3TAXA

A neutral diphosphate mimic crosslinks the active site of human o-glcnac transferase
Total Genus 271
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
271
sequence length
714
structure length
695
Chain Sequence
b'THADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
publication title A neutral diphosphate mimic crosslinks the active site of human O-GlcNAc transferase.
pubmed doi rcsb
total genus 271
structure length 695
sequence length 714
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3taxA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3taxA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 3taxA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3taxA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3taxA03
3L7CA 3OY2A 2YJNA 3CK8A 3ASDA 3Q47B 5FZRA 3CVPA 2R66A 4JA7A 4O6FA 2QLNA 4BQEA 7GPBA 2FBNA 3CVLA 2O6LA 3CX4A 2IV7A 2AVPA 1GZ5A 4GA1A 2I6HA 3H4IA 3T3HA 3MKRA 2PQRA 3C48A 2WPVA 3VDNB 5KJLA 5IKPA 3ASHA 3Q5MA 5LQDA 2Y4TA 5JJ6A 4KYOB 2PRJA 2HY7A 3UUXA 1XL1A 2R4TA 3PE3A 3S7BA 4ME2A 1C8LA 3ZCTA 3WAGA 1GPBA 4LDPA 4UQZA 3HBFA 3IA7A 2IV3A 5A6CA 2C0LA 2HYZA 1C50A 3ZCPA 3Q3EA 4KQMA 3DDSA 3AS8A 5EKQD 3T3GA 2C2LA 2AV6A 4RG6A 2XGMA 4GZ5A 2VSYA 2IYFA 1PYGA 5GPBA 1Y6GA 4F97A 4Z5XA 3EBOA 4EL5A 1JIVA 4WADA 2OFFA 2LNIA 5TMBA 4F3VA 5G05C 4AM9A 3C4QA 3COPA 5BW8C 4CGWA 2BGUA 3MRTA 2GEKA 2WTXA 4GYYA 2H1HA 1Y8MA 4GCOA 2F3UA 2XGOA 1AXRA 3RSZA 2IUYA 2IYAA 1FU7A 3PDNA 1ABBA 1VGVA 4GZ6A 1NLMA 5DBKA 1P4GA 2VSNA 4U0ZA 1WAO1 4HLNA 3OKCA 1GGNA 2C1ZA 1IIRA 4N39A 4M83A 1YA0A 4A1SA 4G1TA 1E96B 3SZ7A 5G04C 3G2IA 1H5UA 3CV3A 1NOKA 5D01A 3ZCQA 3ZHEB 3NB0A 5KJNA 4CDRA 3HBNA 3RIBA 1ZBPA 1Z6QA 4GA2A 4HOUA 1EXVA 3GPBA 1F0KA 3QHPA 1IXYA 5HI7A 1F6DA 2HR2A 3OTGA 6GPBA 5BT1A 4X7MA 3QKYA 4G2TA 3RT1A 2QRGA 4JL0A 3S29A 4G25A 5EX3A 2IEGA 4GA0A 1WV0A 2PL2A 3VTXA 3ZPJA 4JHRA 3MTBA 3GW4A 2IEIA 5M72A 2F3QA 2FETA 2F3SA 3NP7A 3UPVA 2KCVA 2P58C 3CUYA 2G9RA 2BISA 2C9ZA 5D00A 3T3IA 2FI7A 1FTQA 2VCHA 3O48A 4G26A 3OKPA 1XNFA 1B89A 1JIUA 4YVQC 3OXLA 5ARFA 5KJKA 2Y4UA 4UI9J 2JZCA 4N3AA 3G2NA 5JTTA 2IFUA 2J9QA 1FA9A 1Z6PA 2G9VA 3Q3IA 3LKUA 1UZUA 1WW3A 3RU0A 3AMVA 4U04A 4WUYA 2G9UA 2R4UA 4AY6A 4N3BA 5JTUA 1FCHA 4MICA 1JG7A 1L5WA 4RENA 4XI0A 1P4JA 2X6QA 2Q7FA 1ELRA 3UYKA 1FS4A 5CHEE 4YNDA 2AZDA 2VG8A 1LWOA 3HYMB 1NZDA 4J8FA 1NA0A 3LY9A 5A7DB 2X6RA 2XA9A 3G2LA 3NP9A 4F9FA 3Q3HA 3UQ3A 4W6QA 2FF4A 4J8DA 1P5QA 3MEKA 3BEEA 3ZCSA 2UY1B 1XOIA 3OXGA 4YUAA 3MV3B 5CCLA 3CKBA 2KC7A 1HLFA 4HOQA 3GZ1A 3MV2B 4UQYA 3LY7A 4MHSA 1GPAA 4U0UA 4X7PA 5JJTA 4H7XA 4W9RA 2QLLA 4RIFA 2X0FA 1L5RA 5HXAA 3FROA 4GZ3A 4G23A 4EKYA 5IKOA 4NESA 2H1FA 5DLDA 3QWPA 2XCIA 1QZ2A 3BDAA 3CEJA 1HXIA 2ACVA 5G04J 3CUVA 3MS7A 1FC0A 3CUWA 1SXPA 1PSWA 5C1DA 4M7PA 4AY5A 2VGXB 3OXFA 4CTNA 3URZA 3L01A 1W3BA 5CCMA 3NPAA 1P4HA 4U0SA 3CVNA 4RIIA 1E1YA 3H4TA 1PC2A 2Q6VA 2PZIA 4N2QA 3MS4A 1KT0A 1B4DA 4EJ2A 3U3WA 4N2SA 1L6IA 2GT1A 2BUGA 3RO2A 4RIGA 4I1AA 4KXKB 3AS4A 1V4VA 3RKVA 3RO3A 1FU8A 3O3CA 3ZCVA 2SKDA 1GFZA 4GPBA 2VQ2A 3S7JA 4APOA 5FZSA 3T7DA 2XA1A 3CEQA 2BGTA 3MA5A 1YGPA 5TMDA 2PYDA 3QOUA 4EQFA 2QRHA 4X7RA 3GYZA 2UY1A 8GPBA 3RHZA 5FTPA 4NRHB 9GPBA 2R68A 2MHKA 3LYAA 3L7BA 4MRAA 3MSCA 4QLBA 2ASVA 4BQIA 3S7DA 1FTWA 4NC9A 4UI9K 3S2UA 3DZCA 3GUHA 1IYGA 4AIFA 1L7XA 4H7YA 2P6PA 2C0MA 3ESKA 3ZFWA 2PRIA 2SKEA 4Y6CA 3MRXA 2QN9A 4GYOA 4MHOA 3E3LA 4BFCA 4Y6WA 5FZQA 4MI3A 3DDWA 4YI5A 1A8IA 2V5FA 3ASGA 2VCEA 3LPZA 4F96A 2IW1A 2KATA 4BT9A 4XI9A 3OTHA 3TSAA 3SYRA 2SKCA 4FZRA 1P29A 1PN3A 1RZUA 3ZCRA 2FEZA 2XEVA 1QM5A 1NZNA 2BFWA 1WW2A 1NZFA 2ACWA 1JIXA 4BTBA 3MS2A 1XL0A 2VGXA 2FO7A 3FFLA 1K06A 4RG9A 2QRMA 1JG6A 1TJCA 2AW3A 4EKEA 4CGVA 2R5SA 2VYIA 5LCWJ 4BTAA 2KCLA 3ZGQA 3HBJA 2X0DA 3LY8A 3BD7A 4WNGA 3BCUA 4AMGA 2IF4A 3T5TA 1M5RA 1JEJA 2E2EA 3K9IA 2PYIA 3NAZA 3Q49B 3EBPA 3JYSA 2VGYA 2XCCA 3CEMA 3MTAA 1L5VA 2GPAA 4BT8A 5TVGA 2KCKA 4I2WA 4WNFA 2FFRA 4LEIA 3BCSA 2JLBA 4I2ZA 4IN3B 1L5QA 3KD7A 4YI3A 1QKJA 3ZHEA 2QLMA 2UWJG 4N5CA 4N9WA 3N71A 4UQXA 1WUTA 3RJVA 3ASFA 5TMEA 3CEHA 4RBNA 2PQ6A 1ZU2A 1RRVA 4RIHA 2ZB2A 3ULQA 3S7FA 4AMBA 5I45A 1XC7A 3VUEA 5FJYA 3S28A 4BQFA 2GJ4A 3LCAA 3CUUA 3OTIA 2NC9A 3T3DA 4HOTA 4WNEA 1PNVA 4CTOA 3BD8A 1YA6A 3CUTA 4BWRA 1SXQA 2GPNA 3T3EA 4YVOA 3OY7A 1P2BA 1IHGA 4LEUA 3BD6A 5HQ8A 3SF4A 2QFCA 3Q15A 2XPIA 4GCNA 3TAXA 4NEQA 3L79A 2QRQA 5JJ7A 4JA9A 2LSUA 3WC4A 4NQ0A 5DXFA 4ABNA 2YHCA 3TGOA 1KTIA 1XV5A 2GEJA 1KT1A 5ARGA 4L22A 3WADA 3TOVA 2YQ8A 3NCHA 1BX3A 1FTYA 1KLXA 2XCUA 3L7DA 3ZCUA 4CTMA 2OOEA 3BCRA 1FU4A 5BNWA 3L7AA 3MT7A 3VDMA 5LCWC 3IAAA 1NOJA 3KAEA 4J0UA 1QQEA 1L5SA 2GW1A 3S27A 2AMVA 4X6LA 4AN4A 3IEGA 4J8EA 4KQ2A 5D0OD 3U4TA 3CV0A 5DIZA 3MTDA 1UQTA 2GM9A 3HBMA 2ATIA 4WACA 2C1XA 2KS6A 3MT9A 3NC4A 4HOSA 3S0JA 1WUYA 1Y8ZA 2R60A 4WHMA 3QWWA 4U07A 1NVKA 1UQUA 3E3NA 4KQ1A 4G24A 1GG8A 3CK9A 3EDTB 3PE4A 3DD1A 5D0QD 1C8KA 3QDNA 3TG5A 2XMPA 3OT5A 1ELWA 1Y6FA 2DBAA 4GYWA 4M60A 3OKAA 2PQNA 2C4MA 2GPBA 4MI6A 2QZSA 3AS5A 3E3OA 3Q4AB 2G9QA 4EL0A 4KBQA 3UYLA 2WQHA 3CK7A 3TG4A 2X0EA 3QKWA 3ZN3A 5KJMA 4REMA 4I9CA 4N3CA 2XGSA 4I9EA 4UI9C 3WXXA 2QN2A 1NA3A 2QN1A 2QRPA 3RSCA 3FWVA 2ONDA 1LWNA 2QN3A 1C3JA 2QNBA 2JJMA 3G2JA 3CVQA 3G2KA 4RIEA 2HO1A 3VUFA 2QN8A 3D1JA 4RELA 3NF1A 3R9AB 1O6CA 1EM6A 2XCBA 1HZ4A 4WNDA 3MT8A 3KS2A 1P2GA 2F9FA 5FT9A 1Z62A 3MBOA 4PQGA 2QN7A 1GPYA 1HH8A 1K08A 1E4OA 1WM5A 1WV1A 5DU2A 4HORA 1XKXA 2LSVA 1OUVA 3CKCA 3GZ2A 3BEOA 5G05J 1J39A 4B94A 2ECPA 2F3PA 3VTYA 3C4VA 4FKZA 5ENZA 1Z8DA 4I17A 1A17A 4GPKA 4MI9A 3FP3A 5AYWD 2XA2A 3D0RA 1P2DA 4HWGA 4G2VA 3G2HA 2FF5A 1NOIA 1RZVA 3MQFA 2L6JA 3SYMA 3E4BA 3MRVA 5EX0A 4XIFA 3D0QA 1AHPA 3QWVA
