3TAXA

A neutral diphosphate mimic crosslinks the active site of human o-glcnac transferase
Total Genus 271
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
271
sequence length
714
structure length
695
Chain Sequence
THADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title A neutral diphosphate mimic crosslinks the active site of human O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 271
structure length 695
sequence length 714
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3taxA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3taxA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 3taxA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3taxA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3taxA03
3CVNA 3NB0A 2QRGA 4HWGA 1PNVA 3MA5A 2HY7A 2WTXA 2KATA 1LWNA 3H4TA 3MTDA 4M7PA 4G26A 3CVPA 3MT9A 5DIZA 3GYZA 5FTPA 3RHZA 3MBOA 4HOSA 4WUYA 3U4TA 4RIEA 3TG4A 4NC9A 2R66A 4UQYA 3HBFA 4CGWA 2MHKA 3KS2A 3G2JA 3OTHA 4GPBA 5D01A 1P2GA 3RSZA 2FEZA 4XIFA 3SZ7A 5EKQD 3L79A 3MS7A 2AZDA 1NA3A 4GZ6A 1WW2A 3EBPA 4G2TA 3CV0A 3FWVA 3G2NA 3C48A 2Q7FA 9GPBA 1L5QA 1NVKA 4KQ2A 1K08A 2R68A 2FETA 1P2BA 3NC4A 4I2WA 3T3EA 3ZCRA 3CK9A 3E3NA 3N71A 3HBNA 1VGVA 2IV7A 3JYSA 1WAO1 4W9RA 3DDWA 3RO3A 5BT1A 1IYGA 2HO1A 3CEMA 4RBNA 3GZ1A 5GPBA 5HI7A 3ZCTA 3GZ2A 2R4TA 2R4UA 4M60A 2PL2A 3S27A 3OY2A 4FZRA 2XCCA 3ASDA 5ENZA 2XGSA 5JJTA 3ZCQA 2SKDA 3DD1A 2YHCA 4H7XA 2BGUA 1EM6A 4I1AA 1Y8MA 2VSNA 4Y6CA 3MT7A 2VGYA 3QWVA 4X7RA 1KTIA 4MI6A 3TSAA 4GA0A 2R60A 1QKJA 2C1ZA 3LKUA 4BQEA 2FF4A 5D00A 2X6RA 3ZHEB 4MI9A 4BTBA 3ASHA 1HXIA 1JEJA 4M83A 4CTMA 3HYMB 5KJLA 1FS4A 4U0ZA 4MHOA 4U04A 3DZCA 2VG8A 3ESKA 1C3JA 4JL0A 2GPAA 4GYWA 3Q3HA 3VDNB 4X6LA 3S2UA 4H7YA 4NRHB 2GM9A 2PYDA 4REMA 3AS5A 4RG6A 3SYMA 3CVLA 4U0SA 3NP7A 3RIBA 3GUHA 1FU7A 1RZUA 5G05C 1UQTA 4W6QA 1YA6A 4CTOA 2YQ8A 3Q4AB 4N9WA 3E3OA 2DBAA 2FF5A 1XV5A 3FROA 3QKWA 4MI3A 4O6FA 2C2LA 1WV0A 4F9FA 3PE4A 1Z6QA 1Y6FA 3RJVA 1NOIA 1GZ5A 5A7DB 5EX3A 4N3AA 3TGOA 2BUGA 1C50A 2L6JA 1V4VA 5FZRA 3Q47B 1L5VA 4N3CA 4GYOA 1P4JA 1GPAA 4UQZA 3WXXA 2G9VA 5G05J 4WNGA 5M72A 3HBMA 3T3GA 4J8FA 1IIRA 3MTAA 4CGVA 5AYWD 2QRPA 2P58C 3BEEA 