2FJEB

Adenosine-5-phosphosulfate reductase oxidized state
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
149
structure length
149
Chain Sequence
PSFVNPEKCDGCKALERTACEYICPNDLMTLDKEKMKAYNREPDMCWECYSCVKMCPQGAIDVRGYVDYSPLGGACVPMRGTSDIMWTVKYRNGKVLRFKFAIRTTPWGSIQPFEGFPEPTEEALKSELLAGEPEIIGTSEFPQVKKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reaction mechanism of the iron-sulfur flavoenzyme adenosine-5'-phosphosulfate reductase based on the structural characterization of different enzymatic states
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords adenylylsulfate reductase, subunit A
total genus 21
structure length 149
sequence length 149
chains with identical sequence D
ec nomenclature ec 1.8.99.2: Adenylyl-sulfate reductase.
pdb deposition date 2006-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00037 Fer4 4Fe-4S binding domain
B PF12139 APS-reductase_C Adenosine-5'-phosphosulfate reductase beta subunit
B PF12800 Fer4_4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fjeB01
3.30.720.40 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 2fjeB02
3EUNA 1PC4A 7FDRA 1KEKA 1SIWB 3GYXB 1WTFA 3HKZD 4Y28C 2VPZB 1CLFA 2UZAA 3OR1A 3IR6B 2FD2A 3EXYA 4DHVA 2V2KA 3OR2A 1GTHA 1FD2A 3MM8A 1G3OA 1BLUA 1GT8A 1DFDA 3MM6B 5BYQA 1PC5A 2VKRA 1FDDA 3MMCB 1F2GA 4OV1A 3LW5C 6FD1A 3MM7B 1FDBA 2VPYB 2XSJA 2FJBB 1H7XA 2GMHA 2IVFB 4ID8A 1C4AA 4XK8C 1F5CA 1H0HB 4KT0C 2WB1D 1B0TA 1FDAA 2O01C 5CHCB 2GMJA 2XSJB 1FRMA 1BC6A 1XERA 2FJDB 1BWEA 3MM7A 1K0TA 7FD1A 1FRJA 5CH7B 1JB0C 1BQXA 2C3UA 2WSEC 2PMZD 4L6V3 3IR7B 1GAOA 3MM8B 1FRKA 4RKUC 1Q16B 1Y4ZB 2PDAA 3OR2B 1FRXA 1Y5NB 2VPXB 1H98A 3OR1B 4OMFG 1FDNA 1Y5IB 1FCAA 1DURA 3C8YA 4YDDB 2V4JA 1SJ1A 1C4CA 3EGWB 4XDCA 5L8RC 1FRLA 2WAQD 1D3WA 3MMCA 1G6BA 2C3MA 3MMBA 1FF2A 3MM6A 3MM5A 2Y0SD 2C3OA 1A6LA 2Z8QA 3PNIA 2C42A 5BYRA 1H7WA 1ROFA 1FRHA 4CI0B 1R27B 1KQGB 1IQZA 1FERA 2WSCC 2V4JB 1IR0A 1Y5LB 5E7OB 2C3YA 5FD1A 2FJAB 2FGOA 2VPWB 1FXDA 5BYSA 3MM9B 4AYBD 3MMAA 1FTCA 2C3PA 1VJWA 1JNZB 1AXQA 3IR5B 2PA8D 4XDDA 1HFEL 2FJEB 1FEHA 1GTEA 1B0VA 3MM5B 3MMBB 2ZVSA 1JNRB 2FDNA 1SIZA 3MMAB 1F5BA 1FRIA 1KQFB 3MM9A 1BD6A 1DAXA 1B0PA 2WSFC 1RGVA 6FDRA 1FXRA
chains in the Genus database with same CATH superfamily
1WF2A 3QIPA 3VVTA 3GB0A 3OTBA 4URGA 4X4OA 4ZIWA 2OJ3A 2QSFA 3UDVA 4O4RA 3MR5A 4ZHRB 4F4XA 2HVIA 1RA6A 1LWXA 2Y0BB 2RRAA 1KOOA 4R0EA 1NBEB 1MN9A 2CXEA 2XZTB 1J5OA 3DYAA 2KH9A 3D2WA 1K47A 3DLLQ 2VIHA 4N3CA 2ZZTA 3OR1A 2YNIB 3N01A 1T02A 4DHVA 1M1HA 3M2UA 1YI2S 2QLJB 1WEYA 3DFEA 4OYXA 3FEYB 1UWBB 4WK3A 4C0BA 3RBDA 2CG8A 5KFDA 4JI4F 3RTVA 1U02A 1FDDA 4M1KA 1BQNA 5E33A 5KG3A 2VBXA 3I0RB 1HLWA 2AJ0A 5BJRA 3HJVA 3MR3A 2Q1LA 3EPGA 6FD1A 1OYDA 3MM7B 4JV0A 2B4VA 4ZJLA 9RUBA 2MZRA 1VC0A 2L48A 2EFQA 1F2HA 2YWEA 4PWWA 2F65A 1WKLA 4ZPAA 2DGTA 2GMHA 1WTBA 2PFFB 2VKZG 3J7A1 4AKXB 1C4AA 5LJ5Y 1HW9A 3L3CA 3KLVA 4KT0C 3FMWA 3SK1A 3Q8YA 4UF4A 3MEDA 2E1PA 1EQ0A 4WZQA 2DYAA 3I9ZA 2EC0A 3FJ2A 2KRRA 3QYYA 2OSQA 3H20A 2FZKB 2ZC3A 3N79A 2QIFA 3CJRA 1IKXB 1EHWA 1N0UA 2KFZA 1FRJA 4B9TA 1EAYC 2I0XA 1FT8A 5K20B 3T5LA 3E51A 3HKWA 3IRXA 2DISA 2V5HG 1R3NA 2IBOA 3MM8B 4C48A 3BSOA 3F44A 2A18A 1RWWB 2C2ZB 2Z2MA 3JQKA 1Y5NB 4N8OA 1YRTA 4QWBA 3CMAS 4DV3J 4RW8A 3MAAA 4NZ6A 2QJ3A 2V2ZA 4OMFG 4DQRA 1MSWD 3R1LA 2CIMA 2HEKA 1VC6A 4ED0A 2W9AA 2ZWPA 4OX9F 3RGIA 1O51A 3RB6A 4X2BA 4OYAA 4JP8A 4CM2A 1W25A 1ZA2B 4LF5J 2YVSA 4V19J 3KNGA 2DGVA 2V8PA 1BY9A 3ELHA 1QDUB 3K5OA 4QJVA 1D09B 4RBVA 3J7YI 5HL7Q 5KFWA 4ELVA 4UT4A 1T94A 4ED3A 3H5XA 4IH7A 2WW8A 2U2FA 1BQNB 3G8SA 1U1OA 4DR6F 4ED5A 3B54A 3H2LA 4JI8J 2BE9B 1FEEA 4I6AA 4YFUA 1UWBA 5J1NA 2DXDA 1I51B 3P8BB 1Q8IA 2FHKA 2NPFA 1RWUA 1EP4A 3V6DA 1NJZA 4DR3J 2KHCA 2G1DA 4LFBJ 1QE1B 1FVQA 3GIRA 4AL7A 2XY5A 4F2SA 1Z2LA 4J90A 4YMEA 4EGLA 1GK8A 1UFWA 4WYWA 3FNNA 3UD3P 3TZZA 4C8YA 3PIPQ 1KQGB 5KG1A 1XR6A 4DZ6A 3IN5A 4TVAB 2V69A 3WX8A 3QIPB 4USKA 4MIWA 1Q82T 2JC0A 3K17A 2GGPA 4NEZA 1U1LA 3HZEA 5HQLA 3TI0A 1KP6A 2R7WA 1J5EJ 4WTYA 3B8HA 1HMVB 3MEGB 3Q8VA 1FD8A 3UR3C 5KOWA 4YP3A 2L9DA 1VRUB 4OZ5A 1HWJA 5DRKA 2PA8D 3K8WA 4HLBA 4DPXA 1Q1KA 1WSRA 1KQKA 3M8SA 5KFGA 4DR2F 1YJWS 1MMNA 2Q6BA 4Q2MA 4ZLNA 2AQ4A 3CJTA 3WC2A 4GO5X 3HHEA 4R8UA 2HK3A 2Y8YA 2CQDA 2E66A 4NLXA 4YN3B 5DDRC 1L3UA 3QSIA 1HHQA 2VOPA 1APSA 3RYLA 1AFJA 2YNHA 4UUWA 1KQFB 4OX6A 4BCAA 1JJ2R 2AF6A 3KUGA 1OY8A 4B9MA 4EBEA 4DR4J 2DGXA 2K7JA 1YZ6A 1VFJA 2RNEA 3K0JA 2XHCA 3UWTA 3MAQA 1RT3A 5LMUF 2DJWA 1PCAA 2CQIA 5DGBA 4QR0A 4Y28C 5ETPA 2WVEA 4NLSA 2DNOA 4ZVPB 2R2RA 3WIUA 1SCJB 3M2VA 3BJYA 2E1AA 1MWQA 4ANCA 1E8OB 2H51B 3CCVS 1FWKA 3PM9A 4LFCF 4ZLJA 2MKIA 3H40A 4ZP8A 2HVEA 2LQBA 4A46A 3Q8PB 1WEZA 4PZVA 2C2KB 1G3OA 1WC5A 3Q8SB 1S79A 3I32A 3IRXB 4KO0B 4ZJOA 4Z7YA 2W8LA 1VQ7S 1KSPA 4NLTA 2JOQA 2HBRB 2OPRA 1HD0A 3DDNA 2RT3A 2AEJA 4HI1A 2JVOA 1XTZA 3A13A 4RW6B 4TU7A 3PX0A 3QJLA 2W2QP 1KLMA 5B0EA 5CA5A 5J1EA 3K58A 2E5LF 3PZPA 3GLJA 2FUG9 1HBOA 3KHGA 3W66A 1RAEB 4EBCA 4DF4A 4B3RF 3LAKA 1SKSA 1RTIA 3D1QA 3GMGA 3MEDB 2KYXA 4DR1J 2HK2A 2JX2A 2RILA 2DIVA 5E5NA 1U09A 2R7OA 2FPHX 5CHCB 4AD6A 4EI2A 4ZCMA 5JXSA 2CKWA 2L9WA 5C25A 4QWEA 2CPDA 3KYLA 2R7SA 