM8A 5LNK6 1Z0ZA 1ZD1A 3DE3X 4PO8A 4AJPA 3ZXXA 2ODEA 4DX5D 1M34E 4LJAA 1OR8A 1DXHA 4L08A 4LWPA 4NMMA 4KAAA 1KSFX 3DBRA 3KOXA 2B98A 2PH7A 3GGSA 2WYWA 1RDFA 5AW3A 3CTPA 1FFHA 3PSAA 4FYVA 3W5CA 1GTL1 1U1IA 1PIWA 1VJRA 1UL1X 1H2UA 3GYXB 2IDJA 1ONSA 5BVGA 5HJ5A 4PLPA 1KE2A 5JFTA 3U6KA 4KOEC 2W4MA 4JS0A 3O74A 1PR0A 1MORA 1K5DA 4MA4A 2NPFA 4M49A 4JGBA 4P31A 2JKVA 3L92A 4RA6B 3COSA 2BFMA 1TEZA 1L5ZA 4QNNA 1VG0B 1QCZA 2WINI 4X1IB 4KR7A 4LJ6A 2WMYA 2FBNA 2UYOA 3HA3A 2CGEA 5I9SA 2VTKA 3EASA 3G85A 1HZ4A 2BFCB 4KOAA 2D1RA 1BS1A 3P9KA 1ICEA 3DXKG 1JE0A 4BO4A 1VKHA 3FOZA 3OFNA 1XL0A 5D7BA 4GX1A 3WFJA 3WV4A 4LSZA 4LC1A 4AJWA 4P2GA 1V39A 5TMDA 3DQZA 5JANA 4CMEC 4XKJA 1JFRA 3LX6A 2D1SA 3H1BA 3FMFA 2PL9A 5K3DA 4PG8A 4F84A 5HKLA 4XWKA 5EZQA 1T2NA 5IXSA 3B1WA 1HE3A 3WK9A 3ZU4A 1JPJA 4L5IA 1AQUA 3K3PA 4GX2A 3L6OO 4HPWA 3CNBA 3PJRA 2XEXA 2ZK7A 2WK1A 4EMSA 5ARCA 3NM5A 1QIEA 1M1ZA 1IYGA 4BP9A 3W4IA 4KQ6A 4LX8A 5EIXA 1QO0A 1CIPA 2OHOA 5I9BA 4LJKA 1HETA 1AKTA 1RXWA 2ETCA 4X8LA 1V95A 5EJAA 5GJWC 1PBTA 1UWVA 3BB4A 5K0NA 3ZIAA 4WNEA 4AMZA 5IXJA 3UMMA 5B12A 5JRJA 4RF2A 3E9DA 1RFLA 1Z0JA 4UAUA 4ZA2A 3E1SA 3QVJA 3FPAA 3I04M 3O7MA 4ZT5A 1KFBB 4YDSA 3FOEC 1YBMA 3U9SA 1OPRA 2WHEA 4A8HA 4RPCA 1J2JA 1NVVR 3I42A 5DO9A 3ASNE 3UJ8A 4JL8A 5ERGB 1BW9B 1FFAA 4XIIA 2DZNA 3FTSA 4KQJA 5DISB 4HQNA 3U62A 1GL7A 1OX4A 4IDDA 2J3EA 3B48A 1FK8A 1LPBB 2P3SA 1YO6A 4HWSA 1F8FA 4KBGA 3SBOA 4BQOA 3NTOA 5JT1A 1HRKA 3CRQA 4XX1A 3TG5A 3D8HA 2BFBB 4UXHA 1RI4A 1VCIA 4UEKA 4H16A 3FVVA 1ULZA 3AXTA 1JEEA 1VE6A 1CJKC 2CFSA 3C3EA 4N5NA 5AARA 3A6KA 3HVKA 3V4ZA 4YUXA 4ZHBA 3EMDA 5D6NA 3OT5A 4RIFA 4A82A 5BVGB 4XUGB 1JHPA 1Y6FA 2O1WA 3H2JA 5A4KA 2ZUSA 1L8XA 1MO5A 1QB7A 3D8UA 2C97A 3UOGA 4TVBA 4XD2A 4WX2B 3R3VA 2GM3A 4KUHA 4WZAE 2RGXA 4Q48A 2AR9A 3RCBA 3IUJA 3LCAA 2GZRA 3LK7A 1OFGA 2HC9A 3EY4A 2BD0A 2OGSA 1J20A 4PANA 4ALMA 1ODSA 3W5AA 2GN1A 2I22A 1YB4A 4ZZ2A 1DKNA 1H0HA 1ZHFA 4TV9F 5HJEA 4X62B 2V9ZA 2H9IA 1RW4A 4FNAA 4PLFA 3V2UA 4CEJB 3EODA 4HMOA 3GDFA 3WLMA 3EH2A 3EIEA 3I23A 2J0QA 3NAQA 1AJEA 1GQFA 4MZXA 3U4DA 1RWQA 1PNOA 3FDXA 2WJVA 1NXTA 3GA0A 1ZXLA 2ZAGA 3D0QA 1ZM2A 2L82A 3MCTA 4Q3LA 3VVLA 5FOUA 3J81A 4MGHA 1EVJA 3QPBA 1QP8A 3BRWA 4LC9A 5C2JB 4MB0A 1S63A 3FTWA 4QOSA 3RB8A 3NXSA 2AQHA 4I1SA 1IY2A 4YRCA 4YLGA 1JEJA 1FNSA 3AWIA 1ORVA 