4XI9A

Human ogt in complex with udp-5s-glcnac and substrate peptide (rbl2)
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
717
structure length
698
Chain Sequence
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The active site of O-GlcNAc transferase imposes constraints on substrate sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 266
structure length 698
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xi9A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xi9A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4xi9A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4xi9A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xi9A03
2FO7A 3WAGA 3QDNA 4MI3A 1Z6QA 3RO3A 2IUYA 3ZN3A 3DZCA 3NCHA 2QLMA 1YA6A 1E1YA 5JJ7A 3GPBA 3URZA 3AS4A 4MRAA 4RIHA 3OXGA 4NRHB 3ZGQA 3NPAA 3L01A 3S28A 3JYSA 2FEZA 4X7PA 3LKUA 3VTXA 5G04J 3QWPA 1JG6A 2F9FA 5TMEA 4UI9C 3LYAA 5G05C 2GEJA 5LQDA 2XCCA 5DU2A 3L7AA 1RRVA 2GT1A 1GPBA 4YVOA 1W3BA 3RSZA 1Z6PA 4KQMA 2YQ8A 1JIXA 3BEOA 5EX3A 1GPAA 4MHOA 1P4GA 5FJYA 4Y6CA 2ACWA 1YA0A 4G24A 4AIFA 4U0ZA 3C4QA 4N2SA 3BD6A 1PN3A 2IEIA 5FZRA 4YNDA 3BCRA 4N39A 4M83A 3C48A 4G25A 2I6HA 1FC0A 2VQ2A 1P2DA 2QZSA 4RBNA 2WTXA 2XCBA 2X6QA 2GJ4A 5LCWJ 1BX3A 1IIRA 4LEIA 3QOUA 1P29A 1EM6A 2LNIA 1OUVA 3TAXA 2HYZA 2E2EA 2ASVA 3TG4A 2X6RA 1NOIA 3NAZA 4EKYA 1FTYA 2PRIA 4CTNA 3CV3A 4MHSA 5FT9A 1L6IA 4BQIA 1NA3A 3ASGA 4I1AA 3VUEA 2XA1A 2BUGA 1LWOA 3FROA 3AS8A 3ESKA 5KJMA 1XL0A 3S0JA 1FU7A 4HLNA 4EQFA 4GYWA 4U0UA 1NOKA 4U07A 3SZ7A 5C1DA 3S7FA 3Q15A 2KCLA 4BT8A 1VGVA 3H4TA 3OKCA 2H1FA 2SKCA 1L5SA 4HOQA 3OKPA 2G9UA 5BW8C 1Y8MA 2PQNA 1L5QA 3S29A 2ATIA 4AMGA 3RO2A 1ABBA 2NC9A 3CVPA 5TMBA 2XPIA 4N9WA 2OOEA 2PQRA 2GW1A 2O6LA 2QRPA 3LCAA 3E4BA 2C0LA 4M7PA 2VGXA 3U3WA 3O48A 3Q4AB 1P4HA 2QRQA 2SKEA 4J8FA 4GCOA 3HBJA 4RENA 3LY8A 2MHKA 2PYDA 4HOUA 5M72A 3OTIA 1HXIA 2R66A 3N71A 3DD1A 4G2TA 1A17A 3CEMA 4IN3B 1QKJA 1NZNA 2P6PA 2IV7A 3MTBA 3C4VA 3SYMA 3ZHEB 3CKCA 4GYYA 1FU4A 1EXVA 1A8IA 3H4IA 1C8KA 1KT1A 1GG8A 1PYGA 2IF4A 1JEJA 3ASFA 1FU8A 2PQ6A 1WW2A 2Y4TA 4PQGA 4CTOA 4W6QA 1AHPA 4EL5A 3MA5A 4CGWA 4Y6WA 2FFRA 5IKOA 3KD7A 2KCVA 3E3LA 2GPAA 3RIBA 4AN4A 3RT1A 4BQFA 2VCHA 2C1ZA 2IEGA 5BT1A 4WNFA 2ACVA 3QKYA 8GPBA 4U04A 3GYZA 4H7YA 3CUUA 4EKEA 3OXFA 4BT9A 4EL0A 1PNVA 3MRTA 2FETA 1KT0A 2FF4A 2VSYA 3ASHA 3RU0A 3NP9A 3ZHEA 4N3AA 2FF5A 4GPKA 1XOIA 1XKXA 4O6FA 3Q49B 1NZFA 3E3OA 3ZCUA 4GYOA 5HI7A 4G2VA 5ARFA 2JJMA 2FI7A 3FP3A 1UQTA 2QRHA 5D0QD 2V5FA 2IFUA 1AXRA 4GA2A 3MV2B 2VG8A 5D01A 1ELRA 4U0SA 4JHRA 1LWNA 3T3HA 5BNWA 5ARGA 2C2LA 2VSNA 4B94A 3BEEA 4RIGA 2FBNA 4A1SA 3GZ1A 2XA2A 4F97A 3OY2A 3GZ2A 2VGXB 5JJTA 4HOTA 1WUYA 3KS2A 5I45A 1FS4A 2WPVA 2G9RA 3VDMA 2XGOA 3MRXA 3OY7A 3ZCSA 1FA9A 2PZIA 3G2IA 2C4MA 1SXPA 1P2BA 2XA9A 4FKZA 3G2HA 4RG6A 3BDAA 2XMPA 3OTGA 4LDPA 3UQ3A 3HBFA 1QM5A 3DDSA 3O3CA 2X0FA 1XL1A 3D0RA 3CEHA 2KATA 2LSVA 1C8LA 5DXFA 2C9ZA 1KTIA 4KYOB 1F6DA 3MTAA 2QNBA 1H5UA 1WUTA 3D1JA 2UY1A 3S7DA 2AVPA 3MEKA 2QRMA 3AS5A 3L79A 4NEQA 5G04C 4UQZA 3G2NA 3WADA 3CK7A 1GGNA 1L5VA 2AW3A 4RIEA 3L7BA 1B4DA 3VDNB 1HLFA 2GM9A 4XIFA 4J0UA 3BCUA 4I2WA 1Z62A 1C3JA 4GZ5A 2F3PA 3KAEA 5FTPA 1Y6FA 4FZRA 4NQ0A 2YJNA 4GA1A 2JLBA 1FTWA 5GPBA 1Z8DA 4YUAA 3CVLA 2KC7A 3OKAA 3T5TA 3RSCA 2Q7FA 3S27A 3FFLA 3TGOA 1JIUA 3COPA 3DDWA 5DBKA 1M5RA 1UZUA 1NA0A 2R4TA 2AMVA 3FWVA 3BD7A 3IA7A 6GPBA 2QRGA 3RKVA 2GEKA 1ELWA 1NZDA 3Q3IA 3T3DA 1XV5A 3UYLA 3S7BA 3ULQA 5D00A 1Y8ZA 1WV1A 4BTBA 3CK9A 3VUFA 2DBAA 1L5RA 3MRVA 4J8DA 3VTYA 1L5WA 1P4JA 5DLDA 4KXKB 2HY7A 4GZ6A 3BD8A 2ZB2A 3S7JA 3R9AB 1ZBPA 5KJNA 4GZ3A 4YVQC 1WV0A 3SYRA 4UI9J 4MI9A 4AY5A 4I17A 3Q5MA 3Q3EA 1E4OA 2QFCA 5CCLA 1RZVA 2OFFA 4YI5A 4REMA 3OTHA 3MBOA 4N5CA 3NP7A 3RJVA 3MS2A 2R60A 4HORA 2PRJA 4W9RA 2C0MA 5TMDA 3S2UA 2XEVA 4N2QA 2YHCA 3MS7A 4GPBA 3TOVA 1NOJA 3SF4A 2IW1A 1UQUA 4KQ2A 1PC2A 3PE4A 1NVKA 3UPVA 4WHMA 3ZCTA 2KCKA 5A7DB 3UUXA 2IYFA 4WNGA 4YI3A 5DIZA 2QN7A 2P58C 4LEUA 4AY6A 1XNFA 1P2GA 3OT5A 3QHPA 3MV3B 2WQHA 5TVGA 3EDTB 4RIIA 3L7DA 1WAO1 3MT9A 3GUHA 1ZU2A 3CUTA 5HXAA 4RIFA 1FCHA 2VGYA 4JA7A 5D0OD 2QN3A 4JA9A 2GPNA 2IYAA 1O6CA 3WC4A 2G9VA 1C50A 1Y6GA 4RELA 3AMVA 1WM5A 1WW3A 4WNDA 3U4TA 4BQEA 3EBPA 4X6LA 5HQ8A 2X0EA 1QQEA 1FTQA 5FZQA 4F3VA 4JL0A 1B89A 2SKDA 2R4UA 4ME2A 3ZCVA 5CCMA 2L6JA 2JZCA 3MSCA 2HO1A 2J9QA 2BGTA 4HOSA 4NESA 2QN1A 3HBMA 1E96B 3ASDA 4G1TA 5G05J 4KQ1A 3T3EA 3UYKA 2F3SA 2UY1B 4H7XA 5EKQD 2G9QA 4RG9A 3LY7A 1F0KA 3D0QA 2BFWA 4F96A 3MT8A 2VYIA 1JIVA 1K06A 2LSUA 5CHEE 2C1XA 2KS6A 9GPBA 3ZCQA 3L7CA 3CVQA 2XCIA 3CX4A 2PYIA 3ZCPA 3MS4A 1J39A 4BFCA 3ZCRA 3HBNA 4F9FA 4GA0A 4N3CA 2H1HA 1PSWA 1RZUA 4I2ZA 4WUYA 3MQFA 5LCWC 1HH8A 3CV0A 3PE3A 3CUVA 4EJ2A 2Y4UA 3CK8A 3OXLA 2AZDA 3T7DA 2R5SA 4G23A 1KLXA 5A6CA 5FZSA 5ENZA 4AMBA 4WNEA 3T3GA 4I9CA 7GPBA 3HYMB 5KJLA 3CKBA 3Q3HA 4XI9A 3NC4A 3RHZA 4WACA 1P5QA 4N3BA 2GPBA 1NLMA 2F3QA 4ABNA 4GCNA 3MT7A 2QN9A 3Q47B 3CUYA 5JJ6A 2Q6VA 1GFZA 5JTTA 4Z5XA 4CDRA 3G2KA 2IV3A 3CEQA 1L7XA 3MKRA 4QLBA 2ECPA 3T3IA 2UWJG 4KBQA 4L22A 2XCUA 1V4VA 1QZ2A 2F3UA 4M60A 3NB0A 1TJCA 2X0DA 2QN8A 1SXQA 3ZFWA 2BGUA 1IYGA 1IXYA 1XC7A 2QLLA 4G26A 4AM9A 4BWRA 1GPYA 4MI6A 2XGSA 4J8EA 3QWWA 3G2LA 3WXXA 2VCEA 3LY9A 3QWVA 1YGPA 3E3NA 1IHGA 4APOA 4UQXA 3ZPJA 5EX0A 4CGVA 4WADA 5KJKA 3EBOA 3IEGA 4UI9K 1K08A 3BCSA 3CVNA 1GZ5A 4CTMA 3LPZA 5AYWD 4HWGA 4X7MA 3PDNA 3K9IA 4I9EA 2XGMA 3CUWA 1HZ4A 3CEJA 5IKPA 3G2JA 5JTUA 3QKWA 3NF1A 3MTDA 3TSAA 4UQYA 4MICA 4X7RA 4XI0A 2QN2A 3GW4A 1JG7A 3TG5A 4BTAA 2ONDA 2R68A 2BISA 4NC9A 2QLNA 2HR2A 3IAAA 2PL2A 2AV6A