3UYKA 4QLBA 4UI9C 2PZIA 3KD7A 2C9ZA 1Y6GA 2X0DA 3RO2A 4BT9A 1XL0A 2XCBA 2SKCA 2C0LA 4AIFA 5IKPA 4LEIA 3AS4A 1TJCA 1WV1A 3CUYA 2XEVA 3NCHA 4HOUA 2GPNA 2KS6A 3D0QA 3G2LA 4MICA 4EL0A 5LQDA 3KAEA 3CKCA 5DXFA 3U3WA 3RSCA 2KCLA 3S0JA 1P4HA 2C4MA 2C1XA 1O6CA 2GEJA 4KBQA 1WM5A 3URZA 1FA9A 1EXVA 1XKXA 1RZVA 2GJ4A 2UY1A 2UWJG 4RIFA 4GZ3A 4UI9J 4WNEA 2WPVA 2QN9A 1NZNA 2QLNA 2VGXA 3CK7A 1K06A 3AS8A 4WHMA 4RENA 2QFCA 1ELRA 4G1TA 1GFZA 4KQ1A 1SXQA 2F3PA 2P6PA 3PE3A 2IYAA 2PYIA 5JTUA 5D0QD 4U0UA 2QN3A 3CKBA 2PRIA 3FFLA 2FO7A 5G04C 1L5RA 3G2IA 2XCIA 4BTAA 5LCWC 5CCLA 4EQFA 1A17A 1BX3A 1JIVA 2ACVA 4EL5A 2IFUA 3TOVA 3EDTB 4AY6A 5I45A 2X0FA 4EKYA 5ARFA 1OUVA 2C0MA 3D1JA 2XGMA 3Q49B 5FZSA 4F97A 4WACA 3S7BA 3EBOA 2GT1A 3GW4A 2AV6A 1HZ4A 4AM9A 4A1SA 3MT8A 1JIUA 5CCMA 1J39A 2GEKA 3CUWA 4YUAA 5DU2A 2XCUA 2QLLA 4MRAA 4U07A 5LCWJ 4HOQA 3S7JA 3LYAA 3BCUA 4NEQA 2IYFA 2XA2A 3L7AA 3T3HA 1QZ2A 5TMEA 2E2EA 3BDAA 4LEUA 3VTYA 2V5FA 5FZQA 2AVPA 2AW3A 3QKYA 2XMPA 4UI9K 1PYGA 1NOKA 3T5TA 5KJKA 4BWRA 1Z6PA 1P5QA 4B94A 1FTYA 3OKAA 1QM5A 3LCAA 1JG7A 4N39A 3MS4A 1UQUA 3OTGA 3RT1A 1E96B 3CEQA 1B89A 1FC0A 2VQ2A 3Q15A 5TVGA 1Z8DA 4CDRA 1GG8A 3TG5A 2O6LA 1NZDA 5JTTA 3WAGA 5KJMA 3NF1A 3S29A 2JLBA 5HXAA 5BNWA 3VTXA 1NA0A 4Z5XA 4N2SA 5HQ8A 3FP3A 2KCKA 1GGNA 2Y4TA 2XA9A 3OXGA 3QOUA 1HLFA 4ABNA 2F3UA 2VSYA 1NZFA 4EJ2A 3ZFWA 3LY7A 2X0EA 1NOJA 2ECPA 3VUFA 1L7XA 2X6QA 3CV3A 5DBKA 2VYIA 3MKRA 2FBNA 2QN7A 2IEIA 2ACWA 3VDMA 4I17A 2OFFA 2IV3A 4XI9A 2QN2A 3L7CA 3NAZA 1C8LA 3CUVA 1Z62A 3O3CA 1P29A 5CHEE 1FU4A 1XC7A 4GCNA 4HOTA 2HYZA 3CUTA 3BD7A 4NESA 3ZPJA 2YJNA 3OT5A 1E1YA 3MRTA 2BGTA 2HR2A 5EX0A 2WQHA 5ARGA 2J9QA 3RU0A 4YI5A 4BFCA 3IA7A 4J0UA 1F6DA 3COPA 1F0KA 3ZHEA 3R9AB 2GW1A 3E4BA 3NPAA 2IF4A 2KC7A 2XA1A 1W3BA 3QWPA 5D0OD 3ZN3A 2ATIA 2QN8A 2QLMA 3S7DA 3S7FA 1KT0A 4YNDA 1LWOA 2ZB2A 3DDSA 3MTBA 2ONDA 3AMVA 4G2VA 5FT9A 3ULQA 2PRJA 3IAAA 5DLDA 2VCHA 2LNIA 1A8IA 1FTQA 1FTWA 3GPBA 3UPVA 2LSVA 1L5WA 2GPBA 4X7MA 1JIXA 4CTNA 2I6HA 1UZUA 3MRVA 3Q5MA 1HH8A 4RIIA 2H1FA 3PDNA 3MV2B 4L22A 1L6IA 3MRXA 4GA2A 1IXYA 2QRMA 3CX4A 3OKPA 5TMBA 4RG9A 2AMVA 4BQFA 2NC9A 5BW8C 1C8KA 4G25A 1XL1A 8GPBA 3IEGA 4HLNA 1P2DA 4NQ0A 3S28A 3ASFA 