3TAXA

A neutral diphosphate mimic crosslinks the active site of human o-glcnac transferase
Total Genus 271
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
271
sequence length
714
structure length
695
Chain Sequence
b'THADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title A neutral diphosphate mimic crosslinks the active site of human O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 271
structure length 695
sequence length 714
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3taxA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3taxA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 3taxA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3taxA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3taxA03
2FO7A 5TVGA 3ZCVA 2AW3A 4M83A 3BEOA 2OOEA 3K9IA 1WUYA 4WACA 2IFUA 1WV1A 2BISA 3UPVA 4BTBA 1JIVA 3MT7A 4WUYA 3CUUA 4I2ZA 2KS6A 2G9UA 1RZVA 4ME2A 5FZRA 5G04C 3VTXA 4BWRA 3Q4AB 3MKRA 3NF1A 3DZCA 3ZCTA 2C0MA 1P2BA 1P4JA 1A17A 1O6CA 1FU4A 3S7FA 3MQFA 1ELRA 2F3PA 4X7PA 5G05C 2Q6VA 3AS4A 1GPAA 1C8LA 1WW3A 3CEJA 5TMDA 2OFFA 1HZ4A 4AIFA 4BT9A 4G23A 1E96B 4YI3A 4HWGA 2GEJA 2WQHA 1WUTA 3RO3A 3NCHA 2IYAA 1IHGA 3MS7A 2IW1A 4BQFA 5ARFA 5CCMA 1C3JA 1E4OA 2LNIA 2PQNA 4XIFA 3H4TA 1ELWA 4J8DA 1P29A 3HYMB 2GPNA 1FTQA 3U4TA 3ZCPA 1P2GA 3L7BA 9GPBA 3WC4A 3S27A 3ZGQA 3IA7A 5IKOA 3AS5A 2ACWA 3OTIA 1E1YA 4MI6A 1V4VA 2SKCA 1P4HA 3HBFA 3VUFA 2FF5A 3NP7A 2XCIA 4CTOA 5JJ7A 3MBOA 3O3CA 2G9RA 1L5WA 1NZDA 2NC9A 4G2TA 3RSZA 4EL0A 4N2SA 3AS8A 2VCEA 1L5RA 3WAGA 1C8KA 3SYMA 3ZCQA 3ZPJA 2BGUA 2PZIA 2C9ZA 2VG8A 1FU7A 4UQZA 2FETA 2C4MA 2VCHA 1F6DA 4UQYA 4WNDA 4GCNA 1LWNA 3MRTA 2KCKA 2XMPA 4UI9J 3RU0A 1ABBA 4G1TA 1XV5A 3C4QA 4KYOB 1YA6A 5FT9A 3RSCA 3PE4A 6GPBA 4HLNA 2J9QA 4N39A 1GGNA 5JTUA 1W3BA 1PC2A 3G2KA 3NP9A 3EBPA 1WM5A 1L5SA 3Q5MA 2QFCA 2G9VA 2HR2A 5ENZA 3TSAA 4NC9A 4BFCA 3Q15A 4UI9C 2QN7A 4N3BA 2QN8A 3QOUA 4J8EA 2LSUA 4GYYA 1KT1A 3CEQA 4RIEA 2GW1A 3DDSA 2PYDA 1Z8DA 2GPBA 3MTBA 3ZHEA 2HO1A 1NVKA 4RBNA 2C0LA 1HLFA 3ZHEB 4LDPA 3G2JA 3FWVA 2FBNA 3Q49B 2XA2A 2P58C 3ZN3A 3CK7A 1WAO1 4JL0A 3L7DA 2ECPA 3FP3A 1M5RA 3T7DA 2IEIA 3GZ2A 1BX3A 4N2QA 2X0FA 2XGMA 3VUEA 2UY1A 3URZA 1L5VA 4RIHA 2XPIA 2V5FA 2WTXA 4EQFA 3IAAA 4I9EA 1PYGA 1L6IA 2GT1A 2Y4UA 3OKCA 1HH8A 1QM5A 3T5TA 4KXKB 4F9FA 5I45A 1XL1A 4H7YA 3L7AA 3FFLA 4GA0A 2HY7A 4GPBA 4HOUA 4AMBA 2ATIA 5JJTA 3BDAA 1JG7A 2R4TA 4W9RA 3QKYA 3LY8A 3E4BA 4BQIA 3UUXA 3G2IA 3MV2B 1NZFA 3NB0A 1IIRA 1L7XA 4Z5XA 2VGXA 1OUVA 1IXYA 4CGWA 2WPVA 2XA9A 1JIUA 4AN4A 1GZ5A 1F0KA 5DLDA 3T3DA 3ASGA 5D00A 3BCUA 4H7XA 2QRQA 4CTNA 3KD7A 4F96A 1Z6PA 2IEGA 2QRHA 4N5CA 2DBAA 4EKYA 3UQ3A 4GZ3A 2LSVA 3MV3B 3PDNA 4WNEA 3RKVA 4CTMA 2GJ4A 5TMBA 4I2WA 3Q47B 1JG6A 3OY2A 3PE3A 1Z6QA 4WNFA 5HXAA 4RIGA 4EJ2A 1XL0A 2YHCA 3NC4A 3TAXA 1LWOA 2AV6A 3LY9A 1FCHA 4I1AA 1JEJA 2QN9A 5FJYA 5AYWD 2F3QA 2XEVA 4GA2A 2QRMA 2XGSA 3CV0A 3MA5A 5BNWA 4F97A 2FI7A 4GCOA 3GZ1A 3CUYA 1J39A 1K06A 3DD1A 3EDTB 5KJLA 1NOJA 3D1JA 1SXQA 2PRIA 3HBJA 3BCSA 3OXLA 3D0RA 2AVPA 1FA9A 3D0QA 3L7CA 2JLBA 3E3OA 3VTYA 1XKXA 3HBNA 1AHPA 4JA7A 4RG6A 3ZFWA 4M60A 3NAZA 3CK9A 3CVNA 3DDWA 5DBKA 4W6QA 1EXVA 2FFRA 3N71A 3ASFA 4BTAA 2BFWA 4MI3A 1PN3A 1ZBPA 1ZU2A 3GUHA 3UYLA 4Y6CA 2MHKA 2F3SA 5DXFA 3RHZA 4Y6WA 3ULQA 4KBQA 1XOIA 2AMVA 2VYIA 4APOA 3OXFA 2XA1A 2QLLA 5JJ6A 1AXRA 3TG5A 3S28A 2X0DA 1H5UA 3VDNB 2ONDA 2H1FA 2PYIA 4FKZA 3MTDA 5LQDA 1RRVA 3MTAA 3LY7A 2C1XA 3ESKA 4REMA 5EKQD 4G2VA 3SYRA 3IEGA 3MT8A 5LCWJ 1NLMA 3COPA 3S7DA 5KJNA 2QN2A 3OXGA 1WV0A 2C1ZA 3R9AB 4HOSA 4BT8A 2GPAA 3ASHA 1VGVA 4A1SA 8GPBA 3G2NA 3CEMA 3CVPA 1GPYA 4UI9K 3C4VA 1Y6FA 5JTTA 3HBMA 3RIBA 3T3EA 4PQGA 3SZ7A 1UZUA 2BUGA 3Q3IA 5FZSA 2PQ6A 3QWVA 3H4IA 4X6LA 4BQEA 1FC0A 5LCWC 2PL2A 3O48A 3UYKA 1WW2A 4XI0A 2UY1B 3RO2A 4U07A 3BD6A 4XI9A 3WXXA 3OKAA 4AY6A 3ZCRA 2UWJG 4GPKA 2QZSA 4RENA 3QWWA 3T3IA 1EM6A 5EX0A 5TMEA 3QKWA 3L01A 1FTWA 3CKBA 3ASDA 3CK8A 3CKCA 4N3AA 5HI7A 3GPBA 3WADA 2VSYA 2FF4A 3CVQA 3BD7A 4HOTA 4M7PA 3Q3EA 3MSCA 2ZB2A 3MEKA 5DIZA 2GM9A 3T3GA 3LKUA 1B89A 1YA0A 3OKPA 2JJMA 3TGOA 1GFZA 5IKPA 2R5SA 4YVQC 2VGXB 4GZ6A 1RZUA 4J0UA 3QWPA 1HXIA 4X7RA 4CGVA 1QZ2A 4HORA 3GW4A 3KS2A 2G9QA 5C1DA 2IV7A 4WADA 2C2LA 2QRPA 1KLXA 3E3NA 2IYFA 3CUVA 4X7MA 4N3CA 3MRVA 4MHSA 2F9FA 2VQ2A 4ABNA 4GYOA 4YNDA 5FTPA 3RT1A 2KATA 3S0JA 2QLNA 4EKEA 2AZDA 4WNGA 1Z62A 2H1HA 4QLBA 4U0ZA 2P6PA 4WHMA 5CCLA 2X0EA 4IN3B 1XC7A 3OTGA 4YUAA 1L5QA 2R66A 5KJKA 2XGOA 2IV3A 3ZCUA 5KJMA 3S7JA 2YQ8A 4B94A 2ACVA 4NQ0A 2KC7A 2IF4A 3CVLA 3KAEA 3LCAA 3LPZA 5EX3A 3NPAA 1SXPA 4AM9A 4LEUA 5HQ8A 4G25A 1GG8A 4L22A 2R4UA 2QRGA 2KCVA 5CHEE 3C48A 3S2UA 4KQ2A 3S29A 2ASVA 2E2EA 3OY7A 4U0UA 3SF4A 3G2LA 5D0OD 2IUYA 3AMVA 4NRHB 2R68A 3QDNA 4YI5A 1B4DA 2VSNA 4MRAA 3T3HA 2XCBA 1Y8MA 5FZQA 1JIXA 4RG9A 1NZNA 3CUWA 1FTYA 3VDMA 2L6JA 1K08A 1PSWA 3TOVA 3MRXA 5A7DB 2SKEA 3TG4A 4JHRA 4AY5A 3GYZA 3RJVA 1KT0A 2XCCA 2HYZA 3CX4A 4FZRA 3FROA 4EL5A 2PRJA 4MICA 2Y4TA 1NOKA 2KCLA 4RELA 4I17A 4KQ1A 4N9WA 1TJCA 5A6CA 4UQXA 1NOIA 2SKDA 2I6HA 4O6FA 1GPBA 2O6LA 2QLMA 4LEIA 3CEHA 2PQRA 5BT1A 4RIFA 2QN3A 5GPBA 4U04A 2QN1A 4G24A 3U3WA 4I9CA 1C50A 4AMGA 1Y8ZA 3EBOA 4GYWA 2FEZA 4RIIA 1FS4A 1XNFA 4YVOA 2XCUA 4GA1A 1P4GA 2Q7FA 3Q3HA 2BGTA 1IYGA 1PNVA 3CV3A 3G2HA 3E3LA 3CUTA 3QHPA 4KQMA 1UQTA 5ARGA 4U0SA 1QQEA 7GPBA 4JA9A 1A8IA 3BEEA 1UQUA 1QKJA 2YJNA 4GZ5A 5DU2A 2X6QA 1NA0A 4F3VA 1P2DA 1NA3A 1KTIA 5D01A 4CDRA 4HOQA 3BD8A 3LYAA 1FU8A 4MI9A 2X6RA 2F3UA 3MS4A 3BCRA 3MS2A 2R60A 2VGYA 4G26A 3ZCSA 2JZCA 5G04J 3OT5A 2GEKA 4MHOA 1YGPA 5M72A 3L79A 5BW8C 4NESA 4NEQA 3S7BA 4J8FA 3OTHA 1Y6GA 5G05J 2QNBA 3MT9A 3JYSA 1P5QA 5D0QD