chains in the Genus database with same CATH superfamily
4QQKA 2FO7A 1JH9A 4PYOA 2DG2A 5TY0A 4WY2A 1N4SA 4ZK2A 3RO3A 1EM8A 4KQIA 2GB4A 3GEIA 2JLYA 1EK6A 5DYTA 2V3VA 5DM60 3A6DA 1A95A 3HYLA 5FHQA 3GLHB 5JSZB 1BD8A 3EWAA 1M73E 1E1YA 1HETA 1KI6A 1Q22A 2ZYDA 4ISCA 1N9KA 5DBHX 4UOZA 5HJ5A 1POXA 3OXGA 2O48X 2V65A 4UCWA 2V7BA 3A4MA 5DT2A 4EQZA 4F5EA 2IUSA 3CSTA 3R5JA 4Q7MB 2EP8A 3K0CA 2CNKA 4M9QA 3FZNA 2YXDA 4U8YD 3PENA 3CGHA 3M6UA 2PKRA 2Q1YA 1KP9A 3DPSA 3BU8A 4XUGB 3V1UA 4BGDA 4FWTA 1GA1A 2XF2A 4EFNA 3SQWA 1MB0A 1DBIA 1GQRA 2APJA 1PDVA 1C30A 4MGZR 3PKZA 1SB8A 3TF5A 3UV6A 3ZJVA 1Q44A 4QRHA 1YA0A 1FJGB 1J24A 3UUFA 5GVSA 3KETA 5CM2Z 3IMCA 4BN0A 2H08A 3LL7A 1RYZA 3D64A 4HDMA 4RWZA 3R76A 4RSRA 1KZ1A 1U1DA 3WR5A 2IPNA 2DHQA 3U7QA 2GBGA 4YJ3A 4BVAA 4G86A 4P5DA 2ZT5A 3O1LA 4N9QA 2KYRA 1OIXA 2QZSA 2YYYA 1OXVA 2WTXA 5JO9A 1YC2A 2YYZA 1C1DA 2BI7A 2UZ3A 5AHRA 4RVDA 4CL8A 1EM8B 3DNMA 1EU1A 1VL2A 1JR3E 5AW9A 4FHEA 1G20B 3LP8A 4XIIA 4H15A 4AG5A 1QC5B 2DXIA 3KEMA 3UPDA 4RKRA 4Y0VA 5TJ9A 1W35A 3RSFA 5SY9A 3PNOA 1KRWA 2HXSA 1PJQA 4OQFA 1NXOA 3QG5A 5EIAA 3WHLA 1O6FA 4I1AA 3AEKB 2IITA 2QUZA 3OA0A 5JIBA 2HWXA 3LU1A 2EJWA 4HSEA 3NM6B 1X14A 1E2KA 3K9WA 1QOQB 3LPCA 3BA1A 3QXXA 5ESWA 2X1HA 3TLZA 4R9UC 5BXQC 3JSXA 3CVJA 3ZWXA 1CQIA 5AVUA 2H7XA 1W47A 4GYWA 2FJ0A 2CE7A 5F98A 1SOMA 1WB9A 2JANA 4IIEA 3HY4A 3H2HA 4O4IF 4I81A 4TTIA 1BXRB 1G0OA 1Z4QA 5K3FA 1F20A 3KKLA 5E6RB 4FDAA 4KFSA 4KQXA 4N0DA 4JI4B 2P2YA 3D3NA 4B48A 3EK2A 4BV2A 1ZNZA 4HWPA 4NV3A 1ZRSA 4RGVA 2A5GA 2OXEA 2GTIA 1VE1A 2JI6A 3EQZA 2Q3LA 3S1AA 1HQYE 4BSXA 1OW3B 1MB9A 3KKMA 4CFYA 1WXGA 2COEA 3NVMB 4CF3A 4OA5A 5ALFA 3K6KA 3NOCD 4HNGA 2OOEA 4EKNB 3V4LA 2PH7A 4FN5A 5DN6D 3T54A 4NIMA 1FZTA 1E98A 1O5IA 5FI1B 1W44A 2H6GA 3E18A 1FFGA 4B9AA 2C0LA 1XRRA 5L8VA 3DQZA 5LYJB 2XYQA 4EX6A 5LU9A 3T12A 2PUDA 5MF6A 3RF6A 4DYHA 4NQRA 1MGOA 4FUQA 5CJJA 2GEVA 1UQRA 1RM4A 5TS2A 2AOVA 4J94A 3HBJA 4NMWA 3V1YA 3HDJA 3BQOA 1XD8A 4FCVA 2UV8A 2PNJA 2QZPA 2X0JA 2GZ3A 4QGSA 1ZSNA 3EIJA 3Q3CA 2EF0A 3PGVA 5EGNA 1HDIA 2B7LA 4JP1A 3JATB 4M6WA 1OPXA 1ZIDA 2AC7A 3UUEA 1AC5A 2W8ZA 1SZ9A 2FLKA 4H6VA 4ZT7A 5G1PA 2Z3WA 1V7PC 2W0MA 3WGNA 3ZV6A 4EI9A 4F3NA 1HFJA 4BFSA 2JHGA 2UU9B 3OCWA 4Q05A 4EHBA 3KSBC 1U3GA 3DZDA 3BE6A 1E9SA 2PZEA 3QX8A 5CMWA 1QP8A 5ICGA 1Q95A 3WRYA 3FGNA 2VNKA 1ETUA 2BEWA 5AQ7A 2C94A 5E0KB 3GCXA 5BR4A 2HRRA 1B76A 4UHHA 3O26A 3WRXA 3JD4A 4QJ4A 1HYHA 2GNAA 2XZPA 2IYSA 4WL0A 4AN4A 3E53A 4O8ZA 3AR7A 4N49A 1YCHA 5HZMA 1R5NA 3ZGXA 4KOEC 4ND6A 2GPWA 3DDOA 3QBJA 5BT1A 3GK3A 4DI4A 2PSJA 1O8BA 3M2TA 1LW7A 1T0JB 2HIGA 3ABIA 2TYSB 3Q6NA 4UBKA 1NFIE 4WBNB 1LD3A 3UEOA 3ZU6A 4DV3B 3CFYA 4BHTA 1KDVA 4QKQA 3DO5A 1I2CA 2QMUA 4NU0A 2EC5A 1NNLA 3DAGA 3HNRA 3KXLA 2ZU6A 1Z73A 3ZHEA 2G77B 3WGYA 4K9DA 5D5QA 4IWNA 4KXNA 4LRSB 3UOGA 1MV8A 3IUEA 3D3KA 1V96A 3T99A 1VHWA 1U2SA 1K5PA 3WLRA 2INGX 1AKNA 4BCCA 3DWLG 3RIXA 3AKEA 1KORA 3T1YB 5HA5A 1BX1A 1FXUA 4JVSB 3AJAA 4WKNA 2ID4A 1CUJA 2ISQA 4G67A 5L95A 1Z2CA 2OZLB 1RYDA 3QPCA 2YJ3A 2Y05A 3TSYA 3OQNA 3C6MA 4BMYA 4BPRA 2WMNA 4L7TA 3CR7A 1E1QD 1M2FA 2X5GA 2OCGA 2PV7A 5JJ5A 2DIWA 4JK3A 3OY2A 4IGFA 4KGVA 3IO5A 3I6YA 4WZBE 3DV0A 4EJMA 3I42A 3RWBA 4URYR 1UZAA 2B1RA 1UJCA 3E1SA 1XA4A 2G25A 1WY6A 1J8MF 4BZZA 5DLQC 4AKEA 1QFSA 4O33A 2LNDA 2AFHA 4DNQA 2Q41A 2GNOA 1LUAA 2J3IA 3N8KA 4C06A 4JHXA 2HCTA 5ICFA 3RSOA 1SOVA 3W5SA 3IHLA 4LOAA 1OY1A 1U80A 2FMHA 4Q4JB 3EGVA 4IAOA 1U9YA 4B83A 2QYUA 3K9NA 1BDIA 2BRUC 3OEYA 3RD5A 3W6NA 3KKEA 5F1YA 5AW1A 4KXUA 2DPLA 4Q02A 2BTQB 2O2IA 5AW5A 1NRWA 2J1LA 5K3FB 3ZG6A 2R11A 3QFFA 1HE8B 1W8IA 4RVBA 3UT5A 2WU8A 2X5HA 2DPGA 3Q7IA 4IWYA 4WEQA 4F1SA 5DGIA 2RDMA 5C8YF 5IT5A 5K0GA 4GMLA 2GFQA 2XEEA 1CUVA 4Q96A 1V35A 1C9EA 2KM1A 3A7EA 4GPAA 3LJNA 4JD5A 3KVYA 5B57C 4QOHA 1QH8B 1Z74A 1NBMD 3PQ4A 3HGMA 3LF1A 3BTSA 1KZ9A 3FDHA 2VP4A 2VH5R 2ZATA 3CJTA 3CVUA 2FPWA 1U1GA 2ZE5A 4MQEB 1DCQA 4ABYA 5AQ9A 2O8FA 3BMOB 4J0UA 4DR2B 3W78A 2PBZA 1X1DA 5T6BA 2P90A 3ON5A 1TJNA 1VMEA 3DNPA 3DP9A 1A9XB 1O95D 3WLNA 1DG1G 4QUKA 3HUEA 2IYYA 2Q7FA 3SS9X 3DCNA 2UVPB 1L5MA 3DOFA 4I1OB 5DNDA 2F1JA 1P0MA 3NGXA 3Q7FA 3L5KA 2V1XA 1W52X 4B3XA 2C8JA 1NA0A 3AVWA 3U7QB 1NJ8A 4EZEA 4XX5A 1MXFA 2I9KA 2PLRA 2UZ1B 3K5WA 4MHTA 2PS0A 3FVVA 1UODA 4JKYA 3NQ41 4XIGS 2C00A 5D3ZA 2W2OA 4MS1A 2Y0EA 4EOGA 2XYVA 1CE8B 1K89A 2RHHA 3VH1A 3KWLA 3NV9A 1O9HA 4DQLA 3PIIA 5C80A 1WV1A 1I2DA 1GAQA 3TLXA 3KT0A 2FLWA 2QNRA 3UZUA 4AXXA 4TXLA 2FPPB 3P7MA 2GZDA 2R47A 1BYIA 3L0PA 5HMMA 3HCBA 3INNA 3WNCA 4F56A 4YT2A 5IT4A 3KC2A 1G3IA 2DQKA 3DSTA 4X45A 5FQ7A 4DLVA 1OIWA 5FWXB 1V3VA 2QP9X 3MLAA 4J90A 2RAVA 