3PVXA 2NXUA 7FD1A 1VS3A 2VF3A 3NS5A 5F3TA 3GR1A 4AQYJ 4KHRA 1YBUA 2IM1A 2C2MB 2PE8A 4DSIA 3L7PA 3HMJG 2XM3A 2D3ZA 3VZIA 4QR2A 1S49A 2ASLA 2BQUA 1FA0A 1GMWD 2IA0A 3NWRA 4PKDB 3SXLA 4DPTA 3M2UB 2ZOFA 5KG5A 1FXLA 1R8HA 2YKNB 2AJ2A 3DRYA 2CDRB 2MQNA 2WBMA 3K2YA 3OR1B 4BLGA 4IG3B 2A2DA 4JV1A 2B56A 1OPIA 3RG6A 3LUYA 3JYTB 2ZH9A 1HNWJ 1IWAA 1IKVA 4TLQA 3SCKE 5B0CA 3G4SS 1LW0A 2V50A 2KXNB 5KFRA 3Q2TC 5IV3A 4OYPA 1NJWA 1IBLJ 3I5BA 4RUBA 3NMRA 1KR4A 3GIMA 1SH3A 4FXWA 1URRA 1S10A 4Y2CA 1C1BA 3AD7C 1S99A 3D4JA 5CXTA 1WG5A 1D3WA 4R0JA 1I3OB 1VRTA 1YRUA 3B6BA 3ZZTA 4ZLLA 3MMBA 3MPVA 5KFHA 3EYZA 4DV0F 2BQRA 1NK5A 1HQ2A 1N5SA 5IM0B 3BKTA 4ZVTB 1IBKF 1U6BA 4UYJB 1PBUA 2GVDA 2OD6A 2MKHA 1Q4RA 3LGHA 2W9CB 4IQMA 4ILLA 4Q0BB 5IQ6A 3DU6A 2OHDA 4HTJA 1H7WA 2BANA 5EUHA 3W62A 4H4KC 3ZTPA 5ITHA 5KAKA 1Z4UA 4V1Ak 5K8PA 3MFIA 4A8YA 1FNXH 3FFIB 2OKQA 1F3VA 5FDLB 2HZAA 3DGPB 1P8GA 2DR8A 1Y5LB 1TKZA 1VIOA 4KIAA 3D28A 2K06A 3H59A 4KGVB 3FBEA 2FGOA 2DKOB 2DK2A 1JLCA 4NMLA 2VD3A 2E5IA 3CVKA 3HVWA 3MM9B 3QAUA 4ID5B 4OX7A 3AXMA 4CLFA 2QLFB 5HMZA 2AWZA 2XWXA 3N0VA 5EGYA 1Q86T 2AYBA 2FJVA 2BKOA 3H7HB 1E6VB 3HSGA 1YBAA 3ZZPA 2FHJD 3UPFA 1FE4A 3D66A 4XDDA 4X4RA 4GKKF 4NLDA 1U48A 4WFYA 2GW8A 4IQXA 4A8QA 1JNRB 2M7SA 5DDQC 1S4EA 3MCOA 5IV4A 1F6TA 1M5HA 5LL6d 5E3CA 1RWXB 1WF0A 1BD6A 1JLCB 3IS9A 3CCRS 1T7PA 1RGVA 2CPFA 2QA1A 1VK3A 5HAOA 5AXNA 1TKZB 3I31A 4OZ2A 4QPXA 4CIOA 3PR5B 5C42B 3LALA 4D3GA 2ZOMA 3DRRA 4X66F 5KFFA 3FRZA 1QAJA 4HH0A 1SC3B 4L75A 4JI2F 4DCPB 2VJVA 3ET6B 1NNDA 4M5NA 3GJQB 2W9CA 4KH0B 4ED4A 3CIMA 2CWXA 2NYIA 4A4JA 2GVDB 3G87A 2VFTA 3ICLA 3RBXA 2HNDB 3H4DA 4B3OA 1GTHA 5HMWA 1SL0A 2OIHA 4ERDA 2YKOA 3BKUA 2VKRA 3OTOF 1VRTB 3BO3A 1N8RT 2G9OA 2IMWP 4O44A 3J7ZT 3QFWA 3KLIA 4J9OA 1B4SA 3LW5C 1U8WA 2XBPA 5DQHA 3BF4A 4FF1A 5CAAA 3G2XA 1TAUA 2IVFB 1LW0B 2YWKA 2BE2A 5KTQA 4LF5F 1TV6A 2OSRA 1OJ4A 3QGIA 1FFWB 2UXDF 1TV6B 1DFDA 2CYYA 4NL5A 3UVJA 1ZOTA 1RT7B 2R8HA 1ZZNA 4U6PA 4FKYA 1HQUB 5AT1B 2LXIA 1WEXA 1XERA 4DCJB 1SQGA 2ZM6F 4KB7A 4ECVA 4MH8A 2Y3YA 4OYIA 3KLIB 2IC3A 2AT1B 2RKIB 4X65J 3P5BP 2FVQA 1JB0C 5JMNA 2VB6A 4DX5A 4K4XA 1VQOS 3W9IA 2EEYA 3JQJA 3LP1B 1ULRA 2LYVA 2BEFA 4NMXA 5AXKA 1HR0F 1FX2A 1T9TA 2ZH6A 4DG1B 5CD4A 1R0AA 2UUCJ 3AJ1A 2IRXA 4V19X 5C25B 1NJYA 1U0HA 1DJ0A 2CQCA 3ET6A 3VGUA 3R7SB 4PPZA 2HFVA 4CRJA 3DMJB 4XI9A 1N5TA 2A1BA 2OO4A 1RTIB 4Z2XA 1J5EF 1Q81T 2LQJA 5KOXA 3LOUA 3RRGA 2V8HA 1S0MA 2QLWA 3E01B 1CQMA 2ZEJA 5HO4A 2UU9F 5KFSA 4O23A 3FSIA 1JLFA 4B3SF 1OWXA 1TR0A 1IR1A 3NCQA 3M7VA 3QAEA 4N47A 3GFYA 1RCXB 2N4CA 2NLWA 1FKPA 4NYOA 4KO0A 1DLOA 2MKCA 4RJVA 5C2CA 3J81U 4DUYF 2YX4A 1W2BR 1TZ0A 1WHYA 2JL9A 1DQAA 5KFUA 5A76A 3OJUA 4NA3A 4BWJA 4NCGA 3T1YJ 3B4DA 5EX0A 1LQ9A 2LVWA 2Z8QA 3G82B 1PJ7A 1VQSA 2KJWA 1GNKA 2W24A 3IG1B 1PSDA 5BYRA 4M5KA 4CLSA 4CDIA 2Q79A 4X4TA 4MKYA 1S0OA 4ECYA 1JLAB 1V3ZA 2R7UA 1FRHA 4ID5A 2DXFA 3DOLA 3NWGA 5U47A 2CRLA 3TA0A 2FVCA 1RT3B 4OI2A 4KV8B 2A6MA 3HULA 3POTB 1GH8A 2KFYA 2VODA 1NK6A 1UETA 3EZOA 4UOHA 1RHRB 3I4PA 1OIAA 3CT9A 3PTWA 4NLPA 4AYBD 5J1PA 3EE3A 4HL9A 2WTFA 3BSNA 1VJWA 1BE4A 4DN0A 2Y8WA 3H5UA 3TX0A 4EMDA 1RHKB 4I7FA 1RBOB 2FGCA 2XCAA 1YJ7A 2PSZA 3F0NA 1VLOA 3OFGA 3TVYA 1UP1A 5CYJA 1YJVA 3MMBB 2J7WA 3HSDA 1HMVA 1HQEB 2RVJA 1JLGB 4LIRA 5D0GA 4USIA 2XMTA 2KT5A 3EZUA 2ZD1A 2XYPB 4DOZA 5J2PB 4FXDA 2NUHA 2IM2A 2WSFC 2XLKA 2W4CA 1C1CA 1FXRA 1DTQB 3FVYA 1KFSA 4DSJA 4RW9A 1ITPA 1PBAA 2OEJA 1KEKA 2PI5A 3I0SA 1QSYA 1Q5VA 1U6ZA 4A48A 1NSQA 5E41A 4RNNA 3OLBA 1LOUA 4F50A 3I56S 2I6WA 4FYWB 5G0RB 3KG0A 3VGVA 2N7CA 3MEEB 1QTMA 4CLZA 2XS2A 4NXNJ 2V2KA 2YKNA 4LRBA 1KTQA 3WC0A 1N4LA 5J2QB 1SQEA 5AE2A 2QEXS 1RXOB 5A8WB 5BYQA 1AUDA 4HTIA 2E9TA 1RT2A 2DNZA 1Q8KA 1VISA 2V2VA 1WOPA 3OW2R 1X4DA 4UW2A 3HSJA 4C8ZA 4DSEA 5A0YA 4F3OA 4CLTA 3LQVA 3EM1A 4RBTA 1SKWA 3CCSS 1AUSL 2DNMA 2X5GA 2AKWB 3H2UB 1JKHA 3GJTB 1DTTB 2BRKA 3AQPA 4F04B 3OSPA 2EFOA 3TAMB 1TK8A 1RTZA 4FPIA 1KBRA 4NYZA 4ZPCA 3LGMA 4RUHA 1B0TA 5KFAA 4B3TF 3T41A 1X9SA 4K50A 3DU5A 3MAAB 3FBBA 2ZH8A 2H5JB 4M94A 3KK1B 3TQEA 1D9AA 3BR8A 4M8LA 1UPMB 4L74A 1XJWB 5C2GA 2KZZA 1914A 4RNFA 3ZZOA 4WU3A 4JI4J 3PJWA 2Z56B 1X5OA 4FNHA 2AU0A 4OV6A 1RHQB 2W1BA 4JV5F 2PMZD 1KOHA 1ZAVA 3E8OA 4C97A 4L6V3 2P9GA 3LANA 4LUBA 3JTNA 4P2SA 3V3LA 1WJ9A 3MDFA 4G1QB 1VLYA 2OFHX 4LF4F 2FQQB 4LIWA 1U2CA 2JDJA 2V6AA 3SDEB 3Q8RB 3QO9A 1EQMA 1VQLS 1L3KA 2LQ9A 4P2XA 1T05A 2CJAA 5C7PA 1YLXA 2HWTA 2V4RA 5J2MA 1LFPA 1HNVB 1SH2A 4N39A 1WOSA 1TL3A 2M52A 3IBCB 3FQLA 2EWHA 4J37A 1U4BA 3D5MA 3KJQB 1RAOA 2AP6A 1LWEB 3ZZYA 2X1FA 3ZZUA 4WIIA 1LWCA 2LECA 3V6JA 4LF7J 4A8FA 2B4OA 1IBMF 2VHGA 4J9PA 2AD9A 2ZH2A 1RT6A 2J8AA 2BM0A 3P45B 2EG2A 4YOEA 3CTRA 4FF4A 4R8UB 4ZS6A 1YKWA 3PO4A 4J9KA 3ISNC 2OH2A 2YNFA 1UWAA 2RS8A 2RD5C 5AXMA 1RYRA 4QU6A 3MEGA 3CDEA 3ONQA 4N7TA 3VCDA 4JI1F 4J7CA 4MK7A 3FSYA 4CH0S 1UW9A 1S12A 2B9YA 4JI6F 4J9QA 4NRTA 1YTYA 3M4XA 3LP0B 3M8QB 1YVFA 2A0FB 4DV5J 3GYGA 2J7KA 2QL5B 4LJMA 5DG9A 2B5JB 1Z1ZA 4HDGA 1LEOA 4ZVFA 2HHTA 5L39A 1T9YA 2M0GB 4EK2A 5LSRA 4N76A 3JB9k 4DI6A 4EZ9A 1WI6A 3CD5A 3PW4A 4WIQA 2DNNA 3UQSA 5D4PA 3I96A 5ETQA 4C6AA 1HYSB 1C0UA 1NHVA 2KKHA 2OPPB 4NA2A 4LFAJ 3FEXB 3HVAA 2FY8A 3R1HA 