chains in the Genus database with same CATH superfamily
1XN1A 4WOPA 5F77A 2GD6A 1W5FA 3L0PA 3V1TC 4JJIA 4E09A 1PLJA 2WXOA 1G7CA 3O1HB 1NBMA 2FHSA 3NBZC 3L8CA 2P65A 2DPYA 2PQNA 2XKBA 4E2FA 1YL6A 4FYKA 2XENA 1Q12A 3HXCA 4X61A 2D5AA 2QE7D 1CIVA 2PBRA 4V0ME 4EL0A 3RUCA 4TWRA 2XT6A 4FU3A 1QCYA 4CNBA 4H16A 3WI7A 1ZRSA 1G38A 1LBTA 4G5GA 1WY6A 2NUAA 4FD3A 2E1PA 4PLGA 1LNZA 4BE4A 3G0HA 3JTEA 1N9GA 3SXUB 1IN4A 4KQCA 4CG1A 2DC1A 1RQGA 4X1YA 2I03A 1Z2OX 3AL3A 1IUPA 4H0CA 1QH8B 4QARA 5EVJA 1M10A 4TLDA 1G5TA 5JJKA 3APDA 1MC5A 1V43A 1L7AA 1PG2A 1SU7A 2BLLA 1OAKA 4IULA 5AJWA 1E9DA 4ZT4A 5JAIA 2ZI4A 2VATA 3DBVO 1JGTA 1DIGA 3OJXA 2HHLA 3CA8A 1V8ZA 3LSYA 1QKKA 2AL7A 2FUG1 4EOGA 3V1KA 3V6MA 4N1AA 3WTCA 3G2QA 4H3VA 1WLYA 3RREA 3T3DA 2GQ0A 4CDMA 3W3AD 2QRQA 3SR3A 3IQFA 3KZXA 4QOHA 4CEIB 4F93B 2VT2A 5JCZA 2ZOSA 4RIGA 1N4AA 1O87A 4ARZB 3NCTA 3QY9A 2Q4BA 3JD2A 4B5LA 2WEKA 3U61B 4F6RD 4JX9A 1B16A 4CMEA 2W6CX 3D1JA 4IKOA 3BCSA 3HSYA 2X9LA 1GWNA 2XZTG 5TQ0B 2RAFA 1YE5A 3D4NA 1JDNA 2EEZA 4N47A 1PN3A 5DBFA 4A1OA 3GY0A 1AKQA 2UZAA 3ENZA 4HI9A 1RI2A 3PHHA 1F9EA 4MDFA 2G4VA 1NUSA 2DUMA 3LDZA 4LSWA 2J9FA 2PVPA 2C5FA 4JBXA 2NW6A 3P1UA 2D8MA 3RAUA 3VR5D 3FE2A 3NBFA 2YWFA 5KREA 3WLNA 3HXPA 1OH5A 1ISGA 2QUJA 4NCBA 2XB4A 3ZYKA 4M98A 2JJMA 2WY2D 4ZT3A 4O08A 2WJPA 1R6VA 5DP2A 4ZYVA 4MKXA 3LQQA 3CR7A 2FDCA 3THRA 2F1JA 3DKRA 1CY8A 1MZPA 2BFFB 1MP0A 4RCVA 4GLJA 4G25A 3GJZA 2QRKA 2QN6A 4LGMA 3MFQA 5BQXA 3RSOA 4U6SA 5DNCA 2DFTA 4EW1A 5IS2A 6REQB 3FKQA 2WIGA 1NJ2A 3RTBA 1GUFA 4HGNA 4G5OA 1MQ9A 4EL5A 4WLOA 4PZ0A 3JQBA 4GL2A 4O1MA 3JRNA 1UBEA 4JB2A 1T2NA 3PR3A 2HW8A 5KYUB 4J7UA 4GNRA 3EBOA 4J9VA 2J5KA 3BBLA 4J43A 4P4SB 4YT8A 2ID9A 3DPYA 1IULA 4E3WA 4FMCF 5KTNA 4CT5A 2ZEJA 3TR6A 3LKBA 2VH1A 4QUAA 3PVSA 4QNRA 2JGJA 3DMFA 2WKPA 5DGTA 1MO6A 4AJWA 2JLCA 1VHJA 1EK6A 4ID9A 1GGKA 2ABWA 3MS2A 4BLQA 3UT4A 4JJZA 2ZE7A 3FFAA 4KPGA 4YRAA 1T4BA 3V8QA 3P4XA 1UFKA 4BLWA 1UKAA 3M89A 1ZQ9A 1EUDB 4RDHA 1G2OA 2DHQA 1JJAA 3ED5A 3D4LA 3MD9A 5SV2A 1O96A 3M4NA 3G5AA 4I4IA 1CJTC 4JAVC 3ZGNA 3ZIUA 5D5QA 3IH5A 2FPPA 4GU5A 4LYDA 1I2CA 2B2XA 2RARA 1QZXA 3HY4A 1YZUA 3MYYA 3Q73A 4ISCA 3TLKA 1DPGA 1E2PA 4XJVA 4JD2G 1OQAA 3WNBA 2ZUEA 3LBIA 4NENB 2AXZA 3QQPA 3M4JA 4JFAA 2QX8A 5SZIA 4PN3A 3DE1X 3JQ1A 1NJSA 4TKUA 3TSAA 1DTSA 4UI9C 3MCTA 3FDIA 3CHRA 4MINA 1L5KA 4TQAA 1UJRA 1E0AA 1B3BA 1CTQA 4S24A 5EUQB 3OZWA 4GKJB 4QODA 4HWSA 3ZE2B 2ZXEA 1CUCA 4CM6A 1E59A 4NOJA 2ZM6B 1TM7E 3MINB 1NXSA 5DOVA 2IL1A 4NBWA 4FYYA 2B0OE 5KWIA 3FYHA 1EVYA 2JA2A 4X90A 4LHVA 3KR0A 2EBWA 3ECAA 3T1OA 2I66A 3GLKA 1JLMA 4M8NE 3WVNA 3QFCA 1X7XA 1JIUA 4JGBA 2A1UB 1XKQA 4FPXA 4FGJA 2VRCA 3NR2A 4PSKA 3TMAA 5CDYA 4L72A 4QGGA 3TFQA 3HCDA 1YZKA 5DSXA 2PD6A 1QGUA 5ITWA 2YHCA 4MYSA 1XMIA 1EVIA 4I1AA 4PLTA 2FPKA 4I5EA 2YJ6A 2PKYX 4WUTA 3EEBA 4XD2A 4KH1A 1PEYA 3K2QA 3C87A 3VI4B 1US8B 5SY6A 3MWDB 1RVDA 4O3MA 4FW8A 3R9KA 3PDIB 1KSGA 1HYEA 2XNCA 3C3AA 1NMYA 5LOVA 3GEIA 1KOGA 3BS4A 1KZ1A 4YRMA 3L02A 4F21A 3AT1A 1LQ2A 5JZ9A 3IKMB 3P97A 4UAUA 2IOSA 5BN5A 1Y6FA 1MO5A 5LQNA 4N76A 2ERXA 5DLQC 3G2UA 2KM1A 1UK7A 1NF3A 3DBIA 3IAUA 1CYDA 5C51B 3NRBA 2NSDA 3VV2A 3LRXA 4X85A 1VKOA 4TQ9A 3P2EA 1OWPA 4H08A 1OFHA 5THXA 3RIHA 1YF3A 1M2NA 3Q2KA 4XDYA 1E3DA 4D02A 1RTTA 3TVDA 3L43A 2DBYA 2BUBA 1HXIA 4HORA 3H6KA 4ZYWA 1I4DD 3SC4A 2YJTD 5FPHA 3BMQB 3PI7A 4GYOA 4UCQA 3M8KA 1SQFA 5A5GA 6CHYA 3L0BA 5ERGB 3S8YA 4C01A 2XYHA 1A9PA 3JQFA 4F91B 3HKEB 5JSUA 2WU1A 4M89A 2P4EA 4DR3B 1ZNYA 3HYNA 3WRYA 2NLOA 3S2UA 1U7IA 4GI5A 4LYAA 3ABZA 4NACA 4WPGA 1Z3CA 5D0OD 4FJ0A 3QYAA 3FVVA 4DRXB 2W98A 1JEDA 3PYLA 4IQFA 3HWX1 3RIGA 3O8LA 2EBHX 5J4KA 4V0MA 2E7ZA 3O73A 3B8HA 4KWIA 2AHOA 2UZ0A 1ZUWA 1Y8RB 2QYSA 3WIBA 1LX6A 4BCCA 3KB8A 2F2TA 5CCDA 2YFKA 2JLAA 2AKAB 1C9KA 2GSWA 3H5RA 3NBAA 2A33A 2NU8B 1NUUA 1BEEA 1PT8A 4D45A 5LMZA 4IIXA 1E9VA 4YLGA 4O2BF 5HILA 4FCTA 4LDJA 2BF4A 2ZRCA 4J1SA 5JSHA 2VYVD 2W2KA 1YZGA 3KZCA 5B1HA 2HK7A 4R2HA 5K0ZA 3DLCA 1BRTA 1ONPA 3EQZA 4B9EA 1V3UA 5JFTA 5ES4B 1TYAE 3KZOA 5JA4D 2CF6A 4DA0A 4UEOA 1P2BA 1FU4A 4RD0A 2AMLA 3V1LA 4MW5A 3CH5A 1T9KA 1GPWB 2YASA 1X3LA 1UF9A 3ESBA 4P4LA 1U2EA 1RVV1 3ICVA 3PVZA 5AVVA 4N6OA 1FNDA 2DETA 2IUEA 2EP5A 3E9ZA 1PFVA 4WZAB 2YUIA 1QMOE 2VG8A 2JJ1D 5EMMA 2RMKA 4UHCA 3QX7A 5CXSA 3VKHA 4UNIA 1FEZA 2VQSA 3JSXA 3AW8A 5HDQA 2JKZA 2FA9A 1IWOA 4DSZA 3OEWA 1XMVA 5DSTA 3NUQA 2X86A 1EFHA 2P2SA 3MQ4A 1UP6A 4RNCA 3MTBA 1MDBA 4OQZA 1JPJA 5IP5A 4A9AA 4F5YA 3O4RA 5ALOA 5JHGB 1XD2B 3OI7A 3UICA 1C7QA 2HRQA 3EB9A 3NHPA 3TL6A 2Z9DA 1P0CA 3G1TA 2ZRPA 3AKDA 1I6MA 