2FJEB

Adenosine-5-phosphosulfate reductase oxidized state
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
149
structure length
149
Chain Sequence
PSFVNPEKCDGCKALERTACEYICPNDLMTLDKEKMKAYNREPDMCWECYSCVKMCPQGAIDVRGYVDYSPLGGACVPMRGTSDIMWTVKYRNGKVLRFKFAIRTTPWGSIQPFEGFPEPTEEALKSELLAGEPEIIGTSEFPQVKKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords adenylylsulfate reductase, subunit A
publication title Reaction mechanism of the iron-sulfur flavoenzyme adenosine-5'-phosphosulfate reductase based on the structural characterization of different enzymatic states
pubmed doi rcsb
total genus 21
structure length 149
sequence length 149
chains with identical sequence D
ec nomenclature ec 1.8.99.2: Adenylyl-sulfate reductase.
pdb deposition date 2006-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00037 Fer4 4Fe-4S binding domain
B PF12139 APS-reductase_C Adenosine-5'-phosphosulfate reductase beta subunit
B PF12800 Fer4_4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fjeB01
3.30.720.40 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 2fjeB02
5BYRA 4CI0B 6FDRA 1FDBA 1D3WA 3EGWB 1FRJA 2V4JB 1JNRB 1SIWB 4L6V3 1FRIA 4Y28C 1XERA 1DAXA 4AYBD 1BQXA 1HFEL 1GAOA 4XDDA 2FJDB 2XSJB 3IR7B 3OR2A 2WB1D 1Y5NB 5CHCB 1IR0A 2FDNA 1Y5LB 1FXRA 2WSEC 2Y0SD 1DFDA 2PA8D 1G6BA 2PDAA 1F5BA 1KQFB 1FF2A 3MM8B 2C42A 1FD2A 3GYXB 5FD1A 3MM6A 2C3UA 4XK8C 1FRXA 6FD1A 1A6LA 2Z8QA 2WSCC 1GTEA 2WSFC 2FJBB 3MMBA 2GMJA 5E7OB 1VJWA 1FRMA 1B0VA 1G3OA 3HKZD 3MM5A 4ID8A 1K0TA 1H7XA 1FDNA 2FD2A 3PNIA 2V4JA 2C3PA 1PC5A 2FGOA 4DHVA 1BC6A 2VPWB 1C4AA 2UZAA 1FERA 2VPZB 4OV1A 3MM9B 5L8RC 2XSJA 1FCAA 1ROFA 1BLUA 1H0HB 3MMCB 3OR1B 3MM7B 3MMAB 1FRKA 2FJAB 1BWEA 1KQGB 1FXDA 1B0TA 4KT0C 5BYSA 1GT8A 1IQZA 1H7WA 1WTFA 3EXYA 1FDAA 3MM8A 1F5CA 1SJ1A 1FDDA 2GMHA 1JB0C 1KEKA 1FRHA 1Q16B 2C3OA 1Y5IB 2V2KA 2VKRA 3IR6B 1R27B 3LW5C 5BYQA 1C4CA 1RGVA 1AXQA 2C3MA 1F2GA 4XDCA 3OR2B 2C3YA 1BD6A 1Y4ZB 7FD1A 2PMZD 3EUNA 2VPYB 2FJEB 4OMFG 1FTCA 3MM9A 1DURA 1B0PA 7FDRA 5CH7B 2IVFB 1GTHA 3OR1A 3MM6B 3MMCA 3IR5B 3MM7A 3MMAA 2WAQD 1FRLA 1FEHA 1JNZB 1H98A 2VPXB 3MMBB 4RKUC 4YDDB 1PC4A 1CLFA 3C8YA 1SIZA 3MM5B 2O01C 2ZVSA
chains in the Genus database with same CATH superfamily
4J9PA 4B3RJ 2X1GA 2V4JB 3V3LA 2Z57B 2UUWA 4NCBA 3B4MA 3HCXA 2POKA 4DR4J 4QYRA 3TAXA 2K06A 2YKPA 4V1Ak 4XO0A 3G82A 1HQEA 4DZ6A 1JLCA 5F8GA 4PRFA 3ZZRA 2MKJA 2VZ9A 3CDAA 2ZH8A 2MGZB 1CBKA 2VH7A 2IRXA 2UZAA 2DH9A 4N76A 1D09B 4AL7A 2YPZA 2B43A 5KT6A 2HHHJ 3G8QA 2I8EA 3KHLA 2C2EA 1HNVB 2XULA 2HURA 5BYQA 1XBWA 1RWKB 2JC1A 3IC1A 2V2QA 1XMBA 3I9ZA 4XTTA 1MROB 4MYTA 3LP1A 1CJTA 3SEOA 3PYDA 4LFCF 4B3OA 3HK2A 3MM7A 2F63A 4DCJB 2P5VA 1RHUB 4EBCA 3DLKB 5ETPA 4ZHRA 5I42B 4GKKF 4I2QA 1N54B 2ZD1A 2NSBA 1VBZA 2OIHA 5L1IA 3PACA 2QMWA 2CQGA 5KG3A 3QSYB 1X5OA 4JV5F 3LOUA 2DPIA 2FDNA 3MR3A 4DV4J 2R7RA 5HAOA 1FF2A 2QMUB 4CT8A 3CDWA 4ELVA 1Q7LB 2BQUA 1RTJA 1FWPA 3GR1A 2Q43A 4C8OA 3KUGA 2YH1A 4IFVB 2HIQA 3FKBA 2MGZA 4MMOA 2M0GB 4HH1A 3VGVA 1TUGB 2I0XA 2CQ3A 4V19J 1M5VC 2EBEA 3CDBA 4H4MB 4JI5J 4DR3J 1OS5A 4QWAA 2AD9A 3OUYA 5CYQB 4WCEQ 1U2FA 4Z2XA 1KFSA 2VPYB 3DGVA 2GMLA 2VUGA 4ZVRB 3UNGC 3GIIA 4CP5A 2R7TA 1WOOA 2HVEA 1LFWA 4OZ5A 4JI3J 1OIAA 1FFGB 3SCLE 2ROGA 3MUTP 3UN2A 3R5GA 4DCPB 2KT5A 1P27B 2E7XA 3LANA 1NH7A 3QGHA 1AT1B 2F3JA 3D0HE 3AB4B 1FE4A 1PC5A 4LR8A 2WB4A 2NSCA 5IT4A 2YWKA 5CYMB 1IWGA 2B5JB 1OSCA 4OX7A 5EX0A 3SSRA 1S1UB 4P7VA 4CRJA 1M0SA 1F9HA 1FJ7A 3CUNA 1UVMA 4ALZA 3SQGB 3RU0A 4I56A 2RRAA 1WC4A 2DGXA 2C22A 4LSZB 4USIA 1HIYA 4FF1A 5KFWA 4UOCA 4NLXA 1U0HB 1IBMF 4DQIA 4QWDA 4J9OA 4URSA 3F73A 5CD4A 2Q3PA 5HQLA 4HLBA 2B8QA 3OMSA 1TL4A 3I87A 4JI2J 3H2LA 2E1CA 4WK1A 3K5MA 4G6VB 4NEZA 4P2MA 3W9HA 1N56A 5M2UA 1S7HA 1KQFB 3PO5A 4BWMA 2EXUA 3PG9A 2MQLA 4TQSA 3MPYA 3VF0B 2PFDA 1G3OA 2ZUAA 2B6AA 3KNGA 4CYUB 3TZXA 3RAQA 2XWYA 3AFGA 2KT2A 1BGXT 1SQEA 4ECSA 1WC3A 3TANA 2B5JA 1JB0C 2AJFE 3AY0A 3W8PA 1T9WA 5HSPA 3G71S 1T03B 1QE1A 2CPIA 3QYYA 1HNXF 5HJYA 2P2CB 2BKPA 2MZ1A 3RR8A 5DJBA 2R4FA 3L95X 5MLCV 1T9TA 3D0IE 5ETTA 4BBYA 2EC2A 2Z0GA 4N7TA 2ZHOA 1S6OA 1U1PA 4YDDB 2MKHA 1N32J 3O6QA 2OPQA 5GVQA 1LXNA 1Z4UA 2LA6A 4ZVFA 1U2RA 4USHA 3IBFB 4X4OA 1TMJA 5KFHA 1L3UA 3NKYA 3HHLB 3C16A 1WI8A 3QMQA 2VQEJ 1TL5A 1FD2A 2W9JA 5ITHA 4LF9J 2CJAA 1HBUA 2VG7B 5KFFA 4X2BA 5GADU 2YKQA 1IBKF 4OYIA 4OV1A 4UYKB 3T3FA 4DL7A 4KRWA 2F8MA 3NBPB 4CYUA 4MK7A 4DR7J 4ZVOB 2IHR1 2AKWB 3OTEA 1MSWD 2MLZA 3SI8A 1S9EA 1T9YA 3PHEA 4TYAA 3E01A 5HO4A 1RWWB 2ZM6J 5IC6B 1SI9A 5HATA 3IRXB 3KJVA 5DQGA 2ZWPA 4P2FA 4N77A 2QL7B 4FVCA 2XC9A 4RZRA 2B4UA 4MT1A 3LP0B 3D67A 1TKTB 3EGVA 1HL6A 1IBLJ 2GQQA 2OPPA 2U1AA 2GIQA 4LRAA 1HMVA 2FJDB 1BE4A 2KM8B 3EDRB 1X9SA 5D6GA 1UPPA 3NS6A 1FESA 3FCHA 3HHLA 2B51A 4ZP9A 1OYDA 3HZEA 4JI1J 1RWNB 4DSJA 1H2VZ 3G96A 3A8EA 3IAM9 2VOPA 1VQ8S 3CMES 1VOMA 1S0VA 1T3NA 4ITSA 4F4KA 5KT3A 2BJ8A 4X4TA 2JSXA 2GAHC 1E6VA 1D8ZA 4F3QA 1DTTB 1TV6A 5EWGA 1U1NA 3P96A 2B9YA 2Y9HA 5KT4A 4X4PA 3E51A 3IGVA 1VIOA 3IRXA 4OYPA 2XBPA 4FNIA 2HWHA 4NLOA 1OWXA 1S4FA 4KHMA 2G1HA 1NDLA 6FDRA 1UMJA 4NLRA 1U6BA 1F5AA 1OY8A 4IRCA 1M5PC 3TR5A 4DOZA 3EX7B 3WHIA 1YBTA 3OR2A 