1XOIA 3ZCSA 1YA0A 3HBJA 4I2ZA 1GPBA 1XNFA 1WW3A 3C4QA 2QRQA 4KYOB 4HORA 4GA1A 4I9EA 2R5SA 1PC2A 3BCRA 3H4IA 1NLMA 3CVQA 4RIGA 2PQNA 3QHPA 4JA9A 2FFRA 5G04J 3OKCA 2QRHA 4G23A 1RRVA 3ASGA 2KCVA 2JJMA 2QNBA 2F3QA 3RKVA 4GPKA 1WUYA 1YGPA 3BD6A 2Q6VA 5IKOA 1KLXA 2QN1A 5C1DA 4YVOA 1FU8A 3LY9A 4JA7A 4I9CA 3CEHA 4WNDA 3TAXA 3CUUA 3G2HA 3LY8A 4F96A 3O48A 3G2KA 3OY7A 3L7DA 4YVQC 1WUTA 4AY5A 4AMBA 4F3VA 3CK8A 4MHSA 2IUYA 1ABBA 3MQFA 3OXFA 2IEGA 4GCOA 1QQEA 5A6CA 4YI3A 3SYRA 3ZCPA 3UUXA 2PQRA 2F3SA 3MV3B 3NP9A 2G9QA 3L7BA 2XPIA 3T7DA 3MSCA 3VUEA 4BT8A 1Y8ZA 4GZ5A 1E4OA 1AHPA 2UY1B 2G9RA 4AMGA 3L01A 1ELWA 1FCHA 2FI7A 2H1HA 1PSWA 2SKEA 2VGXB 3BEOA 4GYYA 4KXKB 4N2QA 1SXPA 4J8DA 6GPBA 1GPYA 4APOA 4RELA 3OXLA 4AN4A 3Q3IA 5FJYA 3SF4A 1M5RA 1P4GA 1IHGA 2PQ6A 1ZU2A 3QDNA 3WADA 4IN3B 4KQMA 1B4DA 4RIHA 3D0RA 3T3IA 5JJ7A 2ASVA 2QZSA 4X7PA 3BD8A 2JZCA 3BCSA 3ZCVA 3K9IA 4UQXA 3E3LA 3T3DA 4Y6WA 4ME2A 4WADA 2F9FA 3C4VA 4FKZA 3OTIA 2BISA 4J8EA 3ZGQA 1KT1A 1L5SA 2OOEA 3UQ3A 1H5UA 1ZBPA 3UYLA 2Y4UA 4PQGA 3Q3EA 3WC4A 5KJNA 3MS2A 5TMDA 2XGOA 3MEKA 4EKEA 4XI0A 2VCEA 4N5CA 1PN3A 4LDPA 3LPZA 4JHRA 5JJ6A 1AXRA 1JG6A 2G9UA 4G24A 3ZCUA 7GPBA 2LSUA 4BQIA 2IW1A 4WNFA 4N3BA 3QWWA 2BFWA 3CEJA
chains in the Genus database with same CATH superfamily
5EHQA 1YUMA 1KSJA 1G1AA 4LYFA 1FVXA 2R751 2CVOA 3W8EA 4BQSA 2ZT8A 3DUFB 2J3EA 3EBPA 3JR7A 2TMKA 1OXUA 1TLFA 3CK9A 3JZFA 4D4MA 1NBIA 3OCVA 1JG4A 1T2EA 1LX7A 2IHZA 4H77A 1R1DA 5LFAA 4ZOQI 5JJTA 1UMCA 2Q1YA 1Z5ZA 3EIHA 5JPIA 3CVJA 1L2TA 4JSTA 1XIVA 3GVIA 3DAGA 4IFBA 3KZVA 1JDSA 2MIIA 3GZNA 5ELLA 3T54A 1AKWA 1I4TD 3B9PA 4KDEA 2J32A 1ZSYA 4FMCF 2NN3C 4YAWA 3JTEA 2QX9A 2VL7A 3CLSD 1Z12A 1RQNA 3BXFA 5FOXA 3V7UA 4LE0A 1GIAA 1AP7A 2X13A 4NICA 4PZ0A 3O91A 2GEFA 5COBA 4IUBS 3G2OA 5L7TA 1CULC 1P9LA 1IBSA 2IPAB 4Q9JA 5I7WA 4YDWA 2ZWOA 3ONVA 4LSMA 3URMA 5A3QA 2PMKA 2VNHA 2BGKA 4MPTA 4V0RA 3N2KB 1WNFA 3EUAA 1GRCA 1YTUA 4QJBA 4UULA 4ASUD 4PF1A 3MA0A 2GRPB 3Q10A 3U6BA 2FDRA 3KPWA 4G1TA 1Z34A 4JQCA 3G8CA 2QN3A 3BE8A 1O3YA 3DD5A 5U4QA 3MJDA 4LKRA 4QTZA 1Y4ZA 1JHRA 3GVCA 3LBFA 1UMBB 2V3WA 5DGHA 1UC9A 2W4MA 4D5EA 3M3HA 2AL7A 4E0BA 2XXBA 1KHTA 4MKTA 1AGRA 4NCIA 3SDZA 4JB8A 