5CU7A 2DJIA 4NZZA 2P6MA 4IAOA 4MWSA 3WL8A 4G97A 5H16A 3RRMB 4L76A 5AW9A 2HO4A 3ESAA 4KG7A 3C24A 2AUMA 2FNAA 5JYCA 4DV5B 1V7QA 2NU7A 7GPBA 3ZLUA 2V7TA 4KLAA 1SVOA 4ZAVA 1WVGA 1G18A 3PHLA 3PWSA 3R9KA 3NHFA 4WJLA 1HLPA 3CJTA 3FWPA 3V5NA 2NO9A 1ILEA 4JCCA 2CHXA 2PYDA 2V7WA 1PJSA 4GX0A 4Q7LA 4QTTB 1H6DA 1VPTA 3KYBA 4HDMB 3EXIA 4GFDA 4ABNA 1RYEA 4RY9A 4B6FA 1U0GA 4DYDA 3SXUB 1IOZA 1SHLA 1OFVA 4X3PA 4M0KA 1QLWA 1OLXA 1JA0A 4OMCA 1SOMA 1AH2A 3KEFA 2ZE6A 621PA 1EE1A 3D4NA 2J4DA 4TV9A 1KZPA 4H7IA 2QL7A 2HR2A 2ASVA 1IXSB 1VSQA 3DO6A 3GRAA 2BMVA 2ZDQA 2GROB 3H5LA 1ZR2A 7MHTA 2V0NA 4KR6A 4K2HA 2C2ZA 4H7EA 5K8UA 4IKEA 4D25A 1BQ3A 1N6NA 4HJXA 4OQMA 1NG1A 3V30A 4M1ZA 2GCOB 5CYFA 1EYHA 5DNCA 2NN3C 1MJ5A 4ZI7B 1CJUC 1F8YA 2C03A 1C1DB 2WM9A 2WU3A 4ENUA 2YWJA 4KQ9A 4OEHA 3USES 2IRWA 2IYYA 4G8KA 3BAZA 4LVCA 2CK3D 1M1YB 4HZUA 4YRTA 2DUJA 5IKMA 1GWNA 2CMFA 1QFYA 4LZPA 4RMHA 4B48A 4NURA 3BAFA 1J5PA 2F0YA 4JOSA 3GGGA 2AE1A 1CLUA 3LFUA 1U8AA 2FW6A 1NJSA 3E2PA 4F85A 4EUSA 2G8NA 4R9UC 1W94A 1YA6A 3EUVA 3LCCA 2VJDA 1XKQA 4TTTS 2DPGA 1MCZA 1X6VA 2XUJA 1ZIPA 4FHDA 3I6MA 5GPBA 3G9QA 3VOSA 5JJ6A 1LPPA 1U0FA 2BGLA 2W6MA 3H1GA 3NNNA 4B89A 3I83A 4G5RA 5FORA 4ME6A 4F8JA 3GJ5A 4PZZA 4DQLA 4X8MA 1HMPA 1OVMA 4DYHA 1UMCA 4GPEA 4GAEA 1EF1C 4GTRA 1MB2A 2B7LA 1DEOA 1N2ZA 1ZINA 3IXEA 1Z6XA 3SLGA 4CYMA 4GR5A 5IDWA 1BDJA 1F1BA 1XEWY 4RFVA 1MDBA 2L19A 2VF5X 3IPAA 1G9TA 2XMBA 4PR3A 4TYWA 1ESMA 2FSPA 1P0MA 2HWKA 2UYHA 5EUMA 5I7VA 3ZKWA 2IHTA 5KI6A 3ZUPA 3UJPA 3GGCA 4CEIA 2WE7A 2X6JA 3GVHA 5G1NA 3CQ9A 3HBAA 5LKRA 4EJ2A 1E3WB 1TA0A 4RY2A 5ICGA 5KBAA 2F9MA 2HDNB 3QDNA 3RRUA 3GLTA 2AEEA 1M34A 5BPFA 1KYWA 3PNLB 3CIOA 3G2MA 4XI0A 3ODGA 2HRBA 4UNPA 3TRJA 5CDHA 3AETB 4JJAA 2WJ4A 5A7FA 1PGNA 2C31A 4A3TA 4GRIA 3FLMA 4FKBA 1WNTA 4L4RA 3UW3A 1NURA 2ROQA 2K87A 4NDNE 3KAJA 3QEBZ 1DRWA 4IJWA 1ISPA 2O5VA 2KBXA 3FWVA 4E31A 1I30A 2TMGA 3NBZC 1I7QB 5D5QA 1U5BA 3PC3A 3BGOS 3LNTA 1RWOA 1I4TD 2VPYA 3QGMA 2G0TA 5B1YA 2CNKA 5EVCA 4AZ3B 6CHYA 4PBTA 4PS8A 4R4JA 3JZIA 4XRGA 2PE5A 2JIDA 5G53C 1ZRSA 4YFVA 1FFGA 4NDZA 3N7TA 2ZANA 4F93B 3HCWA 4IJ6A 1P5RA 1LRJA 2JGEA 3QWWA 2GN4A 3OLVA 5IJXA 1NVUQ 4BO9A 4DSZA 2H63A 3NBAA 4S0XA 4AP5A 1UMKA 2G3YA 3JWHA 3PQ5A 4XE5A 3QITA 3ZVRA 2ES4A 5FTJA 1ORDA 2HPZA 4Z49A 4C7KA 3W9UA 1ZUHA 1SVWA 2F6RA 1WG8A 2X77A 