3I9OA 1YDHA 3L41A 3QVXA 1W4LA 3RRNA 3V7UA 1NZFA 1JU3A 3Q11A 1WDMA 1W30A 4J4BA 1J25A 1U3DA 5K3EA 2WIAA 3AK4A 4BTVA 4G56A 3IP3A 1HK7A 4HFRA 5GZ6A 2CNNA 1TO1E 2H4JA 5FOQA 4ASUD 3AL0C 1QS0A 1DBRA 4AKTA 5E3HA 2XRZA 4NJMA 2FGJA 2OENG 5DX0A 2JGLA 2C5HA 3IE0A 2IP2A 3KKPA 4JI0B 6LDHA 1R6DA 1RWVA 1V1RA 3OJOA 1MC8A 3PNTB 3ZWAA 3DEOA 3F0TA 3T1HB 1OLUB 3L9TA 1U3CA 1Z6GA 3BKXA 3C8MA 5K9ZA 4MA4A 4WWOA 2BHSA 3H65A 1GL7A 5BQFA 5ILGA 3KDPA 3EGIA 2W11A 4BPBA 3WXMA 3KJXA 3EC2A 1P1BA 4YRTA 2ZIXA 1ADYA 1KQGA 2X13A 3PD0A 3HJRA 2WHQA 4YRDA 5HK9A 5LCWC 3RVLA 1RLOA 4MAMA 2OR3A 1TMOA 4O4HA 2Q5EA 1YH3A 3F71A 3SF0A 2AFIA 3GLIE 4AF6A 2GJ9A 3RYIA 1NR1A 3HYLA 3ZOZA 1NDQA 4DMLA 4LWQA 4YDRA 1S02A 5B6IA 3KOUA 3R3XA 1N0WA 1QFXA 1HY3A 2HXYA 5T4BA 4TWBA 1QZ2A 2G9QA 2IV7A 5EY5B 1UBMS 4PEVA 3O1IC 5EN4A 2LTAA 3GP3A 3W0LB 5E1OA 4BB6A 3UI2A 3KWMA 1W5BA 1CUSA 4E70A 3IHKA 4G4SO 3JYLA 1WUHS 4XJXA 4Q24A 2F43A 2ZYSA 2A14A 4D79A 2R5NA 3FHEA 4RHCA 1IH8A 4JDPA 5ER9A 5H82A 1JWFA 4EFMA 3JUIA 5REQA 5CVJA 4IBOA 3F7MA 1WPRA 4LXHA 1MXHA 3EDQA 5JHAA 2RK6A 3S3TA 1L3IA 3AV3A 5BUQA 2JDIA 2H2FA 3OZ7A 2VOEA 2I7VA 2BGRA 3Q3HA 3OMLA 2R79A 1H2FA 1JTEA 1SOAA 3CNQS 3I5AA 4Z1MD 1Z2NX 4YCAA 2CHEA 4IIHA 5IDXA 2BPOA 1U99A 1U2DA 5CGZA 1MB3A 1K2VN 2XMRA 3CIAA 3GLFA 2COKA 1FK8A 2D5CA 2OXRA 4FMDB 4HAVA 1X0XA 3AXTA 4KFUA 4C22A 2IFUA 4C4YA 4LDZA 3I32A 4AI6A 5DH9A 3ST7A 2ZTLA 2DULA 3CVOA 1Q19A 2WG0A 4UYKA 1ELRA 4DPRA 5K09A 2GB4A 2ZSAA 4DQ0A 1P1RA 5K0LA 3SC6A 4BO7A 2OK8A 4FWBA 3PZDA 3LO8A 4IVPA 3VPAA 1R6BX 5C1PA 2ZCVA 3W7VA 2ALJA 2WAOA 2XTAA 3DOHA 3DL7A 3VMMA 2XDYA 1YKGA 5CXXA 3A2LA 3HLYA 2Q99A 4Y6OA 1EUYA 4OP2A 4PYKA 4RL6A 2XDQA 3LAWA 3V2GA 4JQYA 1SVMA 4ROSA 2C31A 3MC1A 4Q01A 3S2FA 4RANA 1JHXA 3FYSA 3R3SA 3UCFA 4XDGA 3U2QA 2ETCA 2QN7A 2OLJA 2DXIA 4Z7OB 3MAGA 1PWXA 4WDRA 1RC0A 5F76A 3KLOA 1VPLA 3DEPA 5LPNA 2IEIA 3WL6A 3RTCA 1JL3A 2ZSDA 2UY1A 2J7PA 4QPNA 1VJGA 1KJ9A 4YCLA 2ZWPA 3QELA 2Q3JA 4AS1A 2WIFA 1MO2A 4EK9A 3U16A 3W5VA 2AQ8A 2XJ9A 4I8XA 2Z4RA 1KZOA 5J2TB 2R65A 1SRQA 4MQEB 1IQUA 1A1VA 3NB0A 5I8WA 3DD5A 4KFRA 2ZROA 2YJ5A 1D04A 1P80A 3VOTA 3D64A 5AK4A 1ZCZA 3OY2A 5D3MA 3DXMG 1FNBA 1TTQB 1Z75A 4EJSC 5LZ9A 2GS9A 1EGQA 3RYTC 5LP6C 2HBRA 3LPAA 4FADA 2R4QA 3LXXA 3ECSA 2VBCA 4V1CI 3PGLA 5A05A 2XGJA 4L02A 1KY5A 4D0NA 2NN3C 1AKEA 4US2R 5ILQA 3ULQA 4KBQA 4S35A 2J30A 2X9QA 4D0SA 2HBZA 3ORSA 2FMIA 2WE8A 3R7NA 3MTAA 1NSFA 1ZK2A 2XEDA 4AKHA 4L4XA 3GB9A 1XZEA 3G2NA 5I3ZA 3MJSA 1UOOA 3WGVA 3ZR4B 2QR3A 3OH8A 1WW2A 3AUYA 5HUQA 1E8WA 1YZNA 4ALLA 3LCMA 1NW8A 5E9WA 1HR0B 1D9SA 4GC5A 3ZZ1A 5B2EA 2MHCA 1SA5A 2PSHA 4HOTA 1XZAA 4O1IA 3Q3EA 3VKFA 4BTLA 4I5IA 3SYKA 5C2JB 4HQKA 3C6YA 1Z3IX 1XDGA 2JGIA 5KTSA 4PPQA 2IDZA 2PKQP 1S7GA 1CUYA 4FSXA 4QEDA 2ICAA 3UC9A 2NAFA 2ZJ0A 2PBFA 3MUNA 1BKYA 4AP5A 3VSDA 3WIEA 1KS9A 3LNCA 2IYUA 2C03A 4XDHA 5AUPB 5KWSA 1GNSA 3PC8A 3FTEA 3U64A 2YZGA 1C41A 3N2IA 4S2EA 5IH7A 3HA5A 4J16C 3UY4A 1CFZA 3E2PA 4QECA 3BZBA 2F9LA 3LQ2A 3R5TA 1QRAA 2IYEA 3ZDBA 3D6HA 2A0WA 1ESCA 2NZYA 3P0IA 4AY5A 5EI5A 3ZPXA 2D2IA 3KT0A 4U96D 2F8LA 2A1IA 2M6KA 1W1WA 4C0BA 1KH2A 4R51A 4BZZA 3DFZA 3ZV5A 1KI6A 2XVXA 4NV3A 1TLFA 4GM0A 1MX1A 1LPBB 3NATA 2YWCA 4BC1A 2Q5FA 2CV2A 1QG6A 3OLQA 1PUIA 1UM9B 1QKJA 4FR2A 3UZUA 3K16A 1B8PA 2YMQA 4ECEA 3RAGA 3SG0A 2QTLA 2IXTA 2H1SA 1B8UA 1R16A 4G5FA 3C70A 4NAVA 4J90A 4X7BA 2QJTA 1PR1A 1MXFA 3IT1A 1A77A 3GGJA 5IVIA 2IOLA 1ZSYA 1U3FA 3ELDA 5EP4A 3BEOA 4KV7A 1ISHA 3F1KA 4RW0A 1PYDA 5D3ZA 3R3HA 1YR2A 2I62A 3BB4A 2FSHA 3SBSA 5BN3A 4BT9A 3R8XA 1J7JA 2BFBA 2IZ7A 2OM6A 1J97A 3NHSA 3IUMA 2Z8ZA 1JJBA 2N47A 3VA7A 4ZOLA 5B3AA 3VR5H 1O03A 2Z8XA 4ZYUA 4BETA 3KZVA 5HHTA 2AD1A 4WX2B 1S3GA 2YZNA 1EDZA 3Q7RA 2O7VA 2JEKA 2NTVA 4CRWB 4D8WA 2FG6C 1M76A 3LUDA 1PJZA 3SHTA 4C29A 3O2SB 3UPTA 3GCZA 4G1TA 3HJUA 3H5VA 4R1OA 3WLHA 3TSZA 3BG0B 3KYDB 1J8QA 3B48A 2WFAA 1VSUA 3U09A 3BTOA 3K5HA 4AECA 3AHFA 2XLBA 4O0LA 1ENYA 1W73A 3SX2A 1Q0LA 4NPHA 2QPAA 1E61A 1RYEA 4KXLA 3OLWA 4LVUA 2LWIA 1HKUA 3R24A 1EBBA 3SQOA 2D4AA 1UKEA 1FRNA 2Y4UA 1ILWA 4BO3A 1X14A 5KWVA 1OU0A 2I87A 1NVDA 2DHRA 3QVUA 4Q94A 4CEHB 3GW8A 1FFXB 2R751 5AT1A 2YIJA 3MGCA 4AKGA 5KIAA 1S9DA 4XB6B 1P77A 5G2NA 4L6CA 3G2IA 3UOGA 5DW3A 3IAS1 3GLIA 3R76A 5GOTA 3FAZA 3L4BC 4RM2A 4Q9LA 2HLHA 3AGPA 1GPLA 3I42A 1TCVA 3O8QB 3L0IB 1MD9A 1DP4A 4WK0B 2YJ4A 2HSWA 5DHFA 1LWOA 4ALIA 4WXRA 1TCCA 5NULA 3PEUB 5H9VA 4JC4A 1Q7TA 2BGNA 3DQZA 5EZYA 4Y9RA 3L8FA 4FYHA 1IVYA 4OA8A 5K4HA 3D1VA 1QAQA 3DT6A 2OHJA 2HMSA 3KOYA 3ICEA 2VYIA 1K66A 4JGIA 3N2LA 2WINI 3NHZA 3RB8A 1EE2A 3VDRA 1OC4A 1EQ2A 5J5AA 4X1KA 1A82A 1P73A 2MSNA 3NT2A 3GNSA 1LLDA 3KTFA 3WWOA 2R8EA 2AYXA 2AXPA 5AM3A 1XPUA 3BMXA 2X40A 3ZQ4A 1MPXA 1FQKA 4FGLA 3ETGA 2HMAA 2Q6OA 1KO1A 3UYKA 3HDXA 4BKRA 5BV2P 3U9LA 3AR9A 4FYWA 4E94A 2B30A 4DLPA 3DLAA 2VTDA 5C3MA 2ILTA 4YJHB 5GZ1A 4UEKA 1W1IA 2WYVA 5I9IA 5JALA 5KQSA 1H66A 4M9XA 3KTAA 5GIPE 3IVCA 5IXJA 5HCUA 1ESEA 1EFVA 4KH0A 2DZOA 3RHTA 2GPJA 5C18A 3GFTA 3ONWA 3TWVA 3S7JA 3ETLA 1L5HA 1JE0A 3C3JA 4PRZA 3UHAA 4M9RA 3GIWA 3UBMA 3OECA 4LI3X 4E2XA 4FYPA 5DF1A 2AJDA 1JR3E 3ETCA 2XZDG 2FFGA 1O1TA 4MVJP 