4L72A 1U2QA 5C1IA 2QYJA 5B1AE 1R9GA 2DU8A 4YACA 4FHZA 3COSA 3W78A 4DLQA 1HF3A 1M8PA 2AVPA 4QYWA 4MQ5A 2DH6A 3F9RA 1ZZGA 4OL9A 1QM5A 2G06A 3ISJA 1SBHA 1MB4A 5LWHA 2VQ2A 3SCZA 2LDBA 4Q4CA 4L4ZA 4U2KA 3RODA 1JSRA 1T1EA 2B8WA 1KK3A 5K8TA 5CBKA 1TCAA 2ACWA 4O4LA 3WV4A 2OFFA 4Y2UA 4ADSG 1ZA1A 3AHIA 3BD7A 3RS3A 3L40A 3G0DA 4OKIA 2A7XA 4JP8A 4DRXB 5LP6B 3E4BA 4HHEA 2HRCA 1H1DA 4BO4A 2D13A 2R44A 5DM60 4KQHA 4H3SA 1CIPA 3WP0A 4COOA 3TNFA 5CT6A 4FFMA 2JGDB 1914A 1QP4A 2NVUA 2OESA 1MZPA 4BECA 2WTEA 2SCUA 4OJMX 3REFA 5EEGA 3ED5A 2QI9C 1L4KA 1U0NA 1C7QA 3OF3A 2W6OA 2BGJA 3BMCB 4CLEA 1YR1A 3AR6A 3PVCA 4OG2A 4DTIA 3MTEA 1M1NA 2HSZA 3OKCA 2BEVB 4X9XA 1YGPA 1ZSNA 2Q6VA 4JA7A 2GK4A 1G6HA 3FIUA 2WTNA 3A27A 3BL6A 3BMNA 1EVQA 3DCYA 3HI4A 3BHIA 1AD2A 3B89A 2Q5OA 2ODPA 3BQMB 3IR7A 2XRZA 1EP9A 3OD1A 5BSKA 3UM9A 1I7QB 3LJNA 1GPLA 4LISA 1OGYA 1CSEE 1GZHB 4NCHA 4AJPA 3WI7A 2VKQA 1ZI9A 1NDQA 1EUQA 4QIHA 5JS6A 2A9FA 1MXHA 2VZLA 2ZDQA 3P9IA 5ERXA 4AVXA 4UD2A 1X2BA 4DSAA 1GTVA 3A4YA 4H4EA 3UQ3A 4XPIB 2NSZA 3KQVA 3LUPA 1QIMA 1PFWA 3AY0A 1KP3A 2GBIA 3B53X 3ZY3A 1VFNA 3DO8A 4JOCA 2BH9A 5K3CA 1YQGA 3DLBA 4P1ZA 2Z2YA 3TCKA 2IU6A 5F2EA 4POOA 4MKXA 2TMDA 1RRFA 4RVCA 3RHFA 3N07A 3RF7A 3EISA 3CB4A 5BWOA 3G9UA 1YS2X 3H65A 1XRRA 3QAQA 1YZQA 3KEMA 5JQWA 4LK2A 2W00A 1ZH8A 3ZWXA 2HMTA 3PD7A 1P77A 3HB5X 2V7QA 5BSUA 3NVKI 4C1BA 2GPWA 1T36B 4MR8B 3LHIA 3T3MB 4YPVA 1E0JA 4R8VA 2W8BB 1S6YA 3TZKA 5K8UA 2W98A 3OWHA 2CLSA 3E0XA 3JVVA 3RVPA 1Z8HA 4EPXA 4LTMA 3Q3HA 4U00A 4GQBA 4RQBA 4RTQA 3EZLA 4M8KA 2KYRA 2R86A 5F5NA 3U56A 1NXOA 2BTEA 1BDJA 1ZDMA 2CZQA 2BUBA 5C2JB 1O95A 3LP6A 2P9YA 1E6UA 4GGOA 1O0SA 2GYYA 4JJZA 1QU3A 1M0SA 1VKJA 4KLCA 3PEFA 5HZKA 4YDQA 2OGTA 1QE0A 1HO3A 4HH3C 3RVDA 4UI9C 3UWMA 3BGVA 1JKXA 4QELA 1MJGA 3ZGLA 2W37A 1HT3A 3C87A 3DE0X 1EXVA 2WXJA 4W99A 2Q50A 2R05A 3Q7RA 5AH0A 1LPBB 3CWCA 2C29D 2JDIA 4RL4A 3ULYA 3AJ9A 2ST1A 1Z63A 2RG8A 2OC4A 5KWIA 1SD5A 3Q7IA 1EWKA 1GXSA 3EYWA 3RYTC 4PXAA 5KYVA 5KAPA 4U7PB 2A67A 3MT8A 5ITSA 1WMDA 2YJTD 1J0CA 2CE7A 1DC7A 2E0IA 1UEXC 3R6TA 3NBYC 5EE1A 3V8QA 4HEQA 3LX6A 1PVDA 1OV4A 3AGPA 1AUQA 2WIJA 4Y6RA 4YNBA 1YI0A 2QYSA 3PEEA 1NZDA 4FCVA 2YIDA 4TZKA 5FJIA 4WL0A 