chains in the Genus database with same CATH superfamily
1IXRC 1W4BA 2IDJA 3PJGA 4Q1DA 2R8YA 5K3DA 3COVA 2VP3A 2GM5A 2MYTA 1PDWA 3MM4A 3C72A 3OIWA 4HDMB 1MP0A 4PG6A 1XZIA 1Q91A 2H1RA 2R48A 2X8JA 4DT1A 5IHXA 3THRA 2QLNA 4PN7A 1LTQA 2JJ1D 1A9PA 121PA 2PT9A 2X8LA 5A5FA 3FTPA 3O7MA 4Q34A 3IR6A 4OHCA 1SVUA 4HB2A 1VG1A 3U4DA 2W11A 3H4IA 4OB7A 3WLPA 2V3WA 3FOZA 2L69A 1SZCA 4J0KA 4G0NA 2DCMA 2ECFA 3ZLJA 1V55E 1EFDN 1G291 1I24A 2CHFA 2CVOA 1EM8A 1MIHA 3Q5MA 2VZEA 2A9JA 3E9RA 2O59A 2Q99A 1L5HB 1B6TA 3PZ3A 3CZCA 3GU3A 1XL1A 4KQ9A 3S1AB 4DCOA 2ZQ5A 4D3FA 3KKQA 2FN8A 1L7DA 3N2LA 5U4XA 1MABA 3H99A 1OZAA 3VRHA 4DLRA 3JQ6A 5AQ1A 3D2BA 3IA7A 4LY9A 1Q2ZA 4S1OA 3SF0A 3Q87B 2ZIZA 1U2DA 5A3SA 2V5VA 1KOLA 4ENVA 5HS4A 3MRSA 1TNUA 4EHMA 1ID1A 7ADHA 1OFGA 4K6FA 1IOLA 1C3EA 3DDSA 4TSFD 1QHHA 2VA8A 2VP9A 4Q7JB 3TWWA 5KOHA 1U8CB 3MNFA 2UUCB 4FC7A 1MO4A 3I4FA 2X5HA 3ER9A 4UTVA 2AV6A 1PK7A 1VLMA 3UG6A 1MJHA 3H7IA 3GL9A 3PR3A 5FA6A 1M2JA 2J48A 4MOWA 1PGPA 2IYFA 2Q4TA 4HEJA 4PR3A 3WMWA 1UAAA 3KT3A 3AEZA 3WGLA 5THQA 2XUZA 3MFQA 4JOCA 4JEHA 4ISBA 5CA1A 2PBZA 3R9WA 5TMBA 2W37A 3T8KA 3NHRA 1E7UA 4KPUB 3UTDA 1FJHA 3W2TA 4B48A 3G0OA 4JVSB 4EA7A 4HNHA 4YMIA 5J2TF 4GT1A 2OZLA 4IHJB 1NN1A 1L4UA 3BHIA 5BWCA 1QH1B 4BMYA 4DYVA 1ZM9A 3E84A 2Y1LA 4HBZA 2CSUA 1S7CA 2BY4A 3X2EA 3L4EA 4QDZA 4CMCA 1RE1A 2J59A 2WU8A 2QUZA 4FC6A 5IAGA 1YUMA 1PWZA 3THSA 3UB4A 1P73A 1Z5GA 4AY4A 1EB9A 3IT1A 4KDCA 3AR4A 3MZLB 2B5WA 1VL0A 2IHTA 4DX5D 1OYOA 3C5RA 3P9ZA 1GCGA 1U0GA 1NBWB 1YMUA 2HKIA 2N47A 3A11A 3IAM1 4OV6B 3LU1A 2X40A 2VJMB 3RC1A 1OGYA 3O8LA 5B6PA 3HB5X 2BEKA 4HQOA 3I5AA 1CK4A 1ZM3A 2OCPA 1BTOA 5A06A 4ZICA 4UUQA 5LKAA 4F3YA 3RYCA 2C1ZA 1K3FA 5L51A 1RBYA 4CGYA 4GBED 1NJGA 2A9QA 3FVRA 3IOBA 3ZZNA 4E6EA 1TYZA 3R9KA 3UHJA 1I4EB 1FLDA 3L1IA 4PXSA 1H5UA 2B0CA 4JKOA 4REQA 1BX0A 1IYZA 4TKVB 4RPCA 1T0JB 3OH8A 3A3PA 1L4KA 3GCWA 4KZCA 2PRZA 2RFLA 4MRPA 2C5LA 2IOLA 3FTUA 3HSYA 5AFSA 3A0UA 3JASB 3CMMA 4Z99A 4GTPA 5GGXA 1XZDA 5L3VA 3F7TA 2JFZA 3A2LA 1G8MA 2DHEA 3ZNGA 2F48A 3BRCA 1D9ZA 3MWGA 2V98A 1BROA 1CBUA 4MQFB 4MPDA 2KLBA 2FF7A 1D0SA 1NU6A 1A04A 2ZI9A 4K9RA 4P4LA 1NI4A 2Y1GA 3Q7AA 4G2TA 4QBGB 4WI1A 1UANA 4K9KA 3ETLA 1K98A 4HHEA 1QHSA 2Z9DA 5JNRA 4IUYA 5K8JB 4WZAA 4YRTA 5HUHA 2I78A 3FSEA 1GL7A 2G67A 4X8OA 3ZD8A 3OTOB 4F5WA 5JV5A 3C3OA 2JHCA 3PUHA 3PQ8A 1USGA 2RGAA 1ZB1A 4O4LB 2GYVA 2NO9A 1LLFA 2BFDA 3EG5A 4B8AA 1ISJA 2J3DA 2QAGA 4XARA 4B6EA 3GLIA 1XTIA 4XDHA 4OEHA 3IDQA 2J6CA 2C9YA 2LP4Y 5DTIA 3GFTA 2FUG6 3AIKA 4DCPA 4EH1A 3MFYA 3MCVA 3VR4A 1O58A 4NKRA 3OQOA 3TGPA 1ZISA 1I7PA 1DKNA 3R3WA 1YUBA 2O2GA 3DRAA 2W6IA 2JEYA 2P1RA 4BRUA 2FN9A 4NL4H 4TMXA 4S1WA 4BVAA 2EX4A 5KJKA 2W2VA 4I08A 1W4CA 3ESBA 3W78A 1E7SA 1XLUA 5ER9A 2P9YA 3K0KA 2C2BA 1JU9A 2PNFA 2WQ7A 1HWYA 1N8SA 2CFRA 2J9QA 2G9VA 4OQEA 2YOGA 5JRZA 3IOYA 1KKMA 4FHCA 3HPQA 1WPRA 3E7FA 3P94A 3RVBA 4ESVA 2ZYGA 4OU4A 2QI9F 4FHDA 1VIVA 1KZ7B 1P60A 3RVLA 4XOIA 3P9QA 4BMVA 2C5FA 4EX6A 4JYPA 2AXZA 3SY2A 3UIEA 1NLFA 1GKKA 4DLPA 3EA0A 4A8JC 5JEEA 1T9CA 4L28A 1NR7A 1FS4A 4GMHA 1NZDA 2GRMA 4I6GA 5AWFC 3VC1A 4E4YA 1I30A 2JCYA 3OE7D 5F5LA 4D4LA 2H7YA 2IYSA 3IP5A 1AV7A 1M67A 3V8NA 4ESOA 3B3FA 3TX2A 5EMNA 2ETVA 3DM5A 3EIXA 3JTMA 1T4GA 1Z34A 4KE7A 5IKEA 3OXGA 4KUHA 3WYAA 2V4HC 2NXWA 3CKBA 3B51X 1CNMA 2BEWB 3F8SA 4CG3A 5HKOA 4NONA 5I9MA 2LCIA 3BTUA 1JI0A 1DTSA 4DDMA 4FUQA 4DEYA 4U0UA 2XTJA 4BNHA 1IPEA 1F48A 4FE4A 1YZFA 2FSPA 4UZEA 4ZVRA 2XGJA 1EMDA 4ZXFA 4DLSA 3PIRA 5A2GA 3DG9A 1Q0RA 1XLTC 2COUA 1E77A 5ICFA 4ZI2A 2HRRA 1L5RA 2C82A 3QPAA 1ZXBA 4FT2A 4KQEA 4FE3A 3IMGA 2G9NA 4C76A 4LJRA 1U2GC 2QC9A 3RAPR 3RREA 3N0VA 4Q4JA 3AR5A 2OXFA 3MMNA 4DPLA 1VZ3A 1AKYA 4DR5B 1DX4A 1KMMA 1NHWA 1OZHA 3E9CA 3X1DA 5EE3A 2GNOA 3CUWA 5KSZA 4K8RB 1II8A 4M7RA 1WP9A 1N5LA 2BKVA 1ZITA 3N70A 5CYPA 1DT5A 4AY5A 1E2GA 1SXJA 2NNLD 3HKCA 2XOKA 1P39A 4E5SA 5L6LB 1ZIXA 1RKUA 5F73A 1O94D 2H2WA 1BFDA 3CHPA 1M8FA 2P6MA 3KTFA 1P3JA 3MQ2A 4NENB 4QBHA 5TPZA 3REQB 4Q19A 1LY1A 3V7UA 2W48A 3HHPA 2HWXA 4CGZA 3AY3A 1P1BA 3VVMA 2AF3C 4DDUA 1BS1A 1AHIA 1SOUA 1CETA 1FSZA 1I7NA 2GS9A 3AG5A 3A9UA 4JI4B 4EBFA 4GOLD 1QIKA 4JB2A 1LQTA 3NYQA 4D5EA 3MWLA 2BUGA 3ZQ4A 2ZAYA 3BZWA 5ALNA 3MWYW 4MVJD 4QYXA 5EXSA 2YBDA 3ZHTA 1HFJA 2BH9A 3JVDA 4C0EA 4YT5A 4BNUA 4CMKA 1Y6IA 1RQRA 5A5GA 5H59A 3ZV3A 2AE1A 2ZJ8A 4PANA 3R0XA 4PC6A 3CIFA 3RQSA 2PKEA 1QLJA 2AIRA 3F4LA 1Q2XA 3JVIA 2RHCA 1QIHA 3K92A 3QWAA 4PIPA 2OC4A 1QG6A 3OPXA 1QTNA 1Y9JA 3QEOA 4E5MA 4EW6A 4TMFA 4L1KA 4TKVA 2HU7A 1BWQA 1G20E 4FIDA 1T15A 3TFOA 4K6CA 4QLBA 