2Q5JA 4O4IB 1RCTE 5FFNA 1U4SA 4RQBA 4TMWA 1CWUA 4TWZA 1FPPA 1CZLA 4CG0A 3F3KA 4DCCA 4PPGA 4MEBA 2UXCB 1ZOSA 1UBEA 2DCPA 4FHJA 5B1AE 2N0SA 3B3QA 4MUAA 4UUNA 5CH8A 3WIDA 2JFWA 2DFTA 1ZBPA 4KOAA 2JARA 4Q9HA 2A0WA 1ZISA 2XUFA 5H3HA 1DAOA 5KJNA 3ND9A 4N5NA 3ZVRA 3KQPA 4UI9J 2HGZA 5HRYA 3L0SA 5AM4A 3UYLA 1WPXA 4S35A 4AZSA 2WV7A 5IF9A 1R6VA 1M7GA 1OREA 1EVJA 4IHJB 3CLSD 1UXGA 3LWNA 4XUEA 5DEOA 2AOTA 3D8RA 4FU0A 2ZOSA 1G8MA 1B8VA 3IUPA 3GD5A 1IOZA 4D43A 1SUCA 1S3SA 3EZXA 4RF5A 1QDUA 2R60A 4JYCA 5TVKA 2H5JA 1QPGA 4HFRA 3UN1A 1VDYA 4Q4HB 2H48A 1L5FA 3ZBUA 3AV0B 4I5DA 1ISFA 2YBEA 3GT4A 5DBGA 1Z4MA 1E94E 3VJMA 5BQ3A 5EP4A 5IK2D 2J0UA 5H4HA 5GIPE 2C3YA 3DHEA 1D4FA 5CP8A 5EXDA 4DLNA 4UTVA 4JCCA 4PYRA 5I4CA 4JP2A 4BETA 1GAEO 4UMEA 4Y2TA 3VHQA 3LXXA 2QE7D 4ZCSA 3FR7A 2VWQA 1WF6A 2Z9CA 3CHYA 4HGYA 4NF2A 3EFOB 3K2EA 3D3WB 1C4OA 1RACA 2PGNA 3QUTA 5JYCA 1E3TA 3ZLVA 3IV9A 4QNNA 2PZKA 2WQHA 2XCLA 2XWPA 2Z5FA 4N54A 1ZVVA 2X7XA 4LDAA 3G49A 2IHYA 2BJHA 1T1RA 1UJMA 5JCJD 1PSDA 1Z8HA 3VHLB 1BCSA 3AR6A 3GUHA 1IC6A 3QEJA 4GL2A 4XWAA 2GI4A 1NYQA 3KLMX 4UFPA 4RA9B 4B3JA 5BP7A 3F2VA 4G81A 1U3DA 2GRQB 2WXMA 4KGZA 4NCNA 4JA9A 4O29A 5T8KA 4NU6A 5BY2A 1DCEA 3C3XA 2JGRA 1ECBA 2JATA 2B61A 1C50A 5FPTA 4PHTA 5FULA 3FU0A 4GNKA 5G0WA 3SK0A 4ZTZB 4LJ5A 4X6XA 3U4TA 4MVJG 2IKQA 4YH1A 3EBPA 4Q3OA 5HQ8A 1XTZA 2DUWA 8OHMA 4NZ9A 3LQRA 1PNQA 5DBEX 4P3XA 2WJ4A 5EJ8A 1VE6A 2HD4A 2L6JA 2JHCA 4O2RA 2EF1A 1ZH0A 1II8B 1R6AA 1V8ZA 3TIXB 2B4TO 1DEKA 3SY2A 2J30A 3KELA 2CHGA 2EINE 2HGSA 4YN3A 3CO0S 3AG5A 4ITRC 1C7JA 1TW3A 1X7XB 3BQMB 2A0UA 5NULA 3FH7A 4RG9A 3EB9A 4BVLA 2A8YA 4MUFA 4HVBA 2LIPA 2VYIA 1IB0A 2CVFA 3JQPA 5EMKA 1NTOA 2ZRQA 5CHEE 1GCAA 1WXXA 1ZICA 4KZCA 3FNGA 5IBRA 3SZLA 1U0RA 1RKQA 2R6HA 4YRTA 1NG1A 2PYIA 2AG1A 1FNNA 3FRJA 5EMLA 4NCAA 1PR0A 1EDUA 3LS8A 2BFEA 1JDJA 3MS4A 1L5HB 4GI7A 1CIPA 4JGGA 3DF9A 3PVLA 4JQCA 3O4VA 3H9JA 2JK1A 2NO1A 2BFBA 4MRNA 3OCYA 4CEJB 3GRFA 1R3DA 3RFUA 1E3DA 1YQGA 3FLMA 3IEPA 3G8BA 1ZWKA 3CUVA 4K05A 4CM8A 3FPCA 1CB0A 2H4WA 1DVPA 1TZJA 3K5HA 3K1TA 1HFAA 3R3SA 3N0TA 4YJGB 4JEIA 5DM4A 4Z4IA 4TZ0A 3N5CA 4M9UA 2ZITA 5KJLA 5EZ6B 3DTVB 3JU3A 3OFNA 4XI9A 1JR3D 3NC4A 5AVZA 5IKEA 2H17A 2JBAB 1JKFA 1YO6A 2GO1A 3JQ9A 3T3MB 5AWFC 4EW1A 3F73A 2HTFA 4J1SA 4NMXB 2Q1SA 3VRHA 4BFWA 3FKJA 3GUUA 4IGEA 5F52A 2X8WA 1SUBA 1MMFB 3I76A 4HNSA 4B9EA 3L49A 1JUDA 1X3SA 4MRRA 5EJ2A 3TTTA 3TTVA 3OFJA 3R5SA 3CX3A 2MDTA 4MYRA 3U7RA 4MA5A 5TQ2A 4JKIA 4IZOA 1UKZA 3VBCA 2GTHA 1J1UA 1U6KA 4XQGA 3SHWA 4B31A 1T26A 5K8CA 2QD4A 1RJFA 3G0CA 4MDYA 4JGIA 3NKLA 5TEVA 4ED9A 4AZ0A 5SYMA 1S63A 2BKXA 2DHEA 5GTDA 3M5CA 4EX7A 2XXAA 1M34A 1NLFA 1GDDA 2V45A 3M4XA 4MW4A 2QLFA 2HF7A 1KEWA 1KO4A 4DE5A 4CLRB 2FEOA 3INRA 5C8VA 5EHGA 1SU7A 1IXSB 1VQ1A 3CVNA 5HS6A 4IFIA 2LD4A 3UXYA 1M7HA 3BKWA 1Y8RB 4J4BA 1HRKA 4HWGA 5COQA 1EFPA 3SVZA 1C1XB 1THGA 4CIXA 5JMND 2NZXA 2UYYA 1CJBA 1LK7A 1E96A 2W2KB 4MUHA 5L9AA 4GDFA 4I9EA 1ECCA 1F4PA 1UAYA 1DTSA 3QARA 4KQKA 4TL9A 1Y3BE 3TL5A 4JKOA 3UC9A 4E4TA 5B3LA 2WMOA 1UBHS 1L4EA 5LZ4A 2BDEA 1I30A 4YO7A 4PRYA 3TWXA 2BFCB 3GFOA 3L1JA 2I8LA 3GNSA 4JNCA 1LPOA 2H5EA 2WKWA 3TPZA 1NW7A 2QD5A 2R8EA 1PS8A 3OEEA 5E4TA 5CFRA 1LBIA 4J16C 5ESRA 1SHKA 4U4AA 5AJZA 1RXYA 2X8BA 3V2GA 2QDKA 5KPJA 3BXEA 3VLDA 3PV0A 1E8YA 3OIGA 4X61A 3CB4A 5MGBA 2WICA 3JQ7A 3ICOA 4BO1A 4D1YA 5ENDA 1X9HA 2JH3A 4FNGA 4JHJA 1JHXA 1BKSB 1KMHA 1SQGA 4E14A 1Z08A 2J33A 2W2PA 1ZH8A 2Q0SA 1PS9A 1R6UA 4FN4A 1M2EA 5A04A 2YXBA 5LZ5A 3UANA 4L72A 2Q49A 4AROA 4BKMA 2R751 4JUIA 3NB2A 4AT1A 1LRLA 1I7NA 4XUDA 1ZONA 1E0SA 3MMNA 3IXLA 3ZIMA 3MMXA 3UMFA 2L82A 3OHSX 1M54A 2NYAA 5C1IA 3RNLA 2IEJA 4OD0A 2X6IA 1G98A 2AFHE 3I2YX 1CY8A 1I6KA 4O1HA 4PZ0A 1H3NA 3WB1A 3TFQA 1HG1A 1U0HC 2PUGA 4DB2A 2YQ8A 2PFGA 4B80A 4ZYLA 1DIGA 3A4TA 4F5DA 2OZVA 1Z4OA 4HC4A 2BMWA 5FJYA 1OZAA 3HDHA 4MLPA 5E3JA 3N39C 4LI0A 3GNTA 4ZC1A 4C08A 3VKHA 1WLYA 2GNPA 3LVFO 3EXEB 1OU0A 2GRMA 2XYGA 3QU7A 4KNVA 3VNQA 3GGPA 4F93B 3PBKA 5EMHA 2F3RA 1W581 3PUXA 3WIVA 4PYNA 1NM5C 4BMDA 4R71A 1ZKMA 1L5OA 1W1IA 1K6IA 3GZTB 2OR3A 1TZMA 1VRVA 1Z16A 2P67A 1WJGA 2ZJ0A 3AY7A 1QHXA 2BEKA 3C7DB 1J9GA 1T3LA 1KZOA 2OK8A 1ZG3A 2PUWA 3CC8A 4KX3A 5U4XA 3W9YA 3PSAA 2ZRMA 3KAJA 3O8OA 5HCUA 3WDSA 4FFPA 1HL3A 4MCIA 4KLCA 1IJBA 3OOEA 5BSMA 4RU1A 4TT8A 5AW2A 1MC8A 4OHKA 3C72A 1JHQA 1DAHA 3FAZA 1BE1A 4F12A 3R7LA 2X13A 5BQPA 5FOQA 4J6IA 5B4UA 4UAUA 1S4QA 1YULA 3G1UA 4ER3A 4R69A 4TQAA 4Q12A 2XQIA 1H2EA 2NVUA 2R6DA 2ZEJA 3M89A 4W99A 4KREA 1WBJB 2LAHA 1WDKA 1TU4A 2VDKB 4JX8A 2A0YA 4R3NA 5HIKA 3CGWA 3G8DA 4HS2A 2RHBA 3PA6A 2YVUA 2J3LA 5FUYA 4ZMBA 2I55A 2R8YA 2YZ7A 3ACCA 2I4IA 1P5HA 4F6RA 2QU8A 3IPCA 1C9MA 1Y1PA 4ND7A 5D6OA 5T8KC 3AVUA 4D4MA 2XLCA 1DARA 1MJHA 2NZVG 1XZBA 3EH1A 3M6LA 4DADA 3OKPA 4FEGA 3L18A 5ENVA 1WNTA 1X77A 4FIDA 2D1YA 1L4UA 4O4LB 3S2GA 1WLSA 4RXUA 5BYBA 3TQCA 3LI2A 5HS4A 1SKYB 2K2QB 1EYZA 3Q8MA 2F4NA 4WKOA 1TGYA 3BSYA 3WLOA 3ZIUA 3LX4A 1A71A 4GI1A 2V4LA 5G4KB 5B2EA 1FRZA 3GPIA 3LPAA 1KEUA 4LG1A 3GLFE 1IMJA 1SBZA 3U3WA 2QX9A 2BW0A 2OHXA 1LBEA 3Q4AB 1PWZA 1P4HA 3P5SA 4L9SA 2SKEA 4R7GA 3WDKA 