4B7UA 4I9GA 1OFVA 2X9LA 1HE8A 2DPLA 3KCQA 3AKDA 4YC7A 3QX7A 2ATVA 4HS9A 2MINB 3E8SA 3KJZA 1I2MA 2J9GA 3OZ7A 1Z5NA 3PZBA 5J40A 4Q18A 3LYLA 2WNHA 5HOQA 5AM1A 1J06A 3CX3A 1MPTA 5K3FA 4S0XA 1G8AA 2V9ZA 1WCIA 2WT4A 4JROA 2LNIA 1C4WA 5KWVA 2NAFA 4G8DA 5A2GA 1EFPB 2XTZA 3LVRE 4H7KA 4DN6A 1R4ZA 3KKKA 3OJ0A 1JLHA 1G5IA 3R3UA 1B93A 1I0LA 3X2QE 3ESCA 1UXGA 4CQJA 1K1BA 3M4JA 3ZQUA 3EVAA 4BQFA 3W3AA 2P69A 1EI9A 2Q2VA 3TSOA 2UZ0A 5E1OA 2HT1A 5LZ2A 3ABZA 3AVYA 1HRKA 2R5SA 3CGGA 5IARA 3DEKA 3V1YA 4P3XA 4BQRA 4RTKA 2IZOA 1TVCA 2WJHA 5LJLA 1F2DA 2B4TO 5F1PA 2ZIRA 2QN1A 5KREA 4HLDA 5AKJA 1KY4A 3MMXA 2WXFA 4AXHA 4CKWB 4XQ0A 1IBKB 3N9IA 3P32A 1B14A 2BFBB 1CUCA 1YZUA 5AI8A 4C4PA 4W8GA 3NVAA 4O4JB 3PQ4A 5JH7F 4EW3A 1IWOA 4LHXA 2YQZA 1TYDE 1DIBA 1R5BA 3NIGB 3BEOA 5EP4A 3DUWA 3ITEA 1DKNA 3CO0S 3ICPA 1E77A 2O2GA 1W8IA 1FZTA 4LRZA 1MAWA 5IF3A 1T0BA 5KDOA 3NFRA 4EF5A 1KC1A 2H1SA 4XYMA 5IZCC 1UXJA 5JNRA 4FM9A 5ALUA 4UMEA 4OKSA 4YDEA 4QQIA 2LP4Y 4Z0NA 2HGZA 1QMOE 3DOJA 2WMOB 5JAOA 2QTLA 4TXJA 2X0KA 1NAIA 2GVZC 4HPJB 3EDMA 5GIOE 2BV3A 4AO8A 1YTLA 2G88A 4F7AA 4RWEA 5J2UA 2BFCA 3IV9A 4DLWA 2ZRFA 2YL2A 4OOFA 1PZNA 5ANLA 3E7FA 1DV2A 5F2OA 4WZ6A 1KMMA 2BFMA 3BN3A 1CR1A 2AFIA 2HMVA 2WAYA 3QH4A 4H1UA 1KZ7B 3IHLA 4F2PA 3B1XA 3SF0A 3FPAA 2FF4A 4WIAA 1ZJZA 3ICVA 4OFBA 2FOIA 2XB9A 3H7IA 5I7OA 3W5VA 4FR2A 3DEYX 3CW8X 3EY9A 3LS8A 5LMCA 1KHHA 1JUDA 2O07A 1U0EA 4DA4A 4XQ9A 1DX9A 4OHWA 3NWJA 4A8TA 4N3AA 4ACKA 2FR8A 3LGXA 3QLJA 1UZAA 1W0KA 5FPKA 3MJVA 1CZUA 1Q92A 4UQZA 3HCBA 5CX4A 4KSCA 4FBGA 4WNGA 2Q0XA 3HR4A 1N57A 4B87A 2KMLA 3WBJA 1NN5A 3G5AA 3EPJA 1UT8A 4M46A 3JARA 2RBKA 1XL0A 4F2HA 3GZJA 3DOHA 4JJ6A 1AMOA 1KYIA 4X41A 3V4ZA 2W6JD 4BATA 1L5YA 2ZE6A 1JCQA 3V3LA 3P1UA 3SKVA 1OROA 5IJ9A 1KO4A 5K0CA 1UUFA 2XBUA 1DKQA 5FEUA 1R8YA 4OHFA 3QJGA 3SXPA 2NO1A 4HZUB 3F71A 1A7KA 3LBNA 1L5KA 2C4WA 4RA9A 2ZG6A 1FQOA 4RYLA 4BNDB 3DVRX 4BEVA 2VHWA 2BKXA 4L95C 2B1JA 3AERB 5ANRB 4H7PA 3VOBA 3GCDA 5DW0A 1Y6RA 2B3DA 1LA2A 1H3EA 3QUQA 4M9SA 5B1HA 2NUAA 4MLDA 1AMUA 3S2YA 4A0QA 1KTVA 3K1ZA 1KKUA 4FX5A 5JDCC 3VC1A 2ZYTX 1GNQA 5LM3A 4PQFA 4EDHA 4JNCA 1FXUA 2Q9AA 1ZHOA 3GWGA 2JNWA 3H05A 1LI7A 4UOQA 1TAHA 4IZIA 4ZCPA 1U7IA 