1JSCA 1N2HA 2ACEA 3LQKA 4UI9K 2EGHA 3DV9A 1ZM2A 2WU3A 3Q7PA 4JSYA 1US8B 2DFTA 5IBRA 4WOCA 3S2UA 1FYDA 1RYHA 3U62A 3H3FA 2BPOA 1AGYA 1ZWKA 2ZSJA 4MQFA 1UC5B 1WRBA 4UBMA 2ZUUA 4BKOA 5GZ3A 1UXIA 4DWWA 2SKEA 5GVRA 2A84A 2QOEA 2NSJA 3VJLA 2BGNA 2VT7A 3LAWA 2C9OA 1M34A 3G0IA 1NXSA 1XTVA 1ZVQA 3ND7A 4R2KA 3T9AA 1ZESA 4QPCA 1N0WA 1PD1A 3FCYA 2Q9UA 1BLXB 1GZVA 4D02A 1AQIA 3MWKA 1TCCA 2AN5A 3ZXSA 5C52B 5FOSA 1WAMA 4R2XA 5JG7A 2ODWA 3DB1A 4BFRA 3RVKA 2OOKA 1BQ3A 3V2XA 1W0JA 3E33A 4TV9A 5T4FA 3STWA 4IMPA 4BVJA 2CLMB 3VBCA 2G88A 4ZAGA 4MWBA 3W06A 5JEDA 4BTBA 4FW8A 4RK5A 3LHKA 3QFTA 2NO4A 1XL0A 4ZVPA 1M34E 4H1HA 3IVMA 3KPVA 4C4TA 3TX6A 2P68A 5FAXA 1ZHHA 2Y69E 3DS8A 4D45A 3BGOS 4OXQA 3OZIA 3BB4A 1VCMA 1TJ3A 2VR1A 4D2IA 2EFYA 4A55A 1KJNA 3IUMA 3OU7A 1VHDA 4OQPA 4DQVA 1PR1A 2XBUA 5DPMA 5C7OO 3F9CA 1NL3A 5A71A 2X5XA 3DVAB 5IT4A 1ORIA 1AO0A 1M75A 2ORYA 3A3OA 3K9IA 1K75A 5CCBA 3WI7A 5AK4A 1YBHA 4B8YA 1A96A 1YZHA 2J0VA 2W2KA 1R8SA 4L4UA 621PA 1X7YA 5KTOA 1XQ6A 3NFRA 1NQ5A 4EP1A 2ZK7A 3GROA 4WKGA 4NNPA 1QX4A 3UAWA 2AMYA 2VZ0A 5GTDA 1ZJWA 3GR6A 4LEIA 1PZMA 2G04A 1B3BA 4EDFA 5JC1A 2GXUA 4IZIA 4MV3A 2QLMA 4QOJA 3TIXB 2I71A 1JMVA 1QLHA 3EHMA 2E6UX 2NOAA 2ZSKA 3KEFA 3WIVA 4ENUA 3CO5A 2XBLA 2QR3A 4U4AA 2Q4OA 3RYIA 3DMTC 4PGAA 4QUHA 4BECA 3JXIA 2LV8A 3SK0A 2F2TA 3HDTA 3G2VA 4C1BA 2XZTG 4QYIA 4G0UA 4QQFA 4II3A 3V33A 1H3NA 1KQPA 1R4ZA 2V7XA 4HH0A 4OHXA 3RJTA 2ZYTX 4MROA 3UPDA 2C42A 3AOEA 3T6KA 3C3KA 3Q7TA 5G4LA 4E5YA 4K0RA 3BD8A 1N2XA 1G2OA 2BBSA 2R1ZA 3BGVA 3T12A 3VPGA 1TN6A 1QTQA 1M1YA 1U2EA 3PVLA 4DVGA 3A6ZA 1NONA 2GRPB 4CNBA 4YVOA 5CEFA 5JMTA 1Y3DE 2WE7A 4MCHA 3VU8A 1XKTA 2QFCA 2PKWA 3TAXA 2IZ7A 3OIDA 4WCFB 3UM9A 1A9XA 2ODBA 1G55A 3KJIA 3OEHA 4M1QA 1EPUA 2BFEA 1CC1S 4ABNA 1VBFA 2YHCA 2O1EA 5JJCA 2IO3C 3FMPB 2QTVB 3MEQA 3OSZA 3FFWA 3H5VA 4R0NA 4NZNA 5HBGA 1E8DA 2EL7A 3KL4A 3X43A 4YJ3F 4CIVA 4DV0B 1BDIA 2ZPAA 4BNTA 1VA5A 2FZWA 4Q03A 3LX8A 5BSEA 3BCRA 2QX7A 4E5PA 3LW8A 4JWTA 2G36A 3KAEA 4Q18A 4ID9A 3RFCA 4HBDA 4LCJA 1YKSA 4H17A 4S05A 5DNUA 3IKOB 2GZRA 3UMBA 2ESRA 3ABOB 5WRFA 5DM60 4B2YA 4E22A 2C5SA 4QSMA 2RAFA 2I1VB 3AB7A 2D1RA 3HSSA 3E1SA 3NBQA 4PZ0A 4WCFC 3UXHA 3DE2X 1XAGA 5E6UB 5BV8A 1Z6YA 2VJYA 3B6JA 4YDHB 4ZCMA 3USES 3BFVA 3G88A 2HLDA 2KS6A 4V2UA 3U3DA 3ADKA 4NICA 5CDHA 5I4BA 1O89A 3JQDA 4YCAA 3C5EA 1NX6A 3LKZA 1FPMA 5CYGA 3HQ4O 4IHQA 2XDYA 1E9SA 3A6DA 1ZKMA 3QWWA 3PJEA 4ER3A 3CLRC 5TIIA 1KMIY 3RD5A 2YINA 4AZ3A 1UQUA 2JASA 2GBPA 1VMEA 5IG2A 1JNZB 1TVMA 2WOOA 1E0DA 3K6SA 1WHTB 1WXXA 2V6IA 2GN4A 3HZHA 4MR8A 2P11A 3O75A 3TG5A 3MKQB 3II6X 2CDNA 3JQBA 3OT5A 4R81A 3N9IA 2FSVA 2I1JA 4DX7D 1LTKA 2Z2IA 5I5EA 5L7WA 1E1MA 4R8LA 3FCAA 4NF2A 1IM5A 3Q2IA 5ELLA 2EF1A 3QLUC 1ESNA 1UMKA 4F60A 5BSRA 1KQFA 2D54A 1U9YA 4KBQA 1A2OA 3JWGA 4BY9E 2Z30A 4KHZA 1PJAA 3UZUA 2NYRA 2Z3ZA 2APJA 4RGBA 4ENQA 3A58B 2NO7A 4EELA 5JJLA 2D62A 3EF1A 4KR7A 5DT2A 2QVLA 1E8OB 3COYA 1TAGA 1R12A 2DULA 2OV1A 2HO4A 4FYWA 4MQEB 5HGJA 4EYEA 2JI6A 2AC7A 4JAVC 4RNDB 4D4JA 4C03A 4DIBA 1QCCA 4RTPA 1CYEA 4MTCA 2ONDA 1UJ4A 1I5RA 2JIRA 1MKYA 2X1LA 1LWNA 3BXGA 3ID6C 3PPXA 5KCMA 1TJYA 1YZ3A 2WTAA 4MWZA 2VUTA 1XJ0A 5FQ6A 3OMLA 2IEAA 4X00A 4TMVA 3NRJA 2GM3A 3GGOA 2C1EA 2YZGA 4E0BA 4CFZA 2J8ZA 4Y3UA 4G63A 1T10A 3MTEA 2ECOA 4K26A 1WDYA 1YASA 2FWMX 3JCZA 4K87A 2ZUTA 3RJ9A 2OAEA 4CIBA 2W2OA 3WA7A 3NS7A 2QI9C 2F6RA 4M3OA 1PKEA 1YTLA 1N7HA 4XCQA 2X3UA 5IW8A 1JHZA 3V8RA 5L53A 3FA2A 1GP2A 4LPKA 1GL9B 2FQQA 3P0RA 4V1CB 3DF7A 3JVVA 4YRKA 2ODPA 3PUJA 1XE3A 3RG8A 2A1UB 4AT1A 5DCWA 3GZ2A 5CVTA 4OAOA 1ZKDA 2PH7A 2P2GA 2VYFA 3KFVA 4I8XA 2I4MA 3VLFA 1Z8DA 3FWPA 4PCAA 4EGQA 4Q3EA 1EGQA 3AUAA 5JW6A 1RADA 2GRLA 2E55A 2GJAA 2P9BA 1F9EA 5JARA 1XVVA 3LIPA 3MCTA 4W7SA 5L95A 5DYTA 1NG9A 1X7WA 3FY4A 5BR4A 1NNEA 5LOVB 3G2HA 3VR5D 3OFNA 2XMZA 5FTJA 1CY4A 1KFJB 2B98A 2PK3A 5HGXA 1WCXA 3PREA 1KYYA 3L02A 1KGDA 4J94A 4JLNA 5I9IA 1SUEA 5FA8A 5AR1A 2A9OA 3CF0A 1HORA 4MUEA 2VNIA 4EK9A 5CBPB 2XE4A 2CE2X 5D2MC 1T6YA 4I2NA 1I2BA 2Q1TA 3UKUG 2GILA 2I3ZA 4BNDA 2JVKA 4QECA 4L1BA 5ESXA 4X66B 4JGIA 4EF6A 1ILWA 3TL5A 1WDMA 1L4MA 4DRXB 4EYKA 2ZIAA 4O4JB 4YJGA 4DB4A 2J1LA 4B47A 3SD5A 3LHSA 4GWKA 1KHHA 1SB8A 4WN9B 2KB0A 2Y8EA 3MKRA 1CQZA 2Q1SA 2VBIA 3CB2A 3E61A 2F1RA 1C30A 2VSOE 1N8TA 1OIXA 1UKEA 2A14A 2FUEA 2GDZA 3OCUA 3OOYA 4Q3BA 4U3JA 4ZDWA 4IAOA 2LIVA 5FRDA 4UQPA 1S8NA 3WZ2A 1GAXA 4IMJB 3OZBA 1HM5A 3K1AB 2FPSA 5D7NA 1L4FA 2Y1EA 5HFJA 3A4LA 1CJBA 4BUZA 4P98A 5L8VA 2G28A 2OGZA 3TDMA 1RXEA 4PCVA 4QQNA 4ZQIA 5C37A 3KT6A 3Q7SA 3BCHA 2B69A 2C04A 1C2TA 1C50A 1FXWF 1R74A 3ZCPA 1P45A 1NBIA 4KODA 2YS7A 4UWKA 2J3IA 2ZLBA 3O8NA 4TWJA 4PLGA 1NM5C 3IERA 3QVOA 4MI1A 3GFSA 4PC7A 5LMCA 2C2LA 2IZ5A 2X5OA 1FXUA 4HB5A 4QOHA 5BNIA 4GPD1 4D8YA 5A0TA 1NPDA 4U6NA 5DTQA 2QLBA 4Q4AA 4NZOA 4RPKA 4AJ9A 1HDGO 3C6ZA 2VTVA 1KDOA 4J4TA 3V6LA 2WMNB 4MV1A 1IOZA 4WPGA 5AIAA 2DERA 4KIWA 3K05A 4Z4HA 4I55F 4UEWA 2P41A 3H86A 4WADA 1PBNA 3CPJB 2XXJA 3UMGA 2I1KA 1QZ3A 5BP7A 4L3WA 3DYIA 3QVTA 4MRRA 4GTMA 2XWJI 3WGJA 2BFEB 5HIKA 1GKLA 1IK6A 2BRUA 4DQXA 4FYIA 1IDOA 1XJ5A 1TTQB 1HFAA 4RCZA 5GP1A 3D8SA 