1YIJS 5G4DA 1U7IA 3RRKA 3FEZA 1JLEB 4MYTA 2RU3A 5DM7Q 1QY7A 3CJ0A 4ILRA 1S9GB 5HBMA 4HEA9 5B09A 4C3KA 1M5SA 4HHUA 1X8DA 2DNYA 2XLJA 1F5BA 1T3NA 3HPOA 3KDOA 1D1UA 2BE7D 2OMOA 2XZDB 3OTDA 2QA2A 1RHJB 1NJIT 4F2RA 1UZHA 3MECB 2MXYA 1RADB 2HHWA 2RQ4A 3DC2A 3UD4P 4DFMA 1QTNB 4C8OA 1M5KC 4PQUB 1SIWB 3KJVA 3GILA 1Q5YA 4QOTA 2M70A 2QLXA 2W01A 4J9UE 5J2MB 3CJ2A 4CTAB 3KHRA 3HVRA 3VAGA 3O6QA 4K5SA 5HN0A 1JX4A 4DDFA 5D4OA 4X66J 1CS4A 3GCWP 1X4AA 2FD2A 4USTA 4HHHA 2NSBA 3L7OA 1UVKA 4TY8B 3QRQA 2I1RA 4XIFA 1PC5A 2H9ZA 2MLYA 2HW3A 3TYTA 1M5OC 4GZ5A 4ECQA 5HMXA 3K5NA 2F4FA 1IKXA 4N56A 4O0IA 2F4VF 2J9EA 1AW0A 4CCHA 1NHKL 2D3UA 2VBWA 4YY3F 2CNOB 2VPYB 4LBIA 2GMLA 3TR5A 1VQPS 3PW5A 4DSLA 3U1NA 1RBAA 3F73A 4GKKJ 3JAMU 2KB2A 3MPDA 4OI4A 1S9EA 2KJVA 2XS5A 4QWCA 4AL5A 4DEZA 4DL4A 4F8RA 5D4NA 1DTTA 4KHMA 2DR9A 5HROA 4AY5A 2GMJA 2OEMA 3GSDA 4NI2A 5KFQA 4ED1A 2D9PA 3J81j 3UDLA 3M1VB 1N34J 3MM7A 4DV7J 4LRAA 5DG8A 5A0YB 3K59A 1U1KA 3RW6A 3PY8A 3PIOQ 4FVMA 2H3EB 3IM8A 4OIXA 4P2FA 4Q5VA 1AA1B 5JVHQ 2MB0B 1UA1A 1U7LA 2I38A 3BR9A 2VJUA 1UW4A 3C2PA 4G65A 5J2QA 2HPUA 1GMUA 2XY7A 2CQBA 3R7NB 5K14A 4Q2LA 2BOAA 2Z4PA 4L3NA 4USUA 2OELA 3Q24A 2VDIA 1UEVA 5SZTA 2JNJA 2LEAA 5AE3A 2GQQA 4MYUA 2F40A 5IFMA 2NXCA 1SJQA 3AHPA 1RDRA 3H0PA 4MK8A 4QIFA 3C8YA 1Y9OA 1DTQA 1RACB 3ZNUA 2H4YB 3W5YA 4C8LA 4DV2F 4QZVB 2DT9A 5J2PA 3BM7A 3GSIA 3BO2A 1RTJB 2RRNA 3HM9A 1ZS6A 1FF2A 2ZVIA 1EX8A 3AQOA 1MNEA 4LR8A 4I56A 2EFGA 3Q83A 4CM0A 2G0IA 5F9NA 4IOAQ 4NA1A 2W9BA 1WSVA 3PHTA 2YXLA 5GADU 2J6SA 1FWLA 2E1MC 4ZVUB 2J6UA 2COLA 4D3HA 1LK5A 4Y65A 1PGZA 2ABYA 1RCOB 3R5GA 3QGHA 3EGVA 2ALZA 2BQ3A 2HHXA 3W1YC 4EBDA 4W90B 1VQ5S 4RNOA 1IQZA 1LW2A 2DXEA 3AA9A 3NGTA 5ETMA 1ICEB 3IBFB 5L1LA 4DF8A 4DX7A 4A47A 4ELUA 2WVDA 3OL6A 3AD9C 4TN2A 4WE1A 3DOLB 5KFJA 4M5DB 4DL7A 2PIIA 1VBKA 1JLAA 1HBMA 2D1CA 4I2PB 3UDCA 4AL6A 3UNYA 4JI7F 1S76D 2WONB 4X65F 1QD1A 1VJQA 2VG6A 2M9KA 4CLKA 5KFVA 1YSJA 4F26A 3HHKA 4NCGB 1N32F 2F7VA 3LA0A 1HFEL 5H1SV 3W2WB 5I42A 4JI5F 1HR0J 1F9FA 2FZCB 3DDIA 2JLFA 1DLOB 4E8UA 2V8GA 1EKSA 2ATCB 2D69A 4UUXA 5F0WA 3ZZZA 3HO1A 2OTJS 1JLFB 4USJC 1FRIA 3R27A 1J2VA 3TAQA 3DLGA 1IKYA 1HI0P 2HRUA 3PO5A 2BJEA 2H1YA 2QC3A 3ENQA 3H90A 2KT3A 2MDAA 4KR0B 4B9SA 3M8WA 4ED2A 2F3JA 1R43A 3ILLA 4CNYA 5EHHA 2OGUA 2AZ3A 1U25A 2RF2A 3BH6B 4J9VA 5BR8F 1YWXA 2BUNA 1TK5A 2RUSA 4DQPA 5KFZA 3KMQA 3DMJA 2DIUA 3FCWA 1NKEA 1GXUA 3HFZB 3G6XA 1NDPA 1CLFA 2H54B 1RHMB 3AA8A 3IGVA 4M5GA 4GO7X 4HVZA 4QPTA 3K57A 3T5HA 2WCXA 4DL5A 2ASJA 1JLBB 2NREA 3CCLS 4OZJA 3GG1A 2Z2ZA 3DRSA 4ES2A 4K0KJ 2RS2A 1TUGB 3N5FA 3TWZA 4DL3A 1UVNA 4F0MA 2MZSA 2EC2A 2D9OA 2DGWA 1S59A 1U47A 3J7AN 1VQ4S 3W8PA 2HVHA 2G1HA 4YR3A 1ZM9A 1SJ3P 2R8JA 2EBGA 1HPZB 3KLGB 3KJNB 4N41A 3SQGB 4F4KA 5IT0A 4DFJA 1VHIA 3C16A 2VQFJ 1RT7A 4KBIA 3I9V9 1AZSA 4LSLA 2O5DA 5AXLA 3UVJB 4EWTA 5LJ3Y 1F5CA 4A8MP 1VBZA 3D68A 5DO2A 2NR0A 1FDAA 3PKMA 3PDNA 3MMJA 4ZPDA 1BHNA 1S6QB 1TMMA 3MAHA 4IFYB 4JV5J 3KLGA 1RT1B 3V4MA 3HVTB 2ZHOA 3QGGA 2R2TA 4EYIB 4KAIA 1U1MA 1U1NA 1NDLA 4FDFA 1H2TZ 3THTA 3V5RA 1KONA 3OTOJ 5B7WA 1TFYA 3HJFA 1SPBP 4OLOA 3GIIA 1N32J 4GVBA 1G7CB 2GZOA 3AXKA 1XNRJ 3OXGA 2FC9A 2CG4A 1H2VZ 1FRXA 2A2CA 4DR3F 4WFZA 1HBUB 5F8LA 3HD1A 3O5TB 3BREA 5T14A 3PW7A 1RWOB 3ADAC 2O66A 1JLQA 4DLEA 2RDIA 2ZBQA 2H48B 2HRTA 5H9EJ 3TVZA 5RUBA 1HHTP 1S6PB 2G2OA 5HLFB 1M5PC 2Y1RI 2ZBCA 3GYNA 5K8MA 3MGJA 1O0PA 4XDCA 4USVA 2W2NP 1IVZA 3KMSA 4KGXB 4IH5A 3OUYB 4X4QA 5T41A 4K4WA 3AJDA 4ZPWR 1U49A 1NDCA 2MSTA 3TZXA 2LDIA 4A8XA 2UUCF 3FC9A 2BW7A 2HQFA 2PC6A 4WXOA 1N5QA 4NEYA 4NLYA 5AJ3J 4NXNF 2B51A 4P7VA 1E6VA 2RIJA 4LRCA 2VG6B 4F4ZA 2I5JA 4KRWA 2ZJPQ 2WONA 4GC7A 2AX0A 1ZYQA 3HHLB 2IRUA 4LSNA 4ECZA 1XIQA 4QBUA 3MD1A 2B4UA 3VGSA 1S1TA 2RF2B 4P2MA 3E3XA 4NLOA 2LDYA 2C3YA 4U9RA 3RUBL 4K4YA 3UCGA 1LW2B 2XY6A 3C46A 5FDLA 4I2QB 3S6EA 3DLGB 5F3ZA 4BS2A 3BN4A 3GV7B 4RU9A 9ATCB 3RR8A 2BANB 1FK9A 2WBRA 4U7UK 4LBHA 4TQSA 1ZZFA 2UXCJ 4DN9A 5JVGQ 1UZDA 3W2WA 2K1RB 1MW7A 3PG9A 3TP2A 3D6FB 3HHDA 1HWIA 3KHLA 2JH3A 1XBWA 4YB6A 2XMVA 2FZGB 2BM1A 1S5ZA 1X4BA 2ROPA 4UZCA 2R2SA 2HKEA 1KNZA 2D7SA 1SI9A 2VBZA 3K8VA 1Q8BA 2CQ2A 3LGNA 4OZ0A 5KG7A 3DXSX 4BHQA 1REGX 3SV4A 3ZZRA 4DR7J 2G0JA 2ZH5A 2P6SA 2E5LJ 4OI1A 4IYQA 4I69A 3GYXB 4LR7A 2YH1A 4MKAA 4JYAF 1XN9A 3R5AA 4DV1F 3M6XA 2UUBF 1GFWB 2CDQA 2MZJA 4P71A 2VFUA 1O8BA 3Q89A 5IZHA 1X9MA 4AY6A 3V6HA 2NXNA 3CD7A 3EXYA 3O1LA 4O4GB 4OYOA 2E1CA 2UP1A 3HT3A 3KLFB 3GJRB 1PAUB 1GT8A 4QCLA 1YDLA 5CZXA 4B9UA 1FJCA 3SFUA 2PFDA 1S6OA 3CJ4A 3CDUA 4DSFA 1AYEA 3RBZA 3JSBA 2QSWA 4YEAA 3IWNC 1UAWA 3AOBA 4ZA1A 1UJ5A 2KXFA 4X64F 4KSEB 5HROB 3GPAA 5D8HB 1ZAXA 2UXCF 2R7XA 2QL9B 2CNLB 4ZJQA 3W5ZA 5ETRA 4AE5A 2QMWA 3CF5Q 4ZVRB 3FUYA 1HBOB 1FJ7A 3JXOA 1KQSR 2KVIA 1M1KT 5CYQB 1Q53A 4OJ3A 4RX6A 1MMLA 2VC1A 2JLEA 1RLDA 4FBUA 2D3O1 3KXDA 2BACA 1K0VA 2ATLA 3JAMY 5DETA 1Y00A 2HFUA 3NNAA 3OXLA 1IBKJ 1RT5A 1NH7A 1CS4B 3LWLA 4ZDNA 1H98A 1XEZA 1U1PA 2AJ1A 1RAIB 2XB2D 1RBLA 1OYEA 2GQ2A 4BWMA 1EZZB 1UJ4A 1NKCA 5F8IA 1S9EB 3PJXA 4FKXA 1RAJA 4ZVGA 2FC8A 4DXLA 4KY3A 3KJVB 1KVJA 4CWBA 1RZMA 1DURA 2ADBA 4IRDA 2IHR1 4RW7B 1J27A 5FLXU 1B7YB 2MKYA 3EGWB 1HA1A 2UUBJ 4B3RJ 2K4NA 1TUVA 4CLYA 