2O0MA 4E6HA 1IBCA 5FHQA 5J59A 4DR2B 2ZOSA 3TOVA 1ESZA 1SXHA 1SBCA 3CNLA 1CHNA 5CDFE 3CRVA 3RNOA 3COWA 4ARZA 1P2GA 2X4LA 3G17A 4OK5A 2B9VA 2C96A 3HDJA 3T3HA 1UP7A 5J3JA 4I9EA 1F17A 5I7WA 2DVWA 4N8EA 4JA0A 1TQ2A 2WD7A 2DU8A 1HQKA 1N3BA 3QEOA 4PY2A 3KKEA 3T7JA 5G2OA 1Q95A 3C7CB 2PANA 5AHWA 2CNBA 2Q3CA 3ZW7A 2WLSA 2ZIZA 3DQQA 3AESA 1FFXB 1KIFA 3BSSA 3A3OA 1TQ4A 1M54A 2C20A 2ASEA 4F71A 4XZ4A 3VSBA 5HS0A 2BKVA 3K92A 3JCZA 1R50A 2HK9A 5FT9A 4FYPA 2OFPA 4G5QA 4URVR 4NXMB 1T1IA 3UWDA 1H2EA 3MC1A 3KIPA 1BE8A 2Q9BA 4B5LA 2G0AA 2LAHA 2G36A 2ODAA 2P11A 3CEMA 3H9JA 3MGCA 1KDZA 2O8FB 1U3DA 2A9OA 2VA9A 1MX6A 2XZLA 5EPUA 4I55F 2WZCA 2PLFA 2MMGA 2KYRA 3BGSA 3TLKA 3RC2A 2OXFA 4PZUA 5IZ4A 2VSQA 1T9ZA 4CTNA 1KNQA 4LE1A 1GUZA 4OHOA 4RLFA 2XNKA 1NW6A 2Y9MB 3MMXA 4QGFA 1DKQA 4KZ0A 1OYWA 1YMPA 2N1BA 1GPLA 3L01A 3NQ41 1SKYE 4UEQA 4WK0B 1QIKA 1QGOA 1EK2A 2DBRA 2VP9A 4MCJA 4KVFA 4MW5A 4RXUA 2XPIA 1V45E 4LQDA 2AUNA 1N0RA 5CPFA 3RLIA 2WSIA 4AJOA 1L7XA 1S5PA 2EATA 4WNDA 1DL5A 2VATA 3OC0A 2OKCA 4FLMA 3PEVA 2QYUA 3N2ZB 1VLQA 1QPGA 1VIMA 3GPIA 4CYMD 4G85A 3PJGA 4M6WB 5JO9A 2R6JA 4V0QA 1QCCA 4A73A 1JALA 4KWIA 5FYDA 4RTSA 4UPEA 1JEQB 3AV3A 1RHRA 3QBDA 2PQ0A 4DCTA 1WCV1 1P3JA 4EB0A 1JFTA 1QPZA 2AMJA 2OB2A 5I48A 2JFFA 5EHNA 3D59A 2Z2JA 2OZLB 3IQIX 1TZ2A 2C61A 1O03A 1USUA 2ZGDA 2FZGA 1M1YE 3N0XA 2BFEB 1XROA 4BNNA 2V7GA 5DSTA 2ZBDA 1OGJA 2X2FA 2CHWA 5LMZA 4C0XA 3JQCA 1D2GA 3UIOC 1XDGA 3E1KA 2BBWA 1G7SA 4WZ6A 2D8AA 1VFPA 3CVJA 1OLSA 1KVQA 3UJ7A 2CUKA 5HGXA 2CK3A 2O0JA 1Y6GA 3O3NB 4ECAA 3K0EA 4BUZA 4APOA 2A1TR 5FTKA 2JZOA 1USVA 3RAGA 1T34A 4UWKA 2JGFA 3E48A 2AFIE 2YJZA 4C2AA 1I4OA 3W5BA 3UQZA 4QG3A 1J49A 1J8VA 4OBXA 1KMHA 3IP9A 2O2JA 1N5OX 4G6ZA 3VZSA 5I6DA 5CFZA 1Y6QA 1WCIB 4TUYF 4MJLA 4CMBA 4FP9A 2BT4A 5IKPA 1JFLA 2HCTA 3KE8A 2FHPA 2PSSA 4FOSA 5JZSA 2E0IA 1G8HA 4ZOLB 4G24A 3WLEA 3S81A 4BMSA 4EQ6A 4MJXA 1QGUA 2PGOA 2YJNA 2O50A 5ER6A 2FEWB 3APDA 1X1SA 4PXAA 4RCYA 2QD4A 1NVWQ 2LCFA 2J6IA 3R7AA 5A06A 2DFVA 1L3IA 3NOQA 1FYDA 1T8WA 5EUBA 5K6AC 8AT1A 4HH4A 4C4RA 4UZSA 4YDYA 2GEUA 1OY3D 3TAHA 5G04J 1S8NA 1Z3IX 5FJYA 3MMPA 4JI6B 3TLXA 3UMRA 1J06A 2O0KA 1NR7A 5KOHB 5T3YA 4P86A 4OUKX 3REOA 1DSSG 4KDRA 4MI9A 4WIAA 3WGOA 3ONEA 3U09A 4HMQA 4CI0B 4B7ZA 3ILXA 1BHJA 1VBFA 3KYDB 3CLJA 4P83A 4XX0A 5H7XA 5EHXA 1HO8A 2MHKA 