1M8GA 3DMDA 2ONCA 1DBVO 4L8VA 4IDAA 1O1TA 1T9AA 5CBOA 2WTMA 3BFKA 2IYAA 1WO8A 3AR3A 4FBGA 2A5DA 4JWKA 4RZSA 5DO9A 5ECYA 3ZDFA 4WBSA 4ZOLA 4X24A 5K3BA 4O3FA 4DYDA 3WK6A 3SWWA 1P1RA 1V4BA 1ZIOA 1PL0A 2D2EA 5DBKA 3KUDA 4PRYA 3F3MA 4GKBA 4Q0MA 3N87A 1CJSA 2BP7A 4R1QA 2H7VA 5AI8A 3NBAA 3WGVA 1QB7A 4M0MA 2ETAA 5KNDA 4QJBA 4M86A 1FP4A 4NAVA 2UVPB 1L1QA 4UCQA 1U11A 3KJFA 1U1CA 3TJRA 3L13A 1KL7A 1NOKA 2A33A 2PU7A 5AP9A 3OBBA 1T2DA 2V8OA 4EQ6A 3HBNA 1YR2A 5I8PA 1ZW1A 4HWRA 5IVDA 3L0BA 3L8MA 2BT4A 3KPUA 3DCNA 3DCJA 2UYQA 3M3HA 5HI7A 1F1JA 1J8FA 3R5JA 3M83A 4JVOA 3JD2A 1QKIA 2EEZA 4BMNA 4R3UC 4GM1A 3TNJA 3OQIB 2YIJA 1OXKB 2IBMA 4QDOA 1E6UA 2XDAA 2IEGA 2POQX 1V2HE 4MUNA 2WWHA 5ENRD 2WHXA 4O2AA 4MIEA 4J7WA 1MFPA 2MT9A 4QUKA 1Y34E 1UWVA 2P67A 3GAMA 3PD0A 2BF4A 2C88A 1N6OA 2IEIA 2Z5VA 1NBME 1Q0HA 2EIME 1J70A 2F3SA 3CBGA 3NP7A 1IBRA 5E76A 2OFOA 2FRDA 1L8QA 3PQDA 4IO0A 3KLMX 3HB0A 4FU3A 2WYIA 4UNPA 1G8GA 5AI9A 3T3IA 1SB9A 1I51A 4HMOA 1KOGA 4HNAA 4GR5A 4IZHA 4G4JA 5TDHA 3ISMC 3L16A 1R3DA 4BJHB 1PY1A 1KI4A 3HBLA 5KQPA 4NBVA 5KQGA 3U4QB 5ALEA 3HDQA 2CB0A 3QWHA 4KIUA 1NG1A 1YDHA 4MW4A 4L4XA 4N49A 2VHTA 1QYMA 3LL7A 5FPSA 1EJ2A 5A62A 3QVXA 4WINA 3V48A 1ODSA 4BVHA 1DKLA 4V0KA 1PT5A 2OQIA 2IFUA 1QHNA 4RWEA 1G8FA 1UEXC 4Q9DA 4R7GA 4YREA 3L41A 1RKVA 1R7RA 4ZHQA 3SS8A 4GPTA 5EQTA 3QP9A 3TB6A 2JLVA 5HP4A 3HXPA 1JKXA 4AY6A 4JQYA 4MICA 5L9AA 2RG8A 1BCRB 2F8TA 4B4UA 5IDWA 4XI0A 4FQ8A 1ND5A 3UICA 1MVLA 3OVMA 4GLOA 5DI3A 1IUKA 1O97C 2PHZA 3T3PB 4MIKA 5JAQA 4BBPA 1VJ0A 1X8KA 1FFDA 5BSMA 3RYCB 2WJ3A 2PSDA 5UKDA 3HO1A 1U4NA 3D4IA 5DWVA 3GUZA 4BMCA 4R01A 1EIZA 3KOOA 4R6XA 2AWOA 4QAQA 2V7QA 4AWBA 3VLEA 2PYZA 4DANA 3G2PA 2P9JA 5FINA 1X7XA 5AM4A 2XEHA 3TEFA 4BEPA 1BVRA 3QELA 4YAJA 2Q29A 4IVQA 4B6PA 3U66A 1R9JA 3FF4A 1YDGA 2PFGA 2F00A 4MVJE 1YAJA 2FPGA 1M1YE 4A63B 1PGQA 5DYIA 5JS2A 4C78A 2JGIA 4FK8A 2BFMA 1TM5E 4HXYA 4UHFA 1RM0A 3VOAA 3FCCA 3V3KA 3G89A 2IU3A 4GR9A 3T0IA 4BIIA 16PKA 3MERA 5JYDA 3EIFA 1CDEA 3CGHA 3CH4B 3HCCA 4B73A 4TKLA 1NM5A 2MMCA 4H3VA 4E2ZA 1AQNA 2J5KA 1YRBA 5HK9A 2A57A 2HMWA 4MHTA 1IZ7A 4YJGB 3G3EA 5LZ4A 2GFHA 3NDIA 5KNCA 1F0YA 2V4ZA 2I65A 2IU4A 4KZPA 3RS0A 1V47A 4M1MA 4CM1A 3F9IA 4KNVA 4IG4A 1WDKA 1KJJA 1PSWA 2NO1A 4QRDA 4RTNA 4BO3A 1R37A 4UKDA 4PVDA 3URZA 4ZI7A 4TLCA 4ZYVA 3P0JA 5L3QB 2ZS7A 4F8YA 4CLOB 3LX6A 4YY3B 4UM9D 3PRHA 3DFZA 3H84A 4PXAA 4APFA 1DC3A 1OLXA 4YH1A 4URKA 5JCPA 3MTJA 5TQ0A 1HTTA 3HY4A 4BWYA 1VPTA 3VR2D 1XEXA 2FK8A 4A23A 5HX7A 1V3VA 5I4IA 5AQBA 2A58A 1QHIA 1S1MA 2PXCA 3CGGA 2J8SD 1EVJA 3GZJA 4HN9A 2WXJA 4URHA 5CITA 4JIMA 3BWBA 1POWA 3SI5A 3DC2A 3TLJA 2ZUVA 5IDVA 4Q3NA 3GEEA 2DHRA 3RO3A 1UPUA 3O3CA 2AOXA 1CY2A 1GFZA 1RKBA 1UIRA 4GPBA 4JX8A 1JFLA 1MC8A 3ZHYA 2EJBA 5DN6D 4COKA 2PKRA 2QU8A 2C2XA 1RQLA 5AVJA 4IVNA 3T7DA 3VKHA 2FPPB 4I14A 1IZ0A 2YL2A 3IVCA 1BGWA 1YGPA 3OU6A 5JVDA 1H6DA 1SIOA 1AKMA 2BUBA 2JCXA 4BVKA 1XCMA 2R62A 4NV1A 1JB1A 2RD0A 3E18A 1JQJC 1Y4DE 4KB5A 4OHBA 1UG3A 3DNFA 1QCDA 1J33A 1ZAKA 2RAVA 1FNDA 2HQ1A 3B1FA 2B4QA 3ADCA 2AN3A 4NC9A 1FFHA 1RMTA 1PL7A 3EPPA 3VOBA 5HKAA 2PJDA 1A5EA 1YV9A 1S6YA 1W5BA 2PR7A 1T5LA 2ZDHA 4M6WB 5E7IA 5KNLA 1I80A 4XH9B 1V9LA 4V0SA 4BWFB 1F4LA 2C0MA 3PFBA 3RC9A 5DSTA 3I5PA 5E8RA 1SCJA 3RU7A 1RI2A 4DT1B 5CDSA 1Y4ZA 1ZEJA 2HRDA 4DHEA 3ZLTA 3ASGA 1DFHA 4ZFHA 2OO5A 2TECE 1A1SA 2HU2A 2V4LA 4EB3A 5CDYA 4A7PA 2E1RA 3FNQA 4ZANA 3ENWA 2WXOA 2P69A 4TX1A 4XKCA 3DE6X 3IQWA 1RQGA 3ZCRA 3H3XA 3PEFA 1QCYA 1AXEA 1IXSB 2XEVA 3JR7A 3DXKG 1EK0A 2CN1A 2VXYA 4LSZA 2O2EA 2VDJA 3RTGA 4ISCA 4DCNA 4H0FA 5BUZA 1GG2A 5LP6C 4WDRA 1TTTA 4D9EA 4F1JA 1VPWA 1I6LA 1IHOA 5LNK6 1JG6A 3RRYA 2G70A 4DM7A 2QTFA 4D6YA 4RXTA 3UMYA 1Q11A 4A8JB 1T6BY 4PS3A 3E27A 1EG2A 2FHSA 1MORA 1OX5A 5K0ZA 5KTTA 4KMSA 4FZ3A 3DVRX 5B1DA 2R4QA 2CJFA 2IQCA 1O96B 1U04A 2Q3JA 5EMMA 3RIXA 3FI0A 1USIA 3SLGA 2R8OA 5BXQC 4C88A 4QDUA 1B42A 1E5DA 3LUKA 5LFAA 3TZQA 4AWAA 5F1OA 3OKFA 2QV0A 1L5VA 2HCFA 3HFJA 5CVVA 2GLXA 3SIWA 1VJ5A 2JBWA 4HQ0A 4P2GA 3T94A 2VWHA 5CXSA 3F8TA 4BLOA 3IOMA 2FFRA 3EASA 4JXJA 5A5EA 2OUKA 2R2AA 4UDYX 4F5DA 3ADPA 2X86A 4R05A 1SAYA 2PQ0A 2Z9CA 5ILOA 4N5CA 4DHWA 3FTNA 4DCUA 5FO0A 5J40A 1EF1C 5KBYA 3NDPA 4WXMA 1BEZA 1NPTO 2C8KA 2I2DA 4MPTA 3MWEA 4LRZA 3SR3A 1H94A 2HF7A 1Y9DA 4RIHA 5AI4A 5BWOA 4B89A 1EHYA 1Y1QA 4GPAA 3TRDA 4NMMA 4BO0A 1M0TA 1NI4B 5I45A 3Q7FA 5LXTB 4YAKA 1JAHA 5CBNA 2FUCA 2E21A 3EW7A 3FYHA 1VDYA 5CMLA 4ZJPA 3K5PA 2H92A 1YB7A 3T3DA 3IP3A 5HIAA 4HPWA 5JFOA 1NP3A 3QLTA 4CTOA 2H9IA 5EJ8A 2EZ9A 3H4VA 3F5MA 4OBWA 4F7AA 4Q96A 3BIXA 3S2SA 3TJMA 3PGKA 4B3BA 1ZA2A 2DTEA 1FW8A 2X9QA 2P5UA 4AAYA 2E48A 4TRMA 4D9HA 5MDHA 3PCXA 4I19A 4JJFA 5EJIA 4PV7A 4R1PA 5KKNB 1WDLA 3AFMA 4FEGA 3HY6A 4UOEA 4JA9A 1AUPA 1XU4A 3QKSA 2IXEA 3WC4A 2BM8A 4ADSG 4F38A 1GARA 2AJ8A 1KT1A 2I6XA 2WTEA 3HDYA 5ITVA 5TLSA 1GTMA 3WADA 3R3JA 1PAUA 2BBWA 3UANA 2FDCA 1FFXA 1RZ3A 3ND8A 2UZ1B 2P0EA 2FN3A 2ILVA 2PWBA 2X76A 4XX0A 3FSJX 1P1FA 1OX4A 3FMIA 1FU4A 1ZJZA 5H3CA 4F2HA 1DO8A 1VHWA 1F2UB 1ODLA 2ENWA 3ER6A 4O33A 4R83A 3RWMB 4BWVA 1IEVA 3HXKA 4WSOA 2PMEA 4A0HA 4YMWA 3VDXA 2QZZA 4L5IA 1FFWA 