4FD2A 2IYQA 3AM3A 2FMXA 1W93A 3A04A 2PFKA 3IELA 3DE6X 4CMIA 3AUAA 4ZHQB 4RZUA 5KSOA 4U6QA 1YI8A 4TXPA 4K2HA 1E2FA 5LBTA 4WWPA 3OHPA 4TVBA 3OAAD 1Y48E 4O1PA 1BD3A 1GXSB 2UAGA 3P9SA 4I9NA 4PNPA 4Y2VA 3CEMA 4U6SA 1ONPA 4JFRA 4HGZA 4MA4A 4ROTA 5B58C 4DXHA 1KEZA 1NZNA 2P6PA 4KEAA 3ZUPA 4CQMB 1V5EA 5MN6A 1JJAA 1N32B 4LBZA 1SBTA 1YR6A 3IKLA 3USZA 2G0TA 5TR9A 1QNLA 5A5EA 3I9JA 5H9VA 1GG5A 1UANA 5KYUA 5H0IA 1P2FA 4X6UA 3B38A 5F23A 3UT8A 4Y2GA 2Y4TA 4CTOA 2NTNA 4YRFA 4CM1A 3VKWA 5I7UA 3FZGA 3EDCA 3W5HA 4I3FA 1R0KA 3D8TA 4IBOA 1EFKA 1Z2DA 2WWIA 4WFJA 4RJTA 3MXTA 3NTLA 2PD3A 1KR5A 1TT5B 1OSNA 2YWDA 3HJTA 3COZA 2M6SA 2I6TA 2IEGA 4JYMA 4CL3A 4YUWA 1BLXB 2QA5A 3HHMA 4BNDB 1GM5A 5BYKA 4B44A 1EQ2A 8GPBA 1KI3A 3IE1A 4HRMB 4DMHA 1D04A 2XX3A 5FUXA 1MVOA 4ZEWA 4OB8A 5G1OA 5LWQA 2OUKA 3FSRA 1SD2A 3ZV5A 3R09A 4ZEVA 2C2ZA 2AE1A 2OXCA 4KAAA 5KYXB 4JI0B 5HIAA 3EXEA 3R1IA 4KMSA 1W9MA 3SF8A 1SVWA 3AU9A 1T5BA 1U02A 2EVWX 1T36A 1C1HA 3E3OA 4QVGA 4WSOA 4CTKA 4YMHA 4KDCA 3USCS 1Z4KA 4ZYZA 3KR9A 4LMPA 1IH8A 4HQ6A 4B7CA 4XGQA 2VI5A 3FP3A 2ZIWB 4MWBA 5L4LA 3L54A 1MAVA 1EGVB 1FFCA 1DC3A 3ZDYB 1QRRA 3QOXA 2F1OA 3A1DA 5HK9A 5BNWA 3FGZA 4MARA 2PMCA 1I94B 3PPXA 3HB0A 3SVLA 1GNQA 1HLGA 5DSZA 2XBMA 5DGCA 1E92A 3EVEA 4IIUA 4BAUA 1W9HA 1T2EA 1JA0A 3MCUA 2D2IA 2HMUA 3S55A 3M6AA 3M83A 1L4FA 3HKBB 4Z3OA 1V55E 4A9AA 3OPQA 1RT9A 4RZSA 4I8XA 1P1IA 4UTOA 1ETHA 3DUWA 1EHIA 4QWMA 2MR6A 2IOSA 1I2MA 3B1YA 3I2KA 2IYOA 4B43A 4OQEA 3KBOA 4CVNA 2WD7A 2WXLA 2C82A 3RRNB 3I73A 1D2AA 2X0FA 4BIMA 4CM3A 2JVIA 4LJ8A 4OMUA 4OU4A 2WIJA 2W6CX 5HG0A 5IH3A 3CEHA 3T1OA 5J08A 3VYTB 2OHIA 3IUBA 3PC8A 5HKKD 2GK3A 2DB3A 1X2BA 3L1HA 5I9MA 2IOHA 2VP6A 4KFCA 4DQDA 2D54A 3UJDA 2XEDA 2CNWA 3SJBA 1GSIA 2OGWA 1E8NA 4NZZA 2YS6A 5CVUA 3MEKA 5ITZF 2OV6A 3DNFA 4DSNA 2CLLB 3SEAA 3N58A 4HNAD 4UQZA 3HDTA 3GMTA 4QUJA 4ZVOA 4EYKA 1TW2A 5JJIA 3OIFA 3L6BA 2V58A 4G0QA 1P4SA 3L7BA 3JY6A 5FA5A 2EV9A 3M70A 1M1XB 3G2QA 1M2VA 2GRPB 4RE5A 4FKMA 4M99A 4B2PA 4GRAA 3SIWA 1Z62A 3A0UA 1MOZA 3GEMA 2CHWA 1C3JA 1SN7A 5K8TA 2F55A 4LYHA 2CK3D 2X5TA 2YW2A 2OV1A 3GDGA 4Z7NB 521PA 2YJNA 2IO2C 1O5TA 1LNSA 3FUVA 2N47A 1EE1A 2LRHA 2O2CA 4CMJA 1Z8DA 2H1VA 2VHTA 3UJNA 2R2AA 3FFXA 3E33A 5F2KA 2LUOA 3QGMA 4H9GA 1QMGA 4PXYA 4ARBA 4XTCS 4EW3A 3JVEA 2NT3A 3B6KA 1SOWA 1TI7A 2XZTG 1T29A 3MOGA 1ZD1A 5EN5D 4EZKA 1XZPA 2GPTA 1ZL2A 2ZWMA 3V4PB 2QVYX 1REQA 1N5OX 1MLDA 3O0TA 1MB2A 3S7BA 2IDZA 3KALA 1WPQA 4MVJF 2XZOA 4FNMA 4ROSA 1U9IC 1WB6A 1N4QA 2GF0A 4KXYA 4Y6OA 5IAOA 5FWYA 4TTRA 3P1JA 1U0GA 4W5NA 4HXIA 3QNKA 1IULA 5FNVB 2AF3C 3NT4A 4BZXA 1R9MA 1T6NA 4NAVA 4XUCA 1RMYA 1LRJA 2XGGA 1V8PA 3LECA 5K03A 5IS2A 1UP7A 3OQMA 1EGQA 3DVLA 4K46A 1O6GA 3TINA 5T41A 3KZ1E 1VL5A 3KQWA 3UH1A 2NU8A 1UF9A 1ZL0A 4N7JA 1OX6A 1ZVJA 2CCJA 2PMFA 2ZS8A 4DARA 4DJJA 2B5WA 4NFYA 3L82B 2JEOA 4C0EA 1JLKA 4HX5A 1XCGB 2D1SA 2GESA 2R96A 2WTBA 2E4VA 1RCFA 1EXDA 1QDEA 1EWYA 1L8LA 1XEXA 2ZW9A 5M7EA 5E3IA 1KY2A 4POAA 1XGKA 1U28A 3BILA 4XWOA 4U7DA 3GBVA 4L16A 4M9SA 5I7VA 3QEOA 5LC1A 5HNKA 2V97A 4HXEB 3GAMA 4WBSA 2VK1A 2NUBA 4H27A 4WKBA 4CNQA 3O03A 2PEYA 5BOSA 4MI1A 4OHMA 3AR5A 4FOLA 4OI1A 4EA9A 4F45A 3VVLA 2EX0A 4MB0A 1JU9A 4NQZA 1ZRMA 2X9VA 2G67A 3BD9A 3PU6A 5F12A 4A16A 1M8PA 2RCNA 1GZ3A 4D02A 3U4AA 1OYVA 5EWMA 4M1MA 1ZXLA 2WPDD 3Q7QA 2FO1E 1A9SA 4UBMA 1A9RA 3C1AA 1IWPB 1R3UA 2N75A 3W2EA 4MW6A 3BRWA 3SJZA 2NU7A 2WUDA 3PDJA 3JQ0A 4G84A 2HF8A 3E7FA 3S2EA 4IM7A 1HX7A 1T9DA 3BOSA 4FLBA 3UUXA 5CPFA 2ZIEA 2NQTA 1SCNE 2JD1A 4DV1B 1XROA 4CCYA 2P58C 1T4DA 2AJBA 1WUIS 4ZWNA 2R6GA 4ZDIA 2VBGA 3AIMA 1XZJA 1AURA 4U00A 2VZLA 4W1PA 4BX8A 2ZYUX 3VSBA 4MWCA 2QR5A 4OVVA 3PNYA 3MT9A 4MVJH 5IUKC 3H9CA 1TECE 1E2BA 2E85A 3ZUGA 4JUDX 1PR9A 2A9FA 4Q7KA 4A82A 1GOTA 2E4XA 3KJIA 3NIBA 5ULLA 3HUDA 3ZOKA 4AKHA 3E22B 4PSDA 4JA7A 1KE2A 4EH1A 2AN5A 1DCKA 1A2OA 1Z28A 3C3DA 4CQLA 3SIXA 1CU1A 3ZHSA 4EA7A 4P36A 4JBWA 5LMCA 1YCGA 2GCGA 3GW8A 4RYDA 4DPLA 1ZCBA 2JF0A 2QAGC 4JJ7A 4X6LA 4ZCPA 5KVSA 3BH0A 3RYIA 1FTQA 5FZQA 4F3VA 4RVCA 1FOEB 1G9XA 2BKLA 4TX1A 3UK7A 2WTUA 2IUEA 2WSYB 3D1LA 1EX9A 1WSBA 1ZW6A 3B3GA 3IB3A 4P38A 3DBIA 4Q9DA 1ZK4A 2BBSA 1BNCA 4N3NA 4EB0A 2H7VA 1LTHR 1JXOA 2ZRHA 3EXAA 1EPUA 3IDFA 2VT3A 3ISVA 3TLGA 4C2BA 4CKYA 1PWHA 2LR0A 1IBLB 1A82A 1JTEA 3AKCA 4NK5A 1UBLS 4S1TA 3AETA 4EUHA 4ZEXA 9ATCA 5AM5A 5CTAA 5KDDA 3PQDA 2B98A 3QKIA 3RG8A 1KY3A 2OT3B 5KYWA 1F0KA 2P2GA 3ESRA 5BRJA 2YNQA 3AT1A 5INTA 1QVRA 3AINA 4IX1A 4F96A 1JIVA 1CFZA 2BI4A 3VAAA 1IN4A 3RQIA 2BN4A 1U94A 2CF5A 5ICMA 5DBFA 3TZCA 1TM5E 1T9AA 1HDRA 4OYHA 3Q75A 1YRAA 1CEQA 4MUNA 1E9DA 1I10A 5CM8B 5L6LB 2DPYA 3S70A 3R0IA 3PTZA 4L5YA 1UOQA 1A8QA 2NYVA 4GOLD 1MKYA 3T0IA 1GTSA 3GDHA 4X3OA 4RTLA 1QHHA 3M5DA 5AQEA 4RA6B 4HG2A 4EY3A 4CG3A 2PGAA 4B3MB 5LWHA 3CV0A 2EGHA 1ZM3A 2XVYA 3EFBA 1XD2A 3JZFA 4PC6A 5WRFA 3OZTA 3P26A 4CLDA 1P45A 3EZFA 1E1RA 5LL6P 2H9AA 4BNKA 5GONB 4ECAA 5C7YA 4GM4A 5LQCA 1TNOA 4DUZB 3T5PA 3KZMA 5K9ZA 3SBTB 2QYOA 3DBHA 3KK0A 3QRWA 2XRMA 1QIDA 4BECA 1YAJA 3QVJA 2O0MA 4AYWA 4YMLA 2E4ZA 5BMVA 2H2HA 3QVTA 1L2TA 4D3DA 1J4AA 4I1PA 3BQNB 3TW0A 5D86A 3QEAZ 