3DNCA 2IJRA 4LQ9A 4TLRA 1F9EB 2FYXA 4RL1A 5HBMB 3ENVA 5D6GA 2IA6A 2VA3A 1IN0A 1OSDA 2R8KA 2J7UA 2BJ1A 3NBPB 4R5PA 1VQMS 1SC4B 4CO4A 3D1OA 3CWJA 2OPSB 4DPUA 4B3MJ 1B64A 2RRBA 2PEBA 3ZTSA 5HQMA 2HBQB 1A6LA 2GJFA 2XYGB 3V4IB 4KHPJ 1KDNA 4JI8F 5HSPA 3T5JA 3KKFA 3ZTQA 4CTAA 1XNRF 1QAXA 4DV4J 2NUUG 3M2RB 2MHNA 3MPYA 2GGPB 2RB7A 4B17A 1OMSA 4RLEA 3C15B 1WKJA 2ZE2A 4LF6F 2C28A 1FX4A 5FIIA 5IC4B 1M5VC 2OAUA 2FJAB 3A8IA 4FXVA 3CC2S 3PX4A 3AODA 3FRYA 2UUAJ 2DGUA 5KG6A 4EYHB 2OUGA 1T9WA 3K89A 5L1IA 2C2EA 4K4VA 4CLPA 1RI7A 2DR5A 4FBTA 1AXQA 4JI0J 1NB7A 3BB5A 3IR5B 4HKQA 2MHEA 3KLEA 1EP4B 3V6DB 3GQCA 2J5AA 5KFBA 1GTEA 4OI6A 1V5VA 2B7BB 3IA0A 3QWUA 4ZVHA 3TNVA 1PJ6A 3BBFA 4PUOB 4JV2A 1N54B 5BR8J 2HHQA 4ANEA 2K2PA 4LRFA 2F8EX 1RHUB 2FDNA 4HR2A 2RHSB 5HK4A 3UCUP 2RQCA 3OTCA 2KYZA 1B0PA 4PG7A 2B5JA 1H6KX 4QQBA 3NEKA 3RRHA 1H73A 4OYZA 3O2IA 1GMVA 1N34F 5K8OA 3UFCX 3C15A 3OL7A 4OJHA 2R7QA 1RWVB 2QG9B 5DS7A 1MG7A 4PG8A 5GADI 3TUPA 1N5YA 1QUPA 4TNOA 2VPZB 1RLCL 2YKMA 3NCPA 1T05B 1NJXA 3I6PA 3FBCA 3OQ2A 5D78A 3T19A 4KKOB 3CJSA 2YQ1A 2AIRB 3AB2B 1G2EA 1NLKL 3MM8A 2FVSA 4Y2KA 5A6PA 2XHWA 3MMCB 4YQWA 1CJTA 3AH6A 3KJFB 2DHHA 5A8RB 1NK7A 1WD6A 1LWCB 1YGYA 5F8NA 5GAGU 1GX6A 1Y0HA 2E7WA 3DOKA 5C5JA 2CQPA 4LVNP 1H7XA 1IKWB 3G8QA 1TL3B 1ZH5A 3C3LA 2MQQA 3HSZA 2YWHA 4XK8C 1WHWA 2HAFA 4LMZA 4MT1A 2Z2YB 3FMBA 3MUVP 1Q78A 3S7RA 1H38A 3US5A 1CSJA 1X4EA 4JYAJ 2IPOB 3QT6A 1NZAA 3SMZA 4DMZA 2ERRA 1BC6A 4FYYB 4G1QA 1KHWA 3OVAA 4GYYA 1K0TA 2EFVA 2AYGA 2B8QA 4NXMJ 4JI2J 2Z58B 3I0RA 4WP9A 1I1GA 1RSCA 1UVMA 3FK4A 2HLTA 1NHUA 4ECTA 4WF9Q 1BMQB 1LNQA 5DG7A 3R6LB 1SBRA 4C7QA 3J7YU 1EARA 4F25A 2V34A 1OY9A 5CYQA 4KFBB 4RBUA 1YJNS 1IJEB 4UTGA 3HX9A 3KK1A 4N77A 2Y1JA 1A9NB 2ZNZA 3N28A 1FDNA 4F0HA 2FLNA 2CQGA 1WC1A 2AJFE 1N0VC 1MU2B 5IC6B 3PXGa 3TQ1A 1ZTTA 3PRDA 2F9JA 4KGZB 3WIVA 3GTYX 4ZHRA 4FYXB 3H4BA 1Y3JA 2ZHBA 1WC0A 5KFEA 2E5GA 2H4WB 3I0SB 2JEIA 4NLRA 2IM3A 4DL2A 3K7RA 2CJQA 2D41A 1SJ1A 4JOUA 3ILIA 2N3LA 3DGVA 3HI9A 3KWMA 3PKYA 1L3TA 3AAWB 1WG1A 2HNYA 2AGPA 5L8RC 1XMQJ 2X3DA 3OJSA 1Y11A 3R7BB 5MAOA 4B3MF 2KG1A 1A7GE 1C0TA 3KFWX 3MM5A 3VVUA 4QW9A 3PR4A 4FS2A 5D77A 3UCZP 3CJ3A 1N6QB 3VAJA 1HWUA 2Z0GA 3MR7A 4N5SA 4Q45A 1SUQA 2XSFA 4GKJF 3H2VE 1PO6A 1TKXA 3ITWA 2KL8A 3P4UB 5KFOA 4ZCLA 2MGZB 4HI2A 4ED7A 2LXFA 5IT4A 3HHLC 2J9DA 2YQ3A 1CULB 4OFZA 3VALA 3PX6A 3M8ZA 3EMTA 4ED8A 2MZTA 4WK1A 3DHWC 2L08A 2A90A 4WU2A 4Q7AA 5IS2A 2MLXA 1LWFB 1P6TA 3TZYA 1Q7LB 1TVRB 4LFCJ 1PG5B 1REVB 3DLEA 1N48A 2MY7A 1TL5A 2ZDOA 1IBLF 2XEXA 3IG1A 4ZVOB 5I3QA 2WOMA 3CW2C 1TTHB 1MWZA 2BA9A 3G82A 4ETXA 4QIEA 4QYRA 3OMSA 5AOXB 1S4FA 4DCOB 2GHPA 3VZHA 4CNZA 2IRYA 2W2PP 2GIRA 2IYIA 3DLKA 2VZ9A 3R3TA 2QMXA 4H54A 1RAAB 4I7FB 4M5JA 1FKPB 2ZUGA 3OVSA 1NEEA 1Q0NA 3BGFA 2JZ5A 4QW8A 2PO4A 1SKRA 1ELOA 5HJXA 3UD5A 2BX6A 4ECXA 3A3NB 2QA4G 3P6YC 1T11A 2YX1A 4QIGA 1N36J 4CH7A 3ULHA 2HNZA 4UQGA 1SV5A 3DOMA 1XMBA 3GZ7A 7FDRA 2GIQA 1XNQF 4ZVQB 4MFBA 4NE9C 2DCUB 1F3FA 3M8PB 4F4AA 2MKSA 3QIDA 4K2XA 3JSRA 5ETOA 1X9WA 3T3FA 3HHLA 3BN7A 4LSNB 4OYMA 4TKTA 4B08A 5DDOC 2GAGC 1LV5A 4ZMMA 2KI2A 3PYGA 1BUXA 1T3OA 4HACA 2CJ9A 4DG1A 1R0AB 2PMHA 4DR2J 4EO8A 5D0HA 3MWBA 1K73T 1HL6A 2H5EA 3BYPA 3GFHA 2VOOA 5KFPA 1WF1A 3OUYA 3QPIA 2V0NA 3BS9A 1SXLA 4CZCA 3CCJS 1DZ5A 1N33J 3CCMS 2Y9HA 3TU3B 4QYZJ 1X5PA 2DB1A 2ZFHA 3BPSP 2B0GA 3DM2B 3VHQA 4USHA 1K1SA 3TW0A 4LREA 3WQPA 2P5VA 5E3AA 3I4HX 5D4LA 1NM2A 3D9BA 3L4BC 3W61A 4RUCA 4DV3F 2YWGA 4C8KA 1XR7A 1RABB 2JWNA 3Q8UA 3OFEA 1NUEA 3C66A 2HSEB 1NU4A 1VC5A 4X4NA 2E44A 3T1AA 1U0HB 4JI5J 2HURA 1NZ8A 4RWWA 3H8YA 3M32A 4PG5A 2FIUA 3LAMA 1MROA 2OMLA 1S1XA 3W9HA 2IAJA 1X4FA 1P1LA 2B9EA 2RQMA 3LP1A 1R0BG 3BSCA 5GAGI 2ADCA 2FHOB 4P6QA 4DL0C 4OL8A 4DUZF 1JJ4A 1PKUA 2DHAA 3C14A 2E5JA 4YY3J 1NPKA 2WSEC 1SB6A 2NZCA 2BKPA 2IC3B 4JB8B 4K5RA 5DDPC 1YK9A 2DBBA 2J0SD 2RAQA 1AFIA 1HI8A 3ITHA 3EPIA 1RT1A 5LM7E 3M32B 4L76A 2H65B 1S6QA 1ZM4A 3LPYA 4U67Q 3Q23A 4A8SA 2MTLA 1UVJA 1FTRA 2KRBA 1F1BB 1U0SA 2RU9A 1AZSB 3GONA 2DY1A 4PXBA 4LBPA 2CZ4A 1HNZF 1FJGF 2GJIA 2V4JA 3MCNA 5GVQA 3IS9B 2N7YA 1H74A 4DSKA 2HWIA 3H5YA 1VGYA 4ZVSB 2JEFA 4S0MA 4O44B 4DQIA 3ETOA 3J80Y 4YDXA 4C0HA 3VAHA 1PYTA 4FPRA 3MM6A 1VYAA 3M9OB 2DNKA 2DNQA 3DRSB 2CNKB 2FY1A 4MIBA 3HT0A 2GNKA 5ETTA 3T9NA 3W64A 5E0OA 2KG0A 4G3IA 3RU0A 3QSYB 4KTQA 4WCEQ 2C42A 1Q7YT 4ZPTR 2W2OP 3MZIA 4PEOA 4ATNA 2IJFA 5H9EK 1UVIA 4ICLA 3BO4A 1RKIA 4JUZA 1S1WA 2YQ0A 3DKDA 4PABA 4WFXA 4ER8A 2BJ9A 4IRCA 1UMJA 1SVDA 2ZKTA 5IWAJ 4PXEA 1CQNA 2PA3A 1CJVA 3QGPA 2DRAA 1FXDA 1BGXT 1JXEA 2SXLA 2MYFA 3D6MB 3I82A 3CJ8A 3IO1A 4ICLB 2Y1LB 4P52A 3FCVA 3BV8A 4BC9A 4UOGA 3X3UA 1X4GA 1JNZB 1OPZA 3KLHA 4ZPBA 2XI2A 2YY3A 3CD0A 4ZP9A 2AGQA 2MKJA 1X31C 2DD8S 2J0QD 1YJTA 2CJXB 3L7UA 2XWYA 2CJYB 2KN4A 2WOMB 5CZVA 5CYMA 2HGLA 1SIZA 2ZHAA 4J91A 4A8WA 4M5LA 3G71S 3RAXA 1KS2A 2PN6A 3VQTA 1YJRA 3CXCR 3HXMA 4W4MA 2X51A 2V4JB 2CPZA 3CSKA 1FKOB 1TL1A 2DH8A 1PC4A 2C2OB 3IM9A 4AXJA 5LSLA 5EWEA 4U8YA 3BQ0A 3T5KA 4E0DA 4WP8A 1IKVB 3MOZA 2ZITA 4C8NA 2HS0A 4ALZA 5KFTA 4XIUA 1TKXB 4Q0BA 2KTQA 3TOQA 4DJBA 4WPAA 3TAPA 8RUCA 2W9BB 5EN1A 3GR0A 3G6ES 5F8JA 2ZUAA 1CJKB 3M8YA 2GA7A 1FD2A 4F0KA 2MJUA 2JVRA 