3ZH2A 1J8DA 3AGQA 1VRCA 2NZXA 2ZRMA 3TZLA 3GLTA 3GDWA 5AVWA 3KPWA 5H1YA 4DC0A 4JJ8A 4E4RA 5C3UA 4A6PA 2P8JA 3UMYA 1C81A 5BR8B 4H59A 5J2UF 3HTXA 3TI7A 3EGXA 2JB9A 3FZQA 1H8EA 5JJ5A 3JYOA 3FYTA 4ABYA 4PBSA 4ZKEA 3A36A 4TS9A 2QL7A 3D1LA 2B36A 3RS4A 1UKYA 1IJFA 1TEZA 1TQHA 8ATCA 1U31A 4Y6GB 1NI3A 2XZTA 1R4AA 4C08A 3P19A 3LD9A 3FZEA 1LPOA 2DUWA 5LSAA 1NF9A 2FO7A 1NBME 3C7CB 2A1TS 3MK31 1S0UA 3B1JA 2ESRA 3S5JA 3Q78A 1KYQA 2QQEA 4YDOA 1TKAA 3WX0A 3COYA 4CV0A 1HDRA 1U5BB 3NASA 3S7FA 1DC8A 3CVYA 1C8LA 4LTMA 4JU9A 4KXQA 1CZNA 1E2FA 2LNDA 3UENA 4P0PB 3G1WA 2AUNA 1NC3A 1WKCA 1ELWA 1OPRA 4YQZA 1EF1C 1AGRA 1U90A 2V3WA 3PNQA 1SG9A 4X3OA 5F9FA 5TNXA 4X8QA 4CKWA 2XWQA 3SR4A 4LXUA 3BGVA 1NIPA 3LHKA 1UBTS 1V26A 1QHGA 4DTCA 3ACCA 2WD8A 1J0XO 1KP3A 3K9GA 3EZNA 4Z2YA 4CQNA 3AILA 4BO4A 3MSXA 3NP9A 3NBKA 3ZQJA 5GTDA 3U48A 3DOIA 1FDTA 4MYCA 4NCJA 3BE8A 4AXBA 1YOVA 3PIRA 3L1VA 2Y9PB 5JD3A 4B3HA 5HX7A 2B37A 5CLHA 4EEXA 3OZEA 5CX4A 2W2TA 4J76A 4XB1A 4CU2A 4JUCA 3OOYA 1C1XB 3I92A 3WXBA 5IKMA 5I45A 3LUCA 2BMJA 2VQ3A 1XAJA 1EK5A 2HH9A 1RYBA 3F6QA 2OMEA 1YFKA 5H3LA 3CWQA 2J3IA 4Q39A 1UMCA 2IWRA 4JOSA 2FPGA 4QDXA 3C3BA 4YCNA 1EWQA 3O8BA 1ARZA 4BEWA 6AT1A 5AIAA 3KJQA 1Y1QA 4JSTA 5DE3A 2LSVA 1P3JA 1JQAA 2VP2A 3THWB 4RVNA 4KLRA 4O1HA 5MF6A 2J32A 2X7HA 4LF6B 3BWVA 5FOUA 1YJCA 4IIDA 3F5SA 3KUCA 2X19A 3MWLA 1OZHA 1TNBA 1L4MA 5BO5A 3BSWA 3K0AA 5D6NA 2QRJA 2WAYA 2QU8A 4PS3A 4K9OA 3TG5A 3BXGA 5E0OA 3KC2A 1TNUA 1CV2A 4FKZA 1V1MB 1E2BA 5I3CA 3WLFA 5ABPA 5AUQA 3RC3A 3CH7A 4QHSA 5DWVA 1F0YA 4L4SA 3E7WA 2ARKA 2FPRA 4LMPA 4PQRA 2WPNA 4JU8A 4G9BA 4Y1RA 2KM4A 2PUFA 5C4IA 4FEYA 2R84A 4PGMA 3KL4A 4P2BA 1RQ7A 1MVOA 1ICIA 3QEBZ 1T4CB 1L5JA 1ORHA 3MVEA 4A82A 2ZB2A 2GM9A 1P18A 4D0RA 2JBHA 4EUSA 2D5LA 3UG7A 3DBHA 4BQQA 4IIUA 1KZ6A 2V96A 1G8YA 1DBVO 1DCQA 4S12A 3NGXA 5LR6A 2ZRKA 1NJ5A 1NV8A 3UX4A 5EP1A 4IXWA 4E5DA 1MBZA 4GKVA 4YAEA 4UMFA 4DV1B 3CZPA 2R68A 1WD5A 4TRJA 5EJ9A 3GYZA 1R0LA 2ZAIA 5C1OA 2O4CA 3GCWA 4GOND 1JW9B 4H27A 1N5JA 5FBZA 3GDGA 3RFVA 5FTMA 2FFJA 4C0WA 3UTCA 3EXHC 2CFZA 4J3FA 2PUCA 1XRSB 1U8TA 4RV9A 4FTWA 1JG3A 2JARA 4K6KA 4JJKA 2WHEA 4FDLA 1HF8A 1MJ5A 4ZCSA 3LBAA 1T2VA 2GYVA 5EKUA 4W5QA 3NVDA 1JSZA 3EAQA 2J3EA 4XEUA 5ALPA 2BTOA 3CEPB 1ZN2A 1VIVA 3CONA 2O8VA 5LWHA 5MGBA 4UCWA 4YP5A 4N48A 2MOWA 5G05J 5JS8A 4N82A 4TVKA 3R75A 4OHMA 4EHMA 3IBSA 3VPGA 4KR3A 4R2KA 2VWQA 1THTA 4BVLA 1Z06A 2C0MA 4CM7A 4O29A 3AESB 4OAPA 3DMHA 3I9V6 3SU8A 3CF0A 2IYWA 3NALA 2PZJA 3RK0A 2F8YA 3L49A 4C4AA 1DLJA 3RRJA 4WCFC 2X7JA 1E3EA 1TLTA 2BRUC 2OUKA 3CRVA 2VQFB 3G59A 1S01A 2SKCA 2IHTA 3MCVA 4KQHA 3BICA 4XVRA 2AI2A 5LP1A 1W87A 1E2EA 5EC8A 1E8ZA 4BLPA 5CT8A 2PFGA 2HJVA 4HDNA 4UTZA 4HEHA 5DASA 2XNHA 4DANA 3Q15C 4ZK6A 2NZWA 5AVYA 3UJ3X 5JC1A 4PHFA 4N8SA 5K01A 3OHPA 2XAAA 3ZJVA 3SR0A 1CP3A 3MWEB 2BKKB 5E7MA 3DBRA 4B3JA 2HLNA 1N3LA 4LV8B 1VCHA 2PXAA 4M76B 2I2AA 5FBKA 1Q7GA 2WTXA 3EHRA 3ZUVB 1LSJA 3UTDA 4AY2A 3OKCA 1VE9A 4KVMA 4PPFA 4ND5A 3DSXA 1SKYB 5LCXA 2A0UA 5A7FA 2C4UA 1JG7A 1Z37A 5C9ZA 1Y8QB 1F12A 4ZEOA 4UE2A 3EPHA 2XQGA 3IUQA 5KWJA 1YD7A 4NECA 1ZH0A 2RBKA 3UHOA 1NN5A 4CTMA 4BNMA 2VSQA 1DMRA 4HJXA 4EJ2A 1P2SA 3PPIA 4ATZD 3UUEA 3DHNA 3FUJA 1PQYA 3EEIA 3TDKA 5AYWD 5AKKA 1M8KA 3T06B 1P2VA 2E4UA 2NZ2A 4KDFA 4D9HA 2OCBA 2Z6QA 2AG8A 2BP7A 5AKZA 3WFZA 3OJ0A 4IWYA 4KI7A 1DZ3A 3AG2E 1V71A 2NV6A 2HPAA 5IPFA 1H65A 3B51X 4HX2A 5FF9A 1LX7A 2FZWA 1MDFA 3DV0B 3FHOA 1QLWA 1UWLA 4JLBA 2WZDA 4NCHA 2ZJBA 3LHIA 1ZG3A 2HJ9A 1A9SA 1K6EA 2HQBA 5CYPA 3VMFA 1JR2A 4KLZA 2XY4A 1Y34E 3QWVA 5E4FA 3TWSA 1EZZA 1M8JA 3M9LA 4GPKA 3RHSA 1A71A 3ORYA 4BAZA 2WJZB 3EIOA 3HJCA 2DPLA 3FCAA 4D0LB 3SOPA 1WTCA 2JKVA 3VH1A 2OILA 4LVNA 4BDTA 2O50A 1PUXA 2VF5X 2PSFA 3WWEA 4NV0A 1NR7A 2GXUA 5KYYB 5I5EA 1XQ1A 1EVKA 3DUFB 2W2MA 2BHNA 2WFZA 4TXRA 1YMQA 1E20A 1T5BA 4PO8A 2ACVA 1CR1A 5EWJA 2R96A 4LEUA 3W5SA 4ER5A 2IIVA 4L28A 4IDFA 5LIPA 5ALZA 3M0EA 4JEHA 1OE0A 2UU9B 2CG3A 4YUXA 4ZU3A 3PNSA 2X41A 4RGQA 1Y8MA 3ZHRA 4EMBA 3TG4A 3PKZA 4U2BA 3FROA 2EP7A 1PNQA 4CM9A 3DXKG 3AVPA 4U6QA 1N4RA 3N05A 4GM4A 1M2OB 2AZ4A 3P9ZA 1TD9A 3H3XA 3ML9A 4BJ6A 5F35A 3IOYA 2YWDA 3BIXA 3WYDA 5A7HA 2IP1A 2QC9A 3EXFA 4EZLA 1VZ3A 4ZVRA 3WLQA 1UKVY 2VH5R 4X92A 3E9YA 3MTJA 2J41A 3FCXA 2EARA 4N65A 4XKJA 2ZLBA 4R98A 3AETB 4OCZA 5C8DA 4Y1FA 1QC5B 2ZZMA 3T1QA 4MS4B 2CLDX 2NPFA 2Q0SA 4DB4A 1GA6A 2B7BA 4R8KA 1QIDA 2QTHA 4B6PA 1XDWA 3DZDA 2JI4A 2XGGA 4R68A 4GPAA 2G9UA 1RXYA 1JBKA 2YQZA 3WS7A 1QRTA 2PH1A 2Y0PA 4D57A 1T5DX 2ERCA 3JQ0A 3OM0A 1FDUA 2BCJQ 1TVKA 1E4OA 5ESDA 3ON5A 1GCGA 1T6XA 3TTXA 1DRUA 3OX3A 5JEDA 3MFYA 3KR2A 5IAJA 5GQSA 5JS6A 4URWR 1ID1A 3MB8A 1TQ2A 3IBYA 2ZS9A 5CGQB 2XUJA 1BW9B 4WNDA 5G3ZA 2AFRA 4U2GA 1EVZA 4NYIQ 5EN5D 1YA6A 2FVYA 1UBSB 1HPLA 3HB7A 3G2KA 4XLZA 3K71B 2ZITA 1U7TA 2GD1O 3ND6A 1ZM3A 4DL9A 1IOWA 4F9GA 1JSXA 2A0YA 5EL0A 3SXJA 1Z4PX 1UN9A 3GYBA 2HHJA 3GUYA 3H4VA 3VUEA 3HM2A 1MVNA 5EEHA 4FEGA 4D2IA 4KR0A 4FMCB 2JHPA 5CVUA 1VP9A 5ALJA 2RHRA 4OFWA 1MAWA 3A11A 4OUDB 1YQGA 1OXMA 2A8YA 4EI9A 5I6DA 4LBVA 4DIBA 3ORRA 1K6XA 1P1CA 3F4KA 4CLDA 2WIBA 3Q5DA 4MRPA 2XA9A 2GZ3A 2EKPA 1UXGA 