4XI9A

Human ogt in complex with udp-5s-glcnac and substrate peptide (rbl2)
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
717
structure length
698
Chain Sequence
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title The active site of O-GlcNAc transferase imposes constraints on substrate sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 266
structure length 698
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xi9A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xi9A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4xi9A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4xi9A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xi9A03
3VTXA 1Z6QA 2KC7A 1YA6A 5D0OD 3ZN3A 1WW2A 3L7DA 4CGWA 3FFLA 1UQUA 3OTHA 2KS6A 3CVPA 3RIBA 3OT5A 1NLMA 3IAAA 1ELRA 4WNEA 4JA9A 2QRMA 3LCAA 3G2NA 4HLNA 3TOVA 4GZ3A 4YI3A 1QKJA 3L01A 3NP9A 1GPAA 3UYLA 3L7AA 3NF1A 4GCNA 5I45A 5JJ7A 3UYKA 4BQEA 2Q7FA 4CTMA 5TMBA 4FZRA 3CEHA 1K06A 1GG8A 4H7YA 3ZGQA 2GPBA 2G9QA 3MBOA 3CK9A 4I2ZA 5DIZA 2F9FA 1EM6A 2J9QA 2QN8A 5D00A 4HORA 5FZSA 2FI7A 4YUAA 4HOQA 3MQFA 2X0FA 2G9VA 1C8KA 2IV7A 3T7DA 4GYWA 4WACA 4GA1A 1IYGA 4HOUA 2QFCA 2QN3A 1KT1A 4U0ZA 1FCHA 3BCSA 3BD6A 3Q4AB 2PRJA 2L6JA 4RIHA 4REMA 1C50A 1EXVA 2WQHA 4WNGA 4F97A 1L5VA 3T3GA 3PE3A 4GCOA 2Y4TA 4IN3B 4UI9K 2ASVA 2XCUA 4N3CA 2XPIA 4APOA 5LCWJ 4RELA 1NOIA 3E4BA 3Q5MA 3ZPJA 3CV3A 2PZIA 2JJMA 4Z5XA 3E3OA 1Z6PA 4N3BA 1OUVA 2LSUA 3LY7A 1JIVA 4CTNA 1UZUA 3CEQA 1P29A 3CUUA 4W9RA 3UPVA 2R4TA 3EDTB 1XC7A 4RIIA 3WXXA 2QZSA 3MS2A 3OKAA 2AVPA 4B94A 5CHEE 4HOTA 4BQFA 4J0UA 2QRGA 4KYOB 3LPZA 1F6DA 2AMVA 4YNDA 4L22A 5KJKA 3N71A 3TG5A 2MHKA 2ACWA 2OFFA 3T3IA 4G2VA 1C3JA 3AMVA 4UI9C 3S27A 2UY1A 5JTUA 5FJYA 5CCMA 4WADA 1H5UA 1KTIA 5JJTA 3KS2A 4AM9A 3TG4A 2IFUA 4AMGA 2QNBA 2YJNA 1GPBA 2F3UA 2IYFA 2PQ6A 3ASHA 5DBKA 2VGXB 4I17A 5A7DB 1F0KA 1PYGA 5TVGA 5G04J 2QN7A 2ACVA 4U0SA 3R9AB 3Q3IA 4N3AA 4AY5A 5M72A 1Z8DA 3RT1A 2IEGA 3C48A 4N2SA 2V5FA 3MRVA 3ASDA 4GA2A 2WPVA 4PQGA 3T3HA 1JG7A 5AYWD 3BD8A 5BT1A 4M7PA 3Q47B 2H1FA 1UQTA 1NZFA 2SKDA 3G2HA 3QHPA 4MRAA 2HR2A 2UY1B 2HY7A 4X7MA 2PL2A 2XGSA 3QOUA 3SZ7A 3G2LA 1E1YA 3MS4A 4O6FA 5G05C 2IF4A 3S7JA 3CKBA 3OKCA 3ZCSA 3MTDA 4YVQC 5IKPA 1XL0A 2XA2A 1FTQA 1Y6GA 4UQZA 4RBNA 2GM9A 3DZCA 4GZ6A 3UUXA 5KJNA 4RG6A 5EX3A 1GPYA 3Q3EA 3Q15A 3LY8A 3H4IA 1Y8MA 1P2BA 3NP7A 2ZB2A 2I6HA 2KATA 4G25A 4MHOA 3MT8A 2E2EA 4X7RA 2XCBA 4H7XA 2IUYA 3GYZA 4EKEA 3VUFA 1TJCA 2F3SA 1V4VA 4MICA 4ME2A 1NZDA 4A1SA 2C4MA 2XMPA 5FT9A 1YGPA 3L79A 3CX4A 3SF4A 3CVLA 4ABNA 2KCKA 3S7DA 2XA1A 4QLBA 4AY6A 1A8IA 2BGTA 2ECPA 3MS7A 3Q3HA 4XI9A 2R60A 2QN2A 3MTBA 3ULQA 4CGVA 2FEZA 2SKEA 2GPAA 3FP3A 3S0JA 3MRTA 4GPBA 4KQMA 3CUYA 4JL0A 2PRIA 3OTGA 2P6PA 4NESA 2XEVA 1IXYA 3E3LA 1XKXA 4BFCA 2GT1A 2QRQA 1IHGA 4X7PA 1QZ2A 3C4QA 4BQIA 4LEIA 3Q49B 3CEMA 3LKUA 3QDNA 2VGXA 2KCLA 2VGYA 3ZCVA 2GPNA 4M83A 1PC2A 3G2KA 4LEUA 1FC0A 1WV0A 5HQ8A 3U4TA 2F3QA 1HXIA 3MSCA 3BCUA 2PQNA 2C9ZA 1ELWA 2VCEA 2KCVA 1RZVA 4EKYA 5A6CA 4XIFA 4F3VA 2JLBA 4I2WA 5TMEA 4U0UA 1L6IA 2IEIA 4BT8A 2QN1A 1JIXA 4G26A 3D0QA 3NCHA 2C1ZA 1E4OA 1L5QA 3DD1A 3CVQA 2YHCA 4G23A 3D0RA 2GW1A 5CCLA 2GEKA 4W6QA 3MV2B 2HO1A 5HI7A 3RO3A 2X6RA 2G9UA 1P4JA 3NC4A 3ZCQA 4KBQA 3OXLA 1BX3A 1A17A 4BTBA 4WUYA 5LCWC 3OTIA 1HH8A 1GGNA 1SXPA 1P2DA 1KLXA 2Y4UA 3PDNA 2H1HA 1XOIA 4I9EA 3G2IA 2QLNA 3OY7A 1ZU2A 2BUGA 4RENA 1NA3A 3AS5A 3MEKA 3GZ2A 2LSVA 2VYIA 2BISA 4EL5A 5ENZA 3RSZA 2FO7A 2F3PA 4G2TA 2P58C 1RZUA 4BT9A 1P4GA 4RIEA 2QN9A 1L5RA 1PSWA 5DU2A 3GPBA 3ZCTA 3WC4A 3CUVA 1LWOA 3RHZA 2O6LA 3HBJA 3IA7A 3ZHEA 9GPBA 2XGMA 1B89A 2FFRA 4YI5A 5LQDA 4AIFA 1WUYA 2YQ8A 2HYZA 1XV5A 4LDPA 1SXQA 3U3WA 3BEEA 3S7BA 2G9RA 2Q6VA 4J8FA 4BWRA 1JG6A 5G04C 1ABBA 1M5RA 4MHSA 3RO2A 5FTPA 3CEJA 3SYMA 4RIGA 4EQFA 1HZ4A 3COPA 5EKQD 4KQ1A 4Y6CA 4JHRA 3L7BA 2OOEA 3VTYA 1FU8A 3D1JA 4GYOA 3CK8A 2BFWA 3BCRA 3QKWA 1RRVA 3T5TA 3OXFA 4KXKB 2VG8A 4RIFA 3S2UA 3URZA 4AMBA 4J8EA 3FWVA 3TSAA 2C2LA 1L7XA 2VCHA 1E96B 2XCCA 1Z62A 3QKYA 4MI6A 3KAEA 4MI3A 5EX0A 2XCIA 1QQEA 5TMDA 4MI9A 2DBAA 4F96A 1WUTA 3DDWA 1PNVA 3C4VA 3ZCRA 4NEQA 8GPBA 3ZHEB 1WW3A 5IKOA 3DDSA 3NAZA 2AV6A 1GFZA 3T3DA 3O48A 3T3EA 3KD7A 4RG9A 3UQ3A 1L5WA 2LNIA 3ZCUA 1FA9A 1WV1A 3CKCA 2QLMA 2QRHA 3MRXA 4X6LA 1FTWA 3MT7A 4N9WA 1LWNA 1Y6FA 2VSYA 3BEOA 3GZ1A 2C0MA 2R68A 1L5SA 1K08A 3EBOA 3GW4A 1VGVA 1AXRA 3QWWA 3ESKA 3RU0A 2QRPA 2GEJA 4XI0A 1XL1A 2AZDA 4Y6WA 2ATIA 3ZFWA 4NQ0A 1PN3A 4AN4A 4GZ5A 1KT0A 3QWVA 5KJMA 3MV3B 1C8LA 3JYSA 2R66A 3S29A 1FU7A 1NA0A 5BW8C 3HBMA 3IEGA 2R4UA 6GPBA 3MA5A 3BD7A 3TGOA 4UI9J 2JZCA 3K9IA 4U04A 1O6CA 4U07A 3VDMA 4UQXA 3GUHA 5HXAA 3CUWA 3TAXA 3L7CA 3MTAA 4F9FA 5DXFA 2FF4A 2C0LA 2X0DA 1FS4A 4G24A 1FTYA 5ARFA 3H4TA 2FETA 3O3CA 3CV0A 1P2GA 3VDNB 3RJVA 2PQRA 3WADA 3RSCA 2SKCA 3SYRA 1YA0A 2PYDA 4G1TA 2X6QA 3HBFA 1XNFA 3NB0A 1GZ5A 3MKRA 4NC9A 3WAGA 3CK7A 4WNDA 2VQ2A 4J8DA 3NPAA 3OXGA 4HOSA 2NC9A 1B4DA 2IYAA 3E3NA 4YVOA 2ONDA 3FROA 4EJ2A 2VSNA 1JIUA 4N2QA 2IW1A 4N5CA 5JJ6A 1P4HA 4WNFA 5GPBA 3S7FA 3EBPA 4I1AA 4FKZA 3HYMB 2QLLA 5FZQA 3AS4A 3ASFA 3QWPA 2FF5A 2GJ4A 4HWGA 2IV3A 3VUEA 4I9CA 4GPKA 2XA9A 2X0EA 2C1XA 7GPBA 4CDRA 3HBNA 1HLFA 2FBNA 5KJLA 4N39A 5G05J 2UWJG 1WAO1 4NRHB 5ARGA 1J39A 3BDAA 4KQ2A 5DLDA 3AS8A 4GA0A 1NOJA 5BNWA 2BGUA 3CUTA 5FZRA 5JTTA 1Y8ZA 1P5QA 3PE4A 1ZBPA 3RKVA 1AHPA 5D0QD 1JEJA 1NVKA 3OY2A 2AW3A 5C1DA 5D01A 4UQYA 2WTXA 3G2JA 4WHMA 3LYAA 4EL0A 1WM5A 4CTOA 3LY9A 1NZNA 3CVNA 1NOKA 1QM5A 2PYIA 4BTAA 1IIRA 3S28A 1FU4A 3ZCPA 4M60A 2R5SA 1W3BA 3MT9A 4JA7A 2XGOA 3OKPA 4GYYA 3ASGA