5F8NA 3IG1A 1Y5LB 4X4UA 5B0DA 3OTDA 2YPYA 3PYGA 2OI2A 4K4XA 3HHLD 5E3CA 1TKXA 3HXMA 1S0MA 1W2BR 1KNZA 3GTYX 2MPUA 1E8OB 3RG6A 2R8JA 1VHIA 1OQ3A 2L3MA 1ICEB 4ZPCA 3DLEB 4R0EA 2C2ZB 1NPKA 4ED7A 3M1VB 3CIZA 5DM7Q 2E5JA 1WUUA 2MQPA 5K9FA 4WKYA 1HYSA 3BN7A 1U26A 1S10A 1UVNA 1FKOB 1VRTA 4Q0BB 5B0GA 2RJZA 3BBBA 1UW9A 1UEVA 1TL1B 2J0WA 3CIMA 2JZ5A 5T14A 1EKRA 1NK7A 3VQTA 3CD5A 4F0MA 2WAQD 2H65B 2VODA 1Q7YT 3ITHA 3FBBA 4ZMMA 2XB2D 2AJ1A 4EO6A 1M5KC 2NCKL 4EZ9A 4FYYB 3ZZOA 4NASA 1VRUA 3CD7A 3VVUA 4N5SA 4RWWA 4IRKA 5BNWA 2E9ZA 1UWBA 3K89A 3PO4A 2C3UA 4DX6A 4M5KA 4MTPA 2OTLS 3EGZA 5CAAA 4KSEB 2E7WA 3OTCA 1H73A 3V4MA 2FVCA 1YJRA 3PKYA 5JVGQ 2D1CA 2XSJA 1YGYA 1R0AB 1E8OA 1ZTTA 1UETA 3D6MB 2E5HA 1SC4B 3BR9A 1DRZA 2FUG9 1TUWA 3CC4S 3H7HB 3N6LA 1FDDA 3LUYA 4HDGA 3MOZA 2MHEA 1ACMB 3BT3A 3G6ES 4GKJJ 5ETMA 1WC0A 2J5AA 4ANEA 4ZPBA 4JP8A 1YLXA 2NYIA 2QA1A 4P75A 1PO6A 3FBEA 2B8PA 1FKOA 2YKNB 4GVLA 4Q0BA 3BPDA 3ZZPA 4X66J 2AJ4A 4DV1F 5KG0A 2B56A 1C0UB 3QGIA 2R7XA 2KTQA 4E8UA 4FPIA 2WVDA 1X5SA 1EQMA 1YVFA 2N7YA 5RUBA 4HI2A 1UP1A 1HBNB 3K5OA 5D8HB 3KKFA 4DV2F 2BJ1A 4DR7F 4DV0J 4DX8H 4EBDA 1VJQA 4DUZF 3J7YU 2G2YA 3BGRA 4X4QA 4UOHA 1B7FA 1J5EF 4M1KA 3GIRA 2ZM6F 2RD5C 1SH2A 3VAIA 2RF2B 2ALZA 1VC5A 1K8AT 4RW9B 4TLQA 4DV3J 2ZBQA 1HNZJ 1U47A 1TMMA 5DZ7A 2W9CB 3K5NA 2XNRA 3PEJA 4C6AA 1GX5A 4OHZA 3J7ZT 1BD6A 3BJYA 1AFIA 1N5YA 1JX4A 4NRUA 1IBLF 1JLFA 2MTLA 4AXIA 3GJRB 2UVUA 4QYZK 2GCFA 4I2PB 2AV5A 5LMNJ 4ECZA 2KHDA 3BSCA 2O01C 3NCQA 1NSQA 1D3WA 4DDFA 4GC6A 1FRIA 2Y8WA 4OFZA 4GYWA 4Q7AA 2GO8A 1CG2A 1U4BA 1H38A 2E5LJ 4S0MA 3D6HB 3T5KA 3EPGA 5LMUJ 5CZVA 2CIMA 4DV6F 4Q44A 3W63A 4IQMA 1K9MT 3PCOB 1HBNA 2E44A 2JH3A 4FP9A 1AB8A 1FXLA 2MQOA 1CC7A 3OR1B 2BA9A 4PXBA 3NEKA 4GO5X 3L7OA 3IGNA 2R9LA 3M8SA 5L9XA 3NWRA 1RWOB 3HX9A 4C8LA 4ED0A 4U9RA 5E3AA 2HVIA 1U45A 1IWAA 8RUCA 3ZFVA 3U1LA 2BW7A 3VGTA 3OPKA 2EG1A 4TU9A 5A0YB 3SDEA 2FLPA 3OFHA 3MGJA 4Q2LA 2W9BA 4I2PA 3FUYA 4DSLA 3GR0A 2UUBJ 4ZS6A 3R5JB 5F8JA 5KFUA 5LL6d 4KKOB 3DYAB 2DRAA 1PYOB 2PDAA 2IY5B 4QIVA 1QSSA 4MKYA 5HVHA 1WOSA 1W2IA 3GFZA 1HPZB 2WSCC 4U96A 2EFGA 1X4AA 3JQJA 4EYIB 3MPVA 4ZCLA 3HKZD 3MM5A 1VS3A 1IKXA 2PEHA 3UPFA 5HL7Q 3T6JA 2ZWOA 2IYIA 2CJXB 2HFNA 4OI0A 5T7LA 3V4IA 2QL9B 3DGPB 4W92B 4CLTA 4O3RA 2OLWA 3OHBA 1ZPVA 2CQCA 3UDVA 3DRSB 2PI5A 2KFZA 3FJ2A 5IV3A 1RAIB 3CJKB 3CCTA 5C42A 4DSIA 4HTIA 1O8BA 3FCVA 2DNPA 2IBKA 3LF0A 2IC3B 2ZOGA 3M8ZA 2YQ3A 2CQBA 3POTB 2V50A 1GQEA 5A0YA 4FYXB 1SJRA 3W5ZA 3C15B 5SUHA 4KGKA 3QT7A 5J2MB 2WVBA 1HNIB 2DT9A 1ZS6A 2AT1B 2DNLA 3GJTB 2CNKB 2HSEB 4JB8B 1RLDA 1YRTA 4X4SA 2ZH3A 4B3MJ 2RE1A 2UV8A 1LQ9A 4YB6A 1H0HB 5DZ6A 3TX0A 1S6PB 1A9NB 4N3BA 4ZIVA 3RZAA 2CXEA 4OJ3A 1S59A 5GAEI 3IFEA 2VF3A 1MMLA 1RT6B 1ZM4A 4HL9A 4ZP6A 1HW8A 2NYHA 3M4XA 3DRSA 4WYLA 3NOGA 2IM0A 4OV6A 2VJUA 2ZH1A 3M6WA 4UYJB 2HK2A 2BE7D 1LEOA 1U2CA 2XY5A 3Q83A 4RUBA 4BC9A 4Q8FA 3DOKA 1EJ7L 1F6TA 2W24A 1P6TA 3HT0A 1NJZA 4ED5A 4Y6IA 3C6UB 1JLAA 1RHRB 4FKYA 3J81Y 1HWKA 3E3XA 2LQBA 5HMZA 5C2CA 1P1TA 4A48A 2AGPA 1QSYA 1RT7A 3MMBA 3HHDA 5D4NA 4ZP7A 4CO4A 3EVMA 4NRTA 4IO1A 2HVZA 5ETVA 5IS2A 2XCPA 1SJ4P 2BQRA 2ZEJA 2QJ3A 5AE3A 1N0VC 3DI6A 3UW1A 3KG1A 2ZBRA 1T02A 3NWGA 2IA0A 1TQLA 2F4VJ 5LMNF 2DGSA 4A4JA 3ICLA 4CTAB 4UY85 1DURA 1RT6A 4L76A 3IP0A 2IVFB 3IBCB 1SJFA 2DYAA 5GAGI 3RRGA 2W7OA 2KT3A 3L3CA 4YEAA 2GC8A 3TAMB 2QFJA 3T5JA 3ULHA 2R42A 1LW0A 4OYXA 2HLTA 3MEEA 2ZNZA 3N28A 4AL6A 3P6YC 2UVVA 4DSEA 3PRBA 2E9TA 3PW2A 4JI4F 1914A 2FGCA 1RAAB 4IUFA 3H90A 3GG1A 1C4AA 4J9QA 2HRYA 1YX2A 1ZM3A 2YKOA 2X1AA 2MJNA 3A3PB 1N8RT 2GZOA 2HNZB 2LP4A 3QJPA 1S1XA 4X64J 3ILOA 1SL0A 4X65J 3JS9A 4RO0A 1KVKA 2OSQA 5KOXA 2HMIA 2J6SA 3VHQA 3QIPA 2KG1A 2EFVA 2C2MB 4YHHF 4HT5A 3MM9A 2FVQA 2PFFB 1MMDA 1B70B 5KFXA 3M6XA 3ILJA 3ZTPA 1LK5A 3LP2B 5A6PA 3CCMS 4MIBA 2Q6CA 3WC0A 5GAHU 3ET6B 3LGHA 3FFIB 5DQHA 3CEDA 3W2VB 2DR7A 3RBDA 4ECYA 1XN9A 1VDHA 2JEFA 3DXBA 4KH0B 2W4DA 1URNA 3O2IA 2MJUA 2DR6A 1EP4B 2O5DA 3AJ2A 3FQLA 1RI7A 5HMWA 2W2QP 3GILA 2HYIB 3NMRA 2HW3A 5F9LA 2CYYA 4K4SA 3P45B 2CPFA 2ZE2A 3R1LA 1FEEA 2XG8A 2HNZA 1NPRA 2P6TA 1KHWA 3KLHB 5J2QA 3P3DA 5J2PB 2J6TA 3RB4A 4XPCA 4F3MA 4ED3A 1DZ5A 1Y3KA 1S9GA 3D28A 3FVYA 4CLWA 3M9MB 2BR0A 5F3ZA 4OI4A 2IYGA 3M2RA 3GLJA 2VA2A 2G1DA 4NXMF 4QWCA 1F60B 4WZQA 1NB7A 4ZP8A 2NPIA 4B9LA 2CWXA 3TW0A 4U7UK 5LSRA 2GVZA 3HP6A 2KM8C 5AT1B 5LJ5Y 3LP2A 2WVEA 1I3OB 1JQGA 1C1BB 3T1YF 1H2UX 2KXFA 4HYKA 3PJ9A 3DLHA 2QFIA 4B9NA 3TYTA 2X1BA 3W2VA 1NDCA 5D77A 2D69A 3LPYA 4P72A 3QNWB 5HLFB 3VCXA 3SYZA 2F9JA 2PT0A 3CMQA 2ZH4A 4YY3F 2MKCA 1MNEA 3PFEA 2C2KB 4JV0A 3CC7S 1S1WB 2DHXA 3TP2A 5HQ8A 2CNOB 3IAS9 3BH6B 2DO0A 1QSLA 2KDOA 4QW8A 1UVLA 2B4PA 1U24A 1GX6A 1Z1ZA 3L9ZA 3QRQA 3KK3A 2VDIA 1Y4ZB 4B17A 4KGXB 2G0CA 3GFXA 5J2PA 2VBXA 5IC4B 2YWWA 2CAJA 1LWCB 4BC7A 3V81B 4YB7A 2KVIA 3MEKA 1VIXA 2GAGC 4CLYA 4BCAA 1QY7A 3HZGA 3KJFB 4WIIA 3MI7X 4NMLA 5U47A 2FC9A 2CPXA 1Q0NA 1K44A 4F4XA 4ETZA 2RKIB 3V6KA 4DS5A 4O3OA 3HVTA 3DOMA 2F7VA 5I3UA 2HNYB 5J1PA 1WSVA 3VVTA 3U02A 4GYYA 3FDSA 2VPZB 2BJ3A 5B7WA 5BJRA 4HHUA 4JI6F 3K2YA 3VAKA 2NS1B 1L3SA 2SXLA 5ETSA 3KK1A 4XI9A 4KT0C 4M5DA 1TL7B 2G9OA 1LK7A 1RAFB 3KLFB 5DDPC 1WI6A 5D0HA 