4XKBA 3F47A 2QN6A 1HYHA 4D98A 1ZC4A 2Y8EA 4JJKA 3QITA 3COJA 2ONKA 4UAGA 5ED0A 1ZIYA 5FR2A 4OGLA 5AK0A 1U2TA 2AXEA 4OHMA 1G5RA 4Y18A 2QTTA 1G3MA 4HRYA 1SQSA 3B3FA 3AUJB 2PRJA 3G0OA 4N47A 4QAJA 3NI2A 5FBKA 2Q6OA 4OAOA 1SG9A 3VKVA 3QP9A 5M34A 4E5KA 1E69A 5IC4A 3RJZA 1QGDA 3UUGA 3QIVA 5TMBA 3QUAA 5KYNA 4KODA 1A1VA 3DQZA 4UVHA 2QRQA 3M4ZA 3N2ZB 1RZ3A 3QW2A 3AV0B 1D2GA 1J97A 4LXUA 2AJBA 4QLOA 2H51A 5GOZA 3TG2A 4Q96A 5L53A 4AULA 3BJRA 4C0HA 4FR0A 2CL7X 4MKHA 3ICWA 2IA5A 4ZFNA 1D6JA 4YVQC 3X2SA 5JSUA 2B37A 1ZD3A 1PTJC 1U7UA 2Z2ZA 3OZBA 1PG5A 4MKRA 1VTKA 1P3DA 5KNBH 1PV2A 4UUPA 1GW6A 5E1DA 1G63A 1TEVA 1QHYA 2E9SA 4MUIA 3N8KA 4OSOA 1I4LD 5ENQD 5D66A 1CNEA 1O0CA 1EBBA 1QNLA 3ZZUA 5TIIA 1J2TA 4URUR 2WBLC 3EGVA 4Z7JA 4ZEOA 2ZAYA 4OQNA 3P0RA 1GFWA 1RCTE 3PJFA 4YP9A 2OXEA 4R05A 3GH1A 3I9LA 2W71A 4EJSC 1RR6A 4CGWA 4WKOA 1I7SB 3I5XA 3KZCA 4DV4B 2XYVA 5F1YA 2ZQZA 3DHVA 3O4FA 1ZJWA 4C4TA 5BSFA 3C7DB 1S2MA 4C0MA 1R00A 3L46A 5FOVA 4ZZ3A 3FUTA 1GTG1 1UBEA 2NAPA 2XZTG 1V8OA 3D8UA 3RC7A 2Q3BA 5EG5A 4KX3A 1I2BA 2R59A 2AEFA 3PP8A 3EFBA 1NF9A 1ZD1A 1JDBC 4HVBA 2JHGA 2YHBA 3QG1A 4BNTA 5LMZA 1ZNXA 1ESZA 1EFLA 4RLSA 2C4TA 16PKA 3V4FA 3H18A 2VQDA 1YR8A 3OMSA 1YOVB 1UC5B 4NH4A 5J4KA 2IYUA 3IL2A 4RQTA 5D3QA 1I13A 3EIQC 1N8KA 1M1YB 4NNPA 2QRPA 1DOZA 1E9DA 5JSHA 2VHXA 1G19A 4MTLA 1M83A 3TUIC 1XCJA 2ZYAA 4RPKA 4I9NA 4RJKA 5JNSA 2YDXA 3SHQA 3U7JA 1XF1A 4TKVB 4RA6A 4J7AA 3DLPX 1SQFA 2HD4A 5JI3E 2NNLD 1N7GA 2HRRA 1F8UA 2ZJ5A 3OE5A 1U7TA 1K06A 2WF8A 1ULTA 3DE5X 3R5XA 1LDNA 2AFVA 4WXEA 1Z7YA 5JS7A 2DUNA 1U0JA 1OU0A 3V33A 1TFUA 4P9NA 4IJKA 3R77A 3EDTB 2HFJA 4EAQA 3VJRA 1NGSA 3PNBA 3U1TA 3WLAA 4YLEA 2E4XA 5EPUA 1QCCA 4DCCA 2IGBA 1ECLA 1AUVA 2WT8A 4Q4LA 3E3AA 1NE2A 3K0FA 5BSRA 1WSWA 2XB6A 1N32B 3K1AA 1FTYA 1KAHA 3IUQA 3PRJA 4P53A 3UAXA 2O6LA 3KQPA 3OQIB 3HDTA 2FPOA 4QU9A 3LFUA 1NUUA 1ZU5A 3KZMA 2K7FA 2DLNA 4XWOA 4RY0A 1OBOA 4R8MA 4M37A 2QUKA 3OTOB 1W0JD 4ZOLF 4LHZA 2WP8J 2C2GA 2NT4A 6AT1A 3PVZA 1JKJA 5JHBA 5BYKA 5BSGA 2XUZA 2X8JB 4R1PA 1XGWA 3B78A 2DCUA 1D7OA 1WOYA 3GDFA 4ZZIA 3OFJA 3ENWA 3HU1A 1VL8A 1DJOA 2WXOA 3P0EA 4KR0A 1QS0B 1AF7A 1RHMA 3UPVA 4KR3A 4XFKA 3MZ0A 3GRKA 1DELA 2HWYA 3W77A 4FZ5A 