chains in the Genus database with same CATH superfamily
3DKIA 1WKBA 4I14A 4QO7A 2OPHA 5L4LA 5CLJA 1DBRA 3AVPA 3UKUG 2LXLA 3OT5A 1NLMA 5HZKA 3Q9UC 2Q5EA 4BAGA 1DKUA 3FYTA 1OZ0A 1PEYA 4ZGWA 4KQJA 4MDYA 5BSFA 4CYMA 5AK4A 2VSOA 5DBGA 2P68A 1R3DA 3H4VA 5JZBA 4BO2A 3THRA 4WI1A 3R7WA 1KYWA 3QXHA 3IH5A 3CVWA 1LPAB 1V6CA 1TNDA 4G8BA 1E1QD 1JBEA 4ZV4A 4LY6A 4MEJA 1L9KA 4LUNU 2IXTA 2I1JA 1AF4A 4EHAA 2CMKA 3QSGA 4ZU3A 2FRVA 1KK1A 4M9XA 3HYNA 1CBUA 1NUAA 2NXEA 5ADVA 3W78A 5AM2A 3WXXA 2AFRA 4NSNA 4Y1RA 3VR3D 3EIWA 4Z9YA 1XRLA 1TUEA 5E3JA 2YBDA 4FWIB 4RKFA 4H16A 5EXPA 3TG4A 4AMGA 5BWMA 4JJKA 4OBWA 4FMCF 3ABME 5JPIA 1R5OA 4QT4A 3HVKA 1JDSA 4PQGA 4HNVA 1PFYA 2R6CA 4R7GA 3PRKE 1Y98A 3V4OA 5GINE 5K8CA 4F1SA 3IL2A 4EB8A 2HKIA 3F6QA 3STHA 1IMOA 1X7WA 1G20A 2FMKA 4FR2A 2O2DA 2OK8A 2CZCA 2WJVA 4OU4A 4C7OB 3G89A 5JDCA 1ZC4A 2CG3A 4W7IA 1QO0D 2ZP1A 1GYRA 1OIWA 1INLA 3SAJA 5BW4A 4JD5A 5LM3A 1PG5A 4PLYA 4YGXB 1E3EA 4LXUA 4JH0A 3EOAI 4NXNB 1BEZA 7AT1A 5EIXA 1SXJB 3EVZA 4L9AA 1DCTA 5IX8A 3LDGA 4QWWA 1VLJA 3MMSA 3NX4A 1P5FA 1UMBB 1YVPA 1SVIA 4IDOA 2B98A 2Y66A 3T54A 3WQHA 3HJHA 4L5JA 1RMTA 3OQBA 3VR5D 1QYMA 1KDVA 4XZ4A 3K1TA 1KYQA 3P4UA 2FO7A 3W5BA 3QTBA 3NC0C 5AVWA 4ROTA 4HAZA 2C61A 4FDTA 3HU5A 1CUFA 5CM2Z 5IN5A 3AQ4A 3VNUA 2KB0A 5LOZA 4P3PA 3AONB 4HX2A 4X6YA 2H31A 5AJLA 4JHJA 3GZJA 5HQ3B 3AFGA 3SD7A 1OXVA 3WBFA 1RI5A 2PWYA 2VTEA 4B3RB 3TSWA 2AA3A 2GF9A 2VYVA 2AN5A 5J23A 4CEJB 1JHDA 4CM1A 2ZWAA 4G0ZA 3OMSA 1O97D 4F2GA 3AT1A 4XRGA 1K3UB 5IXYA 2O3RA 1FTWA 3MT7A 5BVHA 1IK4A 4EF6A 5BR8B 1Z5UA 5A2GA 3DB2A 3RROA 1BVUA 4XLTA 5HM6A 3BB1A 6REQA 1YRLA 1YFKA 1M2WA 1U81A 3B6ZA 1USWA 1RWVA 1LFDB 4R9VA 3PXCX 2GQ0A 1I3NA 1ODFA 3JWIA 2IS6A 3GYBA 2XIJA 1I6WA 4D74A 1DZIA 3KZNA 3AX6A 2PQMA 2WQ7A 3SR0A 2GYWA 1FMLA 3K71B 4L5BA 3PGKA 2PFGA 2FXIA 3KOUA 4YCLA 4ETIA 3WRYC 1TEHA 1FYFA 1C7QA 2BF4A 3OSZA 4EZBA 2BJWA 1R6VA 2WXPA 1WSWA 4JWKA 3INRA 1J00A 1EGHA 4TKUA 1PY1A 3RVBA 4J0QA 4XD7D 3ULKA 3PD7A 3QVMA 3HV2A 4GBMA 2HV9A 5DCWA 2ECFA 3OZVA 3KO8A 5LMNB 4OI0A 2GERA 1Y1LA 4Y1RB 1SUDA 2BTOA 2YWJA 4PYLA 2PLFA 3LPDA 4GYYA 1HL7A 4ND6A 1OVGA 1LQ2A 2HU7A 3OFNA 1YIAA 2DTDA 3EW9A 2XPZA 1NV8A 1R88A 1J5EB 3CGHA 4GTVA 3H5VA 3HCOA 3HYCA 4YAFA 5FOSA 2WMNB 3LQQA 2M6LA 1XDSA 1VCHA 4BEBA 3ZGQA 2F8SA 4CV3A 1Z12A 1TK9A 3PUKA 1RRFA 1NR5A 3FDHA 1SK9A 1X7WB 1G20B 5J2UB 2PIDA 2Q3MA 1JPVA 5EPUA 3OWHA 2G0AA 4BATA 4N9QA 1XBTA 1V5EA 4PW0A 4TQGA 2OLJA 4NCJA 1EQAA 2ZSJA 1SU8A 2HHLA 5CPFA 4ON9A 1NM5C 1XXLA 5CD1A 2E18A 2YWCA 3EF1A 3IHWA 3BL5A 4KGXA 2XUZA 1VL8A 1FDWA 4M86A 2VYFA 4M8SA 3I4CA 3B82A 3B6EA 1LLQA 4EAAA 4FW8A 4B5LA 3OX2A 2R85A 1PYGA 1ACJA 4ER3A 1S2NA 3EAGA 1DI0A 2CUZA 1EFKA 4KFCA 2WXNA 3AKEA 3MILA 3PDUA 3FLBA 3DD5A 2CVHA 1W8IA 5B3KA 5KC8A 2WBLC 1JCSA 3DMNA 4X66B 2R8ZA 2Q2QA 3OZIA 2D1TA 3FE2A 2XYQA 4AN0A 4N65A 5HA5A 5THQA 1AT1A 4F06A 4QDTA 1THTA 3OE7A 2BF0X 1W5BA 2FWNA 3L5OA 5JCOA 4I50A 1G7RA 2XB9A 4G25A 1U04A 2ZPUA 3VO2A 1GPDG 3CHQA 5BUZA 1GQFA 2C5LA 5LIRA 2NU8A 1Y9AA 4WOKA 2Z5GA 2VUHB 1HOXA 3LQYA 3MTBA 5DIFA 1QJCA 2E4XA 4YP9A 3DBRB 3IBSA 3PC8C 2ODAA 3WDKA 1SN7A 3QDNA 3LUJA 2B8WA 4AKXB 3W6UA 1X1AA 4LWPA 1YR7A 1YJBA 1FC0A 4ZDWA 4CIVA 3KZMA 2C9ZA 1II8B 2HNKA 3P1JA 2ZUFA 1FPQA 2FPMA 1N4PA 1BC5A 4AVXA 2ERXA 4UU0A 1M76A 2Y3AA 2Q0XA 1BYIA 2O8BA 2IYUA 1L7RA 1I2MA 5J59A 1CUDA 5FO0A 1FTGA 3RC3A 5A2QA 2ZI6A 5DLYA 1NVDA 4J7XA 1L5GB 1HNZB 4QBGB 3LDFA 5EMKA 2UZ1A 3BT3A 1UMKA 2J33A 4PHCA 1JSZA 4F71A 4EZJA 1E62A 3K6RA 5EE5B 3PR1A 4DWWA 4PE5B 2FWMX 2P2NA 1SXQA 3CT4A 3KJHA 5HF8A 3I0MA 3PITA 3L7IA 4JNKA 4JODA 3O9VA 3M33A 4MTCA 5EVCA 4QLOA 1ZIYA 2C9CA 1E2LA 1HBJA 2PDAA 1E8ZA 1GQRA 1VC2A 1VMIA 1NDUA 4TKUB 2OGWA 2B83A 2IOHA 1SCUA 3RYHA 3IT1A 3Q7TA 1W0KD 4HUJA 1OW3B 4HAVA 3DM5A 4KQKA 4QX6A 2ES4A 2I8AA 2JI9A 3NM5A 2TMGA 3ESRA 4B76A 3LA8A 4JYBA 4O1OA 3D6UA 1W93A 1PEKE 3ZTWA 1GUDA 3MQ2A 1EYZA 4RMIA 1NQUA 4LJ4A 1GPWB 3OU6A 3IV0A 1EWKA 1PL0A 3TB4A 4G63A 4KYUA 1T4GA 4W8GA 5KDDA 3NUZA 3GRUA 4RK5A 1GCAA 1NHGA 1DAHA 2WXQA 4UEWA 3O8LA 4Q9DA 4GPZA 1SGWA 2H9IA 3EIUA 1GAJA 2PV0A 2XR1A 5JDIA 1JEJA 2YZKA 1MJGA 3A6JA 5T8IA 4CI0B 3O4JA 3GLGB 4MJ3A 2H65A 2GN4A 2JA2A 1WM1A 2CVZA 2Q3BA 2ACEA 4O2AA 3RIBA 3KJQA 1PEDA 4G65A 3HJAA 3FVWA 2A78A 3FOCA 2QNRA 4MV4A 1MAWA 2W00A 3K53A 1JB9A 4K81B 3WY9A 1BJKA 5EHGA 1H8ED 2AUTA 3OECA 1TA9A 2FSUA 3REQA 1K8XB 4A6DA 3EASA 4DLLA 3BTSA 1T5LA 5CLHA 5KU1A 2L6JA 5D3ZA 5AOCA 4BE9A 2Z6UA 1C50A 2FCRA 4GZCA 2UDPA 3R9XA 4I50B 3TQFA 5HJ5A 3OJCA 3N8IA 4RZHA 1JIJA 1IJEA 4N3BA 4J8PA 2XKBA 1EUCB 1SRQA 3RYCA 1HDEA 5EOVA 2QTGA 4EENA 1XTVA 3Q5EA 3BRQA 2ZIXA 4Z4GA 4MVJI 1F6DA 3TG5A 