5J08A 1A8SA 1X80B 3ER8A 2ODAA 4EPTA 4K9SA 3GZSA 3M1YA 3BZUA 2CHWA 4BGDA 4I2WA 3O82A 4QXAA 3TYXA 2OHFA 4GLLA 2GFQA 1NL4A 4ANUA 2YDXA 1ZH8A 2Q1SA 3KOOA 4Z9XA 3G5TA 5KYXA 5L7WA 2EZ9A 5JATA 2VI5A 4B2LA 2AF3C 2AJTA 3LOQA 4O4JA 3VR6A 1GPH1 1SHUX 1PV4A 1YUBA 2E3JA 3L7CA 1ZP6A 4KWEA 4HR7A 4PW0A 1C3OB 1WOMA 4PM4A 5GJVC 2X0DA 1OGIA 3NDIA 4RTQA 4E85A 3C6XA 3WP0A 3AZOA 4GH5A 4KO4S 4EBBA 4BNXA 4HOSA 4BT8A 1WCIA 3ZYCA 4B8AA 2AGVA 2GN8A 3CU5A 3PUKA 5L45A 2ZJ8A 4JPSA 3IQWA 2W2VA 3AU8A 2AFIE 1PJ3A 2HXSA 4KO2S 2O8CA 3DO8A 3QVVA 2J4CA 3PGA1 5FORA 4MV3A 4P98A 3L7KA 1Z0JA 3K1ZA 2BDUA 1RYYA 3TQFA 3W7BA 4U7PB 5K3FB 3GW4A 2I3DA 4MI1A 3U26A 2VZLA 4ADSG 2CXXA 3L82B 3VR2A 1U8UA 2QW1A 3AJRA 3UH0A 4LE1A 1K5GA 3ONEA 4TMTA 3NBXX 3OTGA 3KSLA 4OXRA 1DNPA 1GQQA 3ZLVA 4WZ6A 4X65B 5AQ9A 3L6UA 4IQGA 4RF4A 3HN7A 3MXOA 1B4DA 4XZ3A 3G17A 1QQ5A 2SKEA 1L0BA 3GRUA 1YVEI 4AIRA 4HTFB 1JKJA 4PLPA 5JH7B 1E4YA 2GTPA 2WXQA 1J2TA 5MN4A 3EWIA 2RAPA 4B6OA 4DVGA 1YRWA 3CNNA 4GMFA 3HCAA 3A1EA 3DPDA 2A7XA 2IW3A 1VB3A 3CE6A 4BEJA 4JA9A 3L7IA 4LWPA 4FNMA 5ALXA 2FTKE 5ICSA 3DAPA 3GLFE 3EMDA 4CKXA 3O0DA 2VJMB 3PE6A 4ZHSA 4RK4A 2O3SA 4IMIB 4MI9A 4PFKA 1S63A 3AHEA 4IFIA 4YR9A 3V33A 1YGPA 2WJAA 4KE9A 1ZGGA 4EB6A 3E03A 1PJCA 2Q4EA 3BSFA 4XEHA 1PEDA 1AV6A 4XM2A 1QPBA 4NYMQ 5KNGA 2VSFA 1NVWQ 4WUYA 2Z9BA 2J4BA 5BUZA 1NAIA 3QSGA 4LFBB 4NFYA 1IJBA 4ZALA 1ZI9A 2QGFA 2NQ8A 5E9JA 2WA2A 4IDCA 3T4UA 1GPJA 2X77A 3WYEA 3AR4A 2PV0A 1RWMA 4AP9A 1XVLA 5F33A 3F7OA 2PEZA 1B0AA 4FGWA 4J91A 4P1ZA 5JH7F 2RB5A 1VIAA 2IK8A 2HWKA 2OLKA 1A7UA 3WGMA 4BN5A 5JI3E 5A62A 3W04A 5FQ8A 3TIXB 4TT3D 2CVHA 4XJSA 2CGEA 2VBFA 1AQLA 4LX8A 4ERNA 3LQKA 3CGHA 5B5SA 4D97A 3M1LA 4J0JA 5AR1A 5IY5E 1Z3XA 1CE8A 4ZOAA 2YOFA 1NVEA 1OT5A 1PV2A 1N0QA 3FP3A 1GNLA 1R8YA 1LZLA 4B81A 4PIVA 4PHGA 1AQUA 4JX8A 1JA0A 1NZJA 1T8RA 5CBPA 3EIEA 2WTBA 1ZJJA 3OC0A 3SFYA 3KP1A 2C88A 2PHZA 3TW8B 3I2FA 3WGKA 4O2BB 3U31A 5A4DA 1ZRHA 1VCIA 2IP4A 4RK0A 3X0DA 4C3ZA 1PV1A 1JMYA 1R0CA 3H18A 3FOEC 4P7JA 1CUDA 6NULA 1CUVA 1MLDA 2K4NA 4R2IA 3EVGA 4UUPA 4RZXA 3I45A 1JEAA 3QVGB 5H5JA 4NZPA 2IODA 4QHTA 3QEJA 5CYFA 4UU0A 3FETA 4YROA 3D0QA 2D1RA 4PXSA 3CCFA 3D6MA 2O59A 3D6FA 3H5TA 3NXSA 2X1VA 2IBMA 5FPKA 1E2KA 2C2HA 2O8FA 1BDIA 4PE5B 4BZPA 3M6FA 2VUTA 4YUWA 1ZK4A 4RZSA 3WLJA 1SAYA 2PJDA 3MT8A 1GIAA 5CEJA 3PPYA 4QGFA 4CHGA 1K8QA 4MHTA 4F4DA 2ZBPA 1D03A 3FAKA 3UT0A 2W48A 1L7EA 4MW7A 1JLLB 1XVIA 1E77A 1X1AA 3RO2A 4H1VA 2WAAA 2P0AA 2BKAA 3QWWA 2XADA 5HW0A 5HYVA 2QPLA 2KE5A 4Q66C 1FPMA 5M04A 3H2YA 5DM60 3IEVA 4YAIA 4OM7A 3K9NA 2JAXA 4R8SA 2NSHA 3OM1A 3ESYA 4DXAA 5J4YA 4E5PA 4GEGA 2BSAA 1A4UA 5C5EA 2CJXA 3P9PA 4TMKA 2F9FA 4CKBA 3FJ1A 3HGQA 2HV8A 3A4NA 1WZCA 3HNRA 3OZIA 3LHDA 5DN6A 2Q41A 5FTJA 4EHDA 1DDOA 2J5BA 3CW8X 2V4ZA 4C06A 4KDRA 2IU4A 2IXEA 2R7AA 2VYFA 3ZG6A 1SN7A 1N2CB 3O7WA 3IEIA 4AJNA 1Y5MA 4D25A 1ZCAA 2G28A 3N5KA 1KMHB 1O94C 2Q6LA 3HUDA 4EUHA 3WA6A 4C21A 4Q82A 1VJDA 2WYHA 1W4RA 3ZWMA 2C92A 2QSYA 3JD4A 2D1YA 2ZJZA 1T3GA 3JALA 2E6KA 4LNUB 1XIVA 4E1BA 5BPFA 1QIKA 1LS6A 3AB8A 2HREA 3T7CA 1HDCA 1IN7A 2IUTA 3EA5A 5CMLA 3U9SA 3RFCA 4WVLA 4YXFA 5HF9A 4HGOA 2A9RA 4U0SA 1VP3A 3VC3A 1T1SA 4OAOA 2H17A 2JGFA 4P34A 2YIMA 1RXCA 2HB6A 3IHVA 5FWQA 2NYRA 4TUYA 1IZYA 4D56A 1DDIA 1V9CA 4Y7CA 3D0OA 1RE1A 1U0SY 4ZTUB 3BRSA 1XMOB 3KHKA 3TKYA 4M83A 4MGZR 4YMGA 2JI8A 5E9AA 4Z8XA 5JUWA 2D2VA 5K3OA 3O4VA 4C4TA 1RMQA 1YB1A 1ZMRA 2QIPA 5TQ2B 1XEWY 2B69A 3FWPA 4C4PA 3FRJA 1BQEA 2NXPA 5F1KA 3O3CA 2IZ1A 1NP6A 1FU7A 1ZJZA 5K6TA 3HXQA 2BCEA 4RK6A 4NCXA 3D4OA 2WXIA 5FV4A 1SUIA 2QAGC 4RFSB 4BO9A 3DSWA 4FGSA 2GM5A 1OXKB 4BNHA 4J8EA 3ZHCA 2XX3A 5LNK1 3UANA 5CB8A 1NW9B 3UMFA 3L0SA 3VLFA 3NV9A 1N2EA 1Y82A 1UIRA 3EUAA 1O4VA 1G42A 2UVQA 5B1EA 3B6IA 4D3SA 3V7YA 2XZDA 4UHDA 3CKYA 3FWYA 2FR8C 4IKPA 1UP7A 2EF1A 3GD7A 4Q4HA 5AJHA 1Z56C 2BMVA 1FP4A 1OIWA 4MV4A 1II8A 4GZMA 1SXIA 1Q0RA 3TEMA 5CX1A 1BXRB 2RGAA 5CYOA 1I7LA 1QCCA 3DLBA 4C7BA 3GT0A 2WRZA 3MV3B 2BTEA 1H2BA 4JQCA 2F3RA 4UTVA 1T13A 1FCHA 3WIOA 4JFRA 4HSEA 1KF0A 4MUMA 2AS0A 4K6CA 3M2PA 2QMYA 3EPPA 3T8KA 2EQAA 4RF2A 4FHEA 3AHGA 3W9FA 1Z83A 3MMZA 1XMJA 3IKVA 3FULA 2QLLA 3H42B 2OFXA 3JW8A 2P5SA 3CW9A 2GRAA 2OBMA 3A6GA 4EG4A 2WMNB 3BF7A 5FWXB 3JQGB 4D44A 2YR0A 1Z28A 2RHGB 1YI0A 1NUQA 4ZCRA 1NW6A 4MDEA 2EOAA 1F7UA 3LP5A 2J9RA 3KHSA 1CS0A 3MJFA 4NU5A 1ND6A 2ZKLA 1NRXA 1BSVA 1L4BA 4FJZA 2CKDA 4YJ3B 1C0PA 1PCXA 5LYYA 4DR4B 3LUPA 3RRMB 3WOVA 4ZDKA 2IUFA 2WF7A 5BSHA 1Z5WA 1X74A 4X84A 1V25A 3HXLA 4IQ4A 5CYGA 2Z4SA 1KU6A 5JNRA 3TXAA 4M21A 3FNGA 2BZGA 1YKSA 1BXKA 4W5OA 3JATB 1YJAA 3GJ3A 3ICPA 4ZZ0A 2GMWA 1X9IA 1GCIA 4Z0TA 4Y9DA 1W2GA 3IEPA 1ONNA 4UW9A 3TTVA 2EWWA 5K3DA 2LKDA 5L3SA 2QL9A 1ZNXA 4BX3A 1TUBB 2KC7A 1FNNA 2ZUTA 4ONEA 1GTZA 5CHEE 2EZUA 3F4BA 5A0TA 3AEKA 4V0QA 1YB2A 1F2UB 1BCSA 2UYGA 2O3QA 1M0TA 4II2A 2XMCA 2RHTA 2FI1A 4UUOA 2VA8A 4DB2A 3HV0A 1KRXA 4YJ3F 1IK6A 4HMPA 4BX2A 4HT3B 1G1AA 3C5RA 3CGGA 4Y2HA 3AFGA 4UKDA 3BFXA 4EUNA 4D8TA 1BIFA 1CXZA 1GNPA 3Q9LA 3JUEA 3OUZA 4MP6A 3JWHA 1UQUA 1OAOC 3G3EA 5JCJD 3C8ZA 4G85A 3SSOA 3QXJA 1D2AA 2DR3A 1IBRA 2ZYWX 5G2OA 1M5UA 2A9JA 