1W47A 4QDOA 3KDAA 2J59A 4DRXE 4UHKA 1PK9A 4B17A 3W0LB 4BFVA 1HFKA 4B3XA 4BO2A 3CLHA 2ZJ0A 2DYSE 3N8DA 1TM3E 4M88A 4RAOA 4DJJA 2EZ9A 3ZVNA 4A5OA 4KFCA 2PS0A 4YCBA 1WUYA 2N9UA 1H6KA 3G2HA 1X8LA 3APCA 4B45A 1A04A 2C3UA 4YI3A 3A3PA 4JB2A 1IJFA 2FMHA 3TXXA 3AUSA 3VOSA 3PGXA 1YDEA 5KTKA 1U3VA 3C3YA 2QP4A 3SBDA 4Q7QA 3MCVA 1TB4A 4E2XA 2WM2A 2JFUA 4LBVA 3N05A 2F2TA 3KDSE 4CM1A 1TKRA 1BFKA 1Y8QB 5FPHA 1W6UA 3PUHA 5ALLA 5B1IA 3PX2A 2QTWB 3BREA 2ZJOA 3B6IA 1Q2XA 2CFIA 2SICE 3W04A 4RTRA 2ZBQA 5K4HA 3HB1A 3KSRA 4B47A 3NS7A 1F9EA 2E1RA 3DJFA 1TFRA 5BYBA 1VKHA 1QANA 2G4VA 2RSFA 1ONSA 4BJ1A 1MAHA 3NHSA 2AZDA 3UT7A 2P9FA 1ID1A 4MUXA 1D7AA 2CLCX 4P3PA 3ZHSA 3KPVA 4A1GA 5FD8A 4X92A 4NDAA 1VJDA 3WXBA 4KZPA 3ZH2A 3P26A 2AG8A 4BX0A 3LF1A 5ALEA 1DPGA 3G59A 1FJ2A 4ZI3A 1D3AA 5JOQA 4E2FA 2OQRA 3PNQA 3ADKA 3DZJA 3CPEA 2ZR9A 3LDZA 1QLHA 4Q47A 4LSZA 3HXDA 1URPA 2BMWA 4REMA 4P6VF 3M5DA 1W73A 4KIWA 1FFGA 3O6VA 2BM0A 3CINA 2BR3A 4OH7A 4AL4A 2JFHA 1OLSB 5A6SA 3AJ8A 1ZR2A 4H7EA 3NHLA 4O0MA 2VJPA 4J8FA 2PX3A 2PR2A 4CGVA 4EEZA 2IU1A 1QGAA 2P58C 3BEEA 4OB8A 4EENA 2C5BA 2CN1A 1QK3A 2CG3A 4RXTA 4DSZA 3EJWA 2QD2A 4HZGA 4RPLA 2VH2A 2R6FA 2ARKA 3KSZO 1S0UA 1T43A 1U2ZA 1FA9A 4JU9A 4YMUA 3IDQA 4JYPA 3ELDA 1GAQA 4CFZA 4A0RA 1FQWA 4YALA 2PEZA 3E81A 2VHTA 4UJ5A 4JC4A 2AR7A 1FLVA 4AUNA 1W88A 2VTBB 5IM4F 3DQPA 2AQIA 6PFKA 3E8MA 2XCLA 3KKEA 4EH1A 1WEHA 2GPSA 1XLUA 2O8CA 2Z2IA 4L9SA 2B92A 4UVEA 4JLJA 4QGGA 1FX0A 4YO7A 2QTGA 2RE8A 3GT7A 3HYCA 5TQ0B 4G0UA 2V3VA 4UHEA 5JH7B 4JOSA 4C20A 2JBWA 4M1WA 2GKSA 2DPYA 4LF5B 1Z75A 4QD3A 3STYA 5F23A 1J5XA 4OHPA 2Y4TA 3QF4A 2IPNA 4HADA 2EG9A 3EXHB 2VDKB 1E1MA 1ZINA 3KZ1E 4D9BA 1LRLA 3WLTA 2Y1DA 4M6WB 4L9AA 4YJHA 4TXHA 4O2BF 2Q3JA 5EJIA 4Z4HA 1Z2CA 1E32A 4HLEA 2IFTA 4N5DA 2VHJA 3OWXA 4Z86A 5D6NA 5ALPA 3OJEA 1Z6TA 2N0SA 4MKZA 1ZUNA 1VE7A 3SBOA 4ZVPA 4RZ2A 3FNQA 5BSWA 2LAIA 3MF4A 3ESRA 4AF7A 3O8BA 4DI4A 3D4LA 2Y76A 4FB5A 1JFVA 1YRLA 4AJIA 3WGMA 3HO1A 1JXMA 1C2YA 1DJLA 2ZYDA 3LUBA 2JFOA 1M7HA 4RXUA 5TQ2A 2ZSDA 4X64B 2DYKA 3QRWA 3OSZA 4U2FA 2I9CA 2HBRA 4L5YA 2WMNA 3EZ6A 1SCKA 1UEJA 2CFTA 1RFLA 4OKNA 2X6IA 4OQXA 1LK7A 1CUSA 1ONOA 4URHA 4DE5A 2JGJA 1L4UA 1J0BA 5E38A 2Z8ZA 2WYUA 