3OQMA 1YI0A 2ZAMA 3F4LA 5ALIA 4CUKA 4AM9A 3R6TA 2FWBA 1PJ2A 4TRQA 2IFUA 3JVIA 4C87A 4HD8A 5FL3A 4KVZA 1N9GA 4AG6A 2C9DA 3LBFA 4EP1A 1ODJA 4JL5A 1N5LA 1ZN8A 4AMUA 3FDIA 1RYFA 4D3DA 1C4OA 4LY0A 4DE5A 2QI9C 3ZY5A 3BXZA 5IJ9A 2RGNA 1EWQA 2LIVA 1TYZA 2O8BB 1O0BA 1B6GA 3CLKA 1WSBA 3N53A 1E94E 2JRCA 1TZJA 3NTXA 2PZJA 3BSYA 1KSGA 4ZEOA 4LYAA 2NSHA 3GJ0A 2I9CA 3DE3X 2VH5R 2OCLA 1PWXA 3TCNA 1EPUA 4C0JA 5AJHA 3H5NA 4NYJQ 3F5FA 4TTVA 2GRNB 1XKXA 2NU6B 4MXDA 1I6LA 5D1HA 4TL6A 2XCLA 2G04A 4GMXA 4PG8A 1HURA 5K0NA 2I2DA 3QVKA 1SCUB 3OM8A 4W6QA 3RYHB 3RO3A 1P4JA 3KPWA 3PBKA 3MWEA 3EODA 3PJRA 1NBWB 1R8JA 3UPUA 3WLJA 2WD9A 2A35A 2HLHA 3V32A 5EMJA 1UBLS 2QAJA 2WAAA 5BUQA 1REQB 1JDZA 3FNFA 1TI7A 3UAZA 1EJBA 4TVBA 2RD2A 5FP0A 5AKHA 2VLBA 2PY6A 4B6EA 4X63A 4KQ6A 1U1EA 1Y9ZA 3E7PA 3LC1O 1Y5RA 3ND7A 2QAGA 1VYTA 3RJZA 3COPA 1HYBA 2GHRA 4DIEA 3EDCA 1ORRA 4B81A 4GYOA 3GJRA 5HZMA 1TAGA 2WWYA 4KZKA 3DLHA 4HBZA 3EGVA 5LDHA 4K9MA 4KXQA 1G8FA 1MJGM 4A0FA 4A4DA 1NC1A 2WUGA 3LPMA 1VI6A 3OPMA 2GOYA 4GR4A 1JQAA 4NEQA 4JLVA 3TRHA 1LTKA 3UWPA 2CY0A 4FGKA 1D2AA 1P81A 3T3MB 4UE2A 1G9SA 2P2DA 3JPWA 4QT0A 4ARAA 3WLPA 4NMMA 1FNCA 2VPZA 2IYSA 3BSWA 1EFHA 5DWVA 4M1YA 3H3JA 2AZDA 2ATIA 3DMPA 1SUIA 2JC3A 4IHKA 2CNOA 3QWBA 4Q18A 3JYSA 5C1PA 4PR3A 4O2AB 2R7AA 2NV2B 4Y9RA 2WLTA 2NO1A 5J2TA 2P9GA 5DO9A 5FTNA 3X43A 3IUQA 2OG1A 1U8CB 2CXPA 4OA5A 1L5OA 2RJOA 5J47A 3C3PA 3L84A 1OYVA 3L6BA 2X7HA 3UAOA 4YVOA 4K2AA 3UMVA 1P4HA 3DR3A 4FM9A 4GL2A 2FPXA 3CH6A 2H00A 1W75A 3EMKA 2C2WA 2CNBA 5ARBA 5KOJA 1Z06A 3BUAA 4HWPA 2XQKA 2K87A 3N0VA 3KELA 2I9KA 2GD2A 4LZZA 2EW8A 2EW2A 2ZIXB 3CVUA 1JN0A 3I1IA 2A1TS 4ND1A 3DBHA 3ZDAA 1E4EB 3ASNE 2C3PA 2E4YA 3ZE1B 3WGUA 4J6EA 1EWYA 4EJFA 4FILA 3V3KA 1A9OA 2D3TA 1NN0A 3GT3A 1XZKA 1N9GB 1NF9A 4C1NA 2PPLA 1IZ0A 5A3RA 4YI3A 4UATA 3NP9A 4ILEA 1C7ZA 1HT0A 1RWNA 2W6NA 3I1JA 4R8VA 1D1SA 3PSHA 3KK0A 2GRJA 4EZKA 5BORA 1G3QA 3AERB 3HXOA 2D59A 1RIFA 1P6XA 5BSHA 1OX4A 3WJ1A 1XRRA 2ASVA 4D9MA 1PT9A 4GLLA 5DFAA 3T5VA 3EVEA 2XXJA 4A6EA 3LKZA 3G1TA 3KXPA 1QG0A 3FFTA 2GMWA 1MB4A 1T2DA 1XPOA 4KLCA 2JLSA 3IRUA 3DTTA 3NHBA 1C3JA 4EFMA 1R0XA 3CF4A 2QZ9A 3S2IA 1N0IA 5ENNA 1B0UA 2CZQA 3LCUA 3PE6A 4PPNA 3Q1LA 4ER0A 5JRZA 1XJWA 1NBIA 3D6FA 3TWXA 2OB1A 1XTZA 4EI8A 5KVSA 4CG0A 2X6HA 3SVLA 1GZHB 3RTDA 1H2VC 4DQVA 3AB8A 2FFQA 4TUYA 3DEJA 2C5SA 4KTTE 3MWEB 2OOSA 1R12A 3P2JA 3TLYA 4EFDA 1GRRA 4LYHA 4E5MA 1SY7A 1I7SB 3PQ3A 1Y6GA 4KEAA 4WZBA 4A8JA 2LW7A 1NVGA 3QBTA 2GXAA 2V0PA 4GFDA 4UTXA 3GPCA 3K8ZA 2HD4A 2JCYA 2QAGB 2XS8A 1Y9EA 1VJ1A 3DO5A 4Z49A 1UFKA 2H57A 1YNOA 1QZ2A 1GNTA 1TMKA 4LEIA 3SSMA 2OHXA 3LZ6A 5TQJA 1RWPA 4DQKA 4FQ5A 1H6PA 4TTTS 3ZVLA 1RZ4A 2VNAA 4XEUA 4EZLA 5A23A 2QYOA 1PFUA 4W1PA 1UKBA 1EXNA 1Z29A 3G88A 3W5AA 1GPNA 2F1IA 3KKQA 5M5BA 2D2XA 3EEIA 3ZEIA 2OCDA 3DMYA 2FSVC 2Q4TA 4M1TA 2QMYA 1ZMTA 1EA5A 4C04A 2E3JA 3AUYA 2O3JA 1HX8A 4X41A 1BMTA 5J2TB 3UHPA 3ZIAA 4MV8A 2QENA 2DTXA 3DAPA 2N1MA 4DX7D 1GRQA 3UWMA 4FFPA 5CERB 3W3ZB 4IIUA 1NT2A 3CK8A 4OI1A 4OSPA 4TTIA 1N3BA 3D1VA 4CMIA 4OX9Y 4MI9A 2YW2A 5AKEA 4D2IA 4ZZ0A 1K0UA 3DTYA 1BW9A 4UNNA 4CM5A 4BN5A 5JJKA 2H2FA 1WB6A 4OGLA 5JASA 2GWHA 4HY3A 4E13A 3F3YA 1YFLA 4YJFA 1I7LA 3LHDA 2BTDA 2ADOA 5HRYA 4WCFB 1YL6A 2B78A 4Q3EA 3MERA 3MTAA 1PFKA 5F5NA 3RF6A 3FHJA 1JPUA 1K7SN 5KOHA 2G63A 5ES4B 2JEOA 1JILA 3HZRA 2J3DA 3SYRA 1MW9X 2V0NA 3MTIA 5CDYA 4D25A 1T2UA 1ZVQA 5BSKA 2VATA 1H6DA 4WSOA 3HXKA 4LJSA 5BN4A 1RAIA 4HQLA 1FQOA 4F60A 3LKBA 1X2EA 2CMFA 2VS1A 1Q1QA 4MYRA 2OK7A 3P9QA 5CVDA 4AC9A 3CUKA 4MWCA 2VDNB 3DVLA 1N2OA 3GEEA 1P62B 3ERCA 2DRIA 1TK3A 3NBXX 1JG1A 4R1SA 2LDBA 4UTOA 1MUUA 1Y80A 1U8TA 3CR3A 4KTVE 4C0EA 3A9SA 4P08A 4KWEA 3T4UA 1I14A 5CDFE 1EFUA 3CZCA 5K01A 4LGMA 4HGOA 1T0BA 1XZ8A 1PNQA 4BLOA 2G9QA 3EZ6A 3T1HB 2G9NA 1O4WA 1NXXA 1RYNA 1G21B 1NURA 4PAGA 4WZBB 4AJ4A 1NOIA 4N8EA 2QQ0A 4XWWA 4L2LA 4QUIA 1RYYA 4MJXA 4LKRA 4KR9A 2AE2A 1EJ6A 4W5TA 3M4YA 3G2OA 2PFKA 3L1VA 2Y1GA 1DOZA 3A2KA 2H18A 5HWSA 3E82A 1FVXA 4HNSA 5LZ7A 2ZK7A 4KIJA 1BN7A 5FPPA 4Z4CA 5FQ4A 4NZ9A 2DWUA 5CEJA 1KPSB 1O95C 3R9AB 1W5TA 4YRLA 5A4JA 3LQ2A 3I6BA 1F1JA 3VR2D 3K09A 3P26A 4FWBA 2P9QA 1JHAA 3E2PA 5F7JA 1LBSA 1LEHA 4RK0A 5CFNA 4FSDA 3MJWA 3QJZA 4PZ9A 4U0KA 3LZDA 1HA3A 1M1NA 3U9WA 1QMOE 2FW6A 1H2TC 4JT9A 4IIGA 1NRIA 3WXBA 4M8NE 4ZRMA 1B76A 3RS8A 5TQ2B 3PH0C 1QH9A 4YRZA 2X14A 3VR6A 5AQBA 1YH3A 3FMIA 2X8JA 2WM2A 4EO9A 4UOEA 1UKVY 4XR9A 4O1MA 4XOIA 1P77A 2GJKA 4Z2YA 4UUQA 3SM3A 4CMIB 4NENA 3PQ2A 3SN6A 4MEAA 4H59A 2QYHA 2J9GA 4RIEA 2VJPA 4NH4A 1JDVA 3LH5A 3SS8A 3QSYA 2JEYA 4HUTA 4QKQA 1XJ0A 4OFXA 4AROA 2FZCA 3R0VA 1VDMA 3RC1A 1TQ6A 2NT3A 3JD3A 4P34A 4LFBB 3C8MA 2UVPA 3TQRA 4YJFB 1CRWG 2BONA 2FEWB 1ZHFA 2FRXA 4UYJA 2N9UA 3L54A 3KUDA 4DUGD 1G6HA 4RD1A 1QTNA 1DJQA 3APFA 3K8OE 1TD1A 2I6GA 5FTPA 4EMUA 2AC4A 3DSXA 4FFWA 3P0JA 5CGZA 2JAPA 3T5MA 3OO1A 2RJ3A 5CLIA 1RS0A 3NAWA 4M36A 4KQ9A 4DIDA 4EHBA 3VBEA 3BJIC 2QRKA 3U3RA 2C4UA 1OASA 4R2LA 1DRUA 5TGDA 3WA7A 3OX1A 3K5IA 4QA9A 2ZI5A 4ZQFA 3W4KA 1EZZA 5CM9C 4G1MB 4IEEA 4F5ZA 1DT3A 1XL1A 4FB5A 3NCTA 1M7GA 4ZVVA 4TQ9A 1JVNA 5JSUA 1WQ3A 