3L40A 1G5QA 1W29A 1E1RD 1AKQA 2YVAA 3LBFA 3MJSA 4WVFA 3ETJA 4MKHA 2AJBA 1IHUA 4JYCA 2P2ZA 3MPOA 1PLJA 4H60A 4HWKA 1JR3E 2JAXA 4LZLA 4PLFA 2VJCA 3M34A 4XASA 5D7BA 5E2BA 4UVIA 2WD7A 2Z57A 3DXYA 3NC4A 4L4ZA 4O0MA 3WJ2A 5CUQA 5CH5A 4BEBA 5DNWA 2CCKA 3NNDA 1E0KA 1SCBA 3D02A 3IBGA 4DMHA 3HA7A 2VPTA 4ALMA 1TMOA 2WHRA 3N3AC 1LPBB 3P45A 4FNAA 4XUCA 3KQHA 4UATA 5IUNC 4RHUA 3BQ9A 4B84A 2DR2A 3O0TA 3V42A 3CK9A 4CT4B 2QA5A 3EUEA 2CD7A 1Q6ZA 2QL6A 3KAKA 3PCRB 4PQFA 3GWZA 3PK0A 4Z1MD 3BQNB 4C0SA 1EX9A 3FTWA 4OTZA 4DLVA 4WZAE 4UYKA 2C4MA 2C0CA 1ZFNA 2GPBA 3EOZA 4JC5A 4RSHA 1NTRA 3ZWOA 4ZIRB 1HT3A 5JNVA 3EUFA 3FTQA 3F73A 5ENQD 3TTWA 2D1FA 3SZOA 2QE6A 4Y2VA 1Y37A 1GM5A 2HA6A 3BG1B 1CF9A 3ILHA 3TG4A 3CLUC 2J9FA 4F8JA 4YCCA 2VH5R 3DBHB 1ZGBA 2WUWE 4PCLA 5J1TB 1RW2A 4AJJA 1WZNA 5T6BA 4I1PA 1OKKA 1JBEA 3J81k 4Q21A 3WXXA 1RYDA 4IIFA 4S1VA 4TXRA 5ARDA 3TNFA 4DCGA 1EFCA 3B78A 1XXHA 1ZMBA 3M9WA 2VAPA 3I2FA 3NVMB 4TOIA 3T4XA 4UNRA 5KHOC 1OV6A 2R2LA 2EIHA 2GD1O 2WWIA 4PFSA 4B74A 3THYA 1K8QA 1VBKA 2QNBA 2XE6A 3PNMA 5IJ0B 3DO5A 5EQJB 4GI1A 3MOGA 2CG2A 3D2LA 3OICA 2NZXA 1RTKA 3OCJA 4FE7A 4EQZA 4BAZA 3K5WA 4WCDA 4WLFA 1IRXA 2VJOA 3WAJA 4HQKA 3D64A 1Z4NA 2JAOA 2Z5GA 2NAFA 1EM6A 1F0PA 5AQEA 5KYWB 4WNDA 2V7VA 2YXEA 2EKLA 3CLSD 4KK4A 4DNQA 3FYUA 3UTCA 4CLXA 1AK9A 1K08A 5AQ9A 3DLHA 2YV5A 1JDBB 2WXGA 3IT2A 3H17A 4QTZA 2LSVA 4ENWA 2H6EA 2RHOA 1ZHFA 3PNQA 5CLIA 1DEAA 4KX5A 4ZK6A 4O1MA 3H2IA 2PSFA 4HS4A 3SSOA 4DPRA 3VZPA 3FGPA 1A17A 5FNVA 1ZI6A 4Z7NB 4ZV4A 3D8RA 4B40A 1AK1A 3H2SA 3VCXA 1VM6A 1S1CA 1KYTA 4O4LF 1CD5A 4J6EA 3WGGA 2ERCA 2YVLA 4G2VA 2X23A 3EFOA 3KOUA 1WXIA 3RU9A 1KMHB 1DCKA 1R27A 1XTZA 3SJCA 1VRCA 3E35A 4R9SA 5CX4A 4ZI3A 4CEIA 4QFMA 2QPTA 5CP8A 3T4EA 3QX8A 1S3GA 2CLEB 3F7MA 1XLWA 2UUOA 3LPMA 3L7CA 2ZGVA 4MW2A 1C9DB 4ZOLB 3BBPA 1W93A 1FQOA 1GU1A 1P6UA 2TMKA 1T35A 3GRPA 4OF4A 5IVIA 3SM9A 1TIPA 4BNKA 5KSWB 5B12A 3JQ0A 1S4QA 1U1DA 5JI2E 4DDKA 3W5DA 3SXJA 1XNJA 1T5IA 2FOIA 3VH4A 2OV2A 2AVPA 3C98A 2JG3A 4RTMA 4L5AA 2XB6A 3GRVA 1UFQA 2H17A 4YWHA 2L2QA 4IIGA 2WUGA 1P9WA 4GXRA 4RHFA 3C6KA 3HV0A 4GKAA 5KJLA 1Q22A 1T34A 1FMTA 3QG1A 1ZU4A 3URKA 3FGZA 5CEDB 1SU4A 4QYMA 4XYGA 3EIQA 5CPFA 4ZZ1A 1U9ZA 4F8EA 1H2VC 2F90A 3PWZA 5BVGB 4JXXA 1BGVA 1KAEA 3JARA 4KBGA 1F2TA 1F8XA 2FFJA 3O9VA 2FLVA 5CX1A 3CVXA 5JVDF 3HBFA 1XPJA 1UOHA 4KAXA 3OZRA 1JHDA 1MYOA 2QE7A 2IV3A 3GZSA 4F2GA 3U61B 3ZWPA 2SCUB 5K7SA 3KWMA 3N8GA 3AHEA 2B83A 1T5TA 1HNZB 2OXEA 1H0HA 3TD2A 1Q7EA 1TT5A 2QIPA 5H68A 4BDSA 4Q5IA 3LQQA 4HSEA 3GJYA 3LT5A 4F4DA 4IIDA 3W8EA 3CPHA 3U4MA 3O3OB 3KJNA 1Z4JA 2I66A 4IZOA 4NG4A 3ZZTA 4DXAA 1X81A 1ZRHA 3CCBA 4HLUC 4LC9A 2GZ1A 2FYTA 2PY6A 2X2EA 3FOWA 3M4YA 4M7CA 4OL0A 3KJXA 4B34A 2DBRA 1UPAA 1B14A 4GKKB 3SF8A 1QIFA 1E62A 2P9FA 4NG5A 3R3YA 3BGDA 1M2NA 5BNZA 4F3VA 4XQEA 4DXHA 1HV8A 1T26A 3DDHA 2HSEA 3NALA 3L4BA 3P4UA 3B1VA 1MXFA 4F6RA 4MVJF 4ZFNA 2WTUA 2CDAA 2EILE 3C15C 4REOA 3QJ5A 3BG0B 4CDNA 4B7ZA 1GGEA 4YUZA 1YONA 2NNWB 3V31A 4AJ2A 3UM0A 1WM1A 1UPCA 3RSQA 4ZOQI 1X13A 1GVNB 1KDPA 4M99A 3GN1A 1GGMA 4P2BA 1DG9A 2FN4A 3HP7A 1CUDA 2VLBA 3I3SR 4RPJA 3A1WA 2ABWA 3CRVA 3I09A 1E2LA 2PCJA 4WOPA 5FFNA 3EIQC 1XRSB 3M5DA 1KRXA 4ALLA 2QRZA 4I50B 3ML8A 1JXMA 1VYTA 3TQFA 3CX6A 1I5EA 4GQBA 2YHSA 1EX1A 1L4BA 3ZZ0A 3DLAA 3GMSA 3CF4A 5FTNA 4XEIG 3TZCA 4O1PA 2G1KA 3PJFA 3GBSA 3VYTB 4INPA 5B55A 3FFTA 5IY5E 1XZBA 3THYB 3ORSA 3PUYA 2MHCA 1M1NB 1VI6A 1Z6QA 4HOUA 3S2EA 2EFDB 1QGZA 1FMLA 1HYQA 2J6IA 1R00A 3E7DA 1SXJD 4L8YA 3QUAA 3LF1A 1UOQA 3L5KA 3FUJA 4GMLA 2WYUA 3H1TA 3QKYA 3IB6A 4DIDA 3AY0A 1HE8A 1JB9A 3DHYA 3U0VA 4KFSA 1DJPA 1TCVA 2Z0MA 1SKYE 3CWQA 4MLZA 3RGWS 4RY2A 4LW8A 1E59A 1E61A 1O2DA 3ZNNA 1RWVA 1IN1A 2ZU6B 1DJQA 1YKGA 3KT0A 3I3OA 1SUPA 3L4BC 4L75A 3I1JA 4MX8A 4F46A 4TLDA 4WNAA 1N0RA 3ACCA 1RYNA 2GN0A 5EILA 2JD1A 5DNAA 3SY8A 1UP4A 5EJ6A 1EUDB 3KPWA 3BTOA 2I6SA 2ZI6A 3KBBA 4G1MB 1XNFA 1E1CA 4DIEA 3OXLA 4IHKA 1TEXA 2YDXA 3OEHD 3IQZA 5T3UA 3PGVA 5FL7A 2CVQA 1O3YA 4KR2A 4HDSA 1IXVA 4EVRA 4EVSA 1X38A 3KSQA 5TB5A 4AZ3B 1V16A 2PSHA 2AG0A 2UKDA 4F53A 1THMA 4U5QA 5TT0A 1V5FA 3S55A 1OLUA 3BIOA 4F91B 1QKKA 4DJTA 3R8FA 1BMFA 3D3MA 4QE3A 5HRUA 3GJRA 3E0XA 4IDPA 5FEMA 2GZHA 3AEXA 3JWIA 3FOEC 1ONSA 3OX3A 1BX1A 1YDFA 3P2JA 1JG2A 2CHQA 2PSEA 2XKBA 1FNBA 2JKYA 3PPWA 3DL2A 4ZJZA 4HAUA 4DMUB 5AQ7A 3GX1A 1NQXA 1T8YA 3GLHE 3NPMA 3EPRA 3PIIA 1GTG1 3VGPA 3T1YB 3FD8A 3IHTA 3QKRB 3FNHA 5DVZA 4HUQB 3F46A 4I1VA 4AKEA 5KOYA 2QTRA 5HA5A 2UVPA 3PNYA 3U3XA 1T1RA 5KS2A 4V3BA 1NSYA 1U2TA 3RHTA 4JQSA 3V4LA 2OECA 1OFIA 1T3HA 4MVJH 3ADBA 4W5TA 2PH5A 5DM2A 4AY2A 1XRMA 4XD7D 2KC7A 1W0JD 3IQHX 4C6TB 4H3SA 2AZ4A 3WWCA 1U0EA 4PZ9A 4EHDA 4WCVA 3JALA 3CF4G 4MNTA 4UQYA 1XYVA 1EXMA 4NCKA 5FQ7A 1UN8A 3KEGA 4Y2RA 3I9V6 5T41A 1A27A 5EXDA 1XKLA 4MR7A 1J07A 1YR6A 2E7ZA 4QOGA 1J56A 4J3JA 2ZSIA 5E1OA 3WWZA 1WBBA 2X0FA 1Y4AE 4QYWA 1H8HD 1J0DA 5ALZA 1WU7A 2HMSA 5G53C 3SZRA 3DLTA 2Z98A 3KV1A 5LP6B 2WK1A 2GBGA 4CMAA 4CLRB 4L57A 3WGZA 1W52X 1EQUA 3JD4A 4GTTA 1OWNA 3FWHA 1XZEA 4CN9A 3GFRA 4AV7A 5EAIA 1X6VA 3AT1A 5G04J 3HKDB 2HXYA 8ATCA 1OXUA 2Y71A 2GUGA 2F8SA 2DPHA 