3OLAA 1RT2B 2GIFA 3R2DJ 4GO7X 4I6WA 2MYFA 1DARA 3AOCA 3CWJA 3DM2B 2QEXS 2XMTA 2AGQA 3KXDA 6AT1B 4N8OA 3VZHA 2J7WA 4ILRA 2RB7A 1UAWA 4OQJA 2XO7A 3DXSX 4LVNP 1Q8KA 1G2EA 2DRBA 3AA8A 1I5OB 1XWLA 2DGQA 3OT9A 1PIEA 4DFJA 3R27A 2VBWA 3TUZC 5HP1B 4OZ1A 3PYFA 1ZA2B 2HQIA 3TI0A 3UNYA 2K4NA 1VLYA 4X65F 2CQ1A 3BGFA 1O5JA 4KE5A 4LIRA 5F41A 1VQ7S 1EETA 2QRRA 1GMUA 2ILYA 2F8EX 3RB3A 1SJQA 1SKUB 1W25A 2MHNA 2W7AA 4JBCA 2FZKB 2XI3A 3MM8A 2WHOA 4K59A 1NPPA 2NREA 1JXEA 2DRDA 3G9CA 1CJKB 4DJBA 4EBEA 1YJUA 4C8KA 5KG2A 1RT1B 1RYRA 4CH1A 1PJ5A 5K8OA 3SCKE 5I4MA 1F3FA 4FF4A 3R7SB 3P49B 5H9EJ 3KLIA 2CADA 3R6LB 4DUTA 3W9JA 1LOUA 9RUBA 2G2OA 2DHAA 3BSNA 1WC5A 1WNEA 5CQGA 3CCJS 4H4OB 2EPIA 3GV5B 1S12A 1DQ8A 3I32A 4OI1A 3HFKA 4LF5J 4QU7A 2EFQA 3WC2A 2OPSB 1S57A 1YRUA 3C46A 3F56A 3LO3A 3FMWA 2G13A 3VWSA 5HP1A 1T3OA 5C7PA 2AJ2A 2OKQA 5LSOA 2OAUA 2K3IA 4J9MA 3Q8VA 2GS8A 2I9SA 5D0GA 3RJMB 4LF8J 2CJKA 4RW8B 2B0GA 3G6YA 5I3QA 1JLGB 4OYBA 3LA0A 1NK4A 1FJCA 1U25A 4A8FA 3IWLA 2ATCB 4WKRA 4HKQA 4X62J 4OZ2A 2EW9A 1R0CB 5A8RB 2IM1A 3W60A 4CLKA 4B9MA 3OL9A 3EZUA 1FNXH 1UJRA 4NLSA 1B0PA 1N34J 1J2VA 2FHJA 1S79A 1KLNA 1RT1A 4ZDNA 1FRLA 2VG6A 4WTOB 1REGX 2LEAA 5JUMA 2MZJA 1FRJA 2NXUA 3E8OA 1PAEX 2DY1A 4U8VA 1RACB 4WU3A 1C1CB 4Z7YA 2WRMA 3R5AA 2MQMA 4TQRA 1KLMA 2VD3A 1Q5VA 2Z2MA 5LSLA 1N5QA 2XLJA 4M5GA 3ZC4A 4DFKA 3I0RB 2D3UA 5KFYA 2OPRB 4K4ZA 4K2XA 2A1BA 1JLQB 4FYWB 1WHXA 3DRPA 1Y7PA 3PFOA 5M2RA 1Q86T 1DTQB 2KKHA 3GONA 1GNKA 2LEBA 5CA5A 3NGTA 3ADAC 1NB2A 2IPOB 2JRSA 3RUBL 2QSWA 1CULB 3QATA 1CVJA 3CCQS 1KC8T 2BANA 1BQNA 1MN9A 3BV8A 1IKVB 2YKMB 4R5PB 3IR5B 3OXLA 1UFLA 2FHJD 3MUVP 5HROA 4NWBA 1RHKB 1ZBTA 2OMLA 1RDRA 2H4WB 4TY8B 4LF6J 3PM9A 2EVZA 5B09A 1DAXA 2VKZG 3HI9A 2BUNA 3KWMA 3O44A 5E33A 2J7KA 4PWDB 2BABA 2J9CA 2HHQA 1SH3A 1DFDA 4GVBA 2J0SD 1ZOTA 2UUCJ 1C1CA 2KJZA 3D3CJ 2VC1A 1FK9A 1DLOB 5C25B 3ZTRA 2DTJA 3N79A 4KPCA 1R8HA 1JKHB 4PG6A 1IKWB 3WQPA 3S8SA 2FJAB 1XNRF 3BZQA 1MWQA 4F67A 4JUZA 4DZDA 4NL5A 3PE4A 5FDLA 2C3MA 1C0TA 2RS8A 1VBKA 3W61A 4TKTA 3CJ8A 1J27A 2CJ9A 4F25A 3MMCA 3OTBA 2E29A 2FZGB 3LGMA 5L9NA 3EYZA 4RNOA 5EDWA 1LFPA 4G1QA 3BYPA 4USUA 2YWFA 2XLKA 4NLWA 3K59A 3N9UC 1VC0A 3ZNJ1 1Y10A 1R0BG 2HS4A 2LQ8A 4FN5A 2F8HA 5DS7A 2RHSB 4QIGA 1YDLA 2U2FA 3MEDA 3T9ZA 3JYTB 1WKLA 5T41A 2UXCJ 1FRMA 4DR6F 2QL5B 3GG0A 3U1NA 3TEHB 2RS2A 2MSTA 4DQSA 3A1YG 1RA7A 3CDUA 1DLOA 3MAAA 4M5HA 4PPZA 2HQDA 2M8DB 5A2QY 2NLWA 4OHYA 1JKHA 3CPWR 3JTPA 4ANCA 3JAMY 1IKWA 4DQRA 4HEA9 3MD3A 3M8PA 3W66A 2HQFA 2V67A 3MTJA 4ZPAA 8AT1B 1EB0A 2XMWA 5AOXB 4NZ6A 1RTDA 2EK6A 1CSJA 1YWXA 3BBCA 3IS9B 4Y2CA 3PX6A 2E5IA 1FDBA 3R7NB 4LSNB 3ITWA 1S9FA 3M32A 2WB1D 4C7QA 4ELTA 1TFWA 3HFVA 1B7YB 3I0SA 1HR0F 3SXLA 4CNZA 1PKUA 4UQTA 3KLEA 2DNOA 3D7SB 4DFPA 4PXDA 4L3NA 4ZCIA 2X5TA 2OHDA 3MPWA 1ROFA 3VTIA 3TZZA 4LBIA 4CM0A 3AJ1A 2K1RB 1KRPA 2QC3A 3SMZA 3CC2S 3W1YC 4ETXA 3VAFA 4P10A 5GMDA 3V2UC 4CDIA 1SCJB 1LNQA 2GJFA 2YWGA 2JL9A 3KHGA 2XMMA 2J76E 1X4BA 1P8GA 1KSPA 1Z2ZA 1WDDA 4NCAA 1WHWA 3QJLA 1XERA 3OTOJ 1RWVB 4NLPA 4NE9C 2X51A 3OQ2A 3H4DA 2QTWA 2BE2A 3IM8A 3I82A 3ZO7A 4GC7A 1FKPA 3AH6A 1X9MA 1OSDA 2FJBB 1HWJA 1WDTA 2FVSA 4KO0A 4XPEA 1N88A 2K7KA 3M2UB 3PRVA 3C66A 2KJVA 1SV5B 3PNIA 2DH7A 1S0NA 3BB5A 3OLBA 3RW7A 1JXVA 3I31A 2XY7A 4NCGB 1NO8A 2FPHX 3D3BJ 3UQSA 4IG0A 1TK5A 2I2YA 3IBWA 3NOCA 1NJIT 1EAYC 1H7WA 1N6QA 3DKDA 2V4RA 4NPOA 3KFWX 4DSKA 1UVJA 1RKJA 2VJVA 2K1RA 4DPYA 1SQFA 2MQ8A 1FJEB 2WTFA 5C24A 7FD1A 2LMIA 4LF6F 1RWMB 5MAOA 4UZBA 4USMA 4IYQA 1RHMB 1QTMA 4D3GA 2MZSA 2E7VA 1Q79A 2DVIA 4KTQA 5KFDA 1AW0A 4ZVSB 1FTRA 2QIFA 2HS0A 2CQDA 4Y28C 4Q43A 2EFPA 3D1QA 3UCZP 4LMZA 2VFTA 2I5JB 2IVMA 3QIDA 2CQHA 1XMQJ 4CCHA 5HVGA 3EXCX 2AX0A 5AXKA 3QGPA 1NJWA 1S48A 4RNMA 1VQOS 1BQMB 4KV8A 1ZZNA 4Y2AA 5JMNA 1VBXA 1CS4A 2UXBJ 3DRXA 3M2UA 4IH7A 3CD6S 2MMYA 3TAQA 4DFMA 4C2MA 2QGFB 4JI0J 3CJQA 1J5OB 2XMVA 2AU0A 1H74A 1UA0A 1RT5B 1MW7A 5K8MA 4IFYA 2A3JA 4IH5A 3KG0A 3DOLB 1R8AA 5LJ3Y 4A8YA 4YB5A 2CNLB 2IRYA 5EWEA 2ZBIA 2YX1A 5KFIA 1XC9A 1FEHA 2CJBA 5KG7A 4LRBA 2ACMA 1IKYA 1KHVA 1VFJA 3HF5A 3FEYB 3J81U 3FZBA 5A8KB 1IVZA 4NXNJ 2WSEC 4ZCMA 4U7CA 3MR5A 2IJFA 4B3TJ 5DG7A 2ZVIA 1U8SA 5E7OB 1VJWA 4H54A 3GFHA 3DHWC 1RT3B 1NK6A 4R8UA 4LFAF 4U6PA 1X31C 3MMJA 2VBYA 5K20B 1MU2B 4RW6B 3JSBA 2JEGA 3N01A 3QZ7A 1TAQA 2K3KA 4JI8J 3B82A 3GE9A 4B08A 3L7PA 3KLVA 2JWNA 1Q78A 4TU8A 3EPIA 4PQUB 4WE1B 2LQ9A 4MFBA 4OMFG 2RT3A 2VDHA 3WX8A 3G82B 1HQEB 1NAQA 1RT4B 3DC2A 3DLGA 1JLCB 2Y1LB 2CVIA 5KFNA 3DCAA 1QUPA 1FNOA 3AA9A 2IAJA 3R6GB 3PJWA 1RTZA 1LWEA 2ACYA 2LA4A 2UVRA 4CLSA 2EG2A 3HM9A 4USVA 3RB0A 4B3SF 5B0AA 1T94A 3O3LA 3W8GA 4F7VA 5D3GA 2A6OA 2BXJA 2XNQA 5A8KA 1YJTA 4USKA 3J80Y 3NG8A 2LCWA 3NCPA 2ATLA 4OI6A 1X4HA 4A46A 5GMEA 1RK8A 4PCQA 1EHWA 1U48A 3QT6A 4LF2A 1O0PA 2N3LA 1TK8A 1RT3A 4B3OB 1UJ5A 3CE8A 2DCUB 3MM7B 1FVSA 2RH3A 4ZHRB 4NLDA 3OXFA 2DY9A 3BF4A 2A2DA 2YH0A 3B78A 2C3YA 4QU6A 1VCTA 2OFGX 1TVRB 2OMOA 4K4VA 1L3VA 4K4WA 4PG8A 1Q8LA 4P2XA 4ZJQA 4FYVB 1LXJA 3TZYA 1S97A 4PQUA 3K7RA 4WE1A 3SV4A 1RTJB 1MG7A 2HQCA 2DJWA 3TQEA 4MKVA 4EUVA 1YJ7A 4Q8EA 3DLJA 2A2CA 1RT4A 4WFXA 3FSXA 2V34A 1AFJA 1EQ0A 2K2PA 2C1EB 5K14A 5IT0A 3HJFA 3PR4A 4AD6A 