4MIAA 5ETSA 2DNRA 2DHSA 2ZJQQ 3CGIA 1F2GA 4H4MB 2Q66A 4OV1A 2CQ3A 3A8KA 4DS4A 5KT4A 2V9KA 2HIYA 2IAJB 2HMIA 2E7VA 2YKPA 4OHWA 3N4WA 3OD2A 3MEKA 1D9FA 3PFOA 3D6HB 2M4MA 4OYWA 3TA2A 5LXYA 1WDDA 2ROGA 1Y3KA 4YHHF 1URNA 3UE2A 3NG8A 1FI4A 1TQLA 4EUVA 1OY6A 1RTDB 1D9DA 5LMNJ 3LP2A 1RWMB 2PGCA 5H9FK 4RUAA 1I94J 3KK3A 3DHXA 2BJ3A 2IIHA 5J1EB 2ZH3A 4ZN1A 2QZ8A 4ZP6A 1KHVA 1VMBA 3R5DA 1PIEA 5HVHA 4OZLA 2C3UA 5E2QA 3QQCD 4U7CA 2CPIA 1FRKA 4DV5F 3RJMB 3M30A 3O3LA 3OHBA 3VGTA 2RSQA 3AOAA 1YJ9S 2AJQA 3KG1A 4HACB 3S8SA 3UN3A 3IFEA 3LF0A 4NYPA 4ZOSA 2HLUA 4U95A 3OLAA 1H2UX 1TKTB 2LMIA 2X5TA 5JUMA 4LF9J 2MPUA 4G6VB 2F1FA 2EG1A 1PYOB 4KJIA 3UNGC 1S9FA 2HNZB 5EWGA 4C98A 3NL0A 3MOJB 4DPYA 1ZAWA 4ZITA 4I6YA 4ELTA 3GWCA 1NH8A 1W7WA 2WAQD 2DGSA 5L1KA 3CUNA 1CJTB 3A1YG 3KOAA 5IT9U 3M6VA 2L41A 2CJKA 5KFKA 3ZFVA 3OT9A 2AEMA 3K5LA 4WKRA 4KGMA 3NGUA 2MKKA 2VG5B 4YR0A 1D8YA 2GHVC 2X1AA 1SC1B 2C3OA 3M8RA 3HP6A 1FFGB 4KKOA 8AT1B 2XMUA 1CJUA 1UCNA 4U8VA 2DGQA 2HHVA 1YQHA 1T9XA 2Z57B 3WDOA 2DNHA 4OJ1A 4OI3A 4Z37A 5F8MA 1REVA 1WACA 3CD6S 1TVRA 5HATA 2FFGA 4H4OB 1U1RA 5ETVA 5CQGA 4PQUA 3SIPB 5A2QU 4PWDA 3NOCA 3I87A 3A4TA 4EO6A 2YNGB 2HQ3A 5KT3A 4OX9J 4K4ZA 3JTPA 1SC6A 2ZM6J 4JI1J 5BYSA 3A3OB 1S48A 3AT1B 5HP1B 1S9GA 3HF5A 2XMAA 4M95A 3KTQA 5I4MA 4PUOA 2OFGX 1QE1A 2V63A 1M90T 3QZ8A 1R0CB 2M5YA 3S1TA 4E2FB 4G1PA 3VV2B 3Q86A 1WUUA 3GV8B 4RR5A 3W7BA 1N6QA 5I3UB 1RA7A 2MQ8A 1X0FA 2DR6A 1XMQF 1A0OB 5HP1A 1JMTA 4I68A 4JI3J 4FF2A 1XR5A 2GS8A 4GMKA 5K8NA 2R42A 3UR0A 1N88A 1TELA 1DAXA 4J9RA 1EETA 1RUSA 2YNGA 5KFNA 2QFIA 4P74A 2ZBRA 3CJ5A 3M8QA 2OI2A 1WTFA 4H4OA 3LP0A 3CJKB 3BDPA 4ECUA 2UU9J 3HKZD 5BNWA 2JSXA 2BDPA 4K0KF 1JJCB 3ZC4A 2E7XA 3AB4B 1QUVA 1IUJA 2QYGA 3MD3A 4USMA 4DQQA 4KFBA 2KZMA 3SSSA 2E1RA 1QSLA 4KYZA 1R31A 3NBPA 2DRDA 3PW0A 2CPHA 2H5IB 2UUWA 3PCOB 3TUZC 1T8EA 4HDHA 4Y34A 2HFZA 8ATCB 5F8HA 4J9SA 1NMEB 1WWHA 3VF0B 3IBWA 4ZLPA 5EDWA 1RTHB 3D3BJ 2OP5A 2BKNA 3QLHA 1JIHA 5M2UA 2XSJA 4DV6J 5HVGA 3IC1A 2XMJA 3QBCA 1RQ0A 2YH0A 1C2PA 2ACYA 4UYKA 4ID8A 1OO0B 2BR0A 3VQSA 3NY0A 2Q3PA 3KG4A 2NCKL 2WK4A 2WB1D 4HHJA 3ZTOA 4AT1B 3G6YA 1VQ8S 2C2RA 2UVUA 1KN6A 2R8GA 3P49B 4WBFA 3QO9B 2HAIA 3PACA 2XSJB 4FYVB 1RT5B 3DOKB 3QLHB 3LWMA 1Q8LA 1AB8A 1RTHA 2DCLA 4C2MA 3J7Z5 5KFMA 1NKBA 3MTKA 1KLNA 3EGZA 2BXJA 5A8RA 4U7UD 3G6VA 4LVOP 2EI5A 4C8MA 3FDSA 2GAHC 3OL9A 2GCFA 2E9ZA 2MQLA 4RKUC 1FFSB 4H4KA 1GXTA 1WORA 2WHOA 4CLWA 3LP2B 5DQIA 4PG6A 2HS3A 1NSPA 1RU1A 4TY9A 2BOPA 3IAS9 3OV7A 1I94F 1QVFR 3OVBA 3TUJC 2XQCA 2A3JA 3CO0P 2IDLA 2ASYA 3TAMA 1RWNB 4MMOA 4URSA 4XAKA 1N5YB 1JKHB 3CJKA 3D0IE 2CADA 5EWFA 2KJZA 2FHMA 3GG0A 3QWPA 1GEHA 3BYRA 4PR6A 2FVPA 3R2CJ 1VK8A 3G96A 3D54A 2LEPA 2GQCA 3ZO7A 4CT8A 1VQ6S 1H72C 2GC8A 2QN6B 3GE9A 4H4MA 4USWA 4DU7A 6AT1B 5AE1A 5FLXY 1S77D 4F67A 1UPPA 2DNPA 2C3MA 1R6YA 4CP5A 2DH7A 3NGKA 1CJKA 4HH1A 2XS7A 1FWPA 1R89A 4O3PA 2OTLS 1HNWF 3T6JA 2CWKA 5KT6A 2K3IA 3EWGA 3SYZA 2MQPA 1KVIA 3MUMP 2ZBIA 2CZVC 4DX6A 2IVYA 1XMOJ 4F36A 4OLPA 3NS7B 3R9LA 1FE0A 1NPPA 2BMBA 2XULA 2QLBB 4OZNA 5A8KB 3SI8A 1U45A 2KDOA 4UOCA 4M63A 5EX3A 5GAEU 1HKAA 1XC9A 5DZ7A 2VONA 4RW9B 2QYCA 4PWDB 1FKOA 1TL1B 2ZE2B 1C1CB 5FD1A 1B99A 4GZ6A 1LK7A 5E3PA 2F8MA 2VPWB 3MF5A 2WVCA 3QT5A 2FLOA 3VAKA 2A6OA 2KM8B 2C3PA 3KNAA 2N4DA 3A3PB 1HQEA 1QJHA 5KFYA 4IKAA 3V4IA 2HBZB 3I5AA 1CJUB 3JSMA 5J2NA 3ILJA 3IRWP 2GVZB 5GMEA 2WRMA 3G9CA 3BPDA 3C6UB 2YTCA 3H5SA 3WZ0A 4R5PB 2JLGA 5L1JA 4GYWA 5D3GA 4NOHA 2VFRA 2G4BA 2U1AA 1WC3A 2ZVSA 3C6TB 2X3GA 1V5IB 1S7IA 1F0XA 3PYFA 3A12A 3MMAB 3VR1A 1RAFB 4DPWA 3CPWR 4ZCKA 1WHXA 1IQTA 1N52B 2ZBPA 3NS6A 1R8PA 3OHAA 2I9SA 2RDJA 4QYZK 4RNHA 3POTA 3CEDA 4X62J 2HIQA 2VV5A 3ZTRA 3IWLA 1DQ8A 4DQSA 2CVIA 2NSCA 1EJ7L 4ENOA 4CO2A 2K7KA 1M1GA 3NXZA 4BBYA 3EVOA 5DLFA 4QR1A 4ECSA 2GX8A 1V6HA 4C3MA 3DCAA 2HVDA 5T7LA 4Q8EA 3P3DA 4MK9A 5KFIA 4C11B 2IM0A 2QA4S 2QFJA 4I6WA 2HQIA 2X7IA 1YHQS 2G0CA 1RKJA 4JI7J 1U6FA 3SBMA 2F8HA 4RO0A 4LF8J 3HD2A 4OJGA 1LXJA 3EX7B 4JBCA 4M5HA 3MM6B 1B3TA 2B3TB 2XMWA 4GVLA 4Y2IA 3R5BA 4ANDA 4CLLA 2DH9A 4NLQA 4RW4A 2I2YA 1MN7A 2GO8A 2KT2A 3E01A 4QU7A 2KXHA 2OEKA 1XNQJ 4N3AA 4KH1B 1RE1B 1Y10A 2E5HA 2QO3A 2UXDJ 1X60A 1RTDA 2J0WA 3GFXA 2VH7A 2CJBA 2DEJA 2P6TA 1H0HB 2R7VA 3RZAA 1JJHA 1RK8A 3ETMA 1IR2A 1RT4B 2MSSA 1VDHA 2B8PA 2X1BA 5ETKA 3HHNB 1FRMA 3RW7A 3ENAA 2R4FA 4AXIA 3RB4A 4DLGA 3UW1A 4XTTA 1DRZA 4WYLA 1AROP 2IFXA 2B6AA 5D0RA 1MWYA 4LF6J 1TFWA 2AYEA 2YKQA 3BGRB 3OFHA 3D6TB 3C14B 1FNOA 5ETNA 1VQKS 3TEGA 3W63A 4WFBQ 3W2VB 3ZZ0A 1XWLA 4Q44A 3BDEA 3GCXP 3DDKA 4UOFA 1Q16B 1S1XB 2PDAA 4O4GA 4OHZA 5M2RA 4Z7CA 3V81B 2ALYB 4ILMA 2X5HA 2MEWA 1HQUA 1UEKA 4Y00A 4HYKA 2DEIA 1Y5IB 1VRQC 1FCAA 2KO1A 3PYDA 3QMQA 5ADZA 4LQ3A 1F9HA 1NXIA 1PJ5A 3D0HE 4DR7F 1QAYA 2BJDA 3FGVA 3SQGA 4YDDB 2YPZA 1SJRA 1HPZA 3KUHA 2ACMA 3GU0A 3PYEA 2X1GA 3R6GB 4X64J 3TJAA 3FZ2A 2P9EA 1FRLA 4FVCA 2DK6A 4LT6A 1YX2A 2IDEA 3MPWA 5CYMB 4KPYA 3SCIE 1K1QA 3KDNA 4X62F 2UVVA 5H9FJ 2YKAA 3UO0A 1K8AT 2B7CB 2ZH4A 4DFPA 4B3OB 2BABA 2LU2A 2W4DA 1UVLA 1G1XA 3UI3A 2B43A 2AW0A 2FLLA 3KLHB 1NB2A 2AV5A 2MQOA 4QWDA 5D15A 2XC9A 3M9NB 1KD1T 4W98A 1DY3A 1NRKA 1JXVA 4I2QA 4WXWA 1CJVB 4LRDA 1NDKA 3CCWA 2AYMA 