2QN9A 4PM4A 2XDYA 3ED1A 4KCGA 5JJ6A 1UMBB 2VTEA 1M1YE 1PZFA 3UKUG 1XEAA 2BGGA 5CB6A 2WT9A 2I3AA 3E3MA 4O4JF 3EGCA 3R9XA 1ODFA 1DAFA 1ULHA 4TSFD 5FWQA 1QH1A 4NMHA 4YDHB 2AVNA 3KHTA 5E7JA 3ZLJA 4D9CA 1KP2A 4OFZA 2ETAA 1GARA 4FYKA 2FNAA 1HZZA 2W6PA 3KHSA 2PL5A 3QWIA 2GZSA 4ZCIA 1N9AA 1HF8A 2GD0A 4ZDWA 2I4TA 3EG5A 2FQYA 4NAUA 3FOFC 4IDFA 2AT1A 4GX5A 3ZU2A 3QWVA 4KWCA 3WLQA 3E3NA 1ZIOA 3PE6A 4BESA 1YR3A 4HTFA 4MQUA 5JH7B 5KVCA 2AW6A 5EX0A 3ROFA 4R7LA 1V6CA 2YV2A 3JD0A 4WADA 1EFLA 4MTLA 3TTUA 4BNIA 1MFPA 4TVKA 4MAMA 4KPFC 5KNBA 5KOJB 4PZYA 1YDWA 8AT1A 1YVPA 5CXXA 4KFRA 4CKEB 3I72A 3QMWA 5FWXA 3EC2A 4Z0PA 3M5PA 2YNMD 1N8NA 4TTQA 2RGRA 1YVRA 3K8YA 5DK6A 1EK5A 3ZYKA 3MSXA 1HURA 3K9FC 1GTZA 2R2GA 2PGIA 1LBSA 3EGXA 4HQ0A 1RMQA 4L7VA 4LC0A 2VUSA 3FTDA 3PR1A 1KZ4A 3OZWA 5T5QA 4C0XA 2EBHX 4UBNA 2YIJA 4MICA 4ABTA 3R0ZA 5HDQA 1GADO 1DE0A 4C43A 5DTMA 1DTWA 1BQ4A 3CW9A 3GFGA 5JNWA 2NO7A 3TD9A 1FDWA 1H0SA 2NWQA 3L2OB 2HR2A 5CGQB 2ZI6A 3HXMA 2I87A 3LVRE 3Q88A 1S02A 4WIAA 1L5NA 3UMMA 5IEBA 3ASNE 5F7XA 2IH5A 1KA9H 2AFHB 4WKCA 4EAQA 3ZN3A 2QVXX 2XDQB 1F4LA 1KPSB 1JF8A 3JVUA 4R1PA 3LUBA 3NZSA 1CERA 2DVMA 5JJ7A 2I4OA 2A9KA 2IQIA 4R8LA 3T7IA 3GPLA 2IXFA 2XYRA 3Q87B 1KDZA 3OZAA 2H4JA 5KDOA 2FE1A 4TWJA 3QEBZ 3PWTA 2FOIA 1AXEA 3S5UA 3R0VA 4UI9C 4L07A 4RVSA 3QPUA 5KTMA 4ZYUA 2PT6A 1RFLA 3CSUA 1UBOS 1PR4A 4B8AA 3EWIA 2ST1A 4DSOA 2NUAB 1SD5A 2AN4A 3L41A 1DPFA 4TLLB 3ER6A 2PEZA 2YICA 2GVDC 5EJ4A 1BU5A 1GY8A 1W29A 2WYOA 5FOXA 5JR3A 1XX6A 2ACWA 3OZXA 3PQ7A 5ITZA 5D3KA 1G3NB 2BEUA 3VU3A 1NR7A 2ZSJA 3T9AA 1JWBB 3IQXA 4DSUA 4HOYA 4PTZA 1ISIA 1G41A 1WVMA 2ASEA 1ONOA 1O2DA 1U5AA 3HFJA 3WISA 4QZVA 4M83A 4NMLA 4UYJA 3Q7SA 1I14A 2O06A 3RSLA 3VM6A 4DBVO 1NUQA 4EJSC 5JSQA 2RC6A 4MRVA 4R16A 3SHVA 4YRJA 3HKCA 5B7QA 1GZHB 3FH5A 5ENRD 5ALSA 5KREA 5E7QA 1N3BA 2WT8A 3HC7A 2V55B 1JAZA 1ODCA 2ZULA 4PSUA 4ZOAA 1ZIXA 3M3DA 4HDNB 1OC2A 2LNIA 4V0RA 1OUVA 3TAXA 2PAFA 16PKA 1ZLYA 2YXEA 3WL5A 4DB4A 2O8DB 3A10A 1E8MA 1NMSA 3OESA 4B6OA 3BHNA 4WAFA 1I4EB 1XNHA 2HA0A 3KYDA 4LHXA 4MHSA 4R9NA 1E4EB 3JWPA 4U0JA 3V42A 1CUAA 1SM4A 1VKHA 1Z4PX 2W6QA 4XR9A 3TZHA 1Y1TA 1ZD2P 4RHFA 3ZXIA 2GPSA 1ZXXA 3OG9A 4F7AA 5IU6A 2VJLA 3QY0A 2EIXA 2ZSKA 4HQFA 3BXZA 4PS7A 3S0JA 1FU7A 2ZIUB 1QZXA 5JVDA 4IEFB 4TN5A 1Z7GA 3ZE2B 4MPDA 5FWAA 4YDYA 4U07A 4KWHA 1LDNA 4IP0A 3MQ2A 1J23A 2ZJ2A 4HYYA 5HILA 4J0KA 2JRCA 1A97A 5KWDA 4TYQA 1XTTA 2C99A 4KE8A 3W77A 3ZDXB 4TV8A 2WXPA 4G5SA 4N12A 5CBPB 3JQAD 1OVGA 2C77A 4HQRA 4MKGA 3SC2B 5AVRA 2BWJA 4GOMD 4GOND 4KVZA 4PHFA 3EGWA 1W85B 2AOUA 2I7XA 2II6A 4MWSA 5BO5A 5CBOA 3OZSA 4YK7A 5EQDA 2EKQA 1AWCB 4F5ZA 3LH5A 1SVSA 4L4YA 2ID9A 3EY9A 2IDJA 5E9AA 3TXMA 2X0NA 3AUXA 3IEKA 2XKKA 3GLHA 1JXAA 1CEEA 3JYHA 3QLUA 1B42A 4L1KA 1KMNA 1YL6A 2RG7A 4IL5A 3IV7A 2QP4A 5TGZA 5E4YA 2FV8A 3LBIA 4FFDA 2A84A 1U1CA 4CIVA 3BMNA 1OFUX 3HDXA 3IP8A 2C5LA 2MHKA 2DOKA 3OE7A 5FD8A 4E30A 1DTWB 3KQYA 3N59A 2WG0A 4RJIA 2OHVA 5K4AA 3VH2A 2JLZA 1QJCA 3ELUA 3MUNA 3NU1A 3PITA 1FDUA 3NHWA 4IRXA 4DBLC 1YRYE 2X0KA 4TRMA 1JWFA 3GARA 3D4OA 4BDSA 5CXQA 1T6ZA 3V79K 1QAQA 3C0KA 2HI0A 3H75A 2RD2A 4KMOA 1O57A 3ADPA 3INGA 4IV0A 1WMEA 2CFOA 4KIWA 3MCTA 2YC4C 3IKMB 3MWJA 4FEAA 1NASA 4MQ4A 3THYA 1QCYA 2ZJZA 3D3EA 3P2BA 1SUAA 2X5JO 1GG8A 4KQEA 1F8XA 5EUCA 2A88A 1UJ2A 2GPJA 3H8WA 4ZEOA 5C3UA 5I3CA 1FJHA 1VMIA 4JMLA 2VJBA 1U8XX 1KI7A 3ILYA 5IDXA 4Y6WA 3H6KA 2C7VA 3E3LA 4RL4A 3ZJTA 3RIBA 1HZZC 3ZGLA 3BN3A 4N7RA 3SLKA 1W4AA 5T4HA 1Z5OA 4FMCF 4F9EA 2BGRA 3GQBB 1FDTA 1VBNA 4J0FA 4HVLA 1VXOA 3LCMA 2H6EA 4I5EA 1QBGA 2O3UA 1Y6ZA 2Q4RA 4ZV4A 3QKYA 1UKAA 3OPXA 1N5KA 3LTEA 1JS1X 2C7BA 3GHHA 4HUQB 4OXQA 3FUNA 4W8GA 3W2TA 4ADSG 2H4YA 2YWRA 5C8YB 4AOFA 1I2AA 1CTQA 3BFXA 2X41A 3P0RA 4U95D 1ZNWA 2OFXA 4LTMA 3L6EA 4YCAA 5ALUA 1XOIA 1UT6A 3F6CA 5EE5B 4L78A 5TF4A 3VSDA 4IV5A 4QJ3A 3A70A 3GAAA 3KIPA 4V03A 2G9NA 3QUAA 4PS0A 1YE3A 2ZUSA 2WUFA 2YQZA 1PG5A 3MWFA 1T0BA 3MWYW 2A7QA 3KEOA 1YFZA 1ZS9A 2FI7A 1P9LA 2E7ZA 4NH0A 4QOJA 2EJVA 4GPZA 1TYBE 1J0DA 2VZEA 1V43A 1IWBB 2H92A 2WNHA 3E9RA 3JXJA 1CULC 1NVVR 2GM5A 3EDOA 5TRTA 1UFOA 4PLYA 4EBFA 3OWOA 3L4JA 4GKBA 1SCBA 4ZQCB 3N2KA 2CXSA 3GDFA 4MCHA 3ZHRA 3I5YA 2UZ1A 1HT1E 4F97A 3R7BA 1VIMA 3M1YA 3U7GA 1KHTA 4Y9DA 1OFHA 4AZVA 3DLHA 1JCQA 1VBFA 3L8EA 1BAPA 3M6WA 2IQCA 3ZJ5A 4B8YA 1CVLA 1HOXA 4LPKA 4WASA 2J6IA 1XB2A 3N8HA 3BXOA 2CBXA 3D8NA 3G2IA 3UY4A 5FPPA 1JLSA 4R9SA 2IZ0A 4G5FA 1VSBA 3SFXA 3LT5A 5FL7D 4KXMA 4IDEA 3IULA 4MZXA 5BSGA 2PKQP 3ICEA 3WJAA 1K7YA 2X76A 4QRIA 1UEXC 3KL4A 3K32A 3IIJA 1X1TA 4WCFB 1OZ0A 5ER9A 3RUCA 1RWVA 1PFUA 1DCTA 1LQUA 5CB4B 1KTIA 3MTAA 2I78A 2QZZA 3FPAA 3RROA 2I76A 4OVUA 3RBAA 1ZZEA 1SWVA 2OGSA 1IE3A 4NBVA 1P81A 1HTWA 3WGVA 1V7ZA 3G85A 2LPMA 4HMPA 3PEUB 3PUJA 1FSZA 1JQDA 3MT0A 3OU7A 5M3BA 3TAUA 4BVBA 3QNMA 4EG6A 5CDHA 3ENVA 3DBRB 4C6TA 1UBGA 2XOKA 1NG9A 2VP5A 4R6WA 3I6BA 2BLNA 4XYMA 3HLTA 1DJMA 3PD1A 1DEHA 4RD2A 4RIEA 3BWYA 3RS2A 1QUFA 4RAQA 1BJRE 1W5AA 4I1YA 3SJUA 2AOTB 1W5SA 4BDTA 3FPKA 1RR6A 3Q41A 3ONFA 3AI2A 3TQOA 1R0YA 3OU2A 4X1IB 1C7ZA 3ZIDA 4XVRA 3CHQA 3GUVA 3GFQA 5JAIA 1ULAA 4K7JA 