4YFUA 2AGOA 3MECA 4PXCA 4JI7F 1PBAA 3MM6A 3A3OB 1RZMA 4DPTA 4UQGA 1WKKA 5DM6Q 3OUYB 1UCNA 3M8WA 3BDPA 3H40A 4DHVA 3TA1A 1L3TA 2J8AA 4PWUA 4OX9F 2ADCA 2UVWA 3S01A 4ED4A 2BACA 3IO1A 3M2VB 4NI2A 1NK9A 3A8JA 2BQ3A 1H72C 4FS2A 2R7WA 4DBQA 4J90A 4I4BA 1NLKL 2IIHA 2B4VA 2DIUA 2ZHBA 2D9PA 1GMVA 4LF7J 3VCDA 1DQ9A 3D0GE 1OQ6A 2LXUA 1TVRA 3BQ1A 1S6UA 2ROPA 2W4CA 4F26A 1H98A 2GQCA 3M8QB 3J7Z5 2VICA 1LWXA 4RL1A 4W90B 5IWAF 4M63A 3OBIA 2GGPA 5F8LA 3J7A1 4AYBD 2IM2A 3TUJC 3V6DA 2ZH7A 2DNHA 3TQ1A 2J7UA 1U02A 2Y0SD 2BRLA 1TAUA 2I38A 1NDKA 2MEWA 1U8WA 2F65A 4N39A 3ETMA 1X9WA 1KFDA 2DR5A 2HWTA 4JI0F 3VAHA 2KZZA 2HLUA 2QE5A 1T9VA 1NMEB 3D6TB 5EUHA 5KFQA 3NNHA 5HI7A 2BKNA 4CT9A 2BBEA 1RKIA 4G3IA 3C3LA 4J9KA 2HHVA 4M5LA 3UVJA 3M2VA 4I6YA 1KEKA 2W7PA 2GHPA 2XYGB 2LEPA 3H20A 2VQFJ 3CJ3A 3T1HJ 2M9KA 3H2VE 1Y0HA 3OJUA 2UU9F 2PEBA 1F1BB 2RHQB 3GJQB 4QYZJ 2V9KA 1HI8A 2WONA 3S6EA 2B6AB 3OVSA 1D9FA 4L74A 5KOWA 3G8SA 4DLGA 3MZIA 5C5JA 4CH0S 3M8QA 2HBQB 3TAPA 2AHOB 1Q8BA 3OVAA 4PUOA 2DCLA 2HGMA 2OTJS 5G4DA 1Q95G 2KH9A 1N36J 5ETNA 2UXDJ 2X3DA 1NM2A 2P9EA 2IJNA 2ZUGA 4WJBA 1QE1B 2R3VA 5D0RA 1FDNA 3HKWA 2J0QD 1N5VA 3EJMA 4NLYA 4PAAA 2HHXA 4A47A 2GNKA 3GIMA 2PIIA 2E9RX 1LV5A 5E41A 3H8YA 2HQ3A 2OD4A 2XS7A 3WDOA 2OPQB 1N33F 3AOAA 4LSLB 2DEIA 3NS7B 3GIJA 3KOAA 3ZXWA 2ZKUA 4YMEA 3AODA 1VQMS 3FSIA 3C16B 3W5XA 2H5EA 3BN4A 3KHHA 1BUXA 1HBMB 1R3NA 4K5RA 2LFVA 3HVAA 2OEJA 1RCXB 1HBUB 2MLXA 4OLOA 1PJ6A 2FTRA 2NUUG 3LWMA 4LVOP 1SUQA 3R2CJ 4C4WA 4I0WA 2R8HA 3K57A 2CQ2A 2Z2ZA 4WU2A 5KFSA 1OJ4A 1S9EB 3I56S 2AMCB 1TTHB 2GMJA 2X5GA 2IBOA 3E01B 2KRBA 4QIFA 4BWJA 2FD2A 2B9EA 1RB0A 1HA1A 3KJVB 1IJFB 4B3RF 4YDXA 1T95A 2V2ZA 1NBEB 3MR2A 4NLVA 4J9LA 1M1KT 3GFYA 1FDAA 2RDIA 1YJ9S 1M5OC 1ELOA 4FF3A 4DR4F 1XJWB 2OPPB 3U7JA 5A6WA 1HMVB 4LSLA 4ZVQB 4F4ZA 2DEJA 4L3KA 2DBBA 1TL3A 2MKSA 2Z30B 2RILA 2ZH9A 3CJ2A 2HKEA 4K50A 4KHPJ 4LBPA 3MMAA 4OI3A 2GQ2A 4RW4A 5DRKA 1DJ0A 1YJWS 2DR8A 1HBMA 1SC3B 2CNNB 1NHUA 4OI2A 2HHHF 4UT4A 2FLNA 1C2PA 4WTYA 2Z56B 3IA0A 2QA4G 2Y1RI 3PW5A 3FK4A 2W2NP 4W98A 1CC8A 3RBZA 3KUEA 1KOHA 4DPXA 9ATCB 1E6VB 2DO4A 1T9UA 4RNNA 1TV6B 3LPEA 1VQLS 3PZPA 4ZKAA 3PJXA 1NH8A 2DKOB 3JSRA 2HRTA 3QWPA 1QUVA 4N41A 3PW4A 4KFBA 3GYGA 3GCXP 1RTHA 1VQPS 4B9VA 4AL5A 4DV4F 5EGYA 1XQIA 3OR2B 3NGRA 3IG1B 1JJ2R 4TU7A 2HHSA 1NDPA 3MFHA 2CWKA 4LF4J 2MZRA 3BEGB 5DO2A 4B02A 2OJ3A 1TKXB 3MURP 1V3ZA 2DGTA 3G6XA 1NJXA 2R2RA 1WHVA 2C2NA 2B9WA 1MWYA 5KT5A 1ZZFA 3KLGB 5A8WA 4L73A 2MKYA 1XMOJ 1UFWA 4CWBA 4RUAA 4JI5F 1G4CA 4DR3F 5L1KA 4LFBJ 4YS2A 2AYMA 3Q8PB 2V8VA 2V2VA 2CPHA 4FBUA 1HYSB 5AJ3J 2VG5A 2FHMA 4CO0A 3OVBA 4P74A 3J7AN 1X5PA 2GVDA 2YBVA 2D3OR 1H7XA 3I5CA 1VRTB 2PSZA 5KFJA 2KL8A 3M30A 3UCGA 2GJIA 4ILMA 2YNHA 2XMUA 2XS2A 2CDQA 3HVRA 3T1HF 4ZLJA 4ES3A 3R5DA 3R1HA 3AXMA 3T6BA 2JEIA 3ITHB 1TKDA 4QBUA 2YNIA 4JI3F 3ISNC 1UJ4A 4QR0A 5E5NA 3D4JA 2AYBA 4YQWA 2HZAA 4NYZA 4DN0A 4OIXA 5DDOC 1VRUB 1KBRA 2AZ3A 4D3HA 2IA6A 3GV8B 2DB1A 4I7FA 4DV7J 2HHWA 2P6SA 4E98A 1RQ0A 1A0OB 1UWBB 4QR2A 4DUYJ 2W1BA 3M6VA 3DRRA 2EWHA 3LALA 1HBOA 4ECUA 2R2TA 4C8NA 1N36F 3W3SA 1R89A 2RUSA 2H48B 2ILZA 4KHRA 2BW2A 4DR2J 3EGWB 3W65A 2LVWA 2XSJB 4UOGA 1S4EA 5D4PA 2YTCA 5IZHA 3KLGA 4O4RA 2R7QA 3OHAA 4HH0A 2BJEA 3G86A 1B99A 2R8KA 2LU2A 3QT8A 1JMTA 1R7IA 3KYLA 4K8RA 2HZVA 4ZCKA 3WX4A 4DV5J 3M8RA 5C1DA 3GSIA 2CJYB 3RGIA 2DNKA 1HNWJ 2RIJA 1KQSR 4NLUA 2YVSA 3M8YA 5A76A 4OL8A 4ZLNA 1WEXA 4JI2F 2HFVA 5HVFA 1VQ6S 2DH8A 3D6FB 1YBUA 2C3OA 3GMGA 4EEYA 2CUYA 4R0JA 1U1OA 5I3PA 1T05A 5C2GA 3FQKA 2V94A 3R3TA 2YNGA 4RBTA 4YR3A 2DGWA 4C98A 2DNQA 4M94A 1HQUA 4I6AA 3PV8A 3X1LB 2A0FB 2IMWP 2EEYA 1JNRB 3BGRB 2D74B 2RU3A 4FNHA 2YWHA 3LWLA 4R25A 1Y5NB 1NK0A 4J91A 5KFTA 1JJHA 2GW8A 3L4BC 1QVGR 1RUSA 5EHHA 2PN6A 3M9OB 4ZVEA 1RBAA 1N5YB 4O3QA 1Y9OA 5D78A 3BKFA 4J9SA 3G4SS 1JLFB 1N32F 2ZNYA 3RAMA 3Q8YA 1IM6A 3A4TA 3OW2R 2XS5A 4TLRA 4TNOA 5K5MA 3HLUA 3JAMU 4JV5J 4PXEA 4KHPF 2CKWA 2VQEF 2O1PA 4QWBA 3CJSA 3DMJB 1TKZA 5L46A 3T5LA 3CJTA 3TVKA 2IVYA 2B3TB 4LF9F 5DQIA 3MCSA 1RYSA 1N4LA 2JLFA 2CA9A 2XZWA 2Q1LA 1JNZB 1JLBA 1N0UA 3BREA 1S49A 2OUGA 4CLLA 2YNFB 3OV7A 5CXTA 2GFFA 2DIVA 4LF1A 3J7YI 3W64A 2ZDPA 4PYDA 2KYXA 1NZAA 1VGYA 3MDFA 4WF9Q 4HACA 3E2EA 2BV3A 3U27A 4F2RA 3GIKA 4MH8A 3D2WA 4PWWA 3GYNA 4CO1A 1VLOA 4LREA 3W2WA 1VK8A 5KFOA 1RSCA 4YR0A 3BBFA 3IXQA 4LT6A 2WOMB 1KR4A 3SDEB 4CDRA 2KO1A 2W9BB 2L9DA 5IQQA 2CPEA 1DY3A 2HFSA 3THTA 4PPDA 1FJGJ 1SC1B 3C2PA 1IQTA 3W62A 1S1VB 1FTCA 4JI1F 3DMJA 4PG5A 1VQ4S 3W5YA 1PC4A 2ZOFA 3Q2TC 3MM5B 1IKXB 1UA1A 2MZQA 3N5BA 5AJ3F 5J1NA 3DLBA 3BH7B 1FKAF 2R7UA 1WF2A 4FXWA 1U1LA 2YNFA 2UUTA 5T7LB 1RTIA 4PABA 2PA8D 3V4IB 1KD1T 1V5IB 1WC6A 4DQPA 2QA4S 1KP6A 3FGVA 2RSFA 1IBMJ 4B9SA 1FA0A 1KONA 4J9RA 3JTOA 1CQMA 5B0EA 5HN0A 4WP3A 2M88A 2H51B 5C42B 2QSFA 2VB6A 3DN9A 1YITS 4PR6A 4C48A 4Y2IA 3A13A 4ZA1A 3F0NA 2BVZA 4WIQA 1RXOB 1GXTA 3ENQA 3EVWA 1VQ9S 3MEGA 2LKZA 2CQIA 3ENVA 3IRWP 1MWZA 5IQ6A 2HPUA 2VKRA 2HBZB 2WOMA 3HVWA 2R2SA 2ASLA 1GFWB 2B4OA 2DHHA 3AQPA 2KXNB 5BR8J 2PC6A 4C3KA 3EUNA 4OZNA 3ZZZA 4FS1A 1APSA 4OZJA 3QAUA 2WVCA 1S1VA 5F0UA 1WACA 2XHCA 1L3KA 3UO0A 1NK5A 2Z4PA 2AEJA 2QV6A 5ADZA 1UJ6A 2ZFHA 2MDAA 2AWZA 