2ZT7A 4OQMA 5HKLA 1JPUA 3ELBA 3VSDA 1KMNA 2J5XA 5K01A 1OIXA 1Y8CA 4XWWA 2GN4A 4YCJA 3PJEA 3FGOA 2ZU0C 3HUFA 2OM2A 3QDNA 3LW7A 1UBLS 3R7AA 4CT0A 4R69A 1OJLA 3U7GA 1MIHA 3EHRA 3L5OA 1VFPA 4BRUA 3ZGQA 2H2IA 4MROA 4RS3A 3T9AA 2HUPA 2PPLA 1P6QA 4XWYA 2LSUA 4A0HA 5H5JA 3RDPA 3CEPB 5JPCA 5GONF 2B30A 2JGKA 4G26A 1T13A 4WECA 3V9PA 5BSHA 3IP5A 1IZ8A 2Z3VA 1VPDA 1V8PA 1BE6A 3AG5A 3AYZB 1ODJA 1TW2A 4F1JA 4F1PA 2QF7A 1W19A 3B7TA 4B2PA 3FYDA 4R0NA 1YCGA 1XMXA 3IIJA 5SZJA 4ABYA 4EI9A 4PSVA 5C1BA 2NOAA 4NWIA 3CIFA 4Q0MA 3EGIA 3UMRA 4H7IA 3BMXA 2X6RA 3ZHEB 2G70A 2G7ZA 1Q83A 1Z7WA 4J0FA 3ZXUB 2VNKA 5DN6D 5JYBA 1UC8A 4DR5B 1XWIA 3SKXA 4RG6A 1JXQA 2ZJ6A 3G79A 1U5BB 4CMCA 4YRMA 1TZJA 3B7WA 5A7DB 4DUZB 3QVWA 3TGOA 1R9MA 1O95C 2D7DA 5C5CA 2J85A 5DRYA 2ZS9A 4PPQA 4MARA 2BI4A 3NB2A 3HFRA 4O2RA 2ZU6A 2A1UB 3DVLA 3L2OB 3TRKA 1N6LA 3ONWA 2D62A 3KJNA 4RKRA 3U4QA 5F3DA 2X0DA 3T9BA 1XTKA 1ZCBA 4F6CA 2BMFA 3IPRA 2UYHA 3EZ9A 2B7CA 4B8CB 3FUXA 3KKOA 5CNKA 4DQLA 1TCBA 5JASA 4WNEA 5SZIA 4L7QA 1ND5A 4P54A 4PV7A 3ONLA 1G0OA 3EDYA 121PA 1YNSA 3ITDA 4F21A 4PAMA 2Z43A 2GFIA 4U0UA 4ENUA 5JYCA 2R1UA 2ZANA 4PHFA 3GZSA 1WZCA 2X5NA 1U4SA 2DFTA 3S5JA 3OUTA 4KREA 5AICA 1EVIA 3RVRA 4ARBA 2XE8A 3RTDA 3WFIA 1NW3A 1L0BA 1V4BA 3NZEA 5FWNA 3FU5A 1RE0A 4U5QA 3WIBA 2QL6A 1DRWA 4I46A 5JHHB 3Q5DA 3OKAA 1GTJ1 5JCJA 5CGZA 5BORA 3RVMA 4TRJA 1M6YA 5GY7A 4ZEXA 1TTQB 4BEPA 4F5ZA 1XSEA 2Q5IA 5FPPA 3DFUA 5HQ8A 4QNMA 5DF1A 4UEKA 3C24A 3FMGA 2C7RA 2RKKA 2ZVPX 5FOUA 1JHDA 2X4LA 4MS6A 2QXTA 4TMFA 2FFHA 2RFAA 1FYXA 1KPSB 2NQ8A 2FRVA 2O48X 3L7YA 3AEUB 2GERA 2EJUA 4ZYUA 3COPA 4ILGA 1B6TA 1JBQA 3KHUA 4XX0B 1AOXA 2EGGA 4CIYA 3TR5A 4PINA 3RKSA 5FEMA 4OYLA 5M3BA 4GX2A 2VCHA 3IMCA 2FMTA 3EHNA 1IAQA 1LPAB 4B31A 2XYHA 4ISCA 3KQSA 1XNRB 4X7MA 4GDFA 5CDUA 4PWZA 4HJXA 4KGVA 4O4IF 1JFRA 2V5UA 1QU2A 4JT8A 3V97A 2V4ZA 2CCKA 3GUYA 3PNSA 2WE7A 3LECA 4QOSA 3SJAA 3A4NA 4DHEA 4XX5A 2V7EA 3ZPXA 4KO1S 2V8OA 1F20A 3RAUA 4NFHA 2UVQA 1JU9A 3LBYA 2DUUA 4UNRA 4KT6B 3ZZ1A 1OZ0A 2BUAA 4GPKA 1Q21A 4D9KA 3LX5A 5AO9A 2E49A 5BPFA 4AY5A 3V7FA 3KYDB 1L4HA 4M0EA 4XGRA 1KMQA 3ZD6A 5ALRA 3DMNA 1C0LA 4YRGA 2ZVJA 4QOHA 1UOEA 4UC0A 3ZJTA 4KYVA 1OGIA 2ZJ3A 4FBLA