4I5DA 4WSOA 1IK6A 1OA1A 1PDWA 1Q0UA 1H22A 3JZDA 3BWDD 4R81A 2GK4A 1BMTA 3DLBA 5K0JA 4G0UA 4LF5B 2JRCA 5I01A 3GYZA 1D8TA 2WF5A 4JQZA 2YYSA 4HX5A 1RQGA 1A8PA 4F92B 1U8TA 2VCYA 1NBOA 3ILHA 4HRLA 4TUMA 4IEEA 2QL6A 3U7HB 1SVIA 4R6XA 3OZFA 2WHQA 4OB7A 2VQSA 1OKKA 1MJ0A 3GHHA 1Q7RA 3AUFA 3T9EA 3JX9A 4WUYA 3RS3A 2HUNA 5SZIA 5I8PA 2CFUA 2HSGA 5HRAA 3LT1A 5DT9A 1MO6A 3DL2A 3FYCA 2ST1A 4FE4A 4EG8A 4IIXA 5BMVB 5CCMA 1R0CA 3LL7A 3UJAA 4GWKA 4YJ3F 1TJYA 2P40A 5JSZB 2OXEA 3QXCA 1H42A 4NG4A 2HYIC 3ZBPA 3DRAA 1EXDA 5IVDA 3S2UA 1ZOIA 3LBIA 2KCLA 3SHFA 3OPQA 2BFDB 4I9UA 1Q2UA 3TQTA 4CIWA 1UFKA 2YW9A 1XPJA 3VTZA 3PX3A 1FYXA 2QYSA 3DSVA 1FMTA 3ZWDA 4CGVA 2DBQA 4G07A 4QIHA 4MINA 3KR0A 4XFJA 3U26A 4F4FA 2OZEA 4M0PA 3LHKA 5FIUA 4IINA 4UEWA 1XMQB 4A0GA 4LYEA 2HBYA 4DA0A 4TZ6A 2CVPA 1TK3A 1UOPA 2PGLA 2C3MA 3JATB 2HA4A 3N0TA 4GOND 4IMRA 4LGVA 3FUNA 1N0UA 4O2AA 1EJ2A 2AZMA 2DH6A 3QUSA 3O95A 5ALJA 4QYIA 1H4TA 3LPCA 3S8EA 1TYAE 2IEIA 4NPHA 3OY7A 4Y18A 2PWBA 4CKCA 3IE1A 1OCOE 4JXJA 1KJWA 2O8DB 1XTZA 1G3MA 2ZI7A 5NULA 5J2UF 3DMTA 3CZPA 4YDEA 3D2CA 2FW9A 3EDTB 3RO3A 2JAQA 3OOHA 2XV1A 4RY8A 4RAOA 2Q3FA 4MARA 2QB5A 3W1WA 4RACA 1WZUA 5IUJC 2O2IA 3DE0X 3G82C 3IAFA 3A6ZA 2YRWA 3CT6A 3SBDA 4H7JA 1BIFA 1I2DA 3IT2A 3SIXA 1B26A 1RKUA 1TM1E 1U90A 2ETXA 4M4SA 5AW1A 4L95C 5JS1A 2CDCA 1QF7A 4NPCA 4G89A 1THTA 4GSYA 1OH5A 4HQFA 3GZNB 3CH5A 1UOOA 5FWYA 3U4GA 3KSBC 2AZTA 3S7JA 2H4XA 3HJRA 2WPVA 2B1JA 3ROKA 1X8XA 1U2SA 5LA6B 3O9VA 2VNAA 2R1VA 5IJWA 4FMDF 3GJ4A 4B7XA 3A28A 1WCWA 1KJZA 5SYAA 2BKLA 5TB5A 3TXXA 2IFUA 3IT0A 1GT6A 3K15A 1H8EA 3H5NA 4BEBA 4ZHQA 3BILA 1KO1A 1EM8A 3ZQJA 1WLYA 5LA6F 1GXSB 3CF2A 3GRYA 5KSOA 4JEHA 3IESA 1FTYA 2A33A 3H65A 3I9JA 3T1HB 1U7DA 2I1VB 3JUIA 3SSOA 2FKNA 1ML3A 5REQB 3BN3A 3VNUA 1E79D 2CVFA 3TNYA 1NTOA 1YBHA 5LIPA 2B25A 4OAQA 2BFBA 2A4ZA 2C4WA 3HA5A 3P0EA 4XSHA 1P1IA 4YJ3B 3EUAA 3DVQX 5FA8A 3ZDDA 2R59A 1BG6A 4PFSA 1ZD5A 4YJHA 1KK2A 3H5OA 3LAWA 5ULLA 1VECA 1UXOA 3TQCA 3EU9A 2ZB7A 1HDRA 4MPRA 1JDNA 4ATGA 3ADPA 1MB0A 4PNHA 5F5NA 4GW3A 2D3TA 3NHKA 1J07A 4D3ZA 5HQ3A 2GI4A 4HPXB 2G28A 1EUQA 3L18A 5AYWD 1IRXA 4KQEA 3V3KA 1RP7A 1GHTA 3O1JC 5JOQA 4HWRA 3NJ8A 2OSBA 2J5KA 1W5AA 2JAOA 3SIWA 4FP7A 5AFSA 5D1NA 5K0CA 5H68A 4WBXC 3UXEA 5KNBH 4WRRA 3I9LA 4DNPA 1TF2A 4MYUA 5J90A 2PAFA 2EDCA 3R0JA 3R44A 