1I2AA 5CBKA 2MIIA 3EY9A 3ABKE 3VZQA 3QE2A 1K3ZD 1M10A 4FCCA 1Q83A 2PVCA 1ZGBA 1UH5A 1K7CA 2R7KA 4R8RA 1NMYA 5C4MA 2PWZA 5DI9A 3AHEA 2HE0A 1AK2A 4GOOD 3I52A 1OCOE 3GLHA 1T15A 3GRVA 2DULA 4D10C 1KEWA 1GSIA 3JD0A 1P3Y1 2J49A 1JR3D 2OBXA 5A4IS 4KKXB 4PS8A 1E69A 3F67A 1A9XB 1XAGA 4DCOA 1B6TA 5F3DA 4LJLA 4YAIA 1OXBB 2G72A 1UFQA 4Y2XA 1IPFA 2CV0A 1GKYA 1FCJA 5B1BE 1BHQ1 3GJXC 1COWD 1RYDA 1U9ZA 2BY4A 1N33B 1U2SA 3MELA 4DLAA 4LCTA 2VNIA 1O6FA 2ZTVA 4D42A 1W76A 2Z1NA 1V9SA 3PWKA 2F8MA 2W6ZA 3JAKA 3DBLA 4HH0A 3G1WA 2OCKA 1U8UA 3P9RA 1ODIA 2BDUA 3D59A 2VK4A 4ZVOA 3UB4A 4TVSA 1UANA 2P9SG 4C89A 3TLKA 1IM2A 3WNDA 3VI4B 2UXBB 3JWEA 1US8A 4AJ2A 2XMQA 1W0JD 4HWSA 3P4YA 3VZSA 1UDBA 5CPBA 4JUFA 1M1NB 4BFRA 1ZD5A 2LPMA 4DADA 1OUVA 1H0SA 4MVJH 2YN2A 1UBNA 2WKWA 3P2YA 3V4ZA 3LW8A 1QPZA 2X8JB 1PV4A 4ES6A 1MB3A 4AZ3B 4F3RA 2X5XA 1Z82A 1OAOC 5DBKA 3G8YA 1M0SA 2HBYA 2AKAB 2R6JA 3AG5A 1U2VG 3ADKA 4X20A 4C0SA 3CPHA 3GAMA 2XCSB 1ZVKA 3RS4A 5DRYA 3O84A 4G4GA 5BV7A 2B1IA 4IVQA 3IP6A 3WIBA 2J08A 1U1FA 4LHYA 1U4OA 5AHRA 4XYBA 3WSWA 3JZFA 3QGMA 1KOLA 5B4UA 1E2PA 2C2BA 4IICA 4UUAA 1BDBA 2X6JA 4WWNA 3QEMB 2W2KA 4O4HF 2UVPB 4JJGA 1P2TA 3TJMA 1UJKA 4PGMA 4O08A 3LFHA 4YUZA 3KKOA 4BNWA 3DOOA 2OYCA 2ZRAA 3OKFA 3IT3A 3OMXA 3OTGA 1XTIA 4F45A 2NXPA 1ECJA 3KEOA 3RUFA 2AJDA 3ELUA 2RH4A 2P3LA 1EUDB 1JXQA 2IDKA 1BN6A 2HL6A 3OZEA 1CUYA 1OCEA 2E48A 2AN1A 2IOFK 3TIIA 4DPLA 5IAGA 1HS6A 4F3VA 5AKKA 4F7WA 1YZVA 2VUUA 2ZWPA 3RWBA 1JH8A 4ZU6X 2CBGA 1H23A 3H11A 3RKSA 2WKQA 2ZAOA 1JR2A 3CE9A 3W5VA 2RGYA 2HGZA 1KLXA 1DJLA 1I3KA 4QEKA 3VU9A 3D8NA 4P3YA 3FFWA 5FWXA 4QEDA 4DCMA 1N5JA 3CUSA 3DLAA 4EPZA 4TKZA 2XADA 1DAPA 1USKA 2B36A 4OHWA 2QZ4A 4P5EA 1J0BA 2W6CX 3H9BA 4I2NA 4C6SA 3HXFA 3INYA 4F0JA 5HUHA 4MRSA 2R48A 4LV5B 5KHOC 4AKTA 4UCWA 1N9ZA 4JVOA 4OAUC 1M6HA 1E6CA 2V65A 3E9NA 1RNLA 1CERA 2FEXA 2I67A 4KXKB 4Q4CA 4RZXA 4ZKDA 4LF7B 2R5FA 1D6MA 1QQEA 1RKVA 5KAMA 3SNHA 3SFTA 2JCVA 3DZDA 3G5LA 2YV4A 1DPGA 3X2FA 3OZTA 1B8NA 5GV7A 1YIDA 4BKUA 5K3SA 1L5YA 4G8CA 2OOKA 3MLBA 1XD2B 2BL4A 4EJ6A 2OGTA 5E0KB 1ISMA 3CMCO 2XNDA 2P9NG 4U5XA 5DTIA 3LQRA 2WWVD 1WPRA 4X94A 4MP6A 2YC2C 3NDIA 3DC7A 3DBLB 3VVMA 4W82A 4HRYA 4GOMD 1PFQA 5HXAA 5K3CA 3K9FC 5ICFA 3BWBA 3L7LA 3UB2A 4KB5A 2OXCA 1VE6A 1RHRA 3NHUA 5T8KC 2FE4A 4UDNA 4QPNA 4AAYA 5AH0A 3BM5A 4O6VA 2W8BA 1FLAA 5FUXA 2GM3A 2JIBA 3AJ8A 5AESA 1X7ZB 3FCUB 1D7OA 1KRHA 2ZTMA 3E37A 4I9CA 1ISGA 4GPKA 5KJLA 4X91A 2QL5A 1EK1A 1X81A 3W8EA 2HRZA 3GFVA 1ZS9A 1XMQB 1KMIY 3FR8A 2WTXA 2VEOA 3GROA 5JQWA 1N95A 3AY0A 1BEEA 4H1TA 2YFYA 1RQPA 4HQFA 4GPD1 2JI4A 4Y0NA 3L06A 3RSSA 2WWFA 1C9KA 1RJ9A 1AS3A 2R7NA 5D7BA 3OZBA 5KX5B 2PS3A 3R9IA 1KHTA 5LL6P 3MD9A 3UG6A 2ONJA 3LUDA 2J9QA 2YWBA 1RKUA 3QOWA 2QD3A 4I1VA 3F1LA 3AY3A 2CL5A 3L0ZA 1DIHA 3STYA 4Q6WA 5JZSA 2ZBEA 2JFVA 5JAMA 1LDMA 2QX9A 3EGEA 2W2KB 3FVTA 3SC3A 3UT4A 1TQ4A 2ODPA 1RYEA 4IBOA 4JROA 1P1IA 3SJUA 1OWLA 2R6GA 3ORYA 2CXOA 3V7NA 3IAS6 4N54A 2Q7DA 3ANTA 4ABYA 4XLLA 3G0DA 2EP5A 4B8ZA 5B37A 5B1YA 3I2FA 5FOQA 2AG1A 2HCRA 1PL8A 2QNBA 4YMVA 1M67A 4XYGA 3UKRG 1RHUA 3QF7A 4CR7A 1M54A 4W9MC 3R20A 3X1KA 4GZMA 4JP5A 1H05A 4IGEA 3QVLA 2X9VA 4HPXB 5G53C 3NIWA 1SEPA 4DA9A 1Z17A 4R1TA 3LFTA 4GMLA 2JNWA 3H11B 1SG6A 2IX3A 3ITDA 1Z45A 2QSUA 3CHMA 2VHZA 4UREA 2M6RA 4UHBA 5DHRA 4Y98A 2AN9A 5ALRA 2IUTA 4JKIA 1EUQA 3C6QA 4D02A 1JFTA 5JBQA 4UHCA 3R7BA 2G7MC 4FNOA 2V7BA 4DF3A 3AI1A 3R5TA 3A2MA 3PXEA 3ME5A 2V4UA 3WGMA 1MJ5A 4X8OA 4JC8A 2RGDA 5I7FA 4MV9A 3O1IC 1VPTA 1JSRA 4V1CI 1P7WA 1M2HA 3JWGA 1G8HA 3QEOA 3OO0A 4B3GA 3V42A 2X2EA 2G5CA 5IYZA 1I1HA 4WASA 3F71A 2ZSEA 1Z5WA 4DLVA 4TWBA 4FEEA 2GILA 2QJWA 4MRNA 1GQ2A 3PQ7A 2RGAA 2ZUUA 3HMKA 3K0FB 2ZSUA 3H2HA 5LOVB 4FU0A 1CHDA 4Z8YA 1B23P 5I7RA 2K7ZA 1T8YA 2WFAA 3NB2A 3VLFA 4RJKA 2FWAA 1T4MA 3V4PB 5DH9A 4UHDA 3SX2A 3HVRA 4PSCA 3QX8A 2PWAA 5EJGA 3FLEA 4LXXA 4PSDA 3HCRA 1NYLA 2O6LA 2RG7A 5L4NA 4QM7A 2G1AA 3UQYS 3PFNA 1NJ1A 4XUDA 3LJNA 2O0LA 4JJ8A 1YJ5A 3I32A 4I81A 4H7EA 3NEYA 4LSGA 2B20A 3KPUA 2W8BB 2FQXA 5F12A 5AI9A 1XZQA 4TGLA 3L0BA 3K70C 4FHFA 5AUOB 1BLXB 3H2GA 3QBDA 1M7BA 2OCCE 5IXSA 5FYQA 5KJ1A 1NI5A 1Z3CA 1BKYA 1KYTA 2V6IA 1WCYA 2YFQA 4D8XA 2VHQA 3NBUA 4KAJA 3O2NA 4BC1A 4C06A 4RD3A 3BB3A 3CVJA 1ILWA 2P2SA 1CHNA 4E6EA 2ZJOA 3QPDA 3RS2A 2G8LA 2OEPA 1EU1A 3BFXA 4MDHA 1QBQA 4Z99A 4UI9J 3SFVA 2PKQP 3DDNA 1RJ9B 2OECA 1RBMA 1QG2A 1GDTA 1L7PA 3WRVA 3AJEA 1B00A 3U7HB 3ILSA 1WKCA 3SK1A 2PT9A 3FWYA 2GSDA 2EQAA 5EUQB 3UXGA 1MX2A 2H52A 3RG8A 3L8CA 3HCDA 1HNNA 3O0TA 4MGYR 2OYSA 1H2EA 3GF4A 4NY1A 2ETCA 4DV1B 1G6Q1 3AS4A 3FNEA 2NSZA 1LTHR 1C3LA 3JQ9A 3MUFA 1KI2A 3HQ4O 4NRHB 4S1VA 4RQTA 1OFUA 2WMNA 2EP8A 1R1DA 3RHTA 4ZVTA 1K0FA 4HB4A 1L7EA 1EFRA 5A9SA 1M2EA 5INTA 2XW6A 1T29A 3WK9A 3IC5A 3HL0A 4BL5A 1NW6A 1KYIA 1IVYA 2J4BA 4Z0TA 3UJ9A 5J2UA 2IEDA 2C2OA 1U0BB 1QB8A 3NF1A 4HI9A 1UK9A 5EPOA 4G5HA 4PS1A 3RVDA 2CF5A 4HQDA 1Z25A 2RHOA 3NV7A 3I6IA 1EM6A 2H48A 3L6OO 4W5RA 5FOWA 2GTIA 4R2XA 3LOQA 1ZBDA 3STVA 4ALKA 3GEBA 1YDEA 5LSAA 4IIBA 4Z4FA 5KWVA 1V7QA 3GQBB 3CPSA 2F55A 1GY8A 5KKNB 3RIHA 3TF5A 4PWZA 2GYYA 4KXWA 2RK3A 1N4QA 