3HB9A 1NW3A 2UDPA 4NEHB 5HKKA 1C1HA 4UD6A 4ES6A 1COWD 2X5NA 2CNOA 2IPLA 1IOWA 3VPAA 3EHEA 1NVDA 1MPTA 3HJBA 1GPH1 2Z8YM 5AW4A 1R88A 1RYYA 5KDDA 2Q5OA 2IZ0A 2DFVA 3PVCA 1E1QD 3NOOA 2CBXA 5DX8A 3WDKA 4HLQB 2R59A 1FLNA 4N2QA 3EAGA 3PXDA 1EBUA 4XDZA 3PCTA 2BFBA 4IJ5A 4K46A 3WL3A 2XRYA 5CVDA 3FNIA 5K3CA 2R6GA 1XDGA 2M1ZA 1L6IA 3BWXA 1E2PA 1R9MA 2BE7A 2O8NA 4N5DA 1JA0A 4RIGA 4CKXA 9ABPA 4CKCB 1PZXA 1QWSA 1RJ9A 1T8TA 3NUGA 1P5JA 3LP8A 4L0DA 1C0KA 4M1EA 1P81A 5DI3B 3ZW9A 2C2OA 1L4LA 2P2DA 3BTVA 4NABA 1VFNA 1ZVVA 4DGQA 2UYYA 5A1JA 1CF4A 1IWBB 2HBZA 4LYDA 1ULUA 4P29A 4PYRA 3J5QB 2VRCA 4TXHA 4DM3A 4ACAA 3P4YA 2R68A 5K0GA 3Q9NC 5LVAA 1DEKA 4JP3A 5J9FA 1FTWA 1KJYA 3A31A 3T7SA 4QM6A 4UEOA 3G5TA 4CF5A 2VDWB 1K5GA 2WP8J 1M7HA 1JYEA 2WXHA 1D6SA 1J49A 3I30X 3KEAA 1BI8B 4EBAA 3FTCA 3R0QA 4MARA 4XIIA 5KJEA 1AGRA 4A1OA 2BBTA 1J9EA 4LY6A 1F8GA 2EFEB 4BFCA 1EUCB 1J22A 1C0IA 2HQSA 2C4WA 4ZVOA 4PYJA 2IW1A 1JHRA 4B6GA 5AT1A 1UBFA 3CIAA 4ETWA 1IY8A 4J49A 4RABA 4U7DA 1PN3A 2WIKA 2DOKA 2Q4EA 1ECCA 3P0HA 4PG5A 3B7PA 1K6MA 3ORFA 1BE1A 1J1UA 3K73O 2QYJA 4KXWA 4XYEA 1UXJA 1NZFA 4LA4A 1A2KC 3DNMA 4U00A 4G9EA 4YT4A 3KQUA 1HDOA 1M8PA 3CS3A 3R76A 1YD7A 4AZ0B 3BXOA 2L18A 3FZYA 3H9UA 4PAGA 4XUGB 2YMLA 3HU1A 1TVKB 1MQSA 4TMYA 1R18A 4WXEA 3UGKA 1TQDA 1UMCB 3A1UA 1B7GO 3W5AA 3FTZA 3PL5A 4Z0PA 5DOVA 1UJMA 5EN4A 1IPHA 4B9AA 1E8XA 3S8MA 1SFRA 4QVKA 3RRMA 4JJGA 2YHBA 2X22A 4EY3A 5BSFA 1OBHA 1BAPA 2LE0A 3D6JA 3HCNA 4OXIA 2IF4A 3KEQA 4C0LA 2F1KA 3D6TB 4OGKA 4CMBA 5ICGA 2PL5A 2GHIA 2WD8A 3Q49B 4H7HA 1G8KA 4FXPA 2ISQA 1V8PA 4CCSA 3CXRA 4NHOA 1IEWA 1RC0A 2CB9A 3JZFA 1KQNA 3KD3A 1GRVA 3FBTA 5C5DA 4WGGA 3R24A 2HJWA 4JJ7A 5KTNA 5J4LA 3JYQA 1P17A 3OLCX 2GRNB 4FR2A 4QPPA 3ICOA 5A2QA 2G0NA 3ME5A 3B70A 1B74A 3OEEA 5E7JA 4ZCPA 3WO0A 3SQOA 3ESDA 5B6JA 4D4IA 2CC2A 3EXAA 2ILRA 2Y4OA 5A6VA 5EPEA 3QXCA 3VU9A 4MVJG 4B3XA 1XJCA 3LQFA 2GFIA 1EAMA 5IVHA 3EXHA 1JNRB 3U3RA 1IY9A 1NFQA 4HRXA 2YV3A 1BDMA 2CXSA 4HI9A 3CVYA 1NVGA 1IL0A 3DDZX 3CHSA 5FYQA 5TARA 2LBPA 2IYWA 2QRLA 4FFRA 2Q2VA 4W99A 3ZDCA 4O5AA 3TRHA 2FEOA 3VVLA 3N2KB 4QPZA 5EE9A 3SS7X 3SIPA 1ORVA 5E6SA 1FPPA 2O3JA 2VQDA 3L18A 4B32A 4Z4QA 1PNVA 1OW3B 2PVCA 4IOKA 3UV3A 3BORA 3CUTA 3HLTA 2NU9B 1KQOA 4D9IA 2A6PA 5J08A 1G8JA 1OAKA 4OXRA 2I55A 2PAAA 4D25A 3NBZC 5BV0A 1OF1A 4UAUA 5BYKA 2UUPA 1V11B 4D8WA 1EFRD 3ONLA 4UHBA 3MCUA 1Z0DA 4UXHA 1XVIA 4AF6A 1RIFA 1OI4A 2J7KA 2OT3B 4NQ0A 4M87A 4Q3CA 3IAFA 3REOA 1RLOA 4ALJA 4RJIA 4TXLA 3ZWVA 1GRNA 1BEEA 1T1JA 2NT4A 3F6CA 1DCTA 2BCEA 3IHWA 3PRZA 2OD9A 3JVEA 1IJBA 1UFRA 2XWBF 2OOEA 4I1OA 3ICQB 2Z43A 1IWPB 1SUAA 1YB4A 2ZBVA 3AEYA 1N2CA 1AB5A 1OU4A 3RYFA 4LYHA 1SVSA 3AF2A 4HVTA 4BWGA 4O5OA 4WZBE 4D42A 4QELA 2PD3A 1UJ2A 5FIOA 1XI2A 2VTKA 4QFDA 1I94B 2QB5A 2GGFA 3PSAA 5HFAA 4AB1A 5CT5A 4FZVA 4EF5A 1CE8A 3D8UA 2EIXA 4JT9A 3PUKA 1M0SA 4AN4A 2FMTA 2ZRJA 3C3WA 3FHJA 4OHUA 4PCUA 3CV0A 1KORA 2FE4A 2H0AA 3EQ6A 2EFCB 2HC9A 3CLVA 2FW6A 2JHFA 3AYZB 4IJKA 3T7TA 4FQ5A 5EPOA 1GL6A 5JALA 4FKMA 5LZ2A 4YCMA 4J9VA 4Q12A 1W44A 5BYBA 1EZ1A 3ZDEA 1ST3A 1WB5A 2AG8A 1Z0KA 2EZ4A 4NYIQ 4Q7QA 1HG1A 1QE5A 4PHFA 3SLKA 3EFEA 1X87A 4P4GA 3TCKA 3JZAA 2CNDA 3E2PA 3NANA 5AKIA 1TCUA 4WKCA 3AU5A 3ZWNA 1JEOA 4URXR 1X7ZB 1FT2A 5DDIP 5J5CA 4CFYA 2HF2A 5A7FA 1XVTA 3I9FA 5C8DA 1UFKA 3I2HA 3E15A 5KTKA 2O2SA 2XMRA 1NSTA 2BN4A 1WL8A 4B44A 1NAHA 2GM4A 2JL1A 3W9FA 3U64A 1XZGA 4H7JA 4UE2A 2R8BA 4MTLA 3GJ5A 4WZAB 1RYEA 1UBRS 5CAEA 3CONA 1XVUA 4KYVA 3AS5A 4WEQA 4MRSA 1V25A 2OHVA 2QD1A 4EW1A 3KOWA 1OC4A 5DNCA 4D41A 5ERXA 4BERA 3CQCB 4DTIA 3CFYA 3CPSA 3LOQA 3QKUA 3GLIB 2FKNA 3L93A 4NU6A 1G59A 2XLCA 4K3VA 2FE1A 4NFHA 2VK8A 4YS6A 1TB4A 2QN2A 5G2NA 1GRQA 3X2FA 1NA3A 5K05A 4GZDA 2XTAA 2AB0A 3KKPA 3ABRB 5JYBA 3TZLA 2IDMA 4UMVA 3P5SA 3L0DA 1C9MA 5GWXA 3VPHA 4EDHA 4J1QA 1X2EA 5ELXA 4TUYA 2DPGA 4I9GA 1UN9A 1ZEMA 1OB5A 1W9HA 3GUCA 1C7RA 4YCLA 1OX6A 1U9JA 3QLVA 5LLSA 4H1TA 2GRRB 3JZIA 2R1VA 4RSYA 3A25A 5K3FA 1J20A 4UM9B 5KYTA 5KJFA 2IU0A 1C80A 1JFFB 1AV6A 3F74A 1AQ6A 1MU0A 4ZHSA 5KWJA 4AFNA 2NZWA 3MGBA 4FP7A 3AG6A 3VHRA 2GF9A 3M6LA 3V79K 5KKAA 2VK2A 4K05A 3ILYA 5AUQA 3TDNA 1YZYA 2LO6A 2PUWA 1ACJA 1XKXA 4LSMA 1ISSA 3CWCA 3KZKA 3SDBA 4PUCA 4I46A 2CMGA 3UFXA 5CVJA 3ONEA 4J2TA 4MI9A 4NSNA 3OURA 1F20A 1P4SA 1KZPA 2G07A 2QNIA 5BSVA 5DW3A 1PJ8A 2ZB7A 3F1KA 5EZQA 4IJWA 2IS4A 4P3YA 3BG5A 1NOIA 1QR6A 4BMXA 4OKNA 3WLQA 2V7EA 1MV8A 4PONA 5EKDA 1JQLB 3U7QA 1PJCA 1SCUA 1JIIA 3NHLA 4UBNA 1QSGA 5BRNA 4EB6A 5KJCA 1JT2A 4P33A 4ZZ3A 5IYZA 3OT1A 2NUTA 3ASDA 4R8KA 2DF8A 1ZC3A 3CVPA 1QP8A 2R66A 4P4TA 3TLEA 3V8PA 3A1CA 2QDXA 4BMDA 4HX9A 3L8YA 2FBNA 4C20A 1KY3A 5KX5F 4G9GA 2OZPA 3UV7A 3ZI0A 4PPGA 4KR9A 1K7XB 1XNQB 1IVSA 1ICIA 2QQGA 2E87A 2ZVQX 1GO2A 5FI3A 4PPQA 1PS9A 4BV3A 2QJTA 1WNFA 4BO2A 1JEYA 2PQRA 1E96A 1UKCA 1XRLA 2O0HA 3BKWA 4TKMA 5EWJA 4C89A 1IDN1 5JYCA 3GLHA 4QOFA 5FBWB 2WF9A 5K2OA 4KYOB 2PRJA 1YFLA 2XHEA 3HYRA 2MYPA 4RU1A 1EFPA 3QVJA 2R2GA 3U4GA 1SKQA 1XXHE 2AK3A 4KQFA 5DLPA 2BEWA 3A05A 1S9HA 3V2HA 4LNBA 3TG2A 4LDPA 3ZWWA 2Q7OE 3PUZA 2GEDA 5FX2A 1TF7A 2PJZA 2YW9A 3ZBTA 3KQNA 1WZUA 3QV2A 