4GMHA 4XM0A 3LCRA 2Z3VA 3AB7A 4IKOA 1BCSB 5D5PA 2WKRA 2ZYGA 4I4NA 2FOIA 1QF6A 2J85A 3UPVA 4JLUA 1PVVA 3B1XA 1D4FA 1YGYA 2E9SA 2FMUA 4I08A 4JSRA 2OUIA 1ZPDA 4QUDA 5FHRA 5KKAA 3L8HA 5BNTA 4JXKA 4LJ9A 2QG6A 4K9QA 2BFFA 1AURA 1M8JA 1SHZA 2E6KA 2R79A 1EGQA 2KJQA 5FL7D 2OLKA 3LV8A 4R3UC 4IDOA 1KVTA 4MUEA 3TK1A 3BHNA 5CCLA 3AW8A 3L41A 1JI0A 1NVXQ 2QIOA 1L4BA 3C6XA 3EPJA 4RWEA 2X0IA 1JG3A 2Z9DA 4U8VD 5CEDB 2NLOA 1HSOA 4FEEA 3CX4A 3RJVA 1R8XA 4KMRA 2HO1A 3HJFA 1TKRA 1VLVA 1R64A 4JVSB 2Y68A 4RJ2A 5A9TA 5LQJA 1RE1A 2TMDA 1XYVA 3MZLB 2RARA 1RFGE 2PGXA 2WHPA 5G2NA 1KI4A 4TUYB 1SR8A 3PQEA 1AP7A 2Q7DA 3MWJA 4MQUA 1P2SA 3JUEA 4UVEA 1P2UA 5LD2B 2GX6A 3TWQA 4REQB 4OBBA 2I8AA 2C9OA 1BXZA 4PPFA 1VZ3A 1Z5PA 2X0EA 1P31A 2GH1A 3HKBA 4I36A 1JJBA 3ZHYA 3ZWXA 2UY1B 2NT4A 1IVYA 1EUDA 2QN2A 2BHNA 2OBBA 3WLAA 1CZKA 2AMLA 2YY5A 2IT1A 4PTZA 3BIXA 2WB4A 3D5EA 2FO1E 1OU0A 1U9IC 1WAMA 1WVMA 1C9EA 1U81A 4TM8A 2NNLD 4NQ0A 3U3ZA 4BYGA 4XJSA 3CKKA 4X20A 5IT9A 3PP8A 1I7DA 3KTOA 1BU8A 3ROXA 3K2EA 3W8EA 3ORQA 2WA1A 4IDBA 3T0GA 4P35A 5GGXA 3VNAA 2IZ7A 4PX5A 3ME5A 4K6FA 3SFZA 4PC1A 3TI9A 2GAAA 4X6LA 3RF6A 1RXSA 2A14A 3E5HA 3OY2A 2HQBA 3PHHA 1E96B 1QX4A 1XL1A 4BJHB 4BNLA 1YL5A 2J0UA 5D2MC 4NRHB 1E7MA 3NP7A 4UNRA 1NXVA 4YP6A 3IQZA 3CHMA 2IHVA 3EAGA 1NJFA 1OXXK 2WPNA 4F04A 4C6RA 3H8WA 1Z2NX 2I54A 2C1ZA 1HYQA 2ZB3A 4PC7A 1R0YA 4Q03A 2AXEA 4RSYA 3FMGA 5KHOC 3L4BC 3HVEA 2R62A 3QVTA 1P7VA 5AQ7A 1BVHA 3E0QA 3T38A 1VPEA 2MSWA 3TNJA 2ZISA 3VX4A 3OZXA 3DKPA 3LX5A 1U5CA 1N3YA 1AM4D 1NVDA 5ADHA 1XWIA 4FOLA 1A9RA 1RWXA 5LP0A 4FT2A 3S70A 3F98A 4FB4A 2CUNA 3HO6A 2R8BA 2YIMA 3GCGA 1C2TA 1YSCA 2AI3A 3PNVA 3PU6A 1PJRA 4O6VA 1GU0A 1DAMA 2G9RA 4QPJC 1JGTA 1Z7WA 3QUQA 2AH5A 2HI0A 1HA3A 5ITWA 1OIWA 5B1AE 3KB2A 1XK7A 1M3SA 1TAQA 2XUPA 2HPHA 3GOHA 3GEEA 2H52A 4MAAA 1R5JA 2ZQ5A 2V0PA 2WUFA 1PWXA 3D6FA 4Q16A 3V8RA 5JNVA 2NU9B 1GGJA 2NP7A 4JU8A 13PKA 2DRIA 5E9WA 4EHKA 5CNMA 1NI4A 3UO8B 3QHPA 5A5VA 4GMXA 4W5OA 3QIVA 1VHTA 1T9KA 4I0WB 3U6BA 2GXQA 1IKND 4A7PA 1Q3TA 2VP6A 2Y66A 3K9HA 4ITUA 4PYNA 3I5UA 2FSIA 1I7PA 1UMDA 4ZO7A 4DA7A 2AF3C 3ASDA 5CB4A 3DHVA 2AOUB 2HU2A 2ZJAA 3I5AA 5BSKA 1SZPA 1SUIA 1AQ6A 4KFSA 3GFQA 3COPA 2F48A 4M9CA 4NR0A 5ALQA 2IGTA 4ESEA 4F11A 4YRNA 3CR8A 1A88A 5IT4A 1TOAA 2X2EA 3OQ1A 1KYVA 3A70A 4HAUA 3LYHA 1SIUA 3C70A 