4QEZA 2BEJA 1OV6A 1X7HA 2XUZA 5JI2E 3F0TA 1KFBB 2Q8PA 5GPBA 2P4EA 3UWKA 4AUNA 2Y6VA 4YAIA 4WK0B 2NOAA 4CM9D 4QL3A 4CT0A 2UZ4A 1U0LA 2I66A 3T5TA 2NSDA 3WV4A 3X0DA 1ABEA 2VZ9A 3S27A 3UKJA 4XM2A 4CDMA 4AF8A 1JIUA 3HP7A 2XNHA 3W1VA 1AQJA 3P0HA 1D6MA 2OBMA 3R75A 2EKZA 4WCDA 2VDPB 3KJFA 5HHTA 4IOKA 1GPMA 2Q3HA 5CVJA 4I36A 1VPWA 2Q29A 3TNLA 1GUDA 1K8ZB 4S3MA 1XV5A 4KUEA 5EZYA 3STTA 1NX9A 3HQ4O 3VI3B 3NOXA 1FUEA 3S4YA 5D00A 3I1FA 2VAVA 1W25A 1U7PA 2GSWA 4MA0A 3MPOA 4BRUA 1K3TA 4JT2A 1F06A 1PW5A 1Z2NX 3ULKA 4KZKA 3DLIA 1VJ1A 4DDMA 4DHEA 5BSKA 6REQA 1TEXA 3F5FA 3K8ZA 3U9WA 2M2IA 4RTMA 1T2UA 3B6JA 1SXGA 1EX6A 3CNEA 3L8CA 2QLBA 4NECA 5TJHA 1ND5A 5CD1A 1MEJA 1LVUA 4DZTA 4E32A 1A9QA 1CT9A 4L5BA 3EYAA 5J5CA 5BWNA 1T2FA 2ZYRA 1DC2A 3ABOB 2VHZA 2G7ZA 1CUDA 2DFLA 1CUCA 2PKEA 3WKAA 6NULA 4DY6A 2WU0A 1W4LA 5DNYB 4E4RA 4Z4EA 3KYDB 3SXPA 3D6VA 4A5OA 2WF8A 5IHXA 1RI2A 2OXRA 4GKJB 4GB9A 3GVCA 4XYEA 3E9QA 1QYVA 3I45A 3ZWBA 5FEUA 2J0SA 1OFTA 2Y1LE 4WLUA 1RM5A 4BY6A 1N1EA 2ZXFA 4G6ZA 4WNCA 2X4LA 3S2AA 4TMYA 4MR7A 3WGZA 1DB3A 1VCIA 2ZBUA 4HAXA 3T9BA 3GIWA 1H9BA 2ZAYA 4FGKA 2PLAA 1WZNA 3WGJA 2I9CA 3ZD8A 1LD8A 3FEXA 2LIVA 3LDGA 4GR9A 4OHVA 5JD4A 3HMQA 1PV2A 1QS0A 3UTMA 4YJ3B 5A62A 5FQOA 3SZMA 3E48A 1TJPB 4Z9FA 3GJ4A 3DGEC 3NBXX 2PGXA 2H1SA 1FDOA 3NAMA 2JA2A 4HRVA 3EUVA 4WGFA 2R8ZA 3DFIA 1KOLA 3X1DA 1CJKC 3J81A 3PEVA 2WXNA 1MBZA 2EFDB 2OP0A 4F85A 4ZOCA 1Z0IA 9MHTA 2R1TB 3UJAA 3R8CA 4XD7D 4KQGA 3PNLB 4Z53A 5AW6A 2POCA 1H94A 3ABKE 2BELA 2ZIXA 3QJGA 2FRDA 1T5IA 2IELA 4I4TF 3SQXA 5CX1B 4XVQA 1HEUA 1AQLA 4EPZA 1ODLA 4MYHA 2IDKA 4UDNA 5H59A 2F2TA 4RIIA 1TPZA 4EY6A 4GI5A 4CMCA 1SUWA 1TLTA 2X3MA 1SHTX 3FUMA 2XDQA 3T1VA 3R41A 2ZIZA 5BV1A 4I1RA 1XXHA 3TVDA 1Z29A 3RW9A 3T9KA 5D0OD 4M1YA 3S2ZA 4O1OA 1Q84A 1VYHA 1WMDA 5FPYA 3TNJA 3QVLA 3COSA 3VV2A 3E15A 4GPMA 2G9VA 1C9JA 3GFSA 1QTIA 4WNDA 2FWNA 3TQQA 4QPZA 4KITB 2NSLA 4HRLA 2KLBA 1PLLA 3PFGA 4LY6A 5KX5B 2G0NA 3FU3A 2YOFA 1WB4A 1WCIB 2FOXA 2PA0A 3CN9A 3F9CA 4RHEA 1Q1GA 4R31A 3AXSA 2I1VB 2YJ5A 1RM0A 5IVHA 1N4PA 4ATGA 2J3DA 2HO1A 1XHEA 4X24A 2AEMA 3U7EB 1QIJA 2AXVA 2PM8A 5A3JA 4PC2A 5HRCA 2O0LA 3N5KA 1H4SA 1A4IA 2VAPA 1OZFA 2O7NA 2PSFA 3H1PA 3ZLBA 2WIBA 3IJ5A 3FOBA 3GT7A 2HHAA 1JSXA 2X3YA 1VSUA 1BS1A 4TRNA 2B78A 4BQOA 5BWLA 5CPBA 5DKFA 5FUQA 1E8DA 3WFIA 3VC1A 2LCIA 4OQLA 2R6JA 5B2FA 1FTNA 4A26A 3SP1A 4EPWA 1U0NA 5THXA 1M6NA 4W5WA 5EKXA 4PO3X 1NVTA 2RI0A 4ZT3A 4CE6A 4DA8A 1G20A 1EP2B 1V16B 3JQAA 3HBNA 2WU1A 2AIRA 4FYVA 4PLWA 2ERXA 2PY6A 3RJ5A 3NHBA 1Z6GA 2FQXA 2VJQA 4I2ZA 3MVEA 4BWYA 2OV4A 2NPFA 3MHPA 3FDZA 5LN1A 3ZWCA 4H2DA 1XTSA 1GWNA 2HRZA 4BJ6A 4X94A 1P7ZA 4G1EB 4WNEA 3RUPA 4ZYYA 5F1OA 4DLKA 1VCMA 1K88A 4WOCA 3THOA 4AIRA 5FPKA 4L73A 5M34A 4J1TC 4LISA 3CE6A 2CGEA 4YWJA 3ESAA 3NFRA 5J58A 4HL6A 4JI3B 5F4BA 2GZ2A 1MJ5A 3GEHA 1JQBA 4OAVB 1NVVQ 3PZRA 5J2TF 3RJTA 3WAJA 3I05A 3ER9A 2PWAA 2Q3FA 3O4HA 1AKYA 1E79A 4MW2A 1PX0A 4FFWA 3G9UA 3G7UA 3B6ZA 4IHAA 4CDRA 2V6FA 3QEKA 1OQAA 5HGJA 4B3FX 1X1EA 3VA7A 3T94A 1T5HX 1UBMS 2DP4E 4LQ4A 1WOMA 1J90A 2ZZNA 1D1QA 2DULA 3BWVA 4GKAA 1GEEA 4RPGA 4LJ9A 5KSZA 4M60A 1JEYB 1H3FA 3LKZA 4OJMX 5IKXA 3LEWA 2QY9A 1Q19A 4Q16A 3UXGA 4PN3A 4J07A 3A9SA 2HCRA 4COOA 5D87A 1I4OA 2VCEA 3AZQA 5CYPA 3CSSA 5IEJA 2CEAA 5KIAA 4MINA 4ZK6A 3S40A 4GFDA 4K3VA 3QQ5A 4R41A 3FHTA 5H82A 3IEGA 5CEAA 2QM3A 1V8BA 2JBAA 1FVHA 4IMRA 1AB6A 1EAYA 4MV7A 1Y0BA 5B3AA 3UOAB 5AM3A 3TWQA 3HFSA 3PPVA 4IO0A 3ORHA 5LUAA 1S7CA 3HFRA 3QYFA 2QC9A 1XZ8A 2F7SA 2H16A 2PKXA 3RVJA 3MB5A 1X8JA 3CEJA 1N1GA 4CG1A 4N5MA 4PG6A 4EJ0A 4C7MA 3IUSA 1O1RA 2OSVA 1Q7GA 1OCRE 1FRVA 4BNFA 3SHFA 4C0AC 5K4HA 1IN1A 3TSAA 2VYCA 4F72A 4UQYA 1Z4JA 3LQQA 1Z2PX 2VZ0A 1XDSA 1JL3A 4D4JA 2HYDA 3MINA 4HYQA 1P73A 4A3VA 4O59O 4WMLA 4NENB 3WS7A 1YQXA 1SA0B 3ONVA 3RFTA 3FCCA 2DZDA 3WWPA 5JA4D 1OCZE 3ITWA 1FPMA 3A06A 5AHWA 5KAPA 4EG8A 4Q24A 1Z5VA 3G7SA 5TEWA 2C58A 3GF4A 4QOIA 4QPJC 2FMTA 1PYOA 3VSAA 3A9VA 3G3EA 4BUCA 4E2WA 1N1MA 2BLLA 4P92A 3ZWNA 4CKZA 4WA8A 3RJMA 3K0AB 3D8UA 3IQZA 2P5SA 1X1SA 5KVQA 2EHJA 2JH8A 2XMCA 3DF7A 3SJAA 1D2HA 3GPBA 3OEWA 1YBHA 4BBAA 2X4GA 1X7XA 1P5ZB 2JIZD 3G2PA 3IVCA 3QE3A 4GMGA 3T4XA 4QDOA 2X5XA 2E1PA 4YRMA 2VA8A 4ZI5A 3TLJA 1XMJA 2J5RA 3I5AA 2FN7A 1XJ5A 1AGYA 2I6FA 3NORA 3O92A 5AKGA 5DU2A 3R7FA 5H9WA 4PC7A 2QD1A 4BO3A 1ICEA 3OO0A 3HB7A 2CDRA 3UAOA 1MX6A 3PQ8A 4LCJA 1W3BA 3BL5A 1XZEA 1NGSA 3G68A 3UAGA 3IMFA 1P4GA 4Q03A 2BKGA 1SC1A 3N2NA 4QFDA 2PG3A 5AI6A 4EHNA 2XQKA 3O74A 4JD2G 3U3OA 4JI6B 2GO7A 4G24A 3I6MA 1QX4A 4NBKA 3M4NA 4QEKA 2HV9A 4MRSA 1JT2A 1YA8A 3AAAC 3OOWA 3OIYA 4P4UA 3IIIA 5ITVA 5KQGA 3VO8A 3D6TB 4K6MA 4URXR 3K94A 5BSWA 5CFNA 5EMJA 1QRSA 2F8SA 4H6XA 1OLSA 4X97A 2G7MC 1SIWA 2PNFA 2BHLA 4YIKA 3R8FA 3TZ6A 2SICE 2JK0A 3GI1A 1WVIA 2GJ4A 4AB1A 3LDUA 1YI1A 4Q94A 2QPAA 4GBGA 4ETMA 2FEKA 4L5IA 5B1IA 1T10A 2NSZA 2B83A 1EM6A 4YCDA 1E9RA 3KJZA 4MR9B 1PL6A 3N2ZB 5IYZF 2FJBB 1L7DA 5AIJA 2HYZA 2OO5A 4CIWA 1QFZA 2J9RA 1U7WA 1ZFNA 4EJ6A 2IGTA 1FTYA 8ADHA 1A5SB 2PRIA 2FP4A 2ZI9A 3WLIA 5BQXA 3GA5A 4LNUB 1X1CA 2BM0A 1WD7A 2SECE 2R6AA 4LHWA 3SX0A 1BW9B 1TNBA 