3D3MA 2Y0PA 4HFNA 4GP6A 2WXLA 4OD0A 3K2BA 5FJYA 2DWOA 2PG3A 3PC7A 5AM4A 1LBHA 3JWHA 4E14A 2WD7B 5IYZB 2DKOA 1CQWA 4QYMA 2JLYA 2UYHA 3T5DA 5ALSA 2AXNA 3IEIA 3UT6A 3W2HA 2V5FA 4YRPA 4Q15A 2UYOA 3SQLA 3U1BA 5HE8A 1KDRA 4WV3A 4E15A 1XTUA 4R1MA 4DRZA 2V7VA 5IVHA 2Q27A 4OMDA 4M9ZA 1QS0A 4DCGA 5EWJB 4L9RA 3AUAA 4ZV9A 3DBRA 1T9AA 4E46A 3DEYX 5KJNA 4NYIQ 3I9V6 4J7CA 3HXTA 1II8A 4U2KA 3B3QA 4MIOA 1ZI6A 3TECE 4E31A 2XGJA 3H99A 2CUKA 4YPVA 1RLMA 3QU4A 3FP3A 4ZQIA 3TQOA 1PGOA 1NW3A 4GYKA 2XCOA 3KAQA 3NBKA 1HWYA 1K6MA 1YJXA 4FHZA 2G88A 1Q17A 3NASA 2VP9A 4KVAA 1P7ZA 3U4TA 3BVPA 1XUOA 3T5XA 4ZT7A 4MI1A 3IQEA 2OAP1 4C2TA 4RL4A 5FQ6A 2YMPA 2AFHB 4PRKA 3A1FA 3ZHCA 1VJGA 4YIKA 5J08A 4MAFA 2HRQA 1AXGA 1UK8A 3CFYA 3L13A 1CS4C 4DB2A 2E4UA 1WB5A 1CK4A 4FOOA 3R3HA 2XEHA 3AS5A 3D9NA 2ZFUA 5DRTA 1NG9A 4V39A 3NGLA 1VSVA 1K7XB 4FDUA 3I58A 3PWZA 5DEIA 2KZTB 2V97A 2YHEA 5TF0A 3VOTA 4LA4A 4ZO7A 1TJNA 2W2QA 1TMOA 1SJ9A 1H6CA 1K6IA 2WMDA 1OAKA 1M8JA 4JLWA 1A77A 3DW3X 4RTJA 3LIPA 2FPOA 3ESAA 1MJFA 1XQ1A 2J31A 3KTDA 5LZ9A 4E5KA 1YI8A 2DEUA 2CDAA 4G0XA 1Z7WA 3BIWA 2BBOA 1KJ9A 1NMEA 2LV8A 5CIQA 5A9SB 3NM4A 2PYZA 2WLSA 3VKUA 3OAAD 3D2CA 3RNOA 3F2VA 4WINA 1PN3A 5J4LA 4BVAA 3RVNA 4LX8A 4J6IA 4L72A 3VNRA 3HXDA 3PLAE 3BA6A 1YC5A 4BE4A 2CHWA 4NBSA 1CUCA 3EF3A 1O6CA 4U7HA 4UQXA 1P5RA 4LDJA 2ZSBA 3DTNA 3F6CA 4YAUA 4Q0MA 1GAQA 2RGEA 3KSQA 4MUNA 2P2CP 3CSSA 1LD3A 3FOWA 1UJ5A 4UQLA 1EZ1A 3PLNA 2ZJ3A 3SMVA 4NBTA 1OBFO 2PKWA 3GLGA 1XMVA 1KK3A 2JLCA 2VYCA 4MAMA 2FZ5A 2NVBA 1F6BA 5EUMA 3S7FA 3CGWA 1R8YA 3AFOA 3OJWA 1XVUA 4NK4A 5HQJA 2L0XA 2Y67A 1U8AA 5MN4A 4JSYA 2PUTA 2C5BA 1SD1A 1XN1A 4GWLA 2A4MA 1GARA 1H3FA 5B57C 4N18A 1WU8A 3HVEA 4MWTA 1FFCA 2NSJA 1QQ7A 2EHDA 3IAEA 2EG9A 2F1RA 2Q45A 3X1XA 3QY0A 3VU8A 2D06A 4Y0VA 3UYLA 2WWXA 3IESA 1XTSA 3UYKA 1I9CA 3FU5A 1NVMB 3PP8A 4OH1A 1EUCA 4AT1A 1UK6A 5B3JC 2FUG1 3QQPA 4QOGA 2QX6A 1TQ2A 3TB6A 1P1CA 1QS0B 4DX6D 4YMTA 1IN6A 4P6VF 1OCRE 3FEXA 1GU1A 1E9EA 5H7XA 5MGBA 5GVRA 3CXRA 1IZZA 5AVSA 4CXMA 2HBZA 5AI5A 4N0EA 1LNQA 3ZCXA 1RCFA 4Y6SA 2OM6A 1YASA 2AMVA 4W7SA 2I2CA 3DOHA 3A58B 3OEWA 1JW9B 3C8HA 2A5GA 4LDNA 4S1NA 3UK6A 3KJGA 4QXOA 5JHAA 4X6XA 1CX9B 1WBDA 5TEWA 1RC1A 5MHTA 3JUIA 3EXHC 4IFBA 2OQ2A 3GUYA 3GCWA 4KYIB 1D5CA 1NY6A 5FWQA 3EZ7A 2GA9A 1UBMS 5DYWA 3OCZA 3Q10A 3LX4A 5HF5A 1ZEJA 4WOJA 3GY0A 1GPH1 1TD9A 3DDOA 4FE7A 4ENPA 3BB4A 3BIJA 2AHOA 1BCRB 1YDFA 4LJ7A 2NU6A 1SBCA 3WYEA 1JKJA 2I4LA 5B1IA 4RORA 3ANLA 3TFQA 2XZOA 3PNPA 4RXTA 3KNZA 2FQQA 3WLRA 1SD5A 3U80A 3PNYA 5HIMA 3IE1A 2F4VB 2OXFA 3CHOA 2FFAA 4JI3B 3PVLA 3W8DA 2IGTA 2GNOA 4NV3A 2PIAA 1GFWA 2HWWA 1NDQA 1KO5A 1QHEA 5AK6A 3A2NA 5ALOA 5EMHA 2RBKA 2UU9B 1HFKA 3QA3E 1ZL2A 1PSZA 1REQA 1SBIA 3FJOA 4LRTB 1QYCA 1YQQA 3QU5A 2R1UA 4ZAZA 3VPXA 5C8DA 2R8EA 3PS9A 3DFMA 2XUQA 3IPRA 5KJ6A 4YDRA 1GYQA 2D6FA 4PVCA 4ZZ2A 4ZJPA 5KSOA 4DCJA 2GAFA 2ZIUB 3FU0A 2V3WA 2G1PA 4TMWA 1JF8A 1EDBA 5JNSA 2JD2A 5F5XA 4IDBA 4DS3A 2JIZD 3KQSA 4GC9A 4L07A 3U7RA 1WQ1R 1NW9B 3VC7A 1GADO 3O1LA 3HACA 2FPPB 1IPEA 3HB5X 1TZBA 4TTSA 1C30A 4U5QA 1TCAA 5KYYB 1UAAA 2ZYGA 1W52X 4HJRA 1OE0A 3M3HA 1ZW1A 4IR7A 3O48A 4OGGA 3C97A 4ZHSA 3H0KA 3CKCA 4BV2A 3GGJA 2I2AA 3QI2A 2ZRKA 3ZU6A 4WCVA 4ANFA 4Z3OA 4KR3A 1JWFA 3MG9A 3RSOA 3D6AA 5LP1A 4RHTA 4FYVA 1QK3A 1VBFA 2QJOA 3TD6A 3HVEB 2W70A 3T99A 4A0QA 3BIXA 4I7EA 3Q2OA 3O93A 5I3CA 1JTVA 2IEZA 3CM0A 2P69A 4QXQA 1MOQA 2X6QA 3M7IA 1SG9A 4OQEA 2A0FA 3HU1A 421PA 4DM7A 1E4EA 1WQ4A 3DWLG 4PRZA 3UAYA 3IUNA 4MLDA 3BYZA 2G67A 1BE0A 3EGXB 3NEAA 4DMHA 4DMRA 3GDOA 3D0KA 1W4AA 1JE0A 3DVAB 2UXCB 1XEWY 3EHNA 2BLNA 2HUNA 2P4EA 1NOJA 1G38A 2R87A 1QLWA 3FNIA 4L1KA 2F1KA 3NUQA 4CLOA 3H8JA 2A8YA 4AM8A 2XTAA 3AERA 1UWLA 3HSSA 3ONNA 2KC7A 3ZYZA 2XMZA 3OBIA 2SICE 1ELRA 1HE2A 3RHFA 2RHMA 1I4DD 3C6XA 3N2IA 1R4NB 3EXIA 1ODLA 3L17A 3KFLA 3ZI7A 1W5AA 3TL6A 3EMDA 1O8BA 4EX7A 3V3LA 4NE7A 1PYDA 1MYOA 2FP4A 2MSLA 1D8TA 4FJZA 4EUFA 2NXNA 3O75A 3FTFA 2R2LA 1D2EA 3C87A 3WWYA 1L5VA 3PE3A 2XCUA 1W9HA 1JKJB 2ORWA 2R25B 1SC6A 5KNDH 3GLIE 3F3SA 3Q79A 2VWHA 4Q39A 1SWWA 4IJVA 5D1NA 1EAMA 2WW8A 4IXWA 2AVNA 3V33A 4EMBA 1VPEA 1ZH6A 4J16C 1WD7A 4HR7A 4GMRA 1U0RA 3VKWA 4PZDA 5CM8B 4NHEA 2Y77A 5TRTA 4GE0A 1UODA 3A1WA 1UKCA 4BJ6A 4GMHA 3C3YA 3UA4A 1R6XA 4MGZR 1U28A 1JG7A 3CLHA 3TSCA 4EA7A 3UIEA 1N5OX 4UNSA 3TTXA 2SHKA 4B3DA 1L7OA 2HJ9A 2OV8A 4DRXB 2G08A 4MGHA 1WOYA 1MG5A 3CKBA 5KBYA 2ZIGA 3JRXA 4R2IA 5FPSA 5CRVA 4PSUA 2G7ZA 4MUEA 2PJRA 4J1SA 4QXPA 1DTSA 5DTQA 3T38A 5E9JA 1FRFS 5SZIA 1P75A 1EWTA 2ISSD 3BXXA 2FG7C 2VP5A 3KU1A 2P2LA 4QLAA 1NP7A 3E8SA 3OF3A 5ILQA 2BW0A 2Q29A 1C30B 4U2FA 4AP2A 4QDZA 2GPNA 2O2YA 4N5QA 3M9WA 5A6CA 3FTCA 1G42A 1SZJG 2BFOA 3CKYA 2NXCA 4RQIA 1YR6A 4JLKA 3L77A 4OLHA 2NTJA 2VSXA 3OTIA 2O2EA 1B14A 1B42A 4AKIA 4FLEA 4MKTA 3J80A 3U7QA 4L5AA 4PO1A 3VHRA 3TDNA 4AVYA 4HAWA 1QDUA 2RAFA 1R6AA 1S4MA 5JBNA 5KSZA 3GG2A 3JQBC 3AEQA 4NVRA 3HBJA 4GZLA 5CFLA 3O31A 2GRMA 3Q0TA 2HPHA 3PV0A 3A3KA 1HC7A 3BFVA 5D5PA 4DJFC 4X60A 2OXTA 3IIJA 3OPVA 4UNRA 1QWOA 1T34A 1G41A 1CYDA 4TXJA 2DPGA 2C9OA 5TPWA 3UCFA 4PNEA 3KYBA 4BZWA 5IVDA 5TMDA 1FXWA 