4B3XA 3UGKA 2QX4A 3EZXA 3LF1A 4RFLA 3VSDA 1VBMA 3RYIA 4M7PA 5EIHA 4ZOBA 5EUQB 3NPMA 1SEPA 5EXTA 4OL9A 3GLIE 1GA6A 4FEYA 3P9NA 5B58C 5JZOA 2G4CA 1A27A 1H2BA 1SAYA 1Z6QA 5A9RA 5TEWA 3ED5A 3MUEA 4E1AA 3RYCB 1Z82A 2AYYA 3UINC 3BB1A 4ZAGA 5IP5A 4PZAA 1GD1O 3DL7A 3EVAA 3PRHA 3VYTB 4ENTA 2HY7A 2NMVA 2Q5JA 2RHGB 4B82A 2EILE 3A4MA 4GQAA 4HG2A 2B94A 5FNZA 5GV7A 4RF5A 5KJEA 3WTCA 2PMEA 1PO7A 2B8NA 2VRCA 1YRAA 1A7UA 1KYZA 1ULUA 4ZYXA 3GP3A 3TAUA 4TYPA 3IDAA 1NRJB 1R66A 1O97D 3NWBA 4R1MA 4HLUA 4WXMA 3B12A 2XGOA 4YVFA 5IDQA 1KEEA 3PFBA 4HLNA 5A71A 3P9IA 2X9NA 3R2JA 4EGSA 5C7OO 4ZVMA 3D6UA 1YE5A 1O5OA 1QIMA 5JPDA 3K9GA 1P5QA 2BF7A 3KOUA 3N3BC 4HR7A 1C4OA 1JXAA 4LS3A 1W44A 4E70A 5GINE 2B1IA 4NYJQ 5HHTA 1HFWA 2QMHA 1KPHA 2KX7A 3FYSA 4QSHA 3GGOA 4XQCA 1C7ZA 4DEVA 1HZJA 5KHLB 2DWZA 5F7OA 3NIBA 3VAYA 2GFIA 4PWYA 4RDHA 4RPLA 3RS2A 1EP2B 2JHCA 1YZFA 3NEAA 1N5KA 1X7ZB 2QP4A 1KZYC 4JKYA 4D98A 4D82A 2WAOA 3AR8A 1EDDA 4HN9A 3ZNGA 5ANRA 5IDXA 2FAXA 4FU3A 2P9ZA 5H81A 4NE7A 1UQTA 3H6KA 1UBGA 4ZGWA 2UZAA 3LF2A 3RFUA 5SY9A 3TRKA 3CZCA 4DR7B 5EMHA 4IDNA 1HK7A 1MV8A 1Y89A 1A2OA 2EL9A 1OX6A 2A9QA 4L2LA 4RG9A 2FUKA 3D31A 3GRCA 1M1UA 3P97A 4UASA 4EDFA 4NBKA 4ZREA 2OY0A 4W5TA 4KIJA 2HHJA 3Q2IA 3A6DA 4GMLA 2PWYA 1OXVA 3ITNA 4JLSA 3BJRA 4PXSA 3FXAA 1OYVA 4BZXA 5KNDD 4ZQGA 3G2WA 5ALVA 1ZRHA 2PZJA 2WA2A 3K94A 1C4XA 1MH9A 2R5SA 1FUIA 2R25B 3OETA 4Q4AA 1K8ZB 2OUKA 2JA2A 5CDYA 1VJ0A 6AT1A 2C2LA 3HCAA 4G8BA 2FN7A 1EGMB 3PITA 4XGIA 3MYVA 2BW0A 1IHUA 2QU8A 3IDOA 4ARZB 4CW7A 4AKGA 5FFFA 3PZ4A 3H0CA 1ZITA 3HPQA 3T4UA 3TGPA 3EIHA 3MWEB 4Q1DA 4DREA 4EI2A 1BD3A 2YHCA 3Q73A 1TYZA 1VJDA 2R00C 3ICWA 4DR5B 5ITSA 3ZD7A 5J63A 1UJRA 3OZSA 4JU9A 4IXWA 2HXYA 1VSVA 3V3LA 2D8MA 2J3JA 3U3DA 4KXXA 1FA9A 1NQTA 5JTUA 3M70A 3OG9A 1IC6A 5EX3A 4OP1A 3W0LB 4Z0PA 3ZHSA 4AKHA 3ZVVA 3RRJA 3LLCA 3G2OA 4GTQA 1GLGA 2IY7A 2YFKA 3FJYA 3M4XA 4K88A 4DV1B 1E8WA 5JBNA 1K3UB 1PVDA 2E21A 2BGJA 3GJ8A 5JXJA 2FFAA 3GLSA 1YS7A 2ORED 2Q5OA 2PD4A 3C3BA 5TXGA 1T2EA 2H07A 3V97A 2AFHE 1CQIB 4XPZA 5AD1A 1DAFA 4MVJM 5LBUA 4Q00A 4L16A 1YTUA 4UAJA 3DD5A 3ZYZA 4C14A 4LOIA 1EKXA 2OE2A 1GAXA 1ZX1A 3QF4A 2VDWB 1L4YA 3DTVB 4WK6A 1KJ8A 5ILGA 1UBRS 4B33A 4TS1A 2EIME 2PH1A 5ALOA 2GD0A 4YYZA 4QPDA 4EZEA 5CLLA 1S7GA 4H7DA 4AG6A 3M9WA 5CA1A 3GLRA 1G66A 2F1OA 4FDLA 1CRPA 