1HFEL 1D0EA 5D15A 1KN6A 2YX4A 3AQOA 5EWFA 3ZZUA 5F8HA 1VMBA 3O1LA 3BDEA 1HNXJ 2XMAA 1R8PA 5ETLA 4URQU 2WW8A 3KK2A 3G6VA 3SCIE 3H0PA 4NX9A 1FCAA 1TR0A 2AYEA 2Z2LA 2VU5A 3NGSA 4ZPTR 4ZLLA 1FXDA 2HFOA 1XR6A 5F8MA 1WTFA 2FLLA 5CZXA 4RW7A 4RR5A 1QM9A 1JXLA 2Y8YA 3BKUA 2V2KA 3FC9A 2XMKA 3OL7A 4OHVA 2C2OB 2MLYA 3DOKB 2HIYA 1I94J 1JLAB 4A8KA 2QG9B 4M5IA 2XCAA 1UVKA 2KU7A 3B4DA 4B9UA 2HNDA 1IBKJ 3ZZTA 3EMTA 1RT7B 3MMBB 4CH7A 3ONQA 4EYHB 2VC0A 2AX1A 3D5MA 4PG7A 3JXOA 4GZ3A 4OZLA 4LQ9A 2PI4A 2DNYA 1RABB 4WP8A 5ETQA 1SVDA 2BM0A 3DI6B 1U1QA 4GKJF 1IR2A 4YP3A 4KJIA 2K7JA 1IN0A 1VHFA 2UP1A 2V4JA 5HMYA 1ZAVA 3U1MA 2A90A 4RBUA 3G8TA 3M9NB 4X66F 3HSJA 5IOLA 2WW4A 4ICLB 1E6YB 4J9VA 5DG8A 3BO4A 4TN2A 4UUXA 2FY1A 2DNGA 2XY6A 4ECWA 2XYPB 2OP5A 4KGZB 4IOCQ 4AY6A 1RJJA 4NLGA 1YI2S 1Y00A 3PIOQ 4F3OA 3D66A 1XNQJ 4F02A 1LW0B 4XDCA 2KFYA 3MEEB 2RAQA 2L08A 2FJEB 3OSPA 3WIUA 4DV0F 2XHWA 4DPUA 5F9NA 4WFAQ 2V63A 1K0VA 2W01A 4X4RA 4AQYJ 1XIQA 1HNVA 5FIIA 1WG1A 2O66A 5EX3A 1KTVA 4KR0B 1VYAA 2ABYA 1CPZA 2WBRA 4RX6A 2OD6A 3FEZA 2BE9B 3Q0AA 3MPUB 3QAEA 4DV3F 4OYAA 1HNZF 1Q8IA 3JSYA 4CO3A 3BYRA 1T8EA 1MROA 1S1XB 4LBHA 4A8XA 4AFFA 2EFOA 3J80U 2JEJA 2HMIB 2QLXA 2VFSA 3QSIA 4E0DA 3DLKA 5I42A 3QIPB 3K5PA 1X4FA 2MKKA 2HAFA 2RDJA 4Z7CA 1SKSA 1WG4A 3MM9B 5L8RC 3AHPA 3NAHA 1WEYA 1FJGF 4FZVA 3I6PA 1FRKA 3K17A 5KFMA 4ICLA 1E6YA 1CEZA 3KUHA 5IM0B 4DL5A 5LT5A 1ITPA 3ELHA 1M1GA 3SSSA 1Q16B 2R7VA 1XEZA 1GXLA 2E5LF 3PX0A 2M4MA 1U6FA 2V8GA 5LMUF 1Q5YA 4ECXA 2CZ4A 1OY9A 4IFVA 1Q82T 3PTWA 2H5JB 3AOBA 3Q2SC 3PR5B 2N82B 4F2SA 2C2DA 4DL4A 4RUCA 4H4MA 3CCZA 3DDIA 1BQXA 2CVEA 3MCOA 1RU2A 5CHCB 5CYQA 4Q5VA 2V0NA 4QIEA 1VBYA 2HAIA 4ZIWA 4OYZA 2ZE2B 3IMQJ 4KC5A 1CJUB 5J2QB 4NZ0A 1NKEA 5B08A 3MWBA 5L1JA 5IT9Y 3DDKA 1M5SA 2KN4A 1SQGA 1S9GB 2ZJRQ 4DI6A 4N47A 4QW9A 3M2RB 1BLUA 2X3GA 2VFRA 1UPMB 5G0RB 1WWHA 2DNZA 5BR8F 3TO8A 2UUBF 4P7TA 2GVZB 5IM0A 1QVFR 3CULA 1F2GA 3Q22A 5LM7E 3NNCA 1H3DA 2ZDOA 4PYAA 4NOHA 1PYTA 5GAHI 1YJVA 5KFLA 4UF4A 5CYMA 2X7IA 3GPAA 3HHLC 2E1MC 3R5CA 1S1UA 1W26A 2ZZMA 1B64A 3BKTA 3HO1A 3G87A 2F40A 3SQGA 2JDJA 2ALYB 4CZCA 1FFSB 1M90T 2IDLA 1IBCB 3AAWB 1NZ8A 1EIYB 4J9UE 1QMOE 3BPSP 4N8NA 1U0HA 5EN1A 4ERDA 4ECQA 2VFUA 3FMBA 4IKAA 4QJVA 5DGAA 2C2RA 1I6JA 4OX6A 4RJVA 4K0KJ 3HULA 3HSDA 2PMHA 1WELA 3KK3B 5F0WA 5B0FA 3MFIA 1CJUA 2JOQA 4DV1J 4KAIA 1LKZA 3D1HA 3CCES 2HVHA 2HQGA 1NU4A 3EICA 4ID5B 2M52A 4ES1A 4QZVB 1I94F 2A18A 3SFGA 1IQZA 1OYEA 3Q8UA 2FFGA 2LU1A 5G0RA 2DPJA 3S1TA 4WFYA 4Y0FA 2IFXA 5HMXA 4RLEA 2HHUA 1SPBP 2LECA 2QLJB 4O3NA 4DV2J 4WPAA 2OSRA 4B3MF 1RBLA 4QCLA 3HVTB 4DUZJ 1G7CB 2HFZA 3DOMB 2RQ4A 4P71A 5I3UB 2GHWA 1J5EJ 4O3SA 1P9YA 1PBUA 4KYZA 4RU2A 1N48A 1N5SA 1ZTWA 2V8DA 1T03A 1KDNA 2HGLA 1AUSL 3W7BA 3KK1B 3M7VA 2KFNA 4Y2MA 3UD3P 3BGOP 4M5DB 4KIAA 3CCRS 1RAEB 3I4PA 1D8YA 3CSKA 2XGQA 1Q53A 5H1SV 2NXJA 2KG0A 2B9XA 3AD8C 3H5YA 4EWTA 1NJYA 1XNQF 1UVIA 2VHGA 3QRPA 3GWCA 3C6TB 4ID5A 4NYOA 1RU1A 2MQQA 4RWXA 3UFCX 3HT3A 4AQYF 4DV6J 4Q45A 2VG7A 2RMLA 3R9LA 3I9V9 4IH6A 2AJQA 2PO4A 2HEKA 4UYKA 1X0FA 2GV1A 1M1HA 3PRDA 3NBPA 3AD9C 2MQNA 2RNEA 4GZ6A 4P2SA 3D68A 4Y65A 1EETB 1X4EA 1DHMA 4LJMA 4ECTA 4GZ5A 4JOUA 2F4VF 3MM8B 2IMOA 1URRA 2MY7A 1W7WA 2YKAA 3MHYA 3LP0A 1GEHA 1TKTA 5LXRA 3TARA 3BS9A 3JQKA 1EARA 5DETA 3RBEA 3KLIB 1Q1KA 4C0BA 4C0HA 3T19A 2QN6B 4F8RA 2FJXA 3C6TA 1U1RA 3LQVA 3B6BA 2HBYB 4DMZA 3BSOA 1S6QB 3V6HA 1IXKA 1NHVA 3K0JA 2NPFA 2ASDA 3QRRA 1KTQA 1NUEA 3KDOA 3ISZA 2MB0B 2ZZNA 1FE0A 3H5UA 1DTTA 3SSQA 3UWTA 4X64F 4BLGA 3IR7B 4K7QA 2MKIA 1KVJA 4A8MP 1TU0B 3CCWA 2EI5A 3TU3B 2E5GA 1I1GA 3TEGA 2ZJPQ 2H9ZA 4ZVTB 3FRYA 4FDFA 2DK2A 2J9DA 5HANA 3OSNA 3NY0A 4J7CA 4XAKA 1EX8A 2HFUA 1GMWA 2H1YA 4FVMA 2BX6A 2VG6B 4USTA 3GSDA 3RRHA 4F04B 5KFAA 4P6QA 1HD1A 2IRUA 3TWZA 2CFXA 3CDEA 1GH8A 1IJEB 4M5MA 1UWAA 3IN5A 3F44A 3L7UA 5DGBA 5ETOA 3DLEA 3TVZA 2FJWA 2BOAA 3M1VA 4RNHA 1YTYA 4DLEA 1S6QA 2L48A 1KLMB 3US5A 1SIZA 3GV7B 3J81j 4DWIA 4C8YA 4PEOA 4I1TA 5LOQA 3C14B 3TA2A 1SIWB 3ZTQA 3T41A 2HK3A 3OFGA 3PHTA 3FCWA 1UTAA 4WFNQ 4K0KF 4DSFA 1FFWB 1UFKA 2F5GA 4HTJA 1V6HA 2RRNA 1TL1A 2XSFA 2UUAJ 3DRPB 2QYGA 1TELA 1T9XA 3HD1A 1AROP 5SZTA 2FYXA 1K0TA 2OEMA 3RW6A 2D3ZA 4KPYA 4UUWA 5KFZA 1BC6A 3CO0P 2BANB 2XZTB 1BQNB 2XGPA 2R8IA 4EFAC 3HMJG 4ES2A 2DNMA 3EVOA 3M05A 3DU5A 3T9NA 5HROB 3A12A 1GMWD 3TNVA 1KKHA 3MCMA 2OGUA 1Y5IB 1NSKL 1VQSA 4DEZA 1D1UA 3LTOA 4ZVHA 3HSZA 3GQCA 3ZTSA 1QAJA 2GJ2A 2L9WA 4GVBB 3BGLA 1RADB 3V5RA 1R0AA 1X4RA 2OFHX 4NZ7A 2VASA 1FK9B 2PMWA 2M8HA 3HHNB 4NLQA 4ELUA 3C14A 4KH1B 1RWPB 3P5BP 2FHKA 4IR1A 1X60A 3CT9A 5K8PA 5F8IA 2UV8G 4U95A 5K8NA 2Q6BA 3H5SA 2YKNA 5FLXY 2V8HA 2DHGA 4ED6A 3SBMA 5FDLB 1FNMA 1C0TB 3VGUA 1C0UA 3LH2S 4EO8A 1QAXA 1YJNS 1IR1A 4CLFA 2AIRB 1RLCL 2QX0A 3K8VA 3MMCB 4P9SA 1KQGB 1PAUB 4I68A 1NHKL 3ZZYA 4G1QB 1VQKS 3PX4A 3H98A 4ZVUB 4DCOB 1R27B 2J9DE 3T5HA 2H3EB 1Q4RA 2RQCA 1QJHA 1D9DA 4DF8A 4JI4J 2HGNA 1AZSB 1RP5A 1I51B 3P5TL 1FHTA 4PG4A 3BO2A 3MEDB 1ZH5A 2LQJA 2W2MP 5D0EA 2RF2A 4RW9A 2ZH6A 4URGA 4U67Q 7AT1B 3V6JA 3CD0A 2W9CA 1R6VA 3MAAB 2VOOA 1BMQB 2V69A 2BOPA 1YQHA 2OELA 2OO4A 4YHHJ 2CZVC 3DRYA 3M8PB 5THWA 3FNNA 3RBXA 2C3PA 4YR2A 1Y11A 3CVKA 3UDLA 3K5LA 