3DJFA 4EB6B 3HEAA 1IXZA 4FYKA 3ZK9A 3OJXA 4GRAA 4WCFA 4ID9A 4RSGA 4GOJA 1XYVA 3OQIB 2OQVA 2XF8A 2AR7A 2X9NA 4GHWA 2W6OA 1PS8A 1N6NA 3P0EA 4CLOB 5I3ZA 1L4NA 4L3OA 3L16A 4XPZA 2RC6A 1HTBA 4TQAA 1HMYA 5A06A 1AJEA 1RMQA 5BQ5A 3C14C 3FTEA 5EP3A 4I08A 3EXIB 5KYTA 2RARA 1DDOA 4K9PA 2VWQA 3H2JA 1TJPB 3W8FA 1X2BA 2FP4B 3B48A 5EPEA 3ZUVB 1N3IA 3MKRA 1WP9A 3ZHUA 4DANA 3MBKA 3ORSA 4ND7A 1QIKA 4FKZA 5A5VA 1VIYA 3Q3VA 4XOUA 5GJBA 2G77B 3E5NA 4RPLA 1EFLA 2IDJA 3W3AA 4LRYA 1JDNA 5CW1A 1VKJA 1C9JA 2AW3A 1PR9A 1AUQA 1RM4A 2JLAA 3LYAA 4FDLA 5A62A 3G7UA 2YQZA 1S3IA 3L0PA 4QOHA 1UJBA 1ETHA 1YA6A 1G21A 2RGWA 5DM1A 3O2QB 3JSXA 1LSOA 5L4SA 3ONFA 4Q7KA 5EJEA 4OLBA 3TBHA 1Y5IA 4KPUB 3DE0X 4IUDS 3MUOA 1GZDA 4U7PB 2F8TA 3EIFA 4YUAA 4ZCSA 4P38A 1UZMA 4HAIA 1M34E 2ZI3A 4M0UA 3M5WA 3QU7A 3V00A 2C42A 3UFBA 3FMGA 5E3IA 4LHEA 3DYBA 4UCFA 3RCBA 4KPEC 2F4NA 2UZAA 3UQZA 4CIYA 1IY2A 2FUKA 3H86A 4B6SA 1MAUA 4QICA 1OXUA 4KIFA 4C05A 4DKXA 1KEZA 2ACWA 1JEEA 1LNSA 2ZRHA 3AFHA 4LJ9A 1U9YA 1XDGA 3PZ4A 1WUHS 3KSZO 2IA5A 1FMFA 4QXMA 4QFBA 3H1EA 1Z9BA 3AVVA 2JK1A 4JKYA 4KGDA 4KJZA 1LX6A 5TQ2A 3IVMA 4J0CA 2JGNA 4ENTA 2ZSAA 3ZGLA 4BO8A 3TVYA 1AN9A 4X6UA 4LFAB 5AI6A 3VCXA 2IELA 5F1YA 3D9LA 4D97A 1VP9A 3U7QB 2HW8A 1Q1GA 2V7UA 4BLTA 1NUQA 3D8BA 4XUGB 3GA0A 5FR2A 3ZDDA 8ATCA 3LQKA 3MT8A 4YXWD 3AEQB 3AHCA 1UIMA 4MMZB 3F6SA 4EY7A 3KLPX 4D1YA 1YNSA 3DCIA 3CJTA 2GPAA 3KB6A 1N9AA 2Y8EA 4R2KA 4OYSA 4ND5A 1RW2A 4RK6A 5IM4F 1HH4A 3R3SA 4L9WA 1OI3A 5TPWB 1GA4A 1I4LD 3NS7A 2WXHA 3KSDO 1BU8A 1YOBA 1SUWA 2PXHA 3GX1A 2W4MA 3V6LA 1XCPA 4AMZA 4QYIA 3DAHA 1IQUA 1GTSA 5FX2A 4N0MA 3LFUA 1JS1X 4JB3A 1ZIPA 5AK5A 1JQLB 1CP3A 2V6MA 4KGZA 1ZH8A 4HAYA 3X2SA 3RSZA 1KGDA 3OQOA 3V79K 4TSRA 3HCCA 5EFZA 1UJRA 4L7TA 1Z47A 4RJ2A 1Q7GA 3OP1A 2F64A 5E95A 4ER7A 4MQ5A 1F3LA 1LV8A 2GCIA 1JKXA 1SCIA 3CKKA 4OP1A 4D81A 3T5TA 1OFVA 3AI3A 2FPUA 1FFBA 4GM4A 3PD0A 2Y9PB 3IAM6 2ZJ6A 2XYPA 1HRKA 1XA0A 5JJCA 1PNVA 1Z5OA 3DDSA 2H5IA 2ZWOA 3JD1A 4MARA 1ND6A 1ZJWA 2DPXA 3DT6A 3DXYA 4DTCA 3K2QA 2GJAA 4NOLA 3WL8A 3TLCA 3A0UA 3DSRA 3TI9A 4BUZA 1NP6A 4EKGA 4E5UA 1E77A 1POWA 2H1WA 4YAWA 2PN1A 1BS1A 2JLRA 4KSYA 1AXRA 2I2XB 2VTDA 1KI6A 3JAMA 1QX4A 3VKFA 1DPFA 3U48A 1GKKA 5B3AA 5CLQA 4BO7A 1IVSA 1H2YA 5DM2A 2VT2A 4Y18A 3HKBA 1YL5A 1A9XA 3D3WB 2DBVO 4CEIB 1ZQ9A 1F3OA 4U6NA 4DNFA 3QPWA 1B0ZA 2H2HA 4QOIA 1U3VA 3GOHA 5JOQA 3LLUA 3QPAA 4XIYA 2VQ2A 4I55F 3PL1A 4IP0A 3FGNA 2ONZA 5AVTA 3MOGA 2GM5A 3M1IA 3ACDA 1JG3A 4IWXA 1KPGA 3PF9A 3GT0A 1QGED 1JQ5A 4BQNA 3M6AA 2BD0A 3QE3A 3KETA 3UKDA 3WLFA 5CTAA 2Y1KA 2Z6QA 4GLFA 3EGCA 1RAGA 3GC6A 3GJ8A 1EDZA 5T5QA 3THOA 4LRWA 1DHTA 4RVDA 1VHWA 4Q3LA 3VJMA 3KFXA 5K8UA 2O2CA 1R0BA 1R10A 4IMPA 4TV9A 4J76A 5BWNA 1QRTA 3V4LA 3UAGA 4RE6A 1EXMA 1XXHE 3UC5A 5TMBA 3QPCA 4S0XA 1WZUA 1ZNYA 2DT5A 1T5TA 3FUDA 3B1WA 1DXYA 5ENRD 3S4YA 2ZB4A 3PEVA 3SSOA 1PJLA 4BU0A 4AZ3A 4UM9B 2VJBA 3GRZA 1GCOA 1KQPA 1W35A 1ZJYA 2ZSDA 4WXYB 3RF7A 1JI3A 2RH9B 4EVSA 5BNIA 1J1IA 3ZG6A 4GKVA 2BMVA 1JT2A 4ENRA 2RD0A 4QECA 3MS2A 1UN9A 3C1OA 2XEDA 4BBPA 2WKPA 3KHUA 5GONF 5DTEA 2NZ8A 4DUPA 1QVAA 5GZ6A 4FZVA 3RAPR 4MW7A 1G60A 1YR3A 4LOHA 1HSOA 4HB0A 1KMNA 4ZMSA 3IQGX 2EFJA 3DWGA 3QEMA 5G41A 3UK1A 3MRVA 1V11B 4DCPA 4QYIB 3DVRX 1L5JA 1FFWA 2O8CB 1DTEA 1K6JA 4ERNA 3L4BC 2IY8A 4M1MA 4PNPA 3ZE0B 3BE8A 2WTBA 3EVGA 4IG4A 4KAXA 4OYHA 3A3YA 2NO4A 1LPNA 5DKFA 3IDZA 2G1KA 1KL7A 2C8JA 1RJWA 1QRSA 4M0EA 1EUDA 3I5AA 4O02B 3VRHA 3WWZA 4EDFA 1BE6A 1CG6A 2PNJA 5K0ZA 2CEAA 3MAGA 5C37A 3C8UA 4RLSA 1BJRE 1IATA 1KVTA 3V1YA 4HWRA 3YASA 1AO3A 3ND9A 4NYMQ 4UD2A 4H17A 2MWMA 1S0UA 5FHRA 2DBYA 2FJEB 4TT8A 1FFAA 1MIHA 1H9AA 2XWSA 3GPDG 2PGLA 3CO0S 1L4YA 2VGXA 2VGYA 3WJ7A 2V6GA 2ZKIA 4QHSA 5FUWA 3GK3A 2HSGA 4E08A 2FZKA 2I65A 3N5KA 4DB4A 3D0RA 4H35A 1U4SA 2VP4A 5A1TA 1DBQA 1TJ4A 3NBMA 3U19A 4AJ9A 4NURA 3BXEA 4FEAA 5DBHX 1GM5A 2R8YA 1KI6B 4ILKA 2UYQA 2YY5A 3E03A 5IJAA 2J67A 2IPLA 4AF7A 2DY0A 3A7DA 4ZVKA 3CH4B 2O8EA 3A28A 3C1AA 3HKBB 2WILA 3ZCTA 4BNGA 3NAQA 3CG0A 3UH0A 2Y1EA 2ZM6B 3N0WA 4BWRA 4Q9AA 2DCUA 1VG9B 1DAFA 1XD2A 3QX3A 2CLEB 3THYA 2KSQA 2R0QC 3EHQA 4BCDA 4Y2YA 3IVCA 4UPEA 3ZV5A 3IOYA 1J4AA 1QDLB 3AIIA 1K6EA 1OKKD 4C4AA 2ZB3A 1OA0A 1A2KC 1LWNA 2O52A 3GEHA 4YMHA 1SCQA 1TEZA 2VQ3A 2XQIA 1GN8A 5JYBA 1E1RA 3WV4A 3RD5A 4GZ5A 3KKZA 2ZS9A 1X7ZA 4BWYA 1E18A 2LNDA 1CY2A 4I9GA 2AE1A 3QIVA 1OQAA 3I9MA 5CA1F 4OUKX 4TV9B 2XT6A 1K8ZB 1ZMOA 1KTVA 5IVIA 2IBSA 6ADHA 4MVJG 2REQB 4TLAA 4H31A 1YA0A 1P2VA 1S2LA 4ZOBA 5E8JA 2HDHA 2EZTA 3PEVB 4P98A 4I5FA 4WJKB 1AC5A 3B95A 5HOQA 5U4XA 3U39A 2YJ4A 5DVZA 1L3IA 3SDBA 5L40A 1CIVA 3TTTA 2FPIB 3INGA 2I54A 5KX5A 4N7MA 4QU9A 4MGIR 3G0GA 2O5RA 1XK7A 2YJTD 1XQXA 3WO0A 1O95A 3IDQA 4CGWA 1QVWA 5CX1A 3J5QB 5IZCA 3JYNA 3M82A 2ZE7A 2DFLA 5T4FA 2GJ8A 5K8LA 1PS0A 2WUEA 5JT1A 1YQDA 2HEGA 4XEIG 4NMHA 3ETDA 3MYYA 4ZPXA 3IELA 2F1OA 1YZFA 1BOOA 4IOLA 3ZQ4A 2N46A 1PQYA 5IDWA 2ZUVA 4WACA 4GA1A 4KDFA 4F72A 3T8YA 3Q6MA 2FW9A 2WPDA 2WU8A 1NVBA 5JYDA 2KJQA 4QD3A 3GJTA 1RWXA 2ZDGA 3FBWA 1WMBA 2COKA 1OF1A 3GT7A 4CMKA 4KR6A 4ABTA 1TFUA 4GDFA 4L57A 4E07A 3LXMA 4UHKA 3L2OB 2IF0A 