3PFEA 4C3LA 3CDAA 1TL4A 5GAHI 2BJ8A 1Q79A 3RBEA 3DLHA 1VCTA 5E7OB 2RJZA 2UXBJ 2R9LA 3UN5A 1S1WB 3CCES 1T03A 1S1TB 1EIYB 2DRBA 4LF7F 1IKYB 3T1HJ 2D3OR 3D3CJ 3QRRA 4OZ1A 4PXCA 1R8AA 3QFHA 4NASA 4Y6IA 1KFDA 4CO3A 1VBXA 3EVMA 2W8KA 1FO1A 3U1MA 4LF1A 4I1TA 3TUIC 4DPOA 4QWAA 3FCHA 3I55S 4CH1A 3PRVA 3QATA 2IBKA 2LFVA 2CQ1A 3D1HA 3CCZA 4M5DA 3SEOA 1CC7A 4JI3F 1NCLA 3EUNA 1ZPWX 4WFAQ 1XMOF 1S6PA 3HFKA 3HHLD 3MCSA 4KE5A 1U2FA 1LFWA 1NAQA 1SH0A 2A10A 5K5MA 1N56A 5E3RA 2HHPA 1HNXF 4O3SA 1UJ6A 3EDRB 1QM9A 3PEJA 3KLFA 4W92B 2VQFF 1SUQB 3V81A 2XLIA 1R6VA 2M8DB 3OR2A 2CQ0A 4UYJA 2K8GA 2W25A 5GAHU 2NZ4A 3THPA 2EVZA 2HQCA 3W2VA 1C0TB 1QVGR 1HNIA 4NXMF 4PG4A 4RZRA 1TU0B 3C19A 1IM4A 3G86A 1SKUB 2RHQB 4F7VA 2DHXA 2HFOA 3PRBA 3QJPA 4NLVA 4Y0FA 2GV1A 2C2DA 4PXDA 3HVTA 2RUGA 2DPJA 2POKA 2FJBB 3DI6A 3BZQA 3W5XA 4TXSA 2YBVA 3CMQA 3NAHA 3T6BA 2R2UA 3F41A 2YWFA 5C24A 1MU2A 3SCJE 4DBQA 2DITA 4LSLB 1QMOE 3TJ8A 3N6NA 4Q43A 1L5UA 2CPYA 2XTJP 2KHDA 4IG3A 4A8OA 1UEUA 1BWEA 5GMDA 4DS5A 2V2QA 1P9QC 1Z2ZA 3DM2A 3M6WA 1EKRA 3TX8A 1W26A 4K7QA 4X84A 1FHTA 3EVWA 4WP3A 2HHUA 1L3SA 2FHJA 1ACMB 2WVBA 3R5JB 3RB3A 4BDPA 3GP9A 5IXUA 2FVRA 3MR6A 5KFXA 1TL7A 3N6MA 3MCMA 4ED6A 1OSCA 3CCUS 1JLBA 4IR1A 1Y4ZB 3M1VA 1VHFA 1K44A 2VPXB 3BGOP 2HZVA 3MXHP 1PYSB 1T0TV 1QSSA 4FNIA 3CB4A 4N3BA 2DO4A 1TAQA 3U7JA 2LA6A 4LFBF 5A2QY 1CG2A 4OYBA 1JXLA 3JTOA 3SCLE 3KHHA 4MFBB 1IKWA 4NPOA 1IWGA 4UYKB 2VFVA 2QGFB 1KVKA 4XO0A 4OHVA 3W3SA 1KLMB 4OI0A 1BQMB 3IP0A 3U27A 1RYSA 3SSRA 4GKJJ 2VICA 2XMMA 3MMCA 2OPRB 1I5OB 2GIFA 4A8KA 2L3MA 2VBYA 5DGAA 5D3GB 1TMJA 1RB0A 1IBCB 1XQIA 1YZ7A 2Y0SD 3AY0A 1JK9B 3C6UA 3OFFA 5F9LA 1X4CA 5I42B 3CNQP 2WW4A 1AT1B 1FESA 2GVZA 3LO3A 4P75A 3PV8A 4PRFA 2XNRA 5AOXA 2HZCA 2Z30B 4FN5A 1E8OA 3RR7A 3JQMA 1RWPB 4I64A 2ZWOA 1HBMB 4I2PA 2VL1A 1B70B 2VFSA 1V3RA 2VG7A 2KU7A 1R27B 2BRLA 3TO8A 1LXNA 4CI0B 5D0EA 1LWFA 3KUEA 3BQ2A 3QJJA 2N3OA 3TANA 3QT8A 2VA2A 2BJ7A 4J5OA 2B9WA 2C1EB 3O8WA 1CULA 2YNHB 2EK6A 3D0GE 3R5CA 4DR4F 4PWUA 4PYAA 2HRYA 4CO0A 2MGZA 1CEZA 2FTRA 4ZPVR 2ZC4A 4ZCIA 3NMAA 3L9ZA 4KGKA 2K3KA 4DV1J 4UQTA 3M6UA 5L9XA 1FEHA 1O6XA 2AJ4A 2FB0A 1B0VA 2O3DA 3VWSA 3KLEB 4F02A 3EGNA 4DX8H 4I67A 5KFLA 1VRUA 1HD1A 4IG0A 4WKYA 2GJ2A 4JI0F 1Y7PA 1E6YA 5GMKa 2ZZNA 4F4WA 1B7FA 2EPIA 3UDEA 4HT7A 2MZQA 3NKYA 3CE8A 5IOLA 3W60A 1EB0A 2PD1A 5CH7B 3G8TA 4GC6A 3HFVA 4EEYA 1SJ4P 3TAXA 3KK2A 2EW9A 3M2RA 2KM8C 1VIXA 4MAKA 5HI7A 4OQJA 1X4HA 2DTJA 2UZAA 3BBBA 4WZMA 1J5OB 2Q6CA 5HJYA 1ZETA 3NGDA 5B0BA 3BSAA 1ZM3A 3W9JA 3CMES 5LXRA 3NAIA 4CYUA 2YX7A 4F4YA 2JEGA 4P7TA 2HFNA 4KC5A 4CLUA 5KG4A 2R3VA 5CABA 5M2PA 2AX1A 3CDWA 4CO5A 1RT6B 3BBCA 4X4PA 4J9LA 4NX9A 4DZDA 4PCQA 4TYBA 4DR6J 1OS5A 4IFVB 4TQRA 3PE3A 2UUTA 3IXQA 3SQOP 4B9VA 1UA0A 3LH2S 4LR9A 2MQMA 1HNVA 2MY8A 2G13A 2HHHF 2WVFA 1W2IA 1S72S 3TEHB 1WI8A 4YR2A 2R7RA 4Y3CA 4RW8B 5F0UA 1KWMA 5IQQA 4DUYJ 1NK4A 2MLZA 3FZBA 4IFVA 2J9DE 4QIWD 2HHSA 2APOA 2JHEA 2V8DA 3TJ9A 2CPEA 2CQ4A 2J8SA 4N8NA 4FF3A 3D7SB 3OPKA 3R2DJ 2CAJA 4WJBA 2LA4A 4KHPF 3F56A 2OD4A 1UFLA 3H42A 3IR7B 2N82B 3OXFA 3CC4S 2NXEA 2M8HA 1GXLA 3GJSB 3IGNA 4YHHJ 4RNMA 2YWWA 2MZ1A 4TU8A 1P1TA 3ISZA 2HGMA 2YKMB 4IO9Q 1FKAF 4UY85 5B0DA 3K5MA 3KK2B 3UN2A 3QRPA 5SUHA 2UVWA 2W4PA 1TUWA 4PPDA 3E2EA 1X0PA 4DV2J 1QAIA 3NLCA 3MECA 1EETB 2QV6A 1HHSA 2L9NA 4MTPA 4LF8F 2EXUA 4K8RA 1KRPA 4YUDA 1WOOA 2DPIA 4IG0B 4L72B 3M05A 4PYDA 2IYGA 2WB4A 5I3UA 3W65A 1RP5A 2ZZMA 1HW8A 2EKNA 1V3SA 1C0UB 2OPPA 4CYUB 4LF2A 3RAQA 1ZTWA 2HWHA 2YNIA 3MEEA 3U1LA 1HYSA 5G0RA 3VTIA 4CT9A 5C1DA 2VU5A 3DYAB 4P73A 4YB1P 1NPRA 4OX8A 1DBDA 2CFXA 3DN9A 4G1IA 1ROFA 1SJFA 1SL1A 3CULA 5A6WA 1CVJA 4OHXA 1FERA 2WSCC 3MI7X 2FLPA 2AZ1A 4DL6A 2Y1IA 1FNMA 3R8YA 2RH3A 2ASDA 3FQKA 3CDBA 2VG7B 3QT7A 3SZ2A 1VQYA 2PMWA 2ZD1B 1E6YB 1KC8T 1FTCA 3CC7S 1JLGA 2EK1A 2RMLA 3CCTA 1O5JA 3IAM9 3LTOA 2CPXA 1VR6A 1VI7A 2QX0A 4OHYA 3PW2A 2FJXA 2LU1A 2YNFB 2YPYA 4L3KA 2OPSA 4R25A 5F41A 4UZBA 2C2NA 2VG5A 2AHOB 3ISND 3MTJA 4MJKA 4BC7A 2J9CA 1FK9B 3GFZA 2V94A 5HANA 2VQEJ 1X4RA 1PAEX 1S6UA 4U96A 1P9YA 1MLAA 2O1PA 3AOCA 2HQDA 4XPCA 1TKDA 1RAHB 3N9UC 1LWEA 3S01A 2OPQA 3A8JA 2EBEA 1UFKA 5DLGA 2P8IA 4ECRA 2W9JA 5CD4H 2LLZA 1ZA1B 1T9VA 1GQEA 3JS9A 3J81Y 1TKTA 3PE4A 3OL8A 3BEGB 4EZ6A 3JSYA 4O3RA 3AFGA 5ETLA 2XO6A 1JQGA 2XNQA 3BQ1A 1I6JA 4M5MA 1KKHA 1WHVA 2D74B 3AJ2A 3LPEA 3SDEA 4F3QA 4WTOB 3BKFA 5HQ8A 1OQ3A 3M30B 2ZJRQ 2ZH1A 3HLUA 1S0NA 1IXKA 1VQ9S 4Y2MA 5HVFA 1NSKL 1U2RA 3ENWA 2DR7A 1LKZA 3EDQB 4HT5A 3Q8QB 4AFFA 3BH7B 1WDTA 2DGOA 3P96A 3BT3A 1BQMA 2QTWA 4NZ0A 1JWWA 1FDBA 2AEFA 2UV8G 3KK3B 2BVZA 5HLFA 2UXBF 3N6LA 1R7IA 2LQ8A 2DY9A 2JC1A 2PT0A 4QIVA 5KG0A 4DV7F 1JLQB 1WKKA 2J0XA 2DVIA 2G2ZA 2CVEA 1HBUA 2XMKA 3FBFA 2LP4A 4K59A 3MFHA 4NCBA 2LCWA 4B9NA 3MPUB 2O67A 1F5AA 4NRUA 1TL7B 5E3QA 5BXIA 4EU0A 2HFSA 2QMUB 5DZ6A 3V2UC 1RJJA 5LMUJ 1K9MT 2NQPA 4C4WA 4DV6F 1RT2B 2E29A 2RKIA 1HNIB 3I5CA 4ES3A 4ZK7M 1HWKA 1MMDA 5A8WA 4JI6J 1G4CA 4X4VA 2NS1B 4DUTA 2HBYB 4B3SJ 3OR2B 1U8SA 4P72A 4IFYA 2W7OA 2EFPA 2V4QA 4IR9A 4ZIVA 2VQEF 1HIYA 3BGUA 4NZ7A 1NK8A 5C24B 2HS4A 3CIZA 2CQHA 4DR5F 4B3TJ 2BE2B 1RISA 3HCXA 4UY8T 2BYCA 2NPIA 5K9FA 5LT5A 3DRPA 2JFDA 4P10A 3DI6B 1FVSA 5THWA 