4JQSA 5AENA 2ZWOA 3P5BA 2QTZA 2B4KA 3TQTA 2ZE6A 2VR1A 2QNBA 3HU5A 4ARIA 4DGSA 2WWXA 2YC4C 2YJ3A 1RIIA 3TAHA 3HEMA 1M34A 4I4TA 4XWTA 3OLVA 5JXWA 4ITVA 3P8ZA 3S1SA 1QVZA 4MAAA 1ADJA 5CCMA 4XIYA 4KK4A 4UBLA 1COZA 3FKSD 2LUOA 5T8IA 4EKIA 1MB2A 1JDBB 3K1AA 1UDWA 1H6CA 3ESQA 4RQAA 2DQSA 2REQA 1GKIA 2XYRA 5AJUA 1WB5A 2QT1A 2RKOA 2Y6VA 2YN0A 4FN4A 1R00A 2O8DB 2WJ6A 1TI7A 4IIJB 2FETA 2FJUA 3IQHX 4ZT5A 2I3GA 2L0XA 4XXHA 1EVLA 4BERA 1CYEA 3LH5A 5JI2E 1IHOA 4IZ6A 1RRKA 5DB4A 3TLCA 3ZDCA 5IW8A 3ZBUA 5AW6A 4W1SA 1D07A 2VK8A 1N92A 4XDZA 2YYSA 4E15A 1OSNA 2X14A 5E95A 1TM5E 3SQVA 1SCUA 2HCTA 4WD3A 4FDAA 1AQJA 4BMYA 1WAO1 2AN9A 2NTJA 3BH6A 3QNKA 1N57A 1P6QA 3CF2A 2OOSA 4JY7A 2OBFA 5J4VA 1Y1KE 2ECOA 2GT1A 4JZKA 2YN4A 3LEWA 3BRCA 2YVAA 1GD1O 2I7DA 2ATIA 3DZGA 4ZHQA 1J06A 3GGOA 1C7ZA 1FS5A 4MWTA 4Q3BA 5AOXB 3D7LA 2OBXA 3ESZA 4Z7NB 1QXSA 1RQ2A 5DEIA 3UPUA 2CXUA 4R16A 3D9PA 3RC7A 3NC4A 1XO1A 3K0FB 4IIJF 3LY9A 3KT3A 1BD3A 2H6GA 4ALKA 2GGSA 4GCOA 4MWEA 5KQGA 5E9QA 5T64A 2IYZA 2ACKA 3GFOA 4EJSA 3ZKAA 1QNLA 4PCLA 4JA7A 4QSHA 1Q1QA 5LP6A 3BK7A 4BTAA 4X62B 4XOIA 3OFJA 2OQIA 3A9SA 3CRRA 3U17A 1XZPA 2GN9A 4MZDA 2ZGDA 1VM6A 2XPCA 4H7FA 3I5PA 1UMKA 3H9BA 1FNCA 1Z22A 5H3HA 1L1RA 1LW7A 1X7YB 4RUKA 5HIIA 4F12A 3RT9A 2VZEA 2WFMA 2OAQ1 2AB0A 3C7DB 5IC5A 4R9VA 3FR7A 3ZV6A 3T94A 3C1UA 3IBFA 2EERA 2OXTA 3ZCRA 5AJLA 4YS6A 5BMVA 3K96A 4BB9A 2IUUA 4DWVA 5GWXA 1BOFA 4PYOA 3GARA 4UYJB 1V0JA 1CEEA 3UIEA 3T3GA 2F4VB 3D54D 2QTVB 1H6PA 4PDXA 5FFMA 3PQ3A 4AX8A 1WMEA 1EX7A 1ULAA 1H0AA 4A63B 3BGIA 4LG1A 3C8HA 5KCZA 3A9VA 4MWZA 4IMPA 1LRLA 1Q7BA 4X7MA 4ABNA 4O60A 3DDOA 3C4JA 3U4MA 4J2OA 4KNVA 3E2MA 2DG2A 1U7PA 2YQ8A 4QOIA 2B98A 1QMGA 2KW5A 1LY1A 2O2IA 4PO1A 3OJEA 3OZTA 2JD0A 2FQ1A 4KZCA 3EVAA 4Z4FA 3ZTYA 3IUBA 1RAIA 2VJBA 4HRLA 4B4OA 2WKWA 4JLWA 4AKIA 4J16A 2SNIE 1DB3A 1G8GA 2GYUA 2V4LA 1UODA 2ZWMA 3EZ6A 3U3WA 5C7LO 3WL5A 1LW6E 1U2SA 3VSEA 4W99A 4HZGA 1NQOA 2ZSKA 3B70A 2J0EA 1WVGA 4TTTS 3VZBA 5ERXA 2GXSA 4ZRNA 3H0CA 5ALTA 4AYXA 1HXHA 1NQAO 1EP2B 4GVXA 4ZQEA 4QPCA 5KVQA 3ROKA 2I2OA 1OH8A 1NN3A 3MTQA 3H9CA 1DRKA 5JVDA 1R0BA 4E32A 4N0MA 3REQB 3EPRA 4Y6LA 4JA0A 4WTOA 4Z4HA 5BRAA 2WFLA 3D8BA 5D3KA 4FHCA 2HEIA 2CXTA 3KAJA 3ZV4A 2PAAA 4B87A 1PG0A 2G77B 4YRZA 3QKSA 4UBOA 2P2NA 2ZJ1A 1R4NA 1JTFA 2JC3A 3VZDA 3HSKA 2IW1A 1CJKC 4I1MA 4TZKA 2Z6AA 3HYMB 1NONA 3L7JA 5EWLB 4PLWA 3WYBA 4Q3AA 5B36A 5C5IA 2WXHA 3RUPA 3HN2A 1L7DA 1L5RA 4PSUA 2NUTB 3BMNA 4LNUD 1W44A 4TKMA 2OP0A 2AJLI 3HZZA 4WOKA 4P58A 3BMCA 4QLAA 5T3YA 3RH0A 4HS2A 1Q3KA 2HM8A 1XRNA 1OH6A 4G1EB 5AW8A 2HIHA 2EJCA 4BY9E 5E1DA 3DOJA 5DBEX 5SZHB 1N5IA 4HWKA 2G6TA 3LFHA 5J2UB 2ZBDA 2OVFA 3Q0IA 3O4JA 4Z51A 3C39A 4UUNA 5AN8A 1C0EA 2G5PA 4LAFA 5D2CA 1ZMBA 1WXWA 2R6AA 1UBNA 4N7MA 1VLHA 2EIME 3MV2B 1QHEA 1CQZA 2BMAA 4MAFA 2YFQA 2EFGA 1W76A 3OCZA 2WD9A 1A9RA 4IV5A 2DBQA 2JLYA 3OTQA 4B82A 4BXOB 3ICQB 3L4BA 4DA4A 4MPPA 2JFNA 2Y2UA 1Z47A 2PO5A 1EVEA 1X7GA 3FWZA 1MIOA 4UAVA 5H83A 3ZY6A 2KZTB 2VF7A 5ITSA 2J0QA 1A50B 3OCJA 2X4GA 1TCUA 5IC4A 4RJJA 1F4PA 5FA6A 4MI3A 4OYRA 5CHEA 2JIPA 4D96A 5M7EA 4YPVA 4YACA 5A5FA 1Y6JA 5FUBA 1ZD1A 3DM5A 2Q50A 2WP8J 2MSWA 4F45A 2P7IA 1FTGA 1WEKA 3AERA 4C87A 1L5YA 3AIMA 2WA1A 1UAYA 2DQKA 5A1JA 3Q12A 3SICE 1P7YA 5AVXA 1MFZA 3RKRA 3TOCA 4QREA 4NZMA 4K87A 1V3VA 2C95A 4AN0A 4MDYA 1RQPA 3VX3A 2FPMA 3AAAC 2C5EA 3ORQA 4N7JA 2R86A 1WDLA 1KYXA 1PJ2A 5BR4A 3UK1A 4X1IA 2NU6A 5DNYB 3HFSA 5IWAB 1I1OA 1KSJA 4ILGA 1SUPA 3AM4A 2DECA 1HQCA 2PKRA 3AXSA 1QIJA 5ARCA 4PLZA 3HCOA 5CB0A 1ZA2A 5EYPA 3HACA 4CMKA 3R6LA 5C8XA 2ZE8A 3I83A 3T4XA 2FOIA 4WOBA 3R74A 3GXOA 2D2EA 2G0TA 1RADA 1NI4B 2ZPTX 521PA 4UOQA 3GJ5A 1AKVA 2F0YA 2XOEA 4A73A 3L9XA 1QH0A 3EYWA 4ZO8A 4M0MA 2VPYA 1VC2A 5A6SA 4D43A 2LDBA 5EXPA 2BEVB 3AEYA 1GFIA 5KNCH 2QY6A 3C5CA 1SZJG 2NACA 4AEZC 2G4LA 3IOBA 3LC2O 1E5TA 4U8HA 1P4GA 3Q72A 4DBVO 1DKQA 3NBNB 4V1CA 2XUQA 3D7MA 4ZGBA 5AI5A 1I10A 1J20A 4AKEA 1OMOA 3EVNA 4BU1A 3IMFA 4Q69A 4IOJA 3AP1A 4MQ4A 4BUZA 3H8JA 5FPTA 4TWAA 2ISSD 4WNYA 1Z08A 4UDOA 2PMCA 4PZLA 1MW8X 5DYYA 1VE7A 4RE6A 4KQEA 4DEVA 3EZFA 1GPUA 3C3PA 2VP4A 1M2KA 1I51A 1KTVA 5CBOA 1QFMA 3Q5EA 5FDFA 5AKXA 1D6MA 1CUWA 4JP2A 2VDUE 3PB3A 2VDQB 1O6CA 4GTOA 2H00A 4MWSA 5I7VA 1PHRA 3TX2A 4GTVA 1HQKA 1FSSA 3QBJA 1EK2A 3KRTA 5DDIP 3I6ZA 1E2UA 2B78A 3PPVA 5AXAA 4MJLA 1L5WA 4WSOA 1G19A 3BQMB 3ZWOA 5AYVA 3OF2A 5A2QA 1P2UA 1XTJA 3KLBA 4PANA 1RRFA 4L0MA 2NVBA 4WDQA 4PYNA 5D6OA 1XZKA 4LPKA 1SK8A 2DLDA 5DPMA 4MS1B 3PFBA 1POXA 2MU1A 4MVCA 4RD4A 4KMSA 1PS8A 3O3NB 1MEOA 4YY3B 1T1GA 2WU0A 4GYYA 3CEQA 3GA7A 3MOGA 2O06A 3MRSA 1W94A 3GLSA 1GKYA 1S4QA 1D9XA 5ALFA 3P9QA 1PFGA 4IDDA 4RD1A 4OU4A 3LA6A 3GVPA 5T6MA 3CRMA 4TPKA 3H5WA 3CLVA 2PUTA 4ZVQA 2X6KA 3LPCA 1TVCA 3P26A 1ZVJA 4WJZA 4CQMA 3UHJA 3VISA 4W7SA 3KU1A 1UBGA 1P44A 5HKPA 4MCAA 4N54A 1DAGA 4LTNA 3ROQA 3H9UA 3C72A 2H59A 3CLHA 4KGXA 3PF8A 4W6ZA 5JFOA 3N58A 4RGVA 3A1SA 1BFKA 3KD3A 2PUGA 3JYQA 4I9NA 3EA0A 3ENNA 3K92A 4NOMA 4XEIG 2FPUA 1E7VA 5HKKD 2APJA 3II6X 4NI5A 4LRUA 3TBHA 4LQLA 3MD0A 4F97A 1E3WA 4NDAA 1E64A 5AKHA 3T3OA 3RK4A 3U7EB 4ARVA 2NUAB 1P72A 4TTJA 1JJFA 