1G4UR 3VNBA 1PW7A 2CV2A 1XVAA 2PMKA 2WE8A 4HEHA 4X7PA 5LYYA 4NACA 3HRKA 5LWQA 1DJOA 1Z7EA 2WIBA 4Y2VA 3JQ0A 4FA6A 1S96A 4J8FA 1ZUNA 3NONA 4MO2A 2QPTA 3W05A 4BFVA 5IYZB 5JO0A 1HE1C 4E2XA 4BFLA 3LJ3A 1Q21A 1PGJA 1QFMA 3Q1KA 2I4IA 4YROA 1RACA 3KM0A 1AQNA 4HQOA 3K71B 3T3DA 3JQ9A 3DE2X 4DX6D 3EEYA 1V96A 3HP4A 3PNYA 4M21A 4CV2A 5JAHA 4TM7A 1MU0A 3F5DA 3CHYA 1TZMA 3HJCA 3L16A 1BS2A 5BT9A 3ZHUA 4M8NE 4Y0NA 1KTIA 1GLVA 2YVQA 1W5BA 2Z30A 1PK9A 4XCVA 1VSTA 1U2RA 1X7ZA 3UUWA 4BVJA 5J43A 3E9MA 2X9VA 5T41A 2VPQA 3K70B 3G59A 4AS2A 2R4QA 1X1BA 3BTVA 5IJAA 4DBZA 3SLKA 4RULA 4JWTA 4KRGA 4M1KA 2XTAA 1OROA 4HP8A 2H06A 4TTVA 3LGSA 1UMBB 2PV0A 3ZZTA 1DPFA 4JC5A 3ZE9A 2Z43A 3NS7A 3P5SA 4BXOB 2PX8A 5CLJA 1LLQA 1E89A 2PO5A 3B9RA 3DKIA 3AFGA 5EINA 4IIDA 1Z0FA 4WCVA 1Z28A 4Z54A 5IK2D 3NB2A 4C06A 2DHEA 4UMVA 3RROA 1S1CA 3BMNA 3HJHA 3W2FA 1FTNA 1XRQA 5F9HA 5FULA 1RRKA 2HU8A 3WK8A 4NZPA 4UCWA 4WZAB 4ALIA 4JLOA 3GLFA 4CDRA 1GKLA 7REQA 4F4CA 5FWDA 4PH4B 1TK9A 5GV8A 2PL2A 1EVQA 5HM6A 1C0IA 2OBLA 3WYBA 2EX0A 1GKIA 1ADGA 3G68A 2ZETA 3DOFA 1UBKS 4B6GA 4EUKA 4LF8B 4AICA 1VM6A 4G5YA 4MO9A 1L5JA 5FH9A 4JBNA 4NFLA 2XA9A 1ADFA 4Q3DA 1EMDA 5FOVA 2UWJG 1Z4JA 3T7DA 4EJ0A 2GZMA 2LNIA 3FBWA 4MSUA 5LZ8A 3ZPXA 1CRQA 4NU8X 3ZRHA 2ORWA 4GLBA 3AX6A 3AMVA 5H3LA 4S1PA 3TWXA 3DR5A 1QP0A 4R7LA 3L0SA 3OOWA 2HCFA 1M10A 3H86A 1UMCB 2R6ZA 2QTTA 2DE0X 4O0MA 1C3OA 4HORA 3OOJA 4IRXA 1T1RA 3ASYA 5KOYA 2C82A 3E2IA 5CBNA 1ULSA 3IQGX 1SVNA 3L7BA 2VYFA 1CF2O 5KYVA 3VO1A 3QU4A 5JWOA 4KLRA 4WXPA 1C9MA 3OJCA 5ENVA 4QTYA 4P0PB 4G0QA 1XEXB 3GB9A 2IP2A 1QHYA 4NICA 5ELLA 5ERXA 3M6MD 1N5DA 3F2IA 3ZQUA 2XCIA 1JXMA 2OQ2A 4BNGA 2EFJA 4RTMA 2QI9F 1OCCE 1I3OA 1ZU2A 5FOSA 5T8KA 4CGWA 2AVPA 1NQAO 1XR3A 3C3MA 4LRWA 1PDVA 3PUHA 4LXUA 1YZQA 3R9IA 2Z08A 2C7VA 4XR9A 4AM9A 4YAFA 2YHBA 3PRJA 4IF4A 3V7WA 5IF9A 2AF4C 2SHKA 5CTJA 3LPZA 4J0JA 1N3LA 3HVHA 4QGAA 1Q44A 4RMNA 4PIPA 4LERA 3ZQKA 4Q19A 5LJIA 5IASA 1UFOA 4LWZA 3R3ZA 1YQWA 2C0LA 1DCFA 2XYQA 4Y7CA 1K89A 4C3ZA 4YCNA 2MINB 5DV9A 1KZ9A 3RKUA 5JSFA 3W8RA 1RM4A 1C7QA 4DLUA 3EGDA 1BRTA 3HXTA 4C88A 2WNIA 1PQPA 3UXMA 2EKZA 4WDRA 2PL1A 3K1JA 2WYVA 5FTMA 2Q8PA 4PX3A 5E1MA 3MTIA 3A9UA 4DMGA 3H7AA 1ZY2A 1G60A 4Z7NB 2O8DA 1KFJB 2GN0A 4UYJB 1IJBA 1CZRA 3KQYA 5CNIA 5EHGA 2MCFA 1VL8A 2W2QA 1A9XA 2PS0A 3H16A 3LDZA 