2WVFA 1QAYA 4WBFA 3VQSA 1AUDA 1RTDB 3K8WA 3VR1A 2EFNA 2DR9A 4DL2A 4JV2A 2JHEA 3BR8A 3PW7A 5IXUA 3MAHA 5AXLA 3M32B 3CJ5A 5CABA 3ZNUA 3I0SB 1X4GA 2FVPA 2W9AA 3LAMA 3KLEB 1OPZA 3OR1A 3THVA 3P8BB 1AZSA 5KFEA 5LXYA 2P9CA 1FWLA 4AUKA 1PGZA 3KG4A 1K1SA 3KJNB 4Y00A 3N0VA 3NMAA 3QGGA 1B3TA 4P52A 4ENOA 1YKWA 1K73T 4YOEA 3H59A 4NXMJ 2CDRB 3VZIA 5KFBA 3EWGA 1JIHA 4K5SA 3OFFA 2E1PA 4HVZA 1BWEA 4KKOA 3DYAA 1JJ4A 1SJ1A 2XI2A 1HD0A 1HPZA 1ZM9A 2MZTA 3T1YJ 2RQKA 4LF5F 1S7IA 2VONA 2IDEA 1TK0A 2RUGA 4QPTA 3T1AA 2BE2B 4F50A 1V3RA 5KFCA 1FKPB 4YY3J 2FLOA 2AEFA 2R8GA 5GAEU 4KO0B 2QLFB 3DGPA 4LF8F 2Y3YA 2UUAF 1OPIA 2MY8A 3RAXA 1REVB 2J9EA 2BDPA 4IG0B 4EZ6A 4C11B 3CJKA 2G4BA 5KT7A 1N6QB 4X62F 3TVYA 3OXGA 5FD1A 2IJRA 2Z8QA 4YN3B 1RAJA 4FXDA 3EZ5A 1N34F 2IC3A 3CCUS 1WKJA 4RU9A 3POTA 5C24B 2JLEA 2GA7A 1ZAXA 3DNCA 3ETOA 4MK8A 2VA3A 3C15A 3KDNA 4JV1A 1Z2LA 2Y1JA 4MK9A 5J2MA 2NUHA 2QMXA 1HNIA 3CGIA 2M70A 2X1FA 4U8YA 1ZA1B 3HJVA 4LRDA 4N56A 4UW2A 1VQNS 2J8SA 3UR3C 4ANDA 8ATCB 3PIPQ 4NLTA 5J2NB 4DL6A 4FF2A 5E3RA 5E2QA 4EU0A 3AB2B 7FDRA 4OZ3A 3O5TB 1RISA 1MN7A 3UD4P 1S6PA 4WXOA 1BXNA 4JI6J 3CO9A 4OYMA 4KV8B 3FRZA 3CB4A 5KFGA 2FVRA 2CPYA 4L6V3 1U1KA 1CS4B 1U7LA 1F3VA 3MF5A 2M3DA 2H5IB 1REVA 1BY9A 1F5BA 3QWUA 3VAJA 2FJVA 5GAGU 4C11A 5J1EB 4MIWA 3SFUA 3PE3A 3KMQA 2V4QA 4UYJA 1MLAA 4O23A 5FJ4A 4IFYB 2QZ8A 5KAKA 3NCRA 1UZHA 3WBZA 3DFEA 1YHQS 4FXVA 1QLNA 1JJCB 1FX2A 3C6UA 1F9EB 5BYSA 4W4MA 3MCNA 5KTQA 1IKYB 4MKBA 3K58A 1C4CA 2COLA 1WHYA 1VC6A 4HI1A 3BGUA 2UUCF 1YZ7A 1SKWA 4TVAB 3PY8A 4CNYA 2G2ZA 4Y3CA 3FBFA 5J2NA 4DG1B 1KOOA 3JB9k 4P73A 4HT7A 2C28A 4R8UB 4C8MA 4DL3A 4WK3A 2JC0A 2HG4A 2DK6A 3NGUA 2D41A 4WXWA 1X4CA 1OMSA 4CTAA 5JXSA 4OHWA 4LUBA 2DISA 1H2TZ 1RWXB 1A6LA 2BEFA 1FWKA 1RAOA 1GK8A 2WSFC 2YX7A 4USJC 5J1EA 4WZMA 4M8LA 1JK9B 3DHXA 3CMAS 3TAMA 4MFBB 2OH2A 5AXNA 5E0OA 3DLGB 2YQ0A 2DITA 3CW2C 4I69A 4F0KA 2BJDA 2IAJB 1LWEB 3O8WA 3FEXB 3I5BA 2O3DA 3DU6A 1XK8A 4ZK7M 2JVOA 4AKXB 4USWA 2EK1A 1AYEA 3QZ8A 1RE1B 2ZC3A 2UXCF 2VBZA 1S72S 5M2PA 5D3GB 2W2PP 3N4WA 3CCVS 4FKXA 1UEUA 5CCMA 1M5HA 4DG1A 3D9BA 5DLGA 1PSDA 4MYUA 2NR0A 4LRFA 2A6MA 1BWVA 4I67A 2M7SA 2J0XA 4DXLA 3UE2A 2FIUA 1WEZA 4H4KC 3R8YA 5DDRC 3FSYA 2DXEA 2JX2A 4IOAQ 4N3CA 4NYPA 2B7CB 3QBCA 3TJAA 1S5ZA 3ET6A 2XYHB 3FFIA 3CCSS 1SB6A 2NXNA 3UN3A 1ZPWX 2AF6A 3PDNA 2GMHA 4LQ3A 1XR7A 4ZVPB 1U49A 2FC8A 2MXYA 3X3UA 1EP4A 2PD1A 5K14B 4WWSA 2X5HA 4CO2A 2PMZD 3OFEA 2V9WA 3H4BA 1OO0B 4RBVA 3MECB 1KS2A 3MM6B 4AXJA 4WYWA 3OL6A 3KHRA 3GU0A 4J9NA 4FPRA 1WF1A 3PYEA 5BYRA 5HBMB 3KLHA 2W8LA 3TZWA 2P9GA 3UI3A 5KFVA 4NI2B 1OY6A 2VFVA 3CCLS 1FRXA 2HWIA 4WFBQ 5IT9U 5B0CA 2NZCA 2LYVA 1EKSA 3IM9A 5KFKA 3I55S 4OHXA 4DR1J 3PEHA 4C0OC 3SK1A 4HHHA 3CNQP 4ZPDA 1U09A 1C1BA 2QYCA 5KFRA 3OTOF 4NA1A 5KG1A 3EXYA 3SIPB 1QTNB 2GGPB 3OL8A 2ZH2A 3LW5C 4IG3B 3HFZB 4HR2A 5HLFA 1VR6A 4DU8A 3L09A 5L1LA 2ZZTA 4ECVA 3NP5A 1NKCA 4F0HA 3HSGA 3V6DB 4ZOSA 3NGKA 3AXKA 1S1WA 3SCJE 3HHKA 4H4KA 3MOJB 4QWEA 1FT8A 1MMNA 2AYGA 4KBIA 5HQMA 3NL0A 2DXDA 4DX7A 4ZJLA 1XNRJ 5CD4H 5HBMA 3N6NA 4PZVA 1X8DA 3UVJB 4C9DA 3A3NB 4E2FB 3W9IA 3H25A 2HBRB 2ZITA 1HHTP 3HHEA 1LWCA 1R6YA 1HWIA 2CRLA 3RRKA 3S7RA 3V81A 3QPIA 1KQKA 2ZJQQ 1SL2A 4A8WA 4ILLA 2EC0A 3KMSA 2YY3A 2N3OA 1UZDA 4CLPA 1NKBA 1S99A 4BHQA 2RKIA 3I5AA 4OJHA 3OJSA 3AT1B 2H4YB 2WONB 1RHQB 3CJRA 2G0IA 2JLGA 2CQ0A 3IR6B 2D9OA 4CLZA 1XMQF 1RGVA 3JSMB 2HNYA 2V5HG 1U6ZA 4IDKB 4PUOB 4IG3A 1U1MA 3Q23A 2BYCA 4LR9A 3FZ2A 4DR6J 3PXGa 2EKYA 2MSSA 2UXBF 1WG5A 1CLFA 1KWMA 4OJ1A 2FZCB 2BMBA 1TL7A 1SBRA 3KLFA 1HWLA 2RSQA 1UW4A 2ZHAA 2HVDA 1RT2A 1T11A 1R43A 2F1FA 5ETRA 2W4PA 4QQBA 4NEYA 2CPJA 3DM2A 1T7PA 1G6BA 1TFYA 1VISA 4G1IA 2N4DA 3NXZA 1UEKA 4O0NA 1GTEA 1FVQA 1UL3A 1WORA 4DL0C 2LXFA 1HHQA 2LQ5A 5H9FJ 4CQ1A 4ZPVR 3Q8RB 3EZOA 3Q8SB 2E1AA 1JLEB 3F41A 5AE1A 1ZM2A 1X0PA 3TX8A 1NSAA 2ZH5A 1WTBA 1PJ7A 1ZYQA 1HR0J 1SC6A 4NXNF 3PKMA 2QLWA 1SUQB 2Y0BB 1HI0P 3R5BA 2FQQB 2M2BA 4B3TF 3QJJA 4TY9A 3TJ9A 2W8KA 3JSMA 3I96A 4A8SA 2YQ1A 4IDKA 4AE5A 1V9OA 1VK3A 2ADBA 1YSJA 3TUIC 3EM1A 1SJ3P 2HHPA 1PYSB 2BZ2A 2ZVSA 3RR7A 4KB7A 2LLZA 3C19A 2DHSA 1F9FA 1TZ0A 1CJKA 4JYAJ 3TJ8A 4JI8F 2F9DA 4IR9A 3MPDA 3EE3A 4IQXA 1UKUA 3BQ2A 2VIHA 4L75A 3WZ0A 5D4LA 3D1OA 2BKOA 2P8IA 4ZVGA 1TL3B 1RA6A 3DDNA 4H4OA 2WK4A 4M5NA 1VI7A 5L38A 3MMAB 3DLLQ 1VRQC 4X4VA 4M95A 4RW4B 2W2OP 2Q79A 4XIFA 4B9TA 3TOQA 2HRUA 2DGUA 1XR5A 1JLEA 4ZPWR 2OPSA 2FB0A 4Z37A 2K8GA 3MD1A 3GB0A 2I6WA 3UCUP 2XMJA 4MJKA 4IO9Q 1SXLA 1QD1A 4C3MA 2VL1A 4J37A 4RNFA 3VAGA 2YWEA 4RW8A 1ZAWA 1JLGA 1WOPA 1TUVA 5CCLA 2D3O1 4C8ZA 2ASYA 4NA2A 1LWFB 2NQPA 2AQ4A 2JVRA 4DR5J 4KY3A 4C97A 4PKDB 4XDDA 4KGMA 5A8RA 5JJBA 4KFBB 4DR1F 5L39A 1RTHB 3JTNA 4I64A 1P1LA 3P4UB 3H2UB 1S76D 4XK8C 2GHVC 2CQPA 3LGNA 4F4WA 4OYOA 3ILLA 2RU9A 3Q24A 2CQ4A 4G65A 2NXEA 5AXMA 4UY8T 2ZKTA 4DN9A 2L9NA 5A8WB 3FBCA 4ZN3A 3I0RA 4LIWA 1RAGB 1F0XA 2OPRA 5IFMA 5GADI 1Q81T 3RB6A 4QIWD 2VG5B 1WF0A 1FD8A 1NXIA 2DD8S 1JLQA 2RRBA 2GVDB 4ZLPA 1PG5B 3M30B 2XO6A 4DX5A 5BXIA 1DTQA 3SV3A 1CJVB 1HKAA 2M5YA 4O44B 2CG8A 1BHNA 1K1QA 2YNHB 3BSAA 2FHOB 1LWFA 3SQOP 4HDHA 3MXHP 4QOTA 1CULA 1FXRA 5KT2A 2BJ9A 1V5VA 4PQAA 3MR7A 1HW9A 2YNIB 2ZC4A 