1N9GB 1KR2A 5EOVA 4X1YB 1RS0A 1YTLA 1FFEA 5A3JA 1SUDA 1GV0A 3JD0A 2OBYA 2ZETA 5HGXA 1UK9A 2WU8A 4NURA 3FDZA 1E6KA 2OXIA 3KXIA 2H7XA 1OH7A 1AMOA 13PKA 3N74A 3O48A 1HLPA 3I12A 2DBRA 5GGYA 2UWJG 4B93B 5LFAA 1LLFA 3SYLA 2WVIA 3CK8A 3A1VA 5JECA 1ADCA 4V3CA 4Y9TA 3LKUA 4KFSA 1UW4B 2YL2A 3EDRA 4LHEA 1DJPA 4B85A 3BRWA 3ZQ6A 1W93A 1Q91A 5LC1A 3DHEA 2QTNA 4OFXA 2JAUA 3F5QA 1JU4A 1A8HA 3ME5A 3ZHXA 4M7RA 1NBAA 1HNNA 4DNQA 2VNIA 4X91A 1CJBA 4HPWA 4ER0A 1TDJA 3THOA 2AJ8A 5TGDA 1UFOA 3WWPA 1W85A 4QFBA 1ZD8A 1W0JA 1CDOA 3SWWA 1SUFA 4EB8A 3PH0C 1DCFA 4H7PA 1USWA 4AQYB 4QAQA 1W7AA 1Z0SA 3C16C 2D3TA 5FP0A 8MHTA 1NZNA 4C0JA 1K08A 1EWTA 1NFFA 4Y6RA 4TV9A 1MZVA 1O6BA 2JD2A 1R50A 4OM8A 4Q1AA 3ADDA 2PVSA 3ZU6A 3HFRA 2O7RA 1NSTA 1JX6A 4LS3A 2W6IA 2GDJA 2QENA 2YIVX 3H5AA 4F8JA 3EXHA 3KAPA 3DR5A 1A3CA 2C7RA 3HXBA 4UJ3A 5P21A 3ASOE 5DCLA 4P83A 4Z8YA 1JB9A 2SCUA 3KUUA 1SHKA 3RC9A 1IEWA 1ZXLA 2F3UA 3LF2A 2CMKA 1PBNA 2BF7A 3G9UA 2MWMA 3TJPA 2XWBF 3AG1E 2V4UA 4G2NA 4Q3CA 5EE1A 2EP8A 3FTDA 1NQ5A 4OQPA 3PHBE 1Z5NA 2ZRAA 1XDUA 2BH2A 3VR1A 2OG1A 1UZMA 5K0TA 3E37A 1GVNB 1SC1A 1GSHA 3UT5B 4BMCA 1YQWA 4MO9A 3U81A 1XJCA 1VE5A 2W43A 7YASA 2W0MA 1C3JA 3QMPA 3LX8A 3OZCA 4MQFA 2WTNA 4TGLA 3LGAA 1LD3A 3IT2A 1TOAA 3KDAA 3RIYA 3V3KA 3Q0TA 2FO1E 2LW7A 4WCFA 2VCEA 2BRUA 5F4ZA 3R0XA 3DPIA 2FY8A 3L6EA 2VCHA 2PEYA 5JXHA 1YCDA 2YV5A 4F5DA 4GBMA 4F38A 1YQ9A 1YJ5A 3BF8A 3ZWCA 4DWOA 5EYLA 5DGHA 3Q8LA 4ZTBA 1N4QA 1GTRA 1J8FA 5KVAA 1PWHA 2HR2A 5JNLA 4DOMA 1D1PA 3Q15A 3M9WA 2HYDA 3N2KA 2HA2A 4EA7A 3F2VA 1CUUA 1SU8A 3TFWA 4MIYA 4XCXA 2VK2A 4CM4A 2FRVA 1NBEA 4F4HA 1T3ZA 4KXUA 3UAGA 2XPIA 3RVKA 3T1YB 5U4XA 4TYMA 5EILA 2IONA 2FSFA 5GZ3A 4PCUA 4C9BA 1OFIA 3OLCX 3FCEA 3CH4B 2F1OA 5KSPA 2FWBA 1ZCFA 5HK8A 5BOVA 4B76A 2OD9A 2IGTA 1HZZC 4P35A 1O96B 2BYTA 1Q95A 1QYCA 3H2HA 1B2RA 4OJKA 4OOFA 5JSKA 1J8MF 4X94A 1JG6A 3C3DA 1MHQA 2FPPB 4WNFA 2OGZA 4QULA 3R7RA 5DKFA 1YS9A 4KEAA 4R71A 3TR0A 1QG4A 4RLQA 4JKIA 4YDSA 3T0GA 1K06A 4K8OA 2I4IA 3LECA 4ZRMA 2UZ3A 1JCRA 1EFKA 2JW5A 3B12A 1V35A 3T9FA 1NJ8A 3FTVA 1Q0ZA 5BORA 3EWAA 5DWDA 4K5QA 2Q1XA 1AKRA 4M1QA 4YFYA 2QSUA 4EB0A 2JAQA 3I0NA 1XFAA 2M9MA 3O95A 5AVOA 3BXXA 2RI1A 1MYOA 3H5LA 1ACLA 5ALIA 8GPBA 4U7JA 4YDWA 4JVSA 2ZVPX 4PQGA 2BUGA 4AZ3B 1E89A 3Q3IA 1JQ5A 4NABA 1OFUX 2Y2VA 2O7NA 4DVJA 5LD2C 1TJYA 1CEQA 1QE0A 2GZDA 3A7EA 4AAYA 3CZ9A 3TX6A 4XA8A 3DDUA 4PLYA 3CKBA 1BU8A 4RJLA 5BY2A 5KTRA 4LW8A 3T9EA 2H5EA 3TLGB 3UOAB 4IR7A 4BFVA 2B4YA 2YRWA 4TUMA 2QP3A 1X7XB 3BQNB 1BS9A 4AURA 1ZL0A 2OXCA 4HAUA 2O8EA 3WKBA 1BDHA 4EBFA 3FU3A 4NH0A 5ALQA 4ZP1A 4QM6A 3VJLA 3EZLA 1FFBA 1ZSNA 4B94A 4PZDA 3LCAA 4P7GA 3DM9B 5C5DA 4OP3A 1YHZA 1U2VG 3NNSA 1DV2A 3QVLA 1P0QA 4PHTA 1NFQA 1SVOA 1DI0A 3H2BA 3WK4A 1E3IA 3WLIA 1FOEB 1E9EA 2ZXWE 2QM8A 2YHIA 1CG6A 6Q21A 1IONA 2HA5A 2IEAA 1CETA 3H05A 4ZVVA 2C2ZA 3C5WP 5AP9A 4R2JA 5BN5B 5B2FA 2D7DA 2R6DA 4MPJA 1M66A 1I9GA 2Y69E 5HJ2A 3FHJA 5DU2A 1CUEA 1GR0A 1KP9A 3BD8A 1Y48E 3C24A 3R0IA 3E5MA 4NYIR 3BCRA 3ZCSA 4PYLA 4KMRA 4WWHA 1C4XA 4IGIA 4BKOA 3PDHA 2DMRA 1W88A 2GROB 3LQ1A 1F48A 1BJTA 4XQCA 4RWEA 1Z3YA 3ZEFA 4D1YA 3C41J 2HCFA 1FSZA 2C8LA 2B9VA 5BWNA 1SY7A 4DJ5X 5G05C 3WYFA 4NTZA 3QITA 5ANLA 4WBXC 3FBGA 1SOUA 3ZUGA 3LDUA 6YASA 2PNJA 3FSJX 3IO5A 4ANVA 1I6WA 2CE2X 3SJUA 5TS2A 1BHQ1 2FSVC 5LOVF 2A9KA 2ZB7A 4R2MA 2BGUA 1DZIA 1XCGB 4JLKA 4II3A 4F84A 1FJHA 1FYEA 2H5IA 4QU5A 2HSEA 4DUGA 2YS7A 2RGEA 4MUHA 2ZJ5A 3EMKA 1UBJS 2CXNA 4R3UC 2GCOA 4FGUA 3BDIA 1T9GS 1EHCA 1GQFA 1TO2E 3ZHEB 2X8LA 5DHTA 1U2GC 3ENEA 1H2VC 3WB1A 2W2KB 3S7TA 4G86A 4A5SA 3G2TA 3ANMA 4KLNA 3ONFA 1KZPA 1VI6A 3F3KA 1V11B 1BG6A 3F78A 3I58A 3R7LA 1UT5A 4O8ZA 1BTOA 4CGWA 4QRHA 5BPPA 2ZS8A 4J8PA 1USGA 4D92A 2Q3BA 5L7YA 1BHJA 4G41A 1DU4A 5EJEA 1E6WA 1IHYA 4S1VA 4GVLA 2W4IA 3OZXA 3IEKA 4FILA 4WGFA 4EO7A 3H11A 5JZSA 4LSMA 1G291 1P4SA 1F0PA 3EE6A 1P5RA 4ZQCB 1KI9A 4ATGA 3W7AA 2Q1WA 5AOCA 2W2OA 2NZUG 4Q4AA 4K2HA 4OOEA 2BBTA 3WDSA 2MMCA 3VHQA 2P41A 4OO3A 1I80A 4GMXA 5I9TA 5IUKC 3AWIA 3G0BA 4F4IA 4ZI7A 5GMOA 3TE7A 3IBTA 1YAJA 4AICA 1GRCA 4J3NA 3V8RA 4GX5A 4G1FA 3DO6A 4BQPA 5FULA 3COSA 1C80A 4EZIA 1V5GA 4LVCA 3VHLB 4ZGWA 3EDYA 5AK5A 2KXPC 3KQWA 2L19A 2TMDA 4MARA 3TZ6A 5FFFA 5EJ7A 3ZZUA 1INZA 1R74A 3CLSD 3UM0A 4ZEVA 1U8CB 2VJAA 2HM7A 3MJ4A 2FWRA 5KB3A 3RRNB 5DI3B 3LCCA 1TUGA 2WSLA 4IFTA 3RWBA 1YA4A 1N6IA 4X93A 1OXVA 1QS0B 4KXVA 1GTVA 4NHOA 2JIQA 1YVUA 3OKFA 3ZWVA 4NJMB 4Z9BA 4BGEA 5CRIA 2P9TA 5ESXA 4WMLA 1Z35A 4K40A 1V1RB 4NYMR 9ATCA 3PX7A 3LJ3A 4QOSA 2NM0A 3N07A 1GFSA 1SA0A 4NBUA 4U5QA 4BNYA 4JBGA 1KI1A 2R8ZA 4GPD1 2QBYA 4OQ4A 3ZUPA 1QYVA 1FS4A 4TUYF 4GMKA 2P6UA 2ZIXB 5HRAA 2VHCA 4B3TB 4PSDA 5ARGA 2XUGA 1Z39A 4ODIA 4P53A 1JQ3A 3PXXA 4B6JA 4CF3A 3Q7QA 4BAGA 2CF5A 4I4CA 2JFZA 2Z8YA 2AFIB 1Z9BA 3RYIB 4LNGA 1KDTA 1FVFA 2D59A 1YDFA 1P4AA 4GOKA 1M34E 3R3WA 3FFWA 3SQDA 3FVTA 3TIVA 2P2GA 2OOEA 4B31A 3NNNA 2PSSA 2SBTA 5JHBA 2FU5C 2OBBA 3HVJA 1YXMA 3VTXA 1XQ9A 1DBPA 1JHRA 3HKDB 1A17A 4XUEA 3C7KA 2O0MA 2H0QA 5KNCD 1PJBA 5G1PA 3LCUA 3NAGA 2P6OA 1QIMA 3UJHA 4XGRA 3BE5A 2IOFK 4Z2AA 3ZWYA 2XMDA 1PVOA 2YZKA 2R6JA 4JBHA 