4IO1A 1P75A 3UJHA 5AJDA 2DH5A 5EMLA 2ZUCA 1L5HB 4ZODA 5JWHA 2P5TB 3KVNA 4N5DA 3JW8A 3LZ6A 4DR1B 3M89A 4B84A 1EFVA 4CG2A 1ABBA 1Y33E 3QVOA 2WXOA 1F2TA 3EGXB 4LJ4A 2QTNA 4G1EB 4YI5A 4DSNA 2WWWA 3GL9A 4X65B 2ANCA 3G8AA 2XDQA 1YVUA 3NHZA 1W85B 2X5XA 1XRMA 4EHMA 4HADA 3OJLA 4M38A 5IJ0B 1S02A 1KJQA 3G6WA 3ECSA 4KMMA 2CFZA 2PMFA 2X3UA 1BCSA 4NYMR 5ICSA 4AKXB 1R6AA 2IXTA 3TW0A 3W8NA 1ZDMA 5AIJA 2IW1A 1WD7A 2IHNA 2VHXA 4WMLA 4M9ZA 1TO2E 3UB2A 3LA8A 4P6VF 4JT4A 4LNUA 5LQAA 3SQVA 1N2XA 4EBBA 4CTMA 5AXDA 4U7HA 5HTOA 5T3UA 4HBGA 5EHZA 2NUPA 4HFNA 2NO4A 1KZOA 4KQMA 3RHFA 2D1FA 2WTAA 3J5QB 4ZEMA 1E6WA 1QQ7A 3ECAA 1HQYE 1OJLA 1TJNA 2A5FA 2H4JA 4FXOA 3DXFA 4F7AA 3EEQA 3N07A 1QZZA 3NTVA 3E18A 2FMIA 3A7EA 3EQ7A 2L0IA 4X8OA 4NH0A 3B7BA 2G9VA 3HI4A 5AVJA 3T5AA 2O8FA 5JSHA 3WGTA 2VS1A 4YRDA 5A05A 5K1ZA 4I50A 2JJ2A 3SYMA 1PJ3A 5KVQA 3W7AA 2V0GA 3E5RA 4GOXA 4LVNA 5DN6A 5DTQA 2VUSA 3QKSB 4L5JA 3FKJA 1TRKA 1EGAA 3D3WA 4UU7A 5E6SB 1KYTA 3G2TA 1N9KA 4CFZA 3TG2A 4ER5A 4QM7A 2G7MC 3CEPB 4WKGA 3ZJ4A 1M83A 3SD7A 4DV0B 2MR6A 1TU0A 1XOIA 3GP8A 2GR9A 1PJ4A 4FX5A 4RPJA 1EHIA 2COKA 2JG3A 3E9YA 2Z58A 2IQ5A 1VL0A 2IW3A 5HI7A 4G65A 1D2CA 4Q93A 3U7EB 2VDRB 7ADHA 4IHJF 1CUGA 1K3TA 5DSZA 3I12A 3VHQA 4DLOA 3I6IA 5TQ2B 2Q4EA 1PV2A 3O8QA 3MKRA 3KJXA 2IPNA 5IVPA 1O4VA 2HFJA 2VDMB 2G9NA 3QLJA 4EOGA 3O8OA 3M2PA 2AQ8A 1Z4LA 2QRNA 4ZPJA 1NUPA 4CN9A 4LZJA 4DA6A 4DRZA 4D26A 2EDAA 3PL1A 2P4UA 5BSUA 1R0KA 1XT6A 3SJUA 1IHOA 3D9HA 4CMIA 1M2HA 1YCGA 2KLBA 4FKMA 3D43A 2OHFA 4MWCA 2Z9BA 5DOZA 3V48A 5IJ0A 2A1UA 4TKUB 1K4YA 1NSYA 2X5OA 3NHMA 1QMPA 1YA4A 4IZHA 3VTFA 3QUCA 4HFRA 4UAGA 4XD7D 4X61A 4IDPA 1OFTA 2J30A 2VLBA 5HG0A 3TKAA 3VTXA 5U4QA 3X1XA 1AMOA 2ZUEA 4NLLA 2DMRA 2ZJ4A 1YI8A 3I4CA 2AXZA 1VP3A 2BGIA 2XEDA 5CLIA 3B1KA 4F1JA 3L1JA 3LWBA 2IP4A 4NYIR 2YQ5A 5L3ZA 2CHFA 3DTVD 1CB7A 1LC0A 5JPIA 5HKBA 2X6FA 4S1NA 4CL3A 5C3MA 1U0NA 1U2EA 4ZP1A 2A0UA 4E2YA 1BQEA 5TPWA 2VYND 3WFIA 1G5PA 1CR0A 1E66A 1L8LA 2Z3WA 3VZBA 1XJWA 3L22A 4BERA 3TM4A 3I61A 1TGVA 1V8ZA 4EHFA 1RRCA 1R00A 4P92A 4MZDA 1E3DA 2DT8A 4QJBA 3N75A 4KLNA 5BURA 5EILA 4PDXA 1N8KA 4RYDA 3RT1A 4H7KA 1BXKA 2I6UA 2RI1A 2YIJA 2JGIA 4QTZA 5P21A 1A9SA 1UZAA 5CYOA 1E96A 4YIKA 1RYDA 2YV4A 2XXAA 1QTNA 1K5GA 5AYVA 2P9NG 1AKWA 2A4MA 1TADA 3BK7A 3F3YA 3KZNA 4UQOA 3A58B 1RLUA 1XHEA