2GWRA 2JH8A 2RI0A 5H8WA 3E9ZA 3HZZA 2VGXB 4TUMA 1F8XA 5TVGA 4H4EA 1C9NA 3FJ1A 1V54E 5HCNA 1KJJA 4YC7A 1HG0A 2CJXA 4M2LA 3M5PA 1K3TA 2VYND 1T5OA 5CXUA 1DCQA 3I3NA 4Z6KA 2JFOA 1PR2A 3WP1B 1XFDA 1DQPA 1SKUA 4BRSA 3IUMA 1UDXA 2Y27A 5E6UA 3BDIA 4RTNA 4Z4IA 4JI5B 2CKDA 4DY4A 3QPUA 2IITA 1MQSA 4TMKA 2W37A 2GETA 3RREA 5GY7A 1DRWA 1PZNA 3KOZA 3AB7A 1PDVA 2AMFA 1GSHA 2BHLA 1I2BA 4NMXB 2O8EB 2BMWA 2XMCA 2F1JA 3GYXB 1BPOA 5HILA 4IVPA 1A8IA 3EAFA 3K0FA 1W6UA 2R60A 4MR9A 1JE1A 5LOVA 4ZTUB 3OOHA 4CV1A 5FV4A 1Z34A 4BFCA 4COOA 1LY1A 1UXOA 3THYB 3WNQA 4AWAA 4NDAA 3HK2A 2YXNA 3GVXA 3HR8A 4C2BA 5F77A 2FI1A 4DWVA 3AVXA 4AO8A 2OBLA 4ESEA 2W2LD 2C2KA 4UTVA 3T5CA 3G68A 2JLXA 1N77A 2ESRA 5HOEA 2NPOA 3AR8A 2Z3ZA 1YKGA 3D3JA 5C7LO 4EECA 1L1EA 1RCTE 3INNA 2BUGA 4QDJA 4BQPA 3SQNA 1F14A 1J7KA 2HZ7A 4P31A 4WL0A 4FYPA 5I4CA 1GP2A 5I9IA 1UPBA 4G2TA 2J9FB 4BT9A 3QJ5A 2B5VA 1JLRA 3DDZX 1UIRA 3AZQA 4KBFA 3A1CA 2OL4A 4Z9XA 1Q11A 4G56A 3JQ0A 3WYBA 2YFHA 1XN4A 5G1NA 2G0TA 3ESZA 1NAIA 1DCFA 4BQQA 1HDZA 2BFDB 5AKGA 4ZZ3A 2IODA 1VLLA 2IFTA 5AJVB 2B6NA 1WUTA 3DDWA 5TEVA 3ETLA 2VDVE 4FFNA 3UGJA 1L5WA 1P19A 4TTQA 2BF7A 3RC2A 2NVOA 1E2JA 3DKKA 3DF7A 3GBPA 4GL4A 4R2WA 2Z9CA 3WLNA 3TLBA 2K4MA 4FR5A 4IYJA 2ZIVB 5F52A 3BKWA 1SXIA 1AKUA 2BEDA 4FIZA 1S8AA 2C9MA 4RMNA 2J87A 4IQ4A 3UGTA 1SZ9A 5CX1B 2ISCA 1J24A 2JGKA 2BFAA 2ECKA 4WDRA 2J0VA 1RWQA 3VOSA 2MYPA 2CYAA 2ZRIA 4V0MA 2LWIA 2O2IA 1GGMA 4R7ZA 3C7AA 2ZSIA 1PWZA 1ZGJA 3AEUB 3WTCA 2YNMC 4E4TA 2FJPA 4B6FA 2Q3DA 3KXLA 2H4XA 3PPXA 4Y8VA 1S2DA 2FLWA 4XCXA 3ODGA 2XWPA 3H16A 3BAZA 5ARGA 1XFAA 4JZYA 4A3SA 4J0EA 4W5QA 3ABZA 1QV9A 1TOAA 4MRRA 3WA6A 5AVQA 2JD0A 4DR3B 5KAPA 4C0HA 1I1OA 1QM5A 1FU4A 1OAOA 3C7KA 4U7FA 2CV2A 1H5NA 3UMFA 3L6CA 4R9SA 2YRXA 5H70A 4LK3A 3U16A 3BWDD 3LT1A 1DJPA 3TEMA 2Y2VA 2BP7A 3GQBA 4UC0A 4ZXFA 4UNPA 5A5GA 2IZ6A 4NICA 2XHEA 1CUAA 3H87A 1WVGA 2L0TB 2OHFA 3KQUA 1Z18A 1USUA 2GUGA 5E6UB 4B6OA 1A5BB 2Q5FA 1ZO8A 3RIGA 3REFA 4TTAA 3V8EA 2WD7A 3RSLA 3DPSA 1Z6PA 1NRWA 3K1AB 1Q1NA 3MXOA 4YMUA 4IX9A 1NBAA 1DC8A 3PEUB 4MR9B 4HN2A 2FJAB 3QELA 1QRUA 5JTUA 1D1QA 2JBWA 1L2TA 4ZALA 5EWJA 1R27A 1V55E 2P4HX 1NYQA 4R4JA 4IYRA 1CUEA 2H2DA 4Q12A 1U7ZA 5JAHA 3HM2A 3BH6A 3AHFA 3T06B 5C5CA 4PBSA 5FTJA 4QYWA 4DV0B 2ZE6A 3IUEA 4TYNA 2SKDA 5FAKA 3CWZA 1RJFA 2OCBA 2W6JA 4B48A 1FFGA 2E21A 1BMFD 3IO5A 2PGOA 2ROQA 2AXQA 5KTTA 3LDHA 2IF4A 3UMRA 2O1XA 5B1EA 4ZGBA 4GIBA 5AVRA 5G0TA 1TU0A 5I7HA 1TADA 4RHYA 4K0KB 1HO8A 3ILHA 4LY9A 3W5CA 5BRJA 3BQNB 4ZAXA 4MQFB 4D6PA 1S4QA 2HHAA 4RGBA 3OF5A 5E38A 3OZAA 2AFHA 1N57A 1XZFA 5BMVB 2ZJ2A 4KP7A 1E63A 3MYVA 3DT9A 2HT1A 1Z4QA 3R3ZA 5FL7D 2DUUA 4FINA 3FUIA 1ADCA 3QK7A 1VIMA 3IKLA 2YHCA 4G3XA 4F56A 2KZTA 2WUVA 2HYIC 4A55A 4P5PA 3RYTC 5SZHB 3JQFC 1PFVA 4XVUA 4BP9A 4TWJA 3NC1C 5EG5A 1Z8FA 5DV9A 5I7SA 4ZAWA 9LDBA 1OLUB 4UMDA 1D8EA 3QLUC 2F3PA 2MSEB 3QKSA 4YGYA 1IN7A 2ZJ1A 5EXDA 1VIAA 2V74B 3SOZA 2R97A 3D7KA 3PZ2A 3W7VA 4N7BA 4XQGA 5L7TA 1PZHA 4OREX 2QVLA 2EBHX 1Y48E 4FYXA 1E3SA 5FWDA 2JI8A 2IWRA 1KFBB 1O8CA 2XBUA 1OAAA 4E1BA 1JJIA 3CT6A 3FIUA 1HFJA 4NNJA 4D9IA 5EHZA 2AJAA 4I6EA 2I1QA 5LKAA 4KO4S 3DZGA 1KY5A 4WMLA 2VQFB 5KJMA 1C8LA 1ZD4A 2QSJA 1LDNA 4EBFA 3NHFA 1CD5A 4X3OA 3JQCA 4Q21A 3T9CA 4K1XA 4U95D 4LBWA 2BP7B 5IH3A 3ADCA 4JQCA 1CUBA 3WYFA 1MX4A 2HO5A 3E81A 1D0VA 2CE2X 3AV3A 3RAJA 2B4TO 3A4VA 4WNDA 2H1RA 4D41A 1SKYB 2IBTA 1VFPA 5FOTA 2C4HA 4C1BA 4DR1B 4FGLA 1FDUA 5TXGA 2NPIA 4R05A 2IWHA 4UHFA 2A84A 4LJAA 3AQIA 3UJ3X 6PFKA 3RBXA 1BSVA 3HCNA 2EX1A 1RXYA 4DHWA 3WYAA 3MN1A 1KARA 3FYSA 2HIMA 4BFTA 1RQRA 3A9VA 1GT91 5K2MA 3QELB 4Y2RA 1MTZA 3ETNA 4OLFA 3BU8A 1XO1A 4R8KA 2FEOA 4ZOCA 2RK4A 4CWAA 3OQJA 4G5QA 3B7RL 5AQ7A 3G9UA 2VAVA 3LSTA 5KQGA 3KZ1E 4FONA 2EKDA 3Q87B 5AM3A 4XX1A 1X3SA 2C4TA 5DSXA 1K4YA 5JO9A 1I36A 4UCQA 4TYMA 2H4ZA 4MROA 1U0JA 4MGKR 5LA6F 1Y8AA 1BFUA 1SQMA 2ZUTA 4PLGA 2G5PA 2VKTA 1CY8A 1RQ7A 3CV3A 5FA6A 3EN0A 2BT4A 3UATA 2PZEA 2HMUA 3E05A 2CCKA 4MR7B 1R4MA 1QONA 3HVHA 4L6CA 1ESMA 1O7JA 4NH0A 4WECA 3IPAA 5BQ3A 3SC6A 1HRDA 4D0SA 4EGSA 2I71A 4EATA 1BCRA 3K0KA 5JI3E 2IPAB 3KT8A 1AZLA 3IUPA 2YV3A 1GQOA 4A27A 3U13A 1GNVA 2GYUA 2H63A 3AVWA 3H42B 5CB6A 4ND8A 5DT9A 4IJ5A 1IE3A 4YTEA 3AG2E 2QE6A 1EP3B 1Y42X 5A71A 2DFDA 5EGSA 3MMPA 1YCFA 1Q7TA 4L5IA 3RI3A 4DWJA 4IDDA 4C5BA 4OK5A 3U31A 1QFXA 3ISJA 1E8OB 4ZT6A 4MNTA 3QKSB 4GXTA 4X93A 3FJYA 2RBEA 3H1AA 1NI1A 2DM6A 4MKHA 2VDWA 3GXOA 4AMVA 3ROPA 2UKDA 5CDTA 3Q9SA 3S0JA 4A9AA 5A02A 3PHIA 3J81k 3R2JA 1LX7A 2YWDA 1F7UA 3H13A 4M98A 1Q16A 3QBEA 2XKAA 3Q9UA 2UAGA 3SPXA 1L4KA 4CF5A 1WV0A 4QWMA 1KJYA 4J49A 1N0WA 4BT8A 3PHBE 4FFVA 1GL7A 2FR1A 4DLYA 6YASA 1B8UA 1TC2A 2GDZA 4FOTA 3B7PA 3PB3A 1R18A 1Q95A 4PNHA 3V80A 4CF4A 1SQSA 1KO4A 4K6GA 3EDQA 2IDMA 5LLDA 2FPPA 2GZAA 4ZYXA 2XJ4A 3CQ9A 2O4UX 4ZHQA 1E2GA 4EL5A 1U3FA 3RTCA 5KYYA 5L9AA 1YD7A 4RVHA 4FEYA 2BI8A 2JGAA 4FU3A 3AVYA 1IWBB 3VZPA 5JH7F 4FZ3A 3TRJA 1UN8A 3EQ7A 3U3WA 3FU3A 4YO7A 3FOAA 1NW8A 5EIBC 1Z0SA 1U7WA 2WXRA 4D9KA 4MV1A 2BGMA 2ZGVA 4HYEA 1X86B 5LQUA 2AT1A 3BMXA 3KEMA 3S2YA 4G8KA 4HVLA 3EUVA 1GLNA 5ANRA 3EUEA 1VZ2A 2I62A 