1IKVA 2YKMA 4R5PA 3NS5A 6FD1A 2LDYA 4LF7F 2XWXA 4NA3A 1T0TV 3N5FA 4TY8A 3HDSA 4I7FB 3QQCD 4C3LA 3ZZ0A 4A8QA 2CPDA 3CJ0A 4PWDA 1WSRA 5AE2A 2CJQA 3DRRB 3BM7A 1EZZB 1HBOB 3WIVA 3VAMA 2BM1A 1B0TA 1GT8A 4GMKA 4N3AA 2J6UA 2QA2A 1N52B 1F5CA 1P9QC 1FRHA 1WJ9A 4TYBA 4F4AA 1AXQA 3NLCA 2R2UA 2JNJA 3EGNA 5C25A 2KRRA 3QLHB 4ED1A 4FYDA 5CH7B 2ZBCA 4LFAJ 4MAKA 1WC1A 3NRBA 4TXSA 1ULRA 2KYZA 5HJXA 1HHSA 3Q8QB 1SL1A 2V6AA 3QO9B 3MTKA 3G2XA 5JVHQ 1QAIA 4Q2MA 3UN5A 1CJVA 1CQNA 4O44A 5FLXU 4O0IA 1SH0A 2VQFF 3PW0A 4WP9A 2GIRA 2W25A 4QR1A 3ZTOA 2XZDB 3UR0A 1T05B 2EKNA 2E66A 3SZ2A 2HS3A 2YNGB 5E3QA 2N7CA 4L72B 2KI2A 1HQUB 2KZMA 3GCWP 1FO1A 1NSPA 5CYJA 1U0SA 4B3SJ 2JFKA 3JYTA 1NK8A 2D7SA 2PA3A 5D4OA 1U7IA 2UXDF 1F2HA 2CG4A 2Z58B 4OLPA 3UDEA 3R7BB 2XTJP 3IWNC 2O67A 4K2JA 1VQ5S 2APOA 4OZ0A 3B54A 2IM3A 4JYAF 4Y2KA 2L41A 2XQCA 2VPXB 3QLHA 1FX4A 3ENAA 2BRKA 1RHJB 3VV2B 2NXCA 1QDUB 5KG5A 1YK9A 1GAOA 3Q89A 4ED8A 4CIOA 3MR6A 3QO9A 2AP6A 1IR0A 2FY8A 3AD7C 3UD5A 3KNAA 4EGLA 3KJQB 5AOXA 2XM3A 2H54B 4CM2A 3GYXB 1D9AA 2WBMA 2Z2YB 3M6UA 1O6XA 2DNNA 1WD6A 1JWWA 1RCOB 1IM4A 3ENWA 3IS9A 1TKZB 2V8PA 4LSNA 1DBDA 4QPXA 4Y34A 5GMKa 3MUMP 1R8BA 2KJWA 2AJ0A 4F36A 2Q66A 2B7BB 4MIAA 1YG0A 2GO9A 1JLBB 3D54A 3TUPA 3HD2A 2WZ1A 4G1PA 1N5TA 4ED2A 2V68A 4JI7J 2WCXA 2ERRA 1RBOB 2ZBPA 2NZ4A 2E1RA 4DR5F 2KHCA 4UOFA 5KG6A 3RTVA 1GTHA 3GP9A 4IRDA 4O3PA 4K4YA 2BJ7A 4HACB 2YXLA 2ROEA 1PCAA 5IV4A 4OX9J 4ZITA 1L5UA 1O51A 2I1RA 3NGDA 5ETKA 1TP7A 5F3TA 4RPFA 4LFCJ 3HPOA 3W2WB 2KB2A 1AA1B 4GKKJ 3MAQA 4EK2A 1Y3JA 1DQAA 5B0BA 3PVXA 2RQMA 5A2QU 4O4GB 3THPA 2N4CA 3ILIA 5E3PA 3BQ0A 2ASJA 4K4UA 4MKAA 5KG4A 1G1XA 3QFWA 2FGOA 1GXUA 3A8IA 2JFDA 2HHTA 5IWAJ 4BS2A 2QT7A 3CJ4A 4IOBA 1YBAA 3EDQB 2XEXA 4BDPA 4U7UD 3CF5Q 4ER8A 1IUJA 5HK4A 1PILA 4OYWA 3IWXA 4NMXA 3H5XA 2PE8A 4X4NA 1SV5A 1H6KX 3OD2A 1RTIB 4NCGA 4A8OA 1S1TB 3JQMA 2HZCA 2EBGA 5DDQC 3R97A 2LDIA 5H9EK 4FBTA 3C8YA 4EMDA 4CI0B 4CO5A 1RAHB 4M5JA 3ISND 5H9FK 2QLBB 3CXCR 2G0JA 2DNRA 1ZETA 2CZ9A 3CTRA 4DS4A 1K47A 2PGCA 2RVJA 4DPWA 3MEGB 1X4DA 3AJDA 1V3SA 4DQQA 2UU9J 2LXIA 2AZ1A 2DGOA 3QT5A 4ZJOA 3RYLA 4LF4F 4O4GA 3GJSB 3BO3A 1R31A 1LW2B 1X5TA 2I5JA 3I4HX 4KQZA 4OX8A 4YB1P 1HQ2A 4DU7A 2F4FA 1XMOF 1FI4A 1BQMA 4OJGA 4LFBF 2KVQE 1HI1A 1NRKA 4UTGA 3TA0A 4RKUC 2XLIA 4GRSA 2RDDA 3TRGA 1YIJS 1S1TA 5DG9A 2CPZA 3B8HA 1J5OA 4X84A 3KK2B 1XTZA 4K4TA 1S0OA 3NNAA 2Y1IA 1RT5A 3VALA 1N33J 4UZCA 3KTQA 2JJ4D 2A10A 4CLUA 4DPOA 1NEEA 4ZN1A 1A7GE 4YUDA 4V19X 1HWUA 2DGVA 3DOLA 3NAIA 4F4YA 4RW7B 2C42A 4WFZA 3N6MA 4RUHA 4DV7F 1B0VA 3Q86A 4ID8A 4KGVB 4DUYF 4AT1B 2DXFA 1YRXA 4J5OA 1RWUA 4LR7A 4ECRA 2VPWB 1FERA 1HARA 2AW0A 1R8CA 2R7OA 1S77D 4DR2F 2HNDB 3A8KA 1KVIA 4EI2A 1B4SA 3QFHA 2VV5A 1LW2A 2QO3A 3GZ7A 2R7SA 4AY5A 1YZ6A 1NNDA 1X7VA 3UDCA 4HHJA 2ZOMA 5DLFA 3LP1B 1CJTB 4DF4A 4LRCA 2OEKA 1VQYA 4XIUA 2AEMA 4I2QB 4DV5F 3VGSA 2ZD1B 3LAKA 2GX8A 1SKRA 1MU2A 5KFPA 1NCLA 4RW6A 1HNWF 1HLWA 3H42A 4ATNA 2KXHA
chains in the Genus database with same CATH topology
4J9PA 3MURP 1V3ZA 2DGTA 5LXYA 2X1GA 2P9CA 3G6XA 4BCAA 2V4JB 1NJXA 2R2RA 1QY7A 1WHVA 4AUKA 1PGZA 3HZGA 3KG4A 1K1SA 2B9WA 1MWYA 5KT5A 3V3LA 1ZZFA 3KLGB 4WIIA 3MI7X 5A8WA 4NMLA 2UUWA 4NCBA 4Y00A 3B4MA 5U47A 2POKA 2FC9A 3N0VA 2CPXA 3NMAA 1UFWA 3QGGA 4QYRA 4RUAA 4JI5F 4F4XA 4DR3F 5L1KA 4ETZA 2RKIB 3V6KA 3TAXA 4DS5A 2AYMA 2YKPA 4O3OA 4XO0A 3Q8PB 3HVTA 1HQEA 2V8VA 4FBUA 2CPHA 1HYSB 3DOMA 2F7VA 1K73T 1JLCA 2VG5A 5F8GA 5I3UA 4PRFA 2FHMA 2HNYB 3ZZRA 4CO0A 2MKJA 3OVBA 5J1PA 1X5PA 2VZ9A 4YOEA 2D3OR 3H59A 1H7XA 3CDAA 3I5CA 2ZH8A 1VRTB 2PSZA 5KFJA 2MGZB 3M30A 3U02A 4GYYA 3VZIA 2VH7A 3UCGA 2IRXA 2GJIA 5KFBA 4ILMA 2UZAA 3FDSA 2DH9A 4N76A 2VPZB 5B7WA 5BJRA 4AL7A 4JI6F 1JIHA 2YNHA 2XMUA 3K2YA 3OFFA 4K5SA 3VAKA 2XS2A 2NS1B 2CDQA 1L3SA 2SXLA 3HVRA 3KK1A 2B43A 3T1HF 4ES3A 5KT6A 4HVZA 3G8QA 3R5DA 4KKOA 1BWEA 2I8EA 3R1HA 4XI9A 3DYAA 4KT0C 3KHLA 2C2EA 3T6BA 2JEIA 1HNVB 3ITHB 4M5DA 1TKDA 1JJ4A 4QBUA 1SJ1A 2YNIA 4JI3F 2XI2A 3ISNC 1UJ4A 4QR0A 2G9OA 1LK7A 5E5NA 2AYBA 1HD0A 2XULA 4YQWA 1HPZA 3KLFB 1ZM9A 4NYZA 2MZTA 1WI6A 5BYQA 5DDPC 4DN0A 1XBWA 4OIXA 3OLAA 2JC1A 5DDOC 1RT2B 2RQKA 1VRUB 3IC1A 4LF5F 4GO7X 4I6WA 1XMBA 2MYFA 1DARA 4D3HA 2IA6A 3I9ZA 2VONA 1TK0A 3CWJA 3GV8B 2RUGA 2DB1A 4I7FA 2HHWA 2P6SA 4QPTA 4E98A 1RQ0A 1MROB 3T1AA 2BE2B 4MYTA 4F50A 1V3RA 3DM2B 2QEXS 3LP1A 3SEOA 2XMTA 1UWBB 4QR2A 5KFCA 2AGQA 1FKPB 4N8OA 3VZHA 4LFCF 4B3OA 2FLOA 2J7WA 3HK2A 4ILRA 3M6VA 2RB7A 3DRRA 2EWHA 3LALA 3MM7A 1HBOA 2R8GA 2P5VA 1UAWA 4EBCA 3DLKB 4ZHRA 5I42B 4ECUA 4GKKF 5GAEU 4I2QA 4KO0B 4OQJA 2XO7A 2R2TA 4C8NA 1N54B 3DGPA 2ZD1A 1N36F 4LF8F 2NSBA 3W3SA 1R89A 2UUAF 2ILZA 4KHRA 3DXSX 4LVNP 2BW2A 1OPIA 1VBZA 3EGWB 2OIHA 1G2EA 5L1IA 2DRBA 3PACA 2MY8A 2LVWA 2QMWA 2CQGA 5KG3A 3RAXA 1REVB 3AA8A 2J9EA 2BDPA 1XWLA 2XSJB 1X5OA 2DGQA 5D4PA 4JV5F 3LOUA 4IG0B 4EZ6A 2YTCA 4C11B 2FDNA 2DPIA 5IZHA 3CJKA 3KLGA 2G4BA 4DFJA 3R27A 2VBWA 2R7QA 4O4RA 5KT7A 3MR3A 4HH0A 3TUZC 2BJEA 1FF2A 3TVYA 4X62F 3OHAA 3G86A 1N6QB 4CT8A 5HP1B 4OZ1A 3CDWA 4ELVA 1Q7LB 3OXGA 5FD1A 2R8KA 2BQUA 2LU2A 1JMTA 1R7IA 1RTJA 2Z8QA 3KYLA 2HQIA 3TI0A 4ZCKA 3WX4A 1RAJA 3M8RA 2K4NA 4FXDA 5C1DA 3EZ5A 1N34F 2IC3A 