3M9MB 4K4TA 3V6KA 1VQNS 1F60B 3ZXWA 5DJBA 4IOCQ 2HMIB 1C4CA 1HBNB 2W7PA 3NRBA 3VCXA 3B82A 1WC4A 2IMOA 3GIJA 4NLUA 4RU2A 3RAMA 2LQ5A 1HWLA 1R8CA 2DHGA 2QRRA 3IWXA 1ZM2A 1G6BA 1H3DA 1WC6A 3NGSA 3NGRA 4FZVA 3U02A 4ETZA 4OZ3A 2QL7B 2JEJA 2P9CA 1S0VA 5L38A 1YITS 2I8EA 2K1RA 2CNNB 2HNDA 2NXJA 1X5SA 2B4PA 4DUZJ 3MUTP 1S1VA 2ROEA 2VASA 3CO9A 3R97A 1ZPVA 3TZWA 5F8GA 3T9ZA 3RB0A 1D0EA 1RWKB 1UTAA 5HMYA 4DR5J 1PILA 4LSZB 2HQGA 1T9UA 4CDRA 3DRRB 4GZ3A 3HZGA 1VOMA 5B0AA 3EXCX 5C42A 1T03B 4B9LA 3MR2A 1N36F 4KV8A 4MKVA 5CCMA 5LOQA 3OSNA 3CJQA 5DM6Q 5IT9Y 2BBEA 2XZWA 2JJ4D 2R8IA 3SV3A 4IDKA 4CQ1A 2I5JB 4EFAC 3T1YF 2C22A 2XYHB 1S1UB 3NNHA 4I0WA 3WBZA 1L3VA 4LF9F 1N5VA 2V68A 1X7VA 1HI1A 2CUYA 2FJEB 4PQAA 1WELA 3GV5B 1WG4A 2AGOA 1SL2A 2J6TA 4YB7A 1S1UA 1S97A 4X4UA 4IDKB 1SQFA 3A8EA 3SFGA 2UV8A 5KT2A 2ILZA 3H25A 2FJWA 3MM9A 1YRXA 4I4BA 4YB5A 4WE1B 4ITSA 4GRSA 4RPFA 4RW7A 4ES1A 2W7AA 3VAFA 2IVMA 6FDRA 2V8VA 3NCRA 3Q2SC 5DQGA 3B78A 2KVQE 2DNLA 1IBMJ 3PEHA 2F9DA 4XPEA 3HDSA 3DLJA 3WX4A 2Z2LA 3DRXA 2KFNA 2VUGA 2ZDPA 4FS1A 2ZNYA 4K4SA 1M0SA 5KT5A 1V9OA 3X1LB 3FKBA 3ILOA 1IM6A 4WWSA 2XO7A 1S1VB 2HG4A 1NK0A 1FJEB 3IR6B 3ITHB 2BV3A 1YJUA 4RWXA 2HVZA 2MMYA 3AD8C 4GVBB 1BLUA 4YS2A 3DXBA 2ZOGA 1R8BA 3NP5A 3PJ9A 1RTJA 2ZKUA 1DARA 1TP7A 3BGRA 5I3PA 1CPZA 3CCQS 2VDHA 1Q95G 1CC8A 1P27B 2VC0A 1HBNA 5JJBA 2RSFA 2XGQA 3VAIA 1CBKA 1MROB 2ILYA 1WNEA 3OTEA 3T1HF 3Q22A 4ZN3A 3EZ5A 3DRPB 3WHIA 1RT4A 2GO9A 2B9XA 2IY5B 1HNZJ 4E98A 1FJGJ 2LKZA 3PHEA 4LF4J 3JYTA 2UVRA 1D8ZA 2CZ9A 1U26A 4O3QA 5L46A 2O01C 5K14B 4LFAF 2XG8A 3C16B 3K5PA 4Y2AA 2NYHA 4O3OA 5B08A 4WFNQ 3Q0AA 1S57A 3OBIA 2FJDB 2LXUA 5L9NA 2UUAF 2CPJA 2F63A 4TYAA 3W8GA 3TARA 3TA1A 1IJFB 2OLWA 4C0OC 2R7TA 4FP9A 4KPCA 4RW4B 2LEBA 1TK0A 3EICA 1U1QA 1BQXA 5KT7A 4B02A 4ZVEA 3MHYA 4IO1A 1YG0A 1NK9A 1UKUA 2B6AB 1GAOA 2HYIB 5CCLA 2M2BA 3BGLA 1QLNA 2RQKA 3MURP 1X5TA 1YBTA 3FSXA 2JFKA 4C11A 4J9MA 3P5TL 4NI2B 5T7LB 4IH6A 5FJ4A 2Q43A 5KG2A 2BZ2A 3L09A 4KQZA 2JRSA 4DWIA 5IWAF 3N5BA 4L73A 2M88A 2V67A 2EFNA 3L95X 3M8PA 1RU2A 4PAAA 3NOGA 4AUKA 4IUFA 2WZ1A 2P2CB 3TRGA 1SV5B 3DOMB 2GFFA 2DO0A 1RAGB 2IJNA 3VAMA 3DLBA 5LMNF 3NNCA 4O0NA 4RW6A 3C6TA 4M5IA 2RE1A 2F4VJ 2HHHJ 2G2YA 1N33F 4TY8A 4O3NA 2BW2A 2J76E 4J9NA 3DLKB 4NLGA 5MLCV 4AQYF 2DNGA 1OQ6A 3J80U 3QZ7A 5J2NB 3JSMB 3H98A 3GIKA 3THVA 2XCPA 1NO8A 3PNIA 4NWBA 4DV4F 4F3MA 4DV0J 1XK8A 4MKBA 5AJ3F 4Q8FA 3M2VB 3D67A 3DLEB 4ZP7A 2GHWA 4ECWA 3SSQA 2M3DA 2PEHA 1BXNA 1IR0A 2QT7A 5KFCA 4NCAA 2PI4A 4C9DA 1UJRA 3B4MA 4NLWA 1NSAA 1T95A 2OPQB 1KTVA 3TVKA 3DGPA 1DQ9A 4IOBA 3FFIA 2V9WA 4P9SA 1S7HA 1HARA 2HGNA 3MMAA 1GX5A 5A8KA 4K4UA 1GMWA 2RDDA 2EKYA 2XI3A 3EJMA 3ZNJ1 4IRKA 7AT1B 4ZKAA 4DU8A 3HK2A 1JLEA 1DHMA 1ZBTA 3IMQJ 5B0GA 4X4SA 2CA9A 3QNWB 1BWVA 1HNXJ 5GAEI 4FYDA 5IM0A 2E9RX 2W2MP 4DFKA 1VBYA 3MM5B 2XGPA 3O44A 4K2JA 2F5GA 5LSOA 1UL3A 2QE5A 2AMCB 1U24A 4CO1A 2MJNA 2HNYB 1C1BB 2ZH7A 4DR1F 4TU9A 5B0FA 4URQU
chains in the Genus database with same CATH topology
1WF2A 3QIPA 4X4OA 3GB0A 3OTBA 4URGA 2OJ3A 2QSFA 3MR5A 4O4RA 4F4XA 4ZHRB 2HVIA 1RA6A 2RRAA 1KOOA 4R0EA 1J5OA 3DYAA 2KH9A 3D2WA 3DLLQ 3OR1A 2YNIB 3N01A 1T02A 4DHVA 3M2UA 1YI2S 1WEYA 3DFEA 3FEYB 1UWBB 4WK3A 4C0BA 3RBDA 5KFDA 4JI4F 3RTVA 1FDDA 4M1KA 1BQNA 5E33A 5KG3A 2VBXA 3I0RB 2AJ0A 5BJRA 3MR3A 3EPGA 2Q1LA 6FD1A 3MM7B 4JV0A 2B4VA 2MZRA 1VC0A 2L48A 2EFQA 2YWEA 4ZPAA 1WTBA 2DGTA 2GMHA 2PFFB 2VKZG 3J7A1 4AKXB 1C4AA 5LJ5Y 1HW9A 3L3CA 3KLVA 4KT0C 3FMWA 3SK1A 3MEDA 4WZQA 2EC0A 3I9ZA 3FJ2A 2KRRA 3QYYA 2OSQA 3H20A 2ZC3A 3N79A 2QIFA 1IKXB 1N0UA 2KFZA 1FRJA 4B9TA 2I0XA 1FT8A 3T5LA 3E51A 3HKWA 3IRXA 2DISA 2V5HG 1R3NA 2IBOA 3MM8B 3BSOA 3F44A 2A18A 2Z2MA 4N8OA 4QWBA 1Y5NB 1YRTA 3CMAS 4DQRA 4RW8A 4NZ6A 1MSWD 4OMFG 3R1LA 2CIMA 1VC6A 4ED0A 2W9AA 4OX9F 1O51A 3RB6A 4X2BA 1W25A 2YVSA 4V19J 3KNGA 2DGVA 4RBVA 1BY9A 3J7YI 4ELVA 3K5OA 4QJVA 5HL7Q 5KFWA 1T94A 4ED3A 4IH7A 2WW8A 2U2FA 1BQNB 3G8SA 1U1OA 4DR6F 4ED5A 3H2LA 1FEEA 4I6AA 4YFUA 1UWBA 5J1NA 1Q8IA 2FHKA 2NPFA 1RWUA 1EP4A 3V6DA 1NJZA 2KHCA 2G1DA 1QE1B 1FVQA 4AL7A 4F2SA 2XY5A 1Z2LA 4YMEA 4EGLA 1UFWA 4WYWA 3FNNA 3UD3P 4C8YA 3PIPQ 1KQGB 5KG1A 1XR6A 3IN5A 3QIPB 4MIWA 1Q82T 2JC0A 2GGPA 1U1LA 3HZEA 3TI0A 2R7WA 4WTYA 3B8HA 1HMVB 3MEGB 3UR3C 1FD8A 5KOWA 4YP3A 2KFYA 2L9DA 1VRUB 4OZ5A 1HWJA 5DRKA 2PA8D 3K8WA 4HLBA 1Q1KA 4DR2F 1KQKA 3M8SA 5KFGA 1YJWS 1MMNA 2Q6BA 4Q2MA 2AQ4A 3WC2A 4GO5X 3HHEA 4R8UA 2CQDA 2E66A 4NLXA 1APSA 5DDRC 1L3UA 2VOPA 3RYLA 1AFJA 2YNHA 4UUWA 1KQFB 4OX6A 4BCAA 1JJ2R 2AF6A 4B9MA 4EBEA 2DGXA 2K7JA 2RNEA 1VFJA 3K0JA 3UWTA 3MAQA 1RT3A 5LMUF 2DJWA 2CQIA 5DGBA 4QR0A 4Y28C 2R2RA 4NLSA 2DNOA 3M2VA 3BJYA 2E1AA 1E8OB 3CCVS 4LFCF 3PM9A 3H40A 2MKIA 4ZP8A 4A46A 2LQBA 3Q8PB 1WEZA 1G3OA 3Q8SB 1S79A 3I32A 3IRXB 4KO0B 2W8LA 1VQ7S 1DFDA 1KSPA 4NLTA 2JOQA 2OPRA 3DDNA 1HD0A 4HI1A 2RT3A 4RW6B 1UVMA 2JVOA 1XTZA 4TU7A 3PX0A 1KLMA 5B0EA 5CA5A 5J1EA 3K58A 2E5LF 3PZPA 3KHGA 2FUG9 1HBOA 4B3RF 4UYKA 4EBCA 4DF4A 3LAKA 1SKSA 1RTIA 3D1QA 3GMGA 3MEDB 2KYXA 2JX2A 2RILA 2DIVA 5E5NA 1U09A 2R7OA 2FPHX 5CHCB 4DQPA 4ZCMA 5JXSA 2CKWA 2L9WA 5C25A 4QWEA 2CPDA 3KYLA 2R7SA 3PVXA 2NXUA 7FD1A 1VS3A 3NS5A 5F3TA 3GR1A 4KHRA 