3R5SA 1XLVA 3G3EA 3LT4A 1NF3A 4GSLA 1WV1A 1V8PA 5AJTA 2QRHA 1AUOA 2REXB 1A4IA 1Y6FA 5CBOA 3E5HA 4K9SA 1SAYA 2WT8A 1DDIA 1ZU4A 4U7EB 2HRRA 1PL6A 4RJJA 4BFSA 2B0JA 4E94A 4YCBA 3BIOA 4RM3A 2OV2A 5ER9A 2VNJA 3QEAZ 3I2YX 3FPBA 3KIPA 5HKLA 3EGXA 3PT5A 3UT5A 2YZNA 4Y1FA 3TSYA 4EVQA 4WD3A 1MNAA 2V0GA 3N3AC 3DVAA 4KN5A 1JLMA 1GFIA 3LE8A 3L6RA 5I6DA 3OU2A 5HR5A 2XXAB 2EATA 1KMQA 4GUAA 5SY9A 3M1LA 1JFRA 1X6VA 4UHEA 1F0NA 5HGXA 3QHQA 4HWGA 3P8ZA 4FPXA 4RVNA 4E22A 1YHZA 1AVTA 4B0OA 4FFLA 1LVUA 5G05J 2ADMA 1R4NA 1V5WA 5TB5A 1R4MB 2A5JA 4X3CA 1CUIA 2LD4A 3D2AA 1HTTA 2JKZA 3LK7A 1ADGA 2WJHA 1EXDA 3B36A 5JSZB 4YALA 4WGFA 3LM8A 3PXUA 4U9IS 1GNRA 4QVGA 3K9WA 4NEGA 3NOGD 1LBEA 5IUKC 1CNMA 3NVKI 3PCTA 4EFNA 3QENA 3KVVA 3F74A 2JG3A 2W2OA 2QZJA 2G5GX 2XCRB 3UJDA 2HFKA 3IQFA 5CVJA 1W1WA 4EPRA 3DMTC 1OC4A 2PS0A 4H7YA 5IJXA 4YBZA 2B2XA 4ND8B 3RSGA 3VJKA 4ZCPA 3KJXA 1AHIA 3TXNA 3R23A 4H6XA 3U9TA 821PA 2PRJA 3AIMA 4QUGA 2JF0A 3T4EA 3HJCA 3ZWPA 3HN6A 4L0QA 4RV9A 1P7CA 5ALQA 5FUBA 5FLEX 4Q4JA 2VDWB 4BNMA 1W36C 4JVNA 4GTMA 3O6VA 1TVCA 1EE9A 3IILA 4DRXA 1D4FA 3FAKA 1UXKA 4QFCA 4RVBA 4BYGA 4MUJA 1HSZA 1QHYA 3KR1A 1FSPA 3TCKA 1Z6GA 3L6AA 2X5KO 3HCPA 2CNLA 1Z6YA 4A5SA 5ISMA 2ZETA 1Z0AA 4B40A 4WLOA 1G8YA 1EVQA 3UOGA 3QB2A 2FZWA 4OIFA 3LBYA 3WRYA 4YQFA 5CTJA 2JHAA 1WY5A 3FSGD 5HS0A 2D5IA 4YA6A 2NWQA 4ZHQB 1OWOA 4AF8A 3RFCA 5C51B 3QJGA 3GYZA 3E9MA 3TN7A 1L1FA 1E2QA 4IIDA 3PUJA 2GVNA 2Q5OA 1QP0A 2AF4C 4AECA 1ORTA 4KHPB 1UPCA 1PTJC 2R8PA 1EVYA 1EFTA 4IFEA 2DBRA 4TKLA 4WLEA 2PX8A 5HQ8A 4XWYA 3EK2A 5ALUA 5ANRB 2KCVA 3X0DA 4U0UA 4HHEA 4JS0A 3MAAC 4C6RA 4QJ4A 4DMFA 4F4IA 3GZSA 4KBQA 5SZKB 1HDRA 2P9IG 2BZSA 3ZYCA 1ZMRA 1IONA 1ZYUA 3DSWA 1PJ4A 2NT4A 3HFGA 1NVAA 1GZ7A 2AOUB 1Y6QA 1XX6A 1L5RA 3WLIA 4ZAGA 3DEIA 3UT5B 1GCIA 4EB6A 1DOHA 4JGIA 4ATNA 1SVWA 4GVPA 3VR4H 1NM5A 5AR1A 4EBAG 2HJRA 5B7PA 1IB6A 1DQRA 2ZW9A 3ENVA 2B1JA 5G04C 3OQIA 3SP1A 3AXSA 2FJBB 3LC2O 3R6WA 2WJ6A 4AUEA 4URUR 1TKCA 4JU9A 1IB0A 3VOBA 1XU7A 1SPXA 3S44A 1G3MA 2G76A 1IXKA 2REBA 5SY4A 4NACA 3D8SA 3CLSC 4XASA 2K7FA 1LUAA 3IX7A 1TEXA 3WXMA 3PKIA 3AVOA 3PZ3A 1T1EA 2O0KA 1MPTA 1Z83A 5DGCA 3GZ1A 4EKDA 3BD9A 4WE3A 3ESKA 2IU1A 2WSSD 3KQLA 3K16A 5LZ5A 5EJAA 4N48A 3NDPA 4Q7QA 1TQ8A 4HBDA 2ON6A 3NHAA 4JCCA 5JJLA 4JIGA 1QU2A 1QR6A 3H1PA 4R1PA 1QHIA 1L4FA 3L7CA 5I9BA 5B3JA 2PU7A 4JB0A 3AHJA 2FU5C 4M21A 4RH3A 2P9FA 4U6QA 2SKCA 3DVSX 3LWZA 2CDRA 2YN0A 2DECA 4YRKA 4E88A 4MVJD 1JHRA 3PC8A 4N6NA 2DHCA 3ZEFA 1SKMA 4AG5A 3P9NA 5H59A 3E3NA 3V2XA 2VSNA 3E9RA 1IBSA 2AJLI 1PT8A 3VX4A 3DAGA 5J4YA 4FBGA 1CIJA 1LQTA 1NJGA 1GG9A 3AY7A 3REOA 4Q4JB 2NIPA 3P9XA 4KPUA 4F04A 2P35A 3GXBA 4BO1A 3SIPA 4EL0A 1W4RA 3WNZA 4PX2A 3EHDA 1M74A 3EVBA 1E90A 2D0IA 4G0UA 1RTKA 3L4JA 2VHWA 2VBFA 4QREA 1A72A 1Z56C 2MR5A 5BR4A 1L0BA 3P2KA 3GNLA 1T36A 3L01A 1SU6A 4G0NA 2QB5A 3DEPA 5I7EA 3SU8A 4RY2A 3QX9A 2HIGA 5FBHA 4ZFNA 3IFSA 5CBPA 1ATZA 1H5QA 1W44A 1RFLA 2GVDC 2XVAA 3RR2A 5H3CA 3IEVA 3X1ZA 1RM5A 3BL6A 1HM5A 2QLJA 5DDIP 4UUBA 5JD3A 2QRVB 3RU2A 2D62A 2BAGA 5EP2A 5KNGA 4U4AA 5DTMA 2NO6A 1E3DA 1SW6A 2MRIA 1ZNXA 5JNLA 4R3UC 3ONEA 1V7ZA 1JIQA 3Q75A 2X8WA 3LYHA 3QXCA 3DMHA 5JC1A 1N52A 1V96A 5DYGA 4ZGGA 4GX5A 4L22A 3E32A 2ZYVX 1WB9A 2NOAA 2R17C 3BE6A 3B7BA 2G25A 1K92A 4BKQA 4TKVA 3OICA 2KYRA 5DOZA 5COAA 3KWFA 3C3JA 1UWVA 1MC1A 4JIMA 4KRFA 3ZBTA 4DCUA 1ZJ6A 3NRBA 1CDOA 5IKEA 3WWOA 3MGGA 5T7BA 3KKKA 2RONA 3AR5A 3GEDA 2I6XA 3KCNA 1P31A 3S3TA 1OZFA 3N86A 3K7EA 4ML3A 2P5TB 3H6GA 5C9ZA 3EXG2 2XQJA 1A5ZA 5LJIA 5TDHA 1X38A 2NTNA 2KBFA 3W5HA 4EKEA 4HXIA 2WJGA 3I9JA 5HCIA 3W4IA 5F98A 2B7LA 3U1TA 4RTQA 1X13A 5AM5A 1EVLA 1IHGA 4JT4A 3I5UA 1RJEA 3RC9A 5LB4A 4KXXA 3UMMA 4FYMA 3U4CA 2OQRA 3H75A 2YOGA 3IODA 1IQPA 1ZM7A 1ZIXA 1M73E 3TWQA 2V9PA 1NA3A 3ANNA 4YP1A 5JVDA 4K6HA 2ADFA 3VU0A 4DGQA 1PJRA 1P2FA 3AP2A 2JEKA 4KQWA 5U4QA 5AW0A 4DR4B 3HS3A 5JRDS 4NNOA 1F38A 1MQ9A 2O2XA 2BDTA 1XV5A 4DN6A 5LDDC 2PKQO 5EKDA 2ERCA 2WABA 4ENQA 5E6SA 5JCJA 2OWEA 1NA5A 3NBFA 5F1PA 2FUNB 4J2TA 1LI4A 4ZOAA 3ZXSA 4F9EA 3EFOB 4IMJB 4ALNA 5EVJA 4FHJA 2BR4A 1VXRA 1CUVA 1V1JA 4OXRA 2GLXA 2R7LA 2PV7A 1FDSA 3BIFA 3D3WA 4CEIA 4BMOB 3E9DA 2O57A 4IZHA 3SSAA 4L6IA 1NU8A 1JXOA 4GRDA 3WG7E 2Q5IA 1KWKA 3KXIA 2ZBVA 4COKA 1Z5ZA 1JWAB 1Z6TA 2QPAA 3O95A 3HFJA 7ADHA 4J07A 3S29A 2JJYA 2Z4SA 2R4UA 3BGSA 2BOVA 5AOAA 3DO8A 2MYNA 1T36B 4QASA 2YDYA 1KP2A 3WQBA 4RTOA 4D98A 3MWYW 4JR2A 3ESXA 3UM2A 1FS4A 2PANA 1BX1A 3FHCB 3UGQA 1H8HD 5CBPB 4LGCA 4F3TA 2QVXX 3MJCA 1JU3A 721PA 3RIYA 1MENA 1D5WA 3L1KA 1JR3E 1VJCA 1Z16A 1X7YA 2RGBA 3VMFA 3SI7A 1AKVA 2JIPA 2OC4A 1XELA 3C6BA 4N6GA 3LT5A 4JP3A 3QFTA 4NQZA 4QO8A 3QNWA 2YWRA 3FNQA 3TE7A 4QGSA 3EZ9A 2Z57A 4KN6A 1W5SA 4XQEA 5JJIA 3M6VA 3ZQJA 5H9WA 2OCAA 5BO5A 1N3YA 2IYPA 2A5UA 3I4LA 4QTXA 1FP1D 2J30A 4V02A 2XUPA 1P8JA 3A25A 4ZO4A 4TKVB 4MKFA 1ZH0A 4INPA 1USIA 2OBFA 5KTKA 4I9FA 4K88A 1KJQA 3RUPA 3BQ9A 1IHBA 3ETJA 2CVQA 2J41A 1AY0A 3IMFA 1SHZA 5BN5A 3S1SA 4J1TC 4YP7A 2WQHA 3LRPA 2D2IA 3Q7PA 1EG2A 1M0WA 1TGVA 4GPMA 4JOCA 3E3OA 1Z4PX 1O6GA 2J0UB 2BEJA 1V11A 1P7PA 5EXXA 2QRGA 2O8CA 5JROA 4LRZA