1VLYA 3GR1A 4X65F 3CCUS 2CQ1A 3BGFA 4RU9A 1O5JA 4KE5A 4LIRA 5F41A 2DNKA 2Q43A 3POTA 4C8OA 5C24B 1VQ7S 1EETA 2RIJA 2JLEA 2YH1A 2GA7A 1KQSR 2QRRA 4NLUA 2YVSA 1ZAXA 3DNCA 3ETOA 4IFVB 2ILYA 2F8EX 4MK8A 3RB3A 2HIQA 2VA3A 2MGZA 4MMOA 1SJQA 2M0GB 1W25A 4JV1A 4HH1A 4OL8A 1WEXA 1Z2LA 2MHNA 2W7AA 4JBCA 2Y1JA 4MK9A 2XI3A 2NUHA 4JI2F 2QMXA 5J2MA 1HNIA 3CGIA 2M70A 2I0XA 2X1FA 3MM8A 1VQ6S 2DH8A 2CQ3A 4V19J 2WHOA 1M5VC 2EBEA 4N56A 2C3OA 3CDBA 4H4MB 4K59A 4UW2A 3GMGA 1VQNS 4EEYA 2NREA 1JXEA 3UR3C 1OS5A 4QWAA 4R0JA 2AD9A 3G9CA 1U1OA 3OUYA 3PIPQ 4NLTA 5J2NB 4DJBA 4EBEA 5CYQB 1YJUA 4WCEQ 5I3PA 4DL6A 1T05A 4C8KA 5KG2A 1U2FA 4Z2XA 3FQKA 1RT1B 4FF2A 1KFSA 2VPYB 1RYRA 2V94A 3R3TA 5E3RA 5E2QA 4CH1A 2YNGA 4RBTA 4EU0A 3AB2B 7FDRA 5K8OA 4YR3A 3O5TB 3SCKE 1RISA 2DGWA 4C98A 3UD4P 1S6PA 2DNQA 2GMLA 4M94A 1HQUA 2VUGA 5I4MA 4WXOA 3UNGC 3GIIA 4ATNA 4I6AA 4FF4A 3CO9A 3P49B 4KV8B 5H9EJ 3PV8A 3X1LB 3KLIA 2R7TA 3FRZA 3CB4A 2IMWP 5KFGA 2FVRA 1LOUA 2CPYA 1JNRB 4L6V3 1LFWA 3BGRB 1U1KA 2DHAA 3BSNA 1U7LA 4OZ5A 2D74B 1WNEA 5CQGA 2RU3A 3CCJS 4FNHA 4H4OB 2EPIA 3MF5A 1OIAA 3GV5B 2YWHA 3SCLE 4R25A 1Y5NB 2M3DA 3LWLA 1DQ8A 1NK0A 3I32A 5KFTA 4OI1A 1REVA 2ROGA 1JJHA 3MUTP 1BY9A 3HFKA 1F5BA 2GW8A 4QU7A 3QWUA 2EFQA 3VAJA 2FJVA 5GAGU 1QVGR 3WC2A 2OPSB 5EHHA 2KT5A 4C11A 5J1EB 1YRUA 2PN6A 4MIWA 3SFUA 3C46A 1P27B 3F56A 3LO3A 3PE3A 3M9OB 3FMWA 4ZVEA 2V4QA 3KMQA 4UYJA 2G13A 2E7XA 3VWSA 5HP1A 1T3OA 3LANA 4O23A 5FJ4A 4IFYB 1NH7A 2OKQA 5LSOA 3QGHA 2QZ8A 2F3JA 3D0HE 1N5YB 2OAUA 3AB4B 2K3IA 1FE4A 4O3QA 1PC5A 5KAKA 1Y9OA 5D78A 3NCRA 2WB4A 2NSCA 4J9MA 4J9SA 3G4SS 1JLFB 2I9SA 5IT4A 2YWKA 5CYMB 1N32F 3WBZA 2B5JB 2ZNYA 2CJKA 3RAMA 3DFEA 1OSCA 4RW8B 4OX7A 2B0GA 4FXVA 1YHQS 3G6YA 5EX0A 1QLNA 3SSRA 5I3QA 1JLGB 1S1UB 4P7VA 3C6UA 3OW2R 2XS5A 4TLRA 1NK4A 4TNOA 5K5MA 5BYSA 3HLUA 1FJCA 1U25A 1M0SA 4A8FA 1FJ7A 4PXEA 3IWLA 5KTQA 3CUNA 1UVMA 4WKRA 1IKYB 4KHPF 4MKBA 4ALZA 3K58A 3SQGB 3RU0A 1C4CA 2COLA 1WHYA 2CKWA 4HKQA 2VQEF 2O1PA 4QWBA 2EW9A 4I56A 2RRAA 2DGXA 3DMJB 2IM1A 5A8RB 2C22A 1TKZA 4B9MA 3OL9A 3EZUA 1VC6A 1FNXH 4USIA 3T5LA 3TVKA 4HI1A 3BGUA 2UUCF 2IVYA 2B3TB 4FF1A 5KFWA 4LF9F 5DQIA 3MCSA 1RYSA 4UOCA 4NLXA 3KNAA 1SKWA 3PY8A 1UJRA 1IBMF 4NLSA 4CNYA 4QWDA 1B0PA 4Y3CA 4DQIA 1J2VA 2FHJA 4J9OA 1N4LA 2JLFA 5J2NA 4URSA 1S79A 3F73A 4DG1B 1KOOA 3JB9k 2XZWA 1KLNA 1RT1A 2Q1LA 4ZDNA 1FRLA 1JNZB 2VG6A 1JLBA 1N0UA 3BREA 1S49A 1TKXB 4HT7A 2Q3PA 4HLBA 2C28A 2LEAA 5JUMA 4R8UB 2MZJA 4C8MA 1FRJA 2NXUA 2YNFB 3E8OA 1TL4A 3OMSA 3I87A 3H2LA 4DL3A 3OV7A 4WK3A 2JC0A 2E1CA 4WK1A 2HG4A 3K5MA 5CXTA 2GFFA 2DK6A 4G6VB 2DIVA 3J7YI 2D41A 4WXWA 1N56A 1X4CA 4CTAA 4WU3A 5M2UA 1S7HA 1C1CB 5JXSA 2ZDPA 4OHWA 4LUBA 1KQFB 2KYXA 4BWMA 3PO5A 2DISA 1NZAA 2MQLA 2WRMA 1H2TZ 1VGYA 4TQSA 3MDFA 3R5AA 2MQMA 1A6LA 3MPYA 3VF0B 4TQRA 4WF9Q 3E2EA 2WSFC 2BV3A 1KLMA 2YX7A 2VD3A 3U27A 1G3OA 4USJC 4F2RA 2Z2MA 3GIKA 2B6AA 5LSLA 4MH8A 5J1EA 3D2WA 4WZMA 4M8LA 3KNGA 1JK9B 3DHXA 1N5QA 3CMAS 3RAQA 3TAMA 4MFBB 2XLJA 2XWYA 3GYNA 3ZC4A 4CO1A 4DFKA 2OH2A 3I0RB 2KT2A 1BGXT 5AXNA 2D3UA 5KFYA 3W2WA 2OPRB 1VK8A 5E0OA 5KFOA 4YR0A 1SQEA 3DLGB 2DITA 4I69A 4ECSA 4K4ZA 2BJDA 2A1BA 3IXQA 1JLQB 4K2XA 4LT6A 2WOMB 1WHXA 3TANA 3DRPA 1KR4A 2IAJB 3SDEB 1Y7PA 4CDRA 2B5JA 1LWEB 3PFOA 1JB0C 2AJFE 2KO1A 2L9DA 3AY0A 2W9BB 5IQQA 2CPEA 5M2RA 3O8WA 1Q86T 1DTQB 3G71S 2KKHA 1T03B 1QE1A 3FEXB 2CPIA 1GNKA 2LEBA 5CA5A 3I5BA 3THTA 3QYYA 1HNXF 4PPDA 2O3DA 3C2PA 3DU6A 1XK8A 2JRSA 4ZK7M 1IQTA 2JVOA 2QSWA 2MZ1A 4AKXB 3RR8A 1S1VB 5DJBA 1CVJA 3CCQS 2EK1A 2BANA 2R4FA 3L95X 1KC8T 3QZ8A 1BQNA 1FTCA 5MLCV 4JI1F 3D0IE 2ZC3A 2UXCF 2VBZA 3DMJA 4BBYA 2Z0GA 2ZHOA 4PG5A 1S6OA 1VQ4S 1IKVB 2YKMB 1S72S 4R5PB 3IR5B 3OXLA 5M2PA 5D3GB 1U1PA 1UFLA 2FHJD 3MUVP 3N4WA 5HROA 4NWBA 4YDDB 3CCVS 2MKHA 1PC4A 2ZOFA 3Q2TC 1UEUA 3O6QA 2OPQA 3MM5B 5GVQA 5CCMA 1ZBTA 1M5HA 4DG1A 1IKXB 1LXNA 2OMLA 1UA1A 1RDRA 2MZQA 5DLGA 1PSDA 4TY8B 3N5BA 1Z4UA 2LA6A 5AJ3F 4MYUA 5J1NA 2NR0A 4ZVFA 3PM9A 1U2RA 2EVZA 4USHA 5B09A 4X4OA 1DAXA 3DLBA 4I67A 2VKZG 3HI9A 2BUNA 1FKAF 3KWMA 5KFHA 2M7SA 3O44A 5E33A 2J7KA 1WF2A 2J0XA 1L3UA 4FXWA 1U1LA 2BABA 4PWDB 2R7UA 2YNFA 3NKYA 3HHLB 2UUTA 2J9CA 5T7LB 3UE2A 2HHQA 1SH3A 1RTIA 1WI8A 1DFDA 3QMQA 2PA8D 3V4IB 1KD1T 1TL5A 2FIUA 1WEZA 4DQPA 4H4KC 2J0SD 1FD2A 1ZOTA 2QA4S 5DDRC 2W9JA 3FSYA 3FGVA 2RSFA 5ITHA 1C1CA 2KJZA 2CJAA 4B9SA 2VC1A 1FA0A 1KONA 1FK9A 1HBUA 4J9RA 3JTOA 1DLOB 1CQMA 2JX2A 2VG7B 5C25B 5KFFA 4IOAQ 4N3CA 5B0EA 5HN0A 2DTJA 4NYPA 4X2BA 2M88A 2B7CB 5GADU 2YKQA 5C42B 1IBKF 2QSFA 2VB6A 4OV1A 4UYKB 3DN9A 3T3FA 1YITS 3N79A 4PR6A 4Y2IA 4ZA1A 4DL7A 4KRWA 2BVZA 1R8HA 1JKHB 2F8MA 3FFIA 3NBPB 1GXTA 3ENQA 1SB6A 4PG6A 3CCSS 1ZPWX 4MK7A 1IKWB 2AF6A 3S8SA 2FJAB 1XNRF 3BZQA 1VQ9S 3MEGA 2LKZA 3PDNA 2CQIA 2IHR1 2GMHA 3OTEA 4F67A 4LQ3A 3ENVA 3IRWP 1MWZA 4JUZA 5IQ6A 1XR7A 2HPUA 1MSWD 3SI8A 2VKRA 1S9EA 4NL5A 2WOMA 3HVWA 1U49A 2FC8A 3PE4A 3PHEA 5FDLA 2R2SA 2ASLA 2C3MA 4TYAA 3E01A 2B4OA 2MXYA 1C0TA 3X3UA 5HO4A 1EP4A 2PD1A 5K14B 3AQPA 2KXNB 1SI9A 2RS8A 2PC6A 4C3KA 2X5HA 4CO2A 4TKTA 3IRXB 3KJVA 2PMZD 3EUNA 3OFEA 2V9WA 4OZNA 3ZZZA 3H4BA 4FS1A 1APSA 1OO0B 5DQGA 4RBVA 4OZJA 2CJ9A 3MECB 3QAUA 1KS2A 4F25A 3MM6B