2F43B 3HDGA 1K75A 2RGRA 2H51A 4REOA 1DWPA 2YWHA 4JJ7A 2WPDA 1U4NA 3PXAA 2AMFA 4OBBA 5REQB 1GTSA 1Z4KA 4I3FA 2PM6A 3U9WA 2O2ZA 3NAWA 2PRZA 5DP1A 4Z9FA 3TOXA 3AG3E 3SC2B 4KITB 2WUFA 3CTPA 4NL4H 3D2BA 4C7OA 4TM8A 3DDNA 4O4HF 3D5QA 4DDKA 4I36A 2C54A 4JI5B 3E5RA 2AJCA 2FW9A 2VLBA 3HB1A 4DDWA 4BKMA 4HBZA 3V1YA 4ZO4A 4NZYA 1GOTA 2VT6A 1NA5A 1K8XB 2QUBA 1TW2A 1Q14A 3G8CA 1YS6A 4H7YA 3RYFA 3FNEA 3B36A 1AN9A 1IB6A 3GJ0A 1EESA 3ENVA 1JZSA 2OSVA 3V7WA 2ZDQA 1OVGA 5JDIC 2DWOA 1YWGO 5TEVA 1EDBA 821PA 3BIOA 4BV8A 1P91A 1HQYE 3A4VA 4UYKB 4XLTA 3WSWA 1MX9A 3DE7X 1G8AA 1D1QA 1ENPA 2Q8PA 2UVPA 4F72A 1GNRA 1Q0QA 3PKIA 2I1VB 1N4SA 3ND9A 2XXJA 4RSMA 1VSVA 1VLZA 4QGBA 2G07A 2J3DA 1B0PA 3M3HA 4NAHA 5KTYA 4GA2A 3I52A 2GHIA 3FIJA 1PX0A 3GRYA 1WP4A 2PRIA 4WV3A 2II6A 4QAJA 4WY8A 1RFLA 4AY3A 2VRWA 2XDQB 1MAVA 2XUAA 3E34A 2PNFA 3D6TB 1SCKA 5L53A 2QRUA 3F8TA 1TYCA 2HPVA 3KOMA 3NZUA 1Y7PA 3KSDO 3PF9A 3I5UA 1U0FA 2VDLB 1MF7A 4E5SA 5J9FA 5B6JA 1N33B 4BVBA 5KVCA 3WV5A 4S1TA 1C3VA 1IC6A 3W6OA 3UKRG 2FDRA 2Z30A 1OX6A 4J8YA 2UY1B 4EDHA 4L9AA 3QELB 3QF4A 3VTFA 3WGUA 5ALMA 2WUDA 4MP8A 4BN0A 4U7FA 1AA9A 4KRXA 4LZAA 3WL7A 4C2AA 1YU9A 5L4LA 4CGVA 4RACA 4HG2A 4JHKA 2CLMB 5ECGC 4G84A 4RX1A 1E8YA 1CR0A 5D3MB 1VB5A 1USIA 3LWZA 2QORA 5KBYA 1M0WA 2YFHA 4EPRA 4FBMA 5DJ5A 5LN1A 1D6JA 4CODB 3AJ8A 3OWHA 4MIOA 5AXDA 3Q3VA 3HU2A 2FMFA 3OTOB 1S1MA 4RV4A 2D0OB 2HQSA 5KOYA 4MP3A 1J2YA 4OBXA 1Z16A 4ZI5A 3PRZA 2Q5QA 1V41E 4A7PA 5DLPA 4I17A 1B43A 2GBIA 3TW4A 3CR8A 2A1TR 3T99A 3GRZA 3DDZX 5AKLA 1O94A 4N5LA 4Z53A 1YRYE 3FUXA 1ZM9A 4U04A 1V47A 4LJYA 3R7SA 1C50A 3OUUA 1AUPA 1GA1A 1XA0A 2WIDA 1OVMA 3PS9A 1JHDA 1IYGA 1A4XA 2A4ZA 1Q77A 3GT4A 3QJ5A 1JYFA 3JVEA 2R8XA 3VR0A 2BOVA 3VC1A 2VNSA 3HJBA 1EP1B 1YCFA 3BYZA 4BC0A 2LBPA 4JP1A 3RVNA 1C1YA 2GYWA 4U95D 1GFWA 3ZWNA 3E48A 2IEYA 5EJ8A 1Y80A 4U39A 1LK7A 2CNOA 3TD9A 3TF5A 1MZCA 2I5PO 3JD3A 3RBAA 2VRCD 3KCNA 4PHHA 3OBIA 4GX1A 3ZDXB 3DT8A 3MNFA 4LCTA 3O4ZA 2YMMA 4MRSA 1PZHA 2ONJA 2BAGA 4GDMA 3KV1A 3AHDA 4B3DA 3V4VB 4UNNA 1DKNA 4JW1A 3AS4A 1ZI6A 3NBYC 1HO8A 4WLUA 2EKLA 2IYAA 2VFAA 4WLEA 4KMOA 5HFNA 4J7WA 2IWHA 2Q1UA 1DWUA 2XEEA 1FB5A 1MGOA 1JHAA 1BJRE 3ROPA 4GLOA 5B57C 5CM2Z 1AUOA 1Q0TA 1IB0A 2ZQ5A 3NDRA 4ETWA 4F9TA 4OI0A 2PGDA 4JOQA 2JATA 2WVHA 1GKUB 1KI6B 3TDMA 4ZAXA 1WM5A 2PLFA 4F06A 5ENZA 3GA0A 4MKHA 3LE8A 2QAGA 2D1TA 3L46A 5LWQA 4Z4GA 3E58A 4OJNA 1J90A 3HP4A 4EO4A 4QO7A 4DJEC 1Z4IA 1Z07A 3EVBA 2FRDC 4CGZA 2NNWB 1OY1A 3GR6A 1G4AE 2OV6A 4BVEA 1MOPA 1NAHA 4F1KA 3PC2A 4YASA 2FR8A 3NRJA 3OE7A 2G83A 1GQOA 3G0CA 5CD9A 1NNLA 4G36A 1JIQA 4LKOA 3PQ4A 5BN3B 4XUDA 2ZRLA 3B2NA 2BFBB 4ES6A 1DKOA 5J4HA 2CL6X 3CLJA 2RGNC 5GAJA 1MEJA 1HT2E 1MH9A 3W6NA 1BGXT 3ZEIA 4CIBA 4ZOLB 5CK5A 4H3HB 3S68A 5INTA 1E4EA 2F3QA 7MHTA 2I67A 4TXMA 1XZNA 5G1OA 5JS2A 4AZTA 2ZYVX 3IYLW 4OLAA 4XRGA 5K51A 4KOAA 1S3FA 1WXEA 2OZVA 4E14A 4G1BA 1PK9A 3UGTA 3AF1A 2HD4A 4ILKA 3WLRA 2L69A 2HGSA 1I6LA 4I9UA 1QF6A 1WKBA 3G13A 4BS9A 2ETVA 3USES 3CVPA 2ECFA 1KEEA 3MGBA 1MW9X 4K3VA 1IRXA 3CRW1 3RVDA 3C6KA 1GARA 4ZZ1A 4TYWA 3C97A 2Q8NA 4Z9YA 3WXXA 1AOXA 2YHBA 3K0CC 2AWNA 3PQ2A 5EHXA 4WASA 4GTPA 4B33A 3CMCO 1M0SA 1W8DA 1K3TA 4IOMA 3RK6A 4H1TA 4CLHA 2YFYA 2YQ4A 2ODWA 4YWJA 3GLIB 2BKLA 6ABPA 5CW2A 4GQIA 3KPJA 2ZDHA 4YRGA 2WW8A 4ZOLF 3Q2OA 4JJ4A 2X7XA 3QNMA 1C2TA 3T54A 4DX2A 2F67A 3P9RA 2R3SA 2NP7A 1NQTA 1UC9A 3MPOA 4CIAA 3KYIB 1WP9A 1D3AA 4CM3A 4BO6A 3RBVA 1YRHA 4PX2A 2J5QA 4FFOA 3VRHA 3U3JA 5JYEA 2XBUA 4LQCA 1M1NA 2ZBQA 4QUDA 3SF4A 3EW7A 4FT2A 4Q1VA 1HL7A 4GMLA 1YZHA 1FLVA 5JBIA 5D87A 5K8VA 4FZRA 1Y6IA 3CHQA 2RB4A 5IVPA 1MJGM 4HDKB 2IZZA 4LY9A 4PRLA 4HB3A 1GRNA 5A6CA 2H6EA 2O6LA 1N0HA 1KQPA 4FYJA 2AE2A 1I3LA 3IQGX 5KOJA 1NJFA 1F1JA 3KT8A 1PNVA 1T1EA 1CT9A 3C6BA 1K6JA 1SCBA 4JC5A 3BXZA 2C3YA 2X8BA 4DV5B 3M4XA 2ROQA 3DNFA 1JXQA 5B12A 4NARA 1QZZA 1H0SA 4CDRA 3HCEA 1O3YA 1TZJA 4HNGA 1J0CA 4IF6A 4BGUA 3AF2A 1OAOA 4ACKA 1QRSA 3E53A 4LBZA 1FDSA 2VPPA 1Q7EA 2RHOA 2H6FA 1Q3TA 3KTAB 2XUDA 1EFVB 3A9TA 4D4IA 1MHTA 3QHAA 2XPYA 3PZ1A 5EZYF 1OBOA 2I7XA 1WUTA 1YUMA 1QBKC 4DJJA 1DBIA 2MIIA 3OLYA 1H4SA 4P31A 2VCYA 2C5SA 1WHSA 1ODSA 4UHHA 2C2OA 3EPJA 1YBFA 5CURA 3SYMA 3GLGA 4WN9A 2XKJE 1TL7C 1DO0A 3OLZA 3PICA 3DL0A 3JQ8B 3BL8A 5JE8A 3F7NA 3HWSA 3K3PA 3S8EA 1MOQA 2DHDA 4YXWA 3P2MA 4LMBA 3DAGA 2JFQA 1WF3A 3EGXB 2IBSA 3T7SA 3TPZA 2DVWA 1IQ0A 1BGWA 3UMRA 3SQWA 4GW3A 1WXIA 4QBIA 3EJNA 4OQDA 4KZKA 1VXOA 1U2ZA 3CT6A 2TECE 3GWZA 4I46A 1WZUA 1NVGA 2ETXA 3K2EA 1I36A 4IH1A 5JAOA 4LHSA 2X8JA 2A5JA 4RMJA 3ITDA 3B3QA 4HB2A 4AO6A 2ZUUA 5DO9A 1O97C 3CVWA 3I4RB 2V7QA 1LBIA 4P36A 4ZN6A 1VLQA 1F2TB 1BVRA 4MWDA 2DBVO 4O4IA 1HNWB 4LIPD 4M0UA 5IF3A 3QIVA 2JGMA 5EZ5A 1VBMA 2C99A 4HS4A 2VEOA 4RPGA 4EKYA 2GX6A 1T5SA 2CL5A 1CUHA 5HPYB 4GR4A 4C03A 3INRA 1W35A 3TNYA 2EL7A 3F7TA 1PDWA 3UFXA 2Y1DA 4ZVNA 5CFRA 4QUHA 1Q6ZA 4NULA 4BRSA 4KSCA 1R0WA 1CB0A 4YRJA 1ZBDA 4L7VA 3P27A 3WRWA 3A14A 4LJ7A 3Q8XB 4HLQB 4CMIA 2OV4A 4R81A 2JFOA 3KKEA 2OC9A 3SBXA 1BXZA 4BO1A 2Y0EA 10MHA 3FTPA 3U7FB 5J40A 1YVDA 1YOVB 3R6TA 2JPDA 4MUBA 3DOEA 4C0EA 1S9HA 5AW5A 3O9VA 4INOA 1UXOA 1URPA