4KN6A 3ESLA 4PCUA 4HKTA 3K0FA 3B5EA 4LQLA 1R16A 1KGDA 2CXHA 1ADGA 3DOOA 4B0OA 1C7FA 3ZXYA 4J0HA 4XQ9A 2X6FA 4BJ5A 1E1CB 3SEZA 1E3QA 4F4HA 3EPJA 2WU4A 4GOJA 1BQ3A 4HPWA 4WZAA 4G01B 1W4CA 2ORED 4AJ4A 4WOPA 1KARA 5I8WA 1MNAA 1U2QA 1G6HA 1U3TA 2CDBA 4D4IA 3GLGB 4DVGA 3S7FA 3JTMA 3RU9A 2P75A 2RK3A 4I50F 1T6XA 1CUSA 5IUJC 3SE7A 3VNAA 1I9CA 1SR8A 2VPXA 4FHCA 1P60A 4NOKA 4JC4A 5CVDA 4IQ4A 1BXGB 3DAFA 3QE4A 4QXRA 3PR2B 4YPFA 3L08A 2QLJA 1EWTA 3KZKA 3ZC3A 4BB6A 4BE4A 5I7WA 3DOHA 1PUJA 3QW4B 3TE7A 4WV3A 2HA5A 2PZGA 1JTVA 1TAHA 3ADDA 2ZJ8A 4CWAA 3PXEA 5CGZA 3VO1A 3SC3A 3U49A 1U6IA 2GW1A 1G7TA 4MV3A 1MZPA 4C4AA 3RK6A 1YZ3A 5KQMA 1P2TA 1IN6A 1U9CA 3L0ZA 4MV5A 3DSRA 3UJBA 2BKEA 3ND8A 3D7MA 1FLNA 4QC2A 3FMVA 3WHKA 1U3CA 3EG9B 4Q4AB 3JWEA 3B9RA 2O2EA 3OJFA 1AV6A 2NMVA 4GYJA 2X9LA 3BSWA 1GGVA 1W88A 2NG1A 2R0QC 4ESOA 3RCBA 4Q9NA 4U5XA 4D2IA 4GTQA 3I9LA 4EBBA 2B99A 3TZKA 2PDAA 1FB5A 2FSVC 3RWMB 4OYYA 1MHPA 2P9PG 4IGAA 4B35A 3QF4B 5FADA 2DKNA 1DOAA 2XAAA 1A17A 1HT3A 1OXUA 1R00A 1RRFA 4RZIA 2F67A 3ZW9A 3CW8X 4B2YA 3IKTA 4B6RA 2IS1A 2IY7A 4RADA 2QP3A 2ZJ4A 3UHOA 4Q3AA 2IV7A 2G07A 2P7IA 5DNWA 2V74B 2ZK7A 3E27A 1LLCA 1C8KA 1DAGA 4FOOA 1FU8A 3M1IA 3R20A 1I2BA 3NBAA 4ZQHA 2HM7A 4DIUA 4B3DA 3COYA 1Z25A 1J5EB 3ICPA 5DNEA 1X4RA 1OZGA 5K1ZA 3CLTD 4JODA 1EH5A 4YMSA 2IOLA 4J0EA 3UA4A 2IY0C 5A23A 1VRWA 3RS9A 3TSOA 3ZBPA 4ERNA 3JTEA 5ELXA 3PX3A 4BMPB 4WD3A 4GYKA 5A4KA 5H80A 2WC1A 2A7XA 3PR3A 5AK6A 5I4IA 3JQQA 5TQ0A 1C3EA 4EITA 1E58A 5ERXA 1E5DA 2CMFA 4FA6A 1YB4A 3HJNA 5B3KA 1KO1A 5GV7A 1S2GA 2XAUA 2EWWA 2H0QA 4IG4A 3T8YA 4LSZA 1BGXT 1YB1A 1GG9A 1KT0A 3D4PA 1WR8A 3QYAA 4BMXA 3AWDA 3SZOA 5ITZB 4ZTUB 4N6OA 3CRW1 1I1NA 2DCUA 3OBIA 2EKDA 4DJEC 1KKMA 1XLTA 2I2BA 4UUAA 3R9KA 1P5FA 3TTSA 4CMGA 1ZC4A 3MILA 5FO1A 1KEEA 2G5CA 3LIPA 2ANBA 1ZVKA 1MJGM 2HBYA 4NCJA 4B5LA 1PT5A 1GA6A 2FSGA 5HVNA 3W5DA 4JHRA 4IF4A 4JUAA 1K9SA 4C76A 3Q12A 4RHYA 3WGHA 3BEEA 1XU4A 2VR1A 4UVDA 3UMSA 4L9WA 1HE4A 3WDLA 5AXAA 4LJ7A 1XD2B 2CHVA 2DBYA 1K8XB 1ODIA 4D80A 5EZQA 4DSZA 3BTOA 2GVZC 4C1BA 5I45A 3MX3A 4CEJA 2ZP1A 3D3QA 4XE5A 4OX9Y 1M0EA 3A1NA 2ZTSA 5DX0A 5EWLA 3ONWA 4GQBA 3CX6A 2VS1A 5B6IA 1FYVA 3KE9A 4CR8A 1HSOA 2XA9A 3GP3A 4XXHA 4QXMA 5BN3A 3WY9A 1U4NA 2WMYA 1XRQA 1JXQA 3G5AA 4GH5A 4Q4DA 2J4BA 2IU1A 1B74A 2VYQA 1LW6E 5BSTA 4F53A 4UCXA 5DCLA 5TT1A 1R4MA 1O95C 3LGSA 3RFXA 1RIIA 3VTKA 2GM4A 1WM1A 2VPTA 4OK3A 2O5CA 4XFJA 2VLIA 2GLTA 4JHKA 1H5UA 4D45A 2J8SD 1K98A 3TECE 2CYAA 4NOMA 1HKHA 3S7DA 5ALLA 1MDFA 3GQVA 5E1MA 3CA8A 3D9HA 2TMGA 3PNMA 3NBKA 3IBGA 3NM4A 4RC9A 1L3BA 4LSGA 1V0JA 4N47A 4NEHB 3DFUA 1OLXA 2AW3A 2PH1A 5KNCH 5DCWA 3EZ7A 1XMOB 4E46A 1B8NA 4JXTA 1HLFA 1THTA 1O4VA 3QX7A 1PU2A 4QSMA 3MWKA 4W7IA 3TBHA 3W8NA 3IXMA 4R51A 4ESEA 4F46A 3KPYA 1LK0A 4DX5D 1TM2A 1QTNA 2F43B 1N5DA 4LXQA 1HKUA 3NEYA 5GOZA 3ZWAA 1JPUA 5SY4A 4BRZA 2O8DA 1Y6FA 4XEUA 5JH7F 4BX0A 1P6QA 1PL0A 3T9CA 3T4PA 5JC8A 4MKHA 4GTRA 4ZODA 3WKBA 4FDVA 4NICA 2JIDA 4Q82A 4BMSA 1F5NA 5C7OO 3GPDG 3FUHA 4W9MC 1ISMA 4AJOA 2P30A 4FC7A 2ZPAA 2VJ8A 5AQAA 1NN3A 1QX3A 3COPA 1R0SA 4PX3A 1UZUA 2OAQ1 3MF4A 2R4TA 3VKVA 4FBLA 421PA 3JQ8B 3SWWA 4AAYA 3BGSA 2YN4A 1UXJA 2I2CA 4DK5A 1SXJA 3GP8A 4LA4A 1F3OA 3M7IA 3NUQA 1YU6A 3ZRHA 3ULQA 3RASA 3RAFC 2PZLA 1U3VA 5SZHB 3DSSA 1DI0A 2Y1CA 4Q39A 5DZSA 5CEEA 2XODA 1UT5A 2FPMA 2PKQO 2QG4A 5B1HA 1T6YA 3AF3A 2Q4TA 3BRCA 3DOEA 1UXOA 1QE5A 3K2BA 4GPD1 2IY8A 1L7VC 4KO2S 4LF5B 1JDSA 4OKIA 5FQ8A 2Y2UA 2P8SA 2RG1A 1OAAA 2AEFA 3BMCB 3D6JA 1KQFA 5AKHA 2V8OA 2EZ8A 4FQ5A 3NJ4A 3RC2A 4BNJA 2EJUA 3OUTA 4RFLA 5A0FA 3OJEA 1VL0A 4XDZA 2A9PA 3M5WA 4TL8A 2AC4A 5BT8A 3ZS8A 2P9ZA 2XKJE 1ENYA 3WTBA 1PYDA 3LSTA 3MKQB 1AN0A 2VO1A 7ADHA 2WUWE 1HWYA 2HA2A 3BZBA 1X15A 3R9AB 1GNPA 2C3PA 3L46A 4RJKA 4IMIB 3RT9A 3LF2A 5LJIA 3TIVA 1KJJA 3LQ4A 3AVXA 3VNVA 3BHIA 3SYLA 2SBTA 3S1AB 2R02A 1UKCA 1Z2AA 1XWIA 2GX6A 3SJ7A 2B6CA 3HV0A 3N86A 5KS2A 1JB1A 3MTEA 3NIGB 1D8AA 1X38A 5B4VA 3NLLA 4HUJA 3R5HA 4NG4A 2WSLA 3ZK9A 3C3KA 5F35A 3RABA 4LFAB 4A0FA 4MKZA 3ESXA 1N4AA 3A9CA 2Q6KA 2PRJA 1N0UA 3KXDA 1U8CB 1DXOA 3FPGA 3E3AA 4NY1A 3NCTA 2B1IA 4FYPA 2IXTA 3FYDA 2ZJFA 1L8XA 4LERA 221PA 5G0TA 4IHJF 4YJ3F 1VPEA 1XVUA 1C0IA 3CG4A 1OKKD 1CUYA 2FXVA 3GRVA 3H8VA 3UPVA 4Q48A 4UE3S 1V2HE 1TZCA 2KCKA 3EHRA 1ZEJA 3PUYA 1IM2A 3GLFB 3QP9A 1EWQA 3H9BA 3IHYA 3E4CA 4OXKA 4TYPA 4XYBA 3RUHA 3EZ2A 3L8FA 4KGDA 3TSCA 2A78A 4RK5A 4XPIA 5JAHA 2JIOA 2NN3C 3L7DA 2CL0X 4UEOA 4LTDA 2B21A 2D0IA 3ILSA 2HDHA 4P1ZA 1Q7TA 3W6PA 4RKWA 1ZD5A 2RGEA 4TUUA 2WWFA 3I2GA 4QYIA 2W6NA 3RHSA 1O08A 1KMHB 3F6QA 1OA0A 1ZCAA 2FDRA 2YC2C 4PONA 2AZTA 3JARA 3JQAB 3RS5A 5BRAA 3HWRA 2QN3A 1H66A 2IYAA 2QG6A 4HTAA 1XZIA 1MOPA 4XWYA 7ABPA 3GRRA 3AMVA 3H16A 1N9GA 2P5TB 3LT0A 3V80A 4DR3B 3K4QA 1GL3A 2I5PO 1GUZA 2RFLA 1ZP6A 3BXPA 3LUHA 1JDZA 3PC7A 5JS8A 2HO4A 3MG9A 1IXVA 4FJZA 3G9ZA 4M49A 4F60A 3ZDDA 2WV9A 3PGLA 1BQEA 2JLXA 4MEJA 4ZQIA 5A05A 3COJA 1V11A 1Y80A 2BFPA 4UWGA 1N0HA 3T34A 3AVQA 2BGJA 1XXLA 3LWDA 3L5OA 4EB6A 1EDZA 1CQJB 1DZIA 4GM1A 2GXSA 1EIZA 4IIFA 5BVGB 1S2OA 2RHLA 1ST3A 3THSA 2KPOA 3TCKA 1UJJA 3EVBA 1SUSA 