2IM1A 2PE8A 4DSIA 3L7PA 3HMJG 2D3ZA 3VZIA 4QR2A 1S49A 2ASLA 2BQUA 1FA0A 2IA0A 2X1AA 4PKDB 3SXLA 3M2UB 2ZOFA 5KG5A 1FXLA 1R8HA 2YKNB 3DRYA 2MQNA 2WBMA 3K2YA 3OR1B 4IG3B 2A2DA 4JV1A 2B56A 1OPIA 3LUYA 3JYTB 2ZH9A 3SCKE 1IKVA 4TLQA 5B0CA 3G4SS 1LW0A 2KXNB 5KFRA 3Q2TC 1NJWA 3I5BA 3NMRA 1KR4A 3GIMA 1SH3A 4FXWA 1URRA 1S10A 4Y2CA 1C1BA 1S99A 5CXTA 1WG5A 1D3WA 4R0JA 1VRTA 1YRUA 3ZZTA 4DV0F 3MMBA 3MPVA 5KFHA 3EYZA 2BQRA 1NK5A 1N5SA 5IM0B 1IBKF 1U6BA 4UYJB 2OD6A 2MKHA 1Q4RA 2W9CB 4IQMA 4ILLA 4Q0BB 5IQ6A 3DU6A 5EUHA 4HTJA 1H7WA 2BANA 5ITHA 4X62F 4H4KC 3KLFB 3MFIA 5KAKA 1Z4UA 5K8PA 4A8YA 1FNXH 3FFIB 2OKQA 5FDLB 1P8GA 2DR8A 1Y5LB 1TKZA 1VIOA 4KIAA 3D28A 3H59A 3PR5B 4RW7B 2FGOA 4NMLA 2DK2A 1JLCA 4N3CA 2VD3A 2E5IA 3CVKA 3HVWA 3MM9B 3QAUA 4ID5B 4OX7A 5HMZA 2AYBA 2AWZA 2XWXA 3N0VA 5EGYA 1Q86T 2FJVA 1E6VB 1YBAA 3ZZPA 2FHJD 3UPFA 1FE4A 4XDDA 4X4RA 4GKKF 4NLDA 1U48A 4WFYA 2GW8A 4IQXA 4A8QA 1JNRB 2M7SA 5DDQC 1M5HA 5LL6d 5E3CA 1BD6A 1JLCB 1WF0A 3IS9A 3CCRS 1T7PA 1RGVA 2CPFA 2QA1A 1VK3A 5AXNA 1TKZB 3I31A 4QPXA 4CIOA 5C42B 3LALA 4D3GA 2ZOMA 3DRRA 4X66F 5KFFA 3FRZA 1QAJA 4HH0A 4JI2F 1NNDA 2W9CA 3CIMA 2NYIA 4A4JA 2VFTA 3ICLA 2HNDB 3H4DA 4B3OA 1GTHA 5HMWA 1SL0A 2OIHA 4ERDA 2YKOA 2VKRA 3OTOF 1VRTB 3BO3A 1N8RT 2G9OA 2IMWP 4O44A 3J7ZT 3KLIA 4J9OA 3LW5C 2XBPA 5DQHA 3BF4A 4FF1A 1TAUA 2IVFB 1LW0B 2YWKA 2BE2A 5KTQA 1TV6A 2OSRA 3QGIA 2UXDF 1TV6B 2CYYA 4NL5A 1ZOTA 1RT7B 2R8HA 1ZZNA 4U6PA 1HQUB 2LXIA 1WEXA 1XERA 4ECVA 2ZM6F 4KB7A 4MH8A 3KLIB 2IC3A 2RKIB 2FVQA 1JB0C 4K4XA 2VB6A 1VQOS 3LP1B 1ULRA 2LYVA 1HR0F 5AXKA 2ZH6A 4DG1B 1R0AA 4V19X 3AJ1A 2IRXA 5C25B 1NJYA 1DJ0A 2CQCA 4PPZA 3DMJB 4XI9A 1N5TA 2A1BA 2OO4A 1RTIB 4Z2XA 1J5EF 1Q81T 2LQJA 5KOXA 3LOUA 3RRGA 2V8HA 1S0MA 2QLWA 3E01B 1CQMA 2UU9F 5HO4A 5KFSA 4O23A 3FSIA 1JLFA 4B3SF 1OWXA 1TR0A 3NCQA 4N47A 3QAEA 3GFYA 2N4CA 2NLWA 2DPJA 1FKPA 4NYOA 4KO0A 1DLOA 2MKCA 1W2BR 4DUYF 2YX4A 1TZ0A 1WHYA 2JL9A 1DQAA 5KFUA 3OJUA 4NA3A 4BWJA 4NCGA 3B4DA 5EX0A 1LQ9A 2LVWA 2Z8QA 3VCXA 2KJWA 1VQSA 1NK0A 1GNKA 2W24A 3IG1B 1PSDA 5BYRA 4MKYA 4X4TA 2Q79A 1S0OA 4ECYA 1JLAB 1V3ZA 2R7UA 1FRHA 4ID5A 3DOLA 3NWGA 5U47A 2CRLA 2FVCA 1RT3B 4OI2A 4KV8B 3POTB 1GH8A 2VODA 1NK6A 1UETA 3I4PA 4AYBD 1OIAA 3CT9A 4NLPA 5J1PA 4HL9A 2WTFA 3BSNA 1VJWA 4DN0A 3H5UA 4I7FA 2FGCA 2XCAA 2PSZA 3OFGA 3TVYA 5CYJA 1UP1A 1YJVA 3MMBB 2J7WA 1HMVA 1HQEB 2RVJA 1JLGB 4LIRA 4USIA 2XMTA 2KT5A 3EZUA 2ZD1A 4DOZA 5J2PB 4FXDA 2NUHA 2IM2A 2WSFC 2XLKA 2W4CA 1C1CA 1FXRA 1DTQB 3FVYA 1KFSA 4DSJA 4RW9A 1KEKA 2PI5A 3I0SA 1QSYA 1U6ZA 4A48A 5E41A 4RNNA 3OLBA 1LOUA 4F50A 3I56S 5G0RB 3KG0A 2XS2A 2N7CA 3MEEB 1QTMA 2V2KA 2YKNA 1KTQA 3WC0A 1N4LA 5J2QB 1SQEA 5AE2A 2QEXS 5A8WB 5BYQA 1AUDA 4HTIA 2E9TA 1RT2A 2DNZA 3OW2R 4C8ZA 1X4DA 4UW2A 4DSEA 5A0YA 4F3OA 3LQVA 4RBTA 1SKWA 3CCSS 2DNMA 2X5GA 3H2UB 1JKHA 1DTTB 2BRKA 3AQPA 3OSPA 1TK8A 2EFOA 3TAMB 4NYZA 4RUHA 4ZPCA 3LGMA 1B0TA 5KFAA 4B3TF 4K50A 1X9SA 3DU5A 2ZH8A 4M94A 3KK1B 1914A 1D9AA 3BR8A 4M8LA 2KZZA 4RNFA 3ZZOA 4WU3A 3PJWA 1X5OA 4FNHA 2AU0A 4JV5F 2PMZD 1KOHA 1ZAVA 3E8OA 4C97A 4L6V3 2P9GA 3LANA 4LUBA 3JTNA 4P2SA 3V3LA 3MDFA 4G1QB 1VLYA 2OFHX 4LF4F 4LIWA 2JDJA 3Q8RB 3SDEB 3QO9A 1VQLS 1L3KA 2LQ9A 1T05A 2CJAA 4N39A 5J2MA 2HWTA 2V4RA 1LFPA 1HNVB 1SH2A 1TL3A 2M52A 4J37A 3FQLA 2EWHA 1U4BA 3D5MA 2AP6A 1LWEB 3ZZYA 2X1FA 3ZZUA 4WIIA 1LWCA 2LECA 3V6JA 4A8FA 2B4OA 1IBMF 4J9PA 2AD9A 1QSLA 2ZH2A 1RT6A 2J8AA 2BM0A 4YOEA 2EG2A 3CTRA 4R8UB 4ZS6A 3PO4A 4J9KA 3ISNC 2OH2A 2YNFA 2RS8A 5AXMA 2RD5C 1RYRA 4QU6A 3MEGA 3CDEA 3ONQA 3VCDA 4JI1F 4MK7A 3FSYA 4CH0S 2B9YA 4JI6F 4J9QA 4NRTA 1YTYA 3M4XA 3LP0B 3M8QB 1YVFA 5DG9A 2J7KA 4LJMA 2B5JB 1Z1ZA 4HDGA 4ZVFA 2HHTA 5L39A 2M0GB 5LSRA 3JB9k 4EZ9A 1WI6A 3CD5A 3PW4A 2DNNA 3UQSA 5D4PA 3I96A 1HYSB 1C0UA 1NHVA 2KKHA 2OPPB 4NA2A 3R1HA 3FEXB 3HVAA 1YIJS 4DSKA 1U7IA 5G4DA 3RRKA 3FEZA 1JLEB 4MYTA 2RU3A 5DM7Q 1QY7A 3CJ0A 4ILRA 1S9GB 5HBMA 4HEA9 5B09A 4C3KA 1M5SA 2XLJA 1X8DA 2DNYA 1F5BA 1T3NA 3HPOA 1D1UA 3OTDA 2OMOA 1NJIT 4F2RA 2QA2A 3MECB 2MXYA 2HHWA 3DC2A 2RQ4A 3UD4P 4DFMA 4C8OA 1M5KC 4PQUB 1SIWB 3KJVA 3GILA 4QOTA 2M70A 2QLXA 5J2MB 3CJ2A 4CTAB 3KHRA 3HVRA 3VAGA 3O6QA 4K5SA 5HN0A 1JX4A 4DDFA 5D4OA 1X4AA 2FD2A 2NSBA 3L7OA 1UVKA 4TY8B 2I1RA 4XIFA 1PC5A 2H9ZA 2HW3A 3TYTA 1M5OC 4GZ5A 4ECQA 5HMXA 3K5NA 1IKXA 4N56A 4O0IA 2F4VF 2J9EA 1AW0A 4CCHA 2D3UA 2VBWA 4YY3F 2VPYB 1VQPS 4DSLA 2GMLA 3TR5A 3PW5A 3U1NA 3F73A 2KB2A 4OI4A 1S9EA 2KJVA 2XS5A 4QWCA 4AL5A 4DEZA 4DL4A 4F8RA 5D4NA 1DTTA 4KHMA 2DR9A 5HROA 4AY5A 2GMJA 3GSDA 4ED1A 5KFQA 2D9PA 3UDLA 3M1VB 3MM7A 3RW6A 5DG8A 3K59A 5A0YB 1U1KA 3PY8A 3PIOQ 4FVMA 4OIXA 4Q5VA 5JVHQ 2MB0B 1UA1A 1U7LA 2I38A 3BR9A 3C2PA 1UW4A 5J2QA 2HPUA 2XY7A 2CQBA 5K14A 4Q2LA 3Q24A 2Z4PA 4L3NA 1UEVA 5SZTA 2LEAA 5AE3A 2GQQA 4MYUA 2F40A 5IFMA 1SJQA 3AHPA 1RDRA 4MK8A 4QIFA 3C8YA 1Y9OA 1DTQA 4C8LA 4DV2F 4QZVB 2DT9A 5J2PA 3BM7A 3BO2A 1RTJB 2RRNA 3HM9A 1FF2A 3AQOA 1MNEA 4I56A 2EFGA 5F9NA 4IOAQ 4NA1A 2W9BA 5GADU 2J6SA 2E1MC 2J6UA 2COLA 4D3HA 1LK5A 4Y65A 1PGZA 2ABYA 2ALZA 3QGHA 2BQ3A 2HHXA 4EBDA 4W90B 1VQ5S 4RNOA 1IQZA 1LW2A 3AA9A 5L1LA 4DF8A 4ELUA 4A47A 3OL6A 4TN2A 4WE1A 5KFJA 3DOLB 4M5DB 4DL7A 2PIIA 1JLAA 1HBMA 2D1CA<