3AU8A 3OF3A 2IL1A 1Z26A 3A36A 1BOFA 3DXFA 4GBGA 4AMVA 2H6GA 2XXBA 2OCYC 1T91A 1GGHA 2Z2XA 2ZRNA 3EVCA 3I32A 3JSAA 4L9WA 5F51A 4FYJA 4HOYA 1X1TA 2YKGA 3QEBZ 5CCXA 2CKMA 3LVBA 5I7HA 4I9UA 1PWEA 5B1IA 3IXLA 3NXSA 3PHIA 2CYBA 4CV0A 4EGSA 2DQKA 3GP3A 1J0BA 3WICA 5LYJF 3LT4A 2JIDA 2GPTA 4Y2SA 5EIXA 4GZ5A 1AKWA 4YV2A 1QGUB 4NPAA 2FPWA 4BVBA 2IJGX 2WPDA 4Z5XA 3DTTA 1SHUX 1TF5A 3G5AA 3JAWB 3JQFA 4TVSA 2ZBRA 1NVEA 3EJWA 4RJLA 1F8FA 3AHJA 4YASA 5EGSA 3TOCA 2DTXA 4J7CA 4AUEA 2Q1YA 3AHFA 1J0AA 4ZI7B 3NYWA 3FNEA 3G9TA 2JAHA 2QAGC 2Y66A 3DKIA 2OGUA 4OM7A 1JKMA 4WOKA 3WFIA 1BH6A 2WUFA 4J7UA 4C3ZA 4DADA 2OP0A 3FHEA 5IN5A 2I62A 2X19A 3OCZA 3UG7A 3ZBQA 1TQ2A 3GNSA 4A2PA 1BHSA 3N8NA 4P81A 4DG5A 2ODNA 3EDCA 3GJ7A 4N03A 3WV4A 4EO9A 4F1KA 3OJEA 5LDDC 1RXVA 3B60A 3GARA 1ABBA 1GNSA 4NFLA 4QVIA 3DMNA 2IX9A 4BFYA 1NBMA 3NBMA 4UOZA 4YAUA 2WAYA 1K2VN 2FSSA 3KELA 1M6VA 3GZTB 3L43A 1OCZE 3LD9A 2P9PG 2CLCX 4Y2JA 5ALHA 3JYOA 1P80A 3QWBA 1OTXA 1ZOSA 2BCJQ 4NU5A 3ORQA 4PYMA 4CM7A 1W0CA 3AF1A 2IHKA 2WJ4A 4EWLA 5C32A 3CKMA 1CPYA 1TLLA 4U39A 3ZV7A 1U5BB 2ZYRA 3AVVA 1XZQA 3DR3A 3RARA 4ARSA 1L5LA 1AN0A 3IODA 1QAOA 4MVJP 1PT9A 3ZCQA 5IULC 5AHKA 5KNCD 1DKRA 2CBZA 1R6BX 2E85A 4ND7A 3RB8A 1VOTA 3NIGB 2AFIE 1XTPA 2ZULA 3A28A 3A4YA 2GXSA 2ZRPA 4Y1EA 3GNTA 3OZCA 1TA0A 3QXJA 3ADOA 1E69A 1U81A 1EK1A 2DBZA 4XM1A 2MCFA 4QC2A 1CUCA 1BPOA 3DTVA 1LBSA 2A67A 2ZATA 3M3PA 3UK1A 5EIBE 5IJWA 2R87A 5JHHB 1L4EA 3FUHA 2YFHA 4R40A 4C9BB 4G25A 3EVNA 5I9NA 2CW5A 2RH8A 1KARA 2Y1WA 1WV0A 3AWIA 5E2AA 4HDRB 5LYJB 5KHLB 3HI4A 3N8KA 4KFUA 2PX4A 3TMKA 1GDHA 4MWDA 4EYGA 1L7RA 3P52A 2P0AA 2Q3MA 4PNPA 2WIBA 2W6OA 2X3FA 3EEYA 2WB2A 3GWGA 3W5SA 1X8LA 2C9ZA 5D00A 3B3JA 1T0PA 1F1BA 3OC0A 2XVAA 3NM4A 4I5FA 5DXJA 2QTGA 4JEMA 5DHUA 3NATA 1JKJB 3WLJA 2IGTA 1Y80A 1P5HA 3GP5A 3DCYA 4ZQHA 5BOSA 1J00A 2V03A 1C7FA 2W90A 3IUBA 5LLDA 3H2KA 4IQ4A 4LHSA 1TC2A 3B7SA 3RU2A 3OJXA 1JR3A 2YJ3A 3OPMA 1EX6A 3IJRA 3B52X 3BMNB 3DXZA 3EEIA 3ZIUA 2PIDA 5LOVA 3MD9A 3C0KA 2PGJA 3BA1A 3QX3A 2M2IA 1U7TA 3KQTA 3KTAB 2F67A 3A1VA 2P79A 3ESLA 4FHFA 4HAOA 1V43A 1T6NA 3TR6A 3K09C 3RSGA 1GPDG 4M0PA 3HJTA 3TCNA 3UNXA 1KY5A 1FYWA 4GNRA 1VKOA 1P7CA 1PW5A 4ZREA 3RRFA 1SHTX 1TTPB 2V6GA 1TPYA 3IOEA 3IPAA 3WMFA 4YAGA 1LQ2A 1GYRA 1Z22A 3FPJA 1VI2A 2P2YA 4PBTA 4OIMA 3C97A 4AJEA 3JD1A 3LRPA 1N94A 3UYKA 3T8MA 3WRYA 5BURA 3PC8C 3L1JA 1KEZA 4U7PB 3IXQA 4IM7A 3NZUA 4QM7A 2YFYA 3DTVD 4PRLA 1CLUA 3B2QA 3HUUA 3Q75A 5EWJB 1NW8A 1EDZA 4M2LA 4Z9XA 4AICA 2WUEA 3FRJA 1NI3A 1ZG3A 5KSYA 3IMKA 1RJDA 2QRNA 3UJHA 1N2IA 3ETDA 4WL0A 5DLQC 2ZCJA 3E03A 4KXXA 5CCLA 1TZMA 1ZY2A 4RD4A 3VZSA 1GTRA 1QO9A 1WXEA 3UJ3X 1Q17A 4QHSA 6ADHA 3K5IA 2XZOA 2BM1A 3LHFA 4EO7A 1L9XA 2KBFA 2O7NA 4MP3A 2P5TB 4RJTA 5IYZB 1V3TA 2WINI 3E1GA 5C3MA 4CPDA 4CF7A 3AR8A 3BMQA 3H0KA 1P5ZB 3RVNA 2XE7A 1ZD1A 3E30A 3HVEB 3HHMA 3CNOA 3FNFA 4JSRA 1G19A 3R6GA 5B2ZA 1DCQA 1FQKA 2GFQA 2J7PD 4MWSA 3WTCA 1Z47A 4LWQA 1HXIA 3CUVA 1W6RA 1K2WA 3E3MA 1SK9A 3NM5A 1Z4IA 3DUFB 4EKDA 2ZZMA 3TEJA 2DFPA 4MV6A 1EA7A 2J3EA 3ED1A 4R6WA 4TTVA 3JAWA 1YCFA 3PB3A 4KGZA 1MB3A 5HF5A 4ZYXA 1QVRA 4H7IA 1DVRA 4QNRA 4H3KB 2WIDA 3EC7A 2YIMA 4D3YA 2A0KA 5KHAA 1FEZA 1YWGO 2XR1A 1Z2NX 1G7RA 4DC0A 1Z2CA 1ZD3A 2CKDA 1FUEA 1RLMA 3UMRA 1EP9A 3DBIA 3UK7A 2Z09A 1FUIA 3BC1A 1FP6A 3GJZA 4J1SA 4OU5A 4U2BA 3IKLA 1WHTA 3M4JA 4MR8B 1VGQA 2RHBA 3FHLA 1E6LA 2JANA 2RJNA 1RT9A 1FNMA 3WIBA 5DGCA 1IKND 4TYPA 2FJUA 5BMVF 3UB3A 2QW1A 1FX0A 4XUDA 1PJRA 4GTOA 1KAOA 1L4GA 3I2GA 3MTQA 4ZZ0A 1C7IA 3EMBA 4WZBA 3G1TA 3ZU5A 2W70A 1DP4A 3I2JA 3L82A 1O8BA 1QVVA 1B26A 2BEVB 4R9VA 3I8XA 1USWA 3IR5A 3K71B 2ZBEA 3OPYB 2VO1A 2R0QC 1BFUA 3WQRA 4W1RA 5HDBB 5JO0A 2GK4A 5ADUS 2WM8A 1FBTA 5FKJA 3L7BA 3D4BA 4RLHA 5ALDA 1U8XX 1PF7E 2ZP1A 3R4CA 3RRBA 1U6JA 3ACDA 1F5SA 5CX1B 2CFUA 3UBMA 3KKOA 4L2LA 1A8PA 1XX6A 3ENQA 2J5RA 4HDKA 3R3HA 2Q0HA 4RPHA 2JB9A 4CIXA 4PO3X 1Y4UA 4N7BA 4TWRA 4MPJA 3L9TA 2VAMA 2PPLA 3AHHA 3CURA 3DOCA 4FP9A 4YXWA 1YL5A 1ATIA 1V7CA 5LQDA 2JIPA 4C9BA 4MI3A 4PPFA 2PMFA 3SHQA 3PPYA 3RWBA 2PX0A 4CN8A 4OAUC 2C29D 4EA9A 4FDMA 3V7FA 1FZQA 1V5WA 3DF9A 2J0QA 3K8QA 4UXJA 3VR3A 2J08A 1Y4SA 3IAS1 4C4YA 1DUSA 4PSDA 4WLEA 2XD9A 2OXIA 2J4DA 1LPPA 3QA3E 5AKYA 3KQVA 2J7PA 4KGVA 4F7DA 1N7JA 5DT9A 3L8HA 1UFVA 3GJ8A 5K45A 2H4JA 5ECGC 5HE8A 3FFLA 2WF6A 3IH5A 1M7GA 3ZEFA 1JQEA 3JZDA 3BWYA 3E4DA 1JLLA 1PGNA 2IH5A 3EZYA 2BIFA 4JJEA 4TWZA 3QUSA 4P36A 4Q3KA 2IWHA 3BXZA 5CMYA 2D7CA 3HEAA 5AMXA 4BU1A 4HI8A 2JCGA 3WVNA 1M3SA 3NXKA 3Q8XB 4ACLA 2MSNA 1BS2A 3ZDZB 3ACBA 1ISGA 4J1NA 3ZWCA 1FS6A 4XWOA 2B4KA 2ZQYA 1FFYA 2N0SA 1X15A 2XSZA 1N8KA 1WJGA 4C6SA 3D59A 1EVYA 3EDMA 2PWPA 2B94A 3PVZA 5B1SA 3ZX4A 4D9BA 2NUPB 4AXHA 1X42A 4RY0A 1RABA 3Q7EA 3ZGOA 2EZ8A 4H3HB 1RKXA 3BCSA 4DARA 3AONB 3GA7A 5FP0A 1TE2A 3WYNA 4ER7A 1O9HA 2BELA 2J3JA 3COZA 2CHZA 4N9WA 1W75A 4RLYA 5JAOA 5FOQA 2NYAA 4AMZA 3D6FA 2MSDB 2A5JA 3ZOKA 4IP0A 1BQ4A 1CY8A 1UBJS 3PNPA 3ZWDA 4YRQA 2WYOA 1NLUA 3HYCA 2CCJA 3CY6A 1ZJYA 4J0CA 2ZB2A 4A03A 3SYKA 5L4SA 2DUUA 1S8AA 5F4BA 3R8CA 4HQFA 1KI6A 1UEJA 2CL0X 1CCWA 2FX2A 2V1XA 2RG7A 1I8TA 2XUJA 5DASA 4ZC1A 