3LLUA 2C95A 4KVOA 3RSEG 3MGAA 3H84A 3PLNA 1HRDA 2BZSA 4EFMA 2EP5A 1O0CA 1HORA 2BTQA 1BFUA 3RK4A 4D9HA 2Q4EA 4YXFA 5KQRA 1NVMB 2PUJA 2FX3A 3GH1A 3G9QA 3D7RA 3H2ZA 3AV3A 3FI9A 3R6TA 4HB5A 1E1DA 3FBWA 3TVTA 1NMYA 3T7SA 2OCLA 3MGKA 2JLSA 2HREA 1RNLA 2HC9A 5LVAA 4CLXA 5M04A 4L74A 2PLFA 1JFFB 2DECA 4JJAA 1W5FA 5ALYA 3PJFA 4DOMA 3OSZA 1WZ2A 1ONNA 1N6LA 2ZJOA 3WIOA 5LP0A 3R3JA 1CR4A 1XZFA 3PHJA 2PM7A 3HWX1 3V34A 2R8PA 4KR7A 3N0XA 1E20A 2GHQA 4G4SO 1HH8A 2RONA 1H2UA 1RMTA 3NZEA 1J5PA 4JJFA 2XRZA 4IRMA 2QU7A 2WTMA 3EHMA 1N3LA 1ENZA 1TC1A 3MQ4A 1TKBA 3W4JA 4CI9A 4CV3A 5JVDF 1UJKA 3FNIA 2ZUBA 4RV5A 1T3GA 2WXIA 3PNLA 4EUSA 2IE0A 2JLUA 1JT9A 3IIEA 1RPAA 5AIBA 5JEDA 3CVYA 4O02B 2IPXA 3FBTA 4FYIA 2BCEA 4N3BA 3K09A 4ONEA 4LWOA 5J5AA 1MO4A 1Z5GA 2DLNA 2VK2A 3S44A 5EL0A 3VKUA 3PNSA 1VZ2A 3R3HA 4NABA 3OQOA 1YCSB 3CF6R 3HKDB 5GIOE 1VB3A 4P3PA 4CL0A 1WHTA 3CX7A 1U98A 2XD9A 1R15A 1HQKA 4AG6A 1I33A 4UHJA 1NNUA 4XYLA 1SXJC 5FEMA 1KNQA 1NBAA 3G6WA 4GE0A 1F8FA 1NXPA 2RGCA 3HA2A 2X0DA 4FLEA 5K0ZA 1FJXA 2AQHA 3PGJA 5GV8A 1E6LA 1RTTA 2O4CA 2VNHA 4G56A 2MSKA 3HRIA 3GCDA 1EFHA 2Q3BA 2Y1WA 4BKRA 5LXTB 2XGSA 4J8EA 2GUGA 3GNLA 3LBYA 1XFAA 3C70A 4MW9A 2Q8QA 4EEXA 1T9GR 3QPDA 4TLMB 4RH1A 5ECWA 1LI4A 3SYNA 2NZUG 3BWCA 3FUEA 3VJKA 4RD3A 4P7FA 3MIIA 5F2OA 5K3BA 4UI9K 1JDNA 3C74A 3H0CA 2HA7A 4RCYA 5EQJB 5LQJA 1HZJA 4XFKA 2HFJA 2CJYA 1O97C 2Z0MA 2ZVQX 1Z0UA 4CM6A 3KOYA 3OFND 3IP5A 4Z9BA 1GTRA 3B5JA 4FGJA 1TQ6A 2O8EA 3OFSA 5E2BA 3FNBA 2PUEA 4FFVA 2FZ5A 3BS4A 2CXOA 1H2WA 2R1VB 3F3YA 1CR0A 3F9IA 3G2JA 3INYA 3FDIA 3OZDA 1JHMA 4FR2A 1FFYA 1YZTA 1T8RA 2JJYA 3IOBA 3AZPA 1BXKA 3ORYA 4OIMA 1GXSA 3ESQA 2HWUA 2YIVX 3PCTA 4NZMA 5DCUA 2P4UA 5EXPA 5HJ7A 3O1IC 3KJEA 4EG0A 4UTRA 1N9GB 3I58A 3N7UA 3PGXA 5IULC 4O0LA 5AJYA 1H4QA 2WD7B 1E2NA 3B13B 4MP6A 1NW6A 1LPAB 1MENA 3KAPA 4R2LA 4LJLA 2MR5A 2DJ5A 4TTPA 4D4LA 4WN9A 3DD1A 3GJ7A 2JIQA 4JLAA 5EG5A 1TUEA 1Z33A 4YJKA 5J2UF 3CYFA 4R83A 5BSFA 2C2HA 3EQ7A 3HU5A 1UW4B 1KJIA 2DAPA 3DR5A 4AKXB 1OROA 2FGJA 3LVBA 2O57A 4BVFA 3BK1A 1YVDA 1L4LA 3ZVMA 1QIEA 5IXJA 3V4VB 1A9XA 1I0ZA 1K7XB 1M8GA 3QWPA 1DEXA 2QW8A 5CVEA 5BT9A 4DLRA 4D56A 1Y3IA 3EFOA 2FZCA 1RZ3A 5JFGA 1R88A 4IY1A 3FKSD 1NM5A 4FYWA 2JGAA 4X1IA 2HSWA 2MYPA 3PA8A 4G1UC 3L7OA 3HCRA 5K0CA 2V6IA 1XQXA 2GT1A 3BXHA 3JX9A 5ED0A 1Z13A 4ZCTA 2AFIA 2Y4NA 4NPHA 1HLDA 1JPLA 3F7TA 4JSTA 2BP7B 4XOIA 5EWJB 1IATA 1GKYA 2CE2X 3U4DA 4B84A 3GLGA 5F5NA 4M4SA 2Q62A 3SF8B 4B3SB 1EVYA 3KFVA 4XAQA 3C4QA 4RLHA 4RPLA 2A5EA 3QB2A 2BL4A 1XU9A 3G2OA 2FSFA 4AI6A 1BXZA 1ZY2A 3HWSA 3C7CB 1FC0A 3GEDA 2H4ZA 1EWVA 4EUFA 4DUPA 4V3BA 1A04A 3U3ZA 2R7NA 2UKDA 1ZN7A 2CVHA 2JAWA 1RXIA 4NTZA 4RPHA 5LCWJ 5CA0B 3BUAA 5JQGF 1WDYA 1BX3A 1U7HA 5TQJA 1F2UA 3D9JA 3BREA 1HPLA 1W4ZA 2AGVA 3AJDA 2P5UA 4RD1A 3FTPA 3D9IA 4PGHA 2C29D 3N2GA 3TG4A 4YV0A 5ETJA 4FPXA 3ZKWB 1T4GA 4ZTBA 5JANA 4ZDJA 2J0QA 2GK4A 5FT9A 2GYVA 2IEYA 2CUKA 4LBVA 3DMFA 1DCFA 2AQ8A 2HSZA 3AW8A 2RI1A 4EG3A 1KO5A 1O58A 1UBUS 3Q40A 2O1SA 3AS8A 4KI7A 4LXTA 5HUQA 3RIEA 4R1SA 5G53C 4IIGA 1CF9A 3VR4A 2OXTA 1EFRD 5DGHA 1L5ZA 2I1LA 3A6ZA 3GOHA 4QELA 3U2QA 1BVUA 1NOKA 5LDHA 3UK1A 4B32A 1HDYA 3SVTA 4ZP1A 5CTJA 2P7HA 5L45A 4TUMA 4MV9A 1M76A 3T5BA 2G5GX 2JGKA 3OC0A 3EZLA 4GEKA 4M55A 4TS9A 4RTKA 4GEGA 5HFAA 4ZYXA 1CVRA 3K05A 1AQIA 2KQUA 3GMDA 3PDCA 4N0PA 5AI8A 2V8SE 2DX7A 3PQ2A 3V8QA 2FSVA 4BNNA 2ZU6B 1PY1A 4AMYA 1T5TA 1E9AA 4AMGA 4P4LA 4C3ZA 2BKKB 2GRRB 4F4IA 1IN5A 4Z1MA 2CF6A 3U4QB 5CAEB 4ARAA 1NQVA 4DWOA 3H5AA 4H7EA 4X93A 1M2GA 2Q7OE 2DWZA 3C3BA 4HDAA 3J7AC 3I2IA 1P4RA 2ATVA 3FUJA 2FW7A 2I7DA 1CY4A 1DIAA 1LBTA 4W6ZA 1ICIA 3R9XB 1VB5A 1XYVA 2WY2D 2J46A 5I7SA 1KI2A 1YU9A 3EUEA 1I7LA 1LF8A 4JEHA 2CFIA 2PBRA 1A4RA 4Y2PA 3LBFA 1NBIA 1GUBA 1Y9JA 1CJUC 4FFOA 4ALLA 2V3WA 3T8MA 3LFHA 2ZGVA 3ZWYA 1JVBA 4MWOA 4Z7JA 4J76A 1K4KA 1X7GA 4RHCA 5E6SA 4Z4HA 4DDKA 4NCBA 1KGSA 3IAXA 1K86A 3UJPA 4TV9B 2RGGA 2ZRGA 1DUIA 3BZUA 4DAOA 1Z17A 3N6VA 1JEQA 1ESZA 4XCXA 5IG2A 3O4ZA 1XTUA 1VJDA 4UCQA 5DW0A 5ARBA 4U2FA 2XOXA 4GPEA 5TMPA 4D0RA 1SA4A 1HE8A 1J0XO 3Q9LA 3PFWO 1EJ0A 3QA9A 3QOWA 1NQXA 1YAHA 2FEXA 4HGQA 4FD3A 5CHEA 5DWVA 1DMRA 5JCOA 2OYCA 2E4YA 4ZVNA 3PF9A 1WW2A 4RPIA 3WFZA 2EIHA 2F6RA 1GD1O 2F9LA 3CBQA 4UUOA 4RMJA 3EIUA 4Y2YA 3KFXA 5FLXA 1ZA2A 1GGKA 3EISA 3HN6A 3N3BC 2H29A 3OE5A 4MO2A 5H8WA 1OYOA 5JDIA 1Z56C 1CXZA 2WVJA 1SAYA 2C59A 4V0NA 2OC4A 1SWWA 1VKNA 2RGWA 4PZCA 2HMVA 4W82A 3I4GA 1SBCA 1UAGA 1QHFA 1M2OA 2OTCA 2VQ3A 5REQA 3ZU4A 3ZLTA 3QOFA 4K26A 3VOBA 4XSGA 4BT9A 5IJWA 4G5HA 1JEYA 3FETA 4M1ZA 3VR5H 4CKXA 2H54A 1VDZA 5KYUB 4QXOA 1EQUA 5JCJA 3ABZA 4RNDB 3AETB 3V46A 4L4XA 1DV1A 3C15C 5D8DA 4D6PA 4AN1A 5A6SA 3IT2A 5KSYA 1CFJA 3Q5GA 3FOAA 2VJMA 1NR1A 2XCOA 1GU1A 1G8PA 5DX1A 3WA7A 2QGFA 5ARFA 2V9ZA 4DA0A 4GRIA 1YBVA 2I4LA 1EG7A 4EQ6A 4QDKA 1XVAA 2JJMA 1SEVA 4YJ2F 2FZLA 1UQTA 2QRHA 1TQ8A 3NEAA 3QSGA 2NSHA 5SZIA 1NNEA 4LN1A 2BKAA 5T57A 1NLZA 1B73A 2V7XA 4I50B 1E3SA 4DBZA 2QTHA 3WQQA 4O60A 3DDCA 4KIJA 4RD4A 4YMVA 4L28A 4N41A 2GCEA 4PC3A 2WZBA 5JAPA 4A1SA 1INZA 2LKCA 5MFPA 4OTZA 4U96D 1AB5A 2XQ0A 2XLBA 3OCUA 1R6DA