5AJUA 2XOXA 1HC7A 3ZVRA 1CRPA 1AQLA 3HB4X 4Y8VA 3PENA 4KKXB 5F52A 2BW0A 5ALTA 5CLGA 4LYGA 3IHKA 2IOFK 3VSEA 2F37A 3QK0A 3ORRA 4ZT7A 4KW7A 2B6NA 1NVAA 2GAOA 2YV2A 2XUDA 4FDTA 3ROPA 3CR3C 3SP1A 1MRNA 1LW7A 2JH3A 3CO0S 1TEHA 3FCUB 1P1IA 2P6NA 5F78A 3VPBA 4TXMA 2D2VA 5NLLA 1UOOA 3KYBA 1GYPA 1IEQA 1ZCAA 2FU5C 2IZ6A 1OI2A 5JECA 4CEHA 4F1WA 4LMPA 4GCNA 2BL4A 3V55A 3SBOA 5LQCA 3DEJA 4HP8A 4IMIB 3COSA 4Z4CA 1XEFA 1GGJA 4HJXA 5DXFA 3ZV5A 5TS2A 3I4GA 1KTIA 1WQ1R 1F12A 4N7MA 5FQNA 3IEVA 3WNZA 3BUSA 4FX2A 1KK3A 3WBBA 3EHNA 1DIRA 1KLXA 1T36B 3BJEA 3NI2A 4LCBA 4N5LA 4XPZA 4LFCB 1G2IA 4EJ0A 5JD6A 5FOTA 2WFLB 3O6VA 4A5SA 3VO2A 5JANA 3FR7A 1PP4A 1DWPA 3A3NA 3DE3X 5KYWA 4HB4A 4YVFA 4MULA 2BTQA 3KZCA 2NU7B 4M9UA 1KDTA 4ED9A 5I6DA 5CECB 1A9SA 1TKCA 4J8EA 3KFXA 3K0AA 4WLUA 4A2QA 2V7UA 3EXEB 5EHXA 4KMMA 3Q79A 4H6PA 4P7JA 2VF7A 3W34A 2RHWA 2XMBA 4ENRA 1FP4B 3QIVA 1UT5A 3W4JA 4E7OA 1O97D 1WWKA 4IIJB 1THTA 4UU8A 3L6DA 2WM9B 2A0XA 1DPGA 3IAUA 4V02A 2AVNA 2ZU0C 4BLUA 1R0KA 4I5EA 4WKOA 1QPZA 2C8VA 1ZOPA 2G0TA 4J9UE 4MS1A 4K6MA 5LD2B 2H85A 1YQGA 1GILA 2V3VA 4EJ6A 2Z6AA 1OLXB 1OZFA 1YRQA 4HDQB 1SCUB 1P2VA 2R751 3OCWA 4UHHA 3IAM6 3KDAA 5A02A 5AW8A 3GQBA 3ODPA 2O23A 4ZT4A 3W8NA 1PR9A 1ELWA 2JFPA 2OPHA 3DJFA 3OKAA 1N9KA 4CCYA 3HCOA 4G3XA 4JYBA 3SEZA 2P2SA 2YJ4A 1R8JA 2ZXWE 2RAPA 3FZNA 5DTJA 3C6QA 2D5IA 4QFBA 5FLXA 1R6DA 2G4CA 4KG7A 4PZCA 4QQRA 2JEZA 3L6OO 1NF3A 2VDPB 3QVKA 4ZAVA 5K0NA 2AJLI 5TE9A 3V4FA 3C3CA 5CDFE 4LFAB 2JLRA 2Z08A 3T5BA 4WIAA 4JYMA 2Z1NA 2QR2A 1ZX1A 3KDSE 4POAA 3RIHA 4ME6A 4F5ZA 3R7WB 1NJ1A 2ZZKA 5FI0B 1SMKA 4F7WA 1Q92A 4I36A 5A04A 4ZRDA 3KJQA 5FAKA 5HKBA 1TJ5A 2NQTA 3CVQA 1M6EX 2VJNA 1H2YA 1YA8A 1TM7E 2O7VA 4Y2XA 4B5LA 1CNFA 2Z4SA 4U95D 4BNMA 2ZTHA 1K3TA 4JUDX 4FYKA 1D8TA 1U9IA 3R3SA 2XCBA 3HXTA 1U3DA 1Y5RA 3EZFA 3TXYA 4QGBA 4IINA 1M2EA 2G72A 4H0NA 4CLHA 2YZNA 3L8CA 3U1TA 4D98A 1XDWA 4B4OA 2HBQA 1O87A 1HH8A 4UVEA 5AKZA 3TNDA 1J23A 3H6HA 4W9NA 1Q50A 2QWXA 3GYXB 2X6KA 4NOLA 3TKLA 5C8YF 2H08A 3CKCA 1JZSA 3R74A 1Z0SA 3FRIA 2PCLA 4MKXA 1TGYA 2XRZA 3WK7A 2QRVA 4JFAA 4LHZA 1NIPA 3Q72A 1XF1A 4QOIA 2VPYA 1XQ1A 3CKLA 4LJ8A 1WKVA 4LRXA 4RK6A 3I9OA 1G8AA 3NASA 3ZY6A 1FDOA 1K89A 2CLIB 2O2HA 4N01A 4MA5A 4F3TA 4ANVA 5DGDA 1EDEA 1EA5A 5H1YA 4HEHA 1QH1A 3BX1A 3PS9A 4Y2HA 3Q5GA 4MVJI 5KDOA 5A3RA 2JLUA 5M3BA 5LIPA 3RCBA 1O0BA 1XD8A 3EA4A 4NULA 4PGMA 4NJOA 4OHKA 3PD1A 4U7WA 4MB0A 4BO6A 1JG4A 1RRMA 5G40A 1ZUNA 4FMBB 1H6PA 1GKUB 4K2AA 2NWQA 4L5BA 2ZBGA 3OOWA 4ZHQB 1Y1SA 5FZRA 4FFBB 1T2CA 4I5GA 4MS4B 5LDGA 3UA4A 4C4ZA 2ZETA 2B78A 1B6RA 2OHXA 3VMFA 4YAWA 4DJ5X 4P92A 2UAGA 4P34A 1DHTA 3IURA 4UE3S 2CDBA 1BRMA 3STXA 4E12A 1BXGB 3OECA 2JLYA 3WNCA 3UC9A 3GPIA 4YNBA 4O59O 1LNQA 1JH9A 1A5ZA 1Q7CA 1KEEB 4DLUA 4IDDA 1R4AA 3UJCA 4MQLA 5KNBA 2DETA 1UXGA 3QVMA 3UJNA 4DBVO 4CG1A 4Q66C 3E3AA 3DMPA 1QFSA 3PQCA 1NULA 1HEUA 3KUCA 3TDKA 2Z6VA 1E1DA 4OQXA 1B15A 3FTYA 4M8SA 4CLOA 3WJAA 3RJMA 3W4KA 1MAAA 2D00A 4DWOA 4MJXA 2CFCA 5CU7A 2PUVA 3OETA 3PRJA 3HXDA 4JR0A 4OIFA 5A6CA 3NFYA 3M1IA 2PM6A 5LXTA 4RTSA 3OMXA 2ZREA 2WFLA 3RFVA 1T13A 4YONB 2GD2A 3KQOA 3AXSA 3SQDA 1XCBA 3NZSA 2GO7A 4CT0A 2RCYA 1U3GA 2VDQB 2N9UA 2WEKA 3KQQA 3LUHA 3QY9A 5LYJA 2MYUA 4Y30A 4CG0A 5KWIA 2HDHA 2IHYA 4QDTA 3WHIA 2L0XA 3ZU6A 1TNZA 4AZTA 1ZUWA 4CR7A 4LRSB 4EABA 1SU7A 2RAUA 1GNLA 2PT7A 2PZBA 2OAP1 3TWRA 1CSEE 3QBEA 4YXFA 1Z5ZA 2ZPTX 3CJTA 4HWPA 3RLFA 2NU6B 2WMDA 5DF1A 2OBFA 2Y4NA 3QBDA 4MUXA 5G05C 2GPSA 4FYMA 4EY7A 3W5BA 3GCDA 4Z8XA 4GPIB 1M2OB 3QKSB 1WUJS 2MINA 4K9SA 1KEKA 1QFXA 5SY9A 2BWJA 5G0WA 1AKEA 1W4AA 4RV9A 4PG8A 3V2OA 2EBWA 4LQ4A 4FBLA 1E2JA 2PR2A 1ZI9A 4O6VA 3CNBA 2CV0A 1ONPA 1YMVA 1PNQA 4K5BA 3I9MA 3HWWA 2A9PA 3PDNA 5LZ7A 3N7AA 3OT1B 1L5MA 1RKQA 3UQZA 4WK0B 4ASUD 4C0JA 4BB6A 5I3ZA 1D2EA 1PK8A 3K72B 4I9HA 3TE6A 2ZJ4A 3N2KA 1VHLA 5AOCA 1JPNA 2GTHA 2VSNA 2C59A 1WAO1 2NU7A 4G36A 1Y9AA 4HBGA 3FMVA 4HLNA 4LZWA 2B1GA 1USVA 5JAUA 2GCEA 3UPUA 3ICEA 3SYTA 1P9OA 2BEUA 4B2IA 1MD9A 2I4NA 3AI1A 4W5WA 3NDRA 3O8RA 1WSBA 3BK7A 5E6UA 2HUNA 1OY1A 3OF5A 4Z4FA 1Y1LA 5EIEA 3ZW8A 2RKBA 4OHRA 1JECA 3WFJA 3RS7A 3SC6A 2XZPA 2Z8XA 2HPAA 3PVSA 4ON9A 4W1QA 4XFDA 4Q6WA 3SGHA 1J1ZA 4ZCTA 3WK9A 1OFUX 5KPDA 3DPDA 1Z4QA 1BN6A 2XS8A 1ICEA 3EXHB 2BKKB 4BLQA 2XTMA 1XWWA 4RF2A 4RD0A 3NV9A 3KVNA 3FU6A 1T8RA 4BB0A 1D1PA 1F8UA 1XGWA 5CRUA 4LJSA 4XW2A 1E3IA 4L5JA 2XBMA 1LGYA 2WIAA 2XYVA 3DZBA 4BVGA 2XPZA 1W48A 5JSYA 3RT1A 4FFNA 3EZLA 5C8XA 3U4HA 4EHFA 1Q14A 4GA0A 3NU1A 3DEHA 2V54A 3TWUA 5I4CA 3H42B 3TPCA 1CS0B 3V1MA 2JGRA 4M9XA 3RVDA 2IIPA 5P21A 1QFYA 3UJ6A 4BO8A 2F3QA 3VSBA 5T5QA 3TO5A 2GZDA 2VKQA 1DO0A 4MAFA 3DE0X 1NJ2A 4ML3A 1HF3A 1JHYA 1SKBA 3RYTC 1E7RA 3EB9A 3O93A 5J5AA 1SXJB 2Y77A 5BV2P 5KVCA 4A10A 5TY0A 1VIDA 1SOAA 5HJ7A 2I7CA 1K5PA 2WY2D 3TTYA 1Y6QA 3WIOA 3NJ4A 2DRIA 1GT91 1N2GA 2XD4A 3CSDA 4KNWA 5EXXA 3ZE9A 5C81A 4K0KB 5FQ8A 1TFRA 1MDFA 3EEQA 2Z5LA 4MIYA 3ZVNA 4KGXA 1CP3A 1CQPA 1OPRA 1MX2A 2J3KA 3B7WA 4KR0A 4OATA 4QOEA 5AK6A 1MX4A 4ZCSA 1Z68A 4EENA 2P9QA 2P30A 3TQRA 1K8KG 2W6MA 1JQKA 2VDVE 3I9NA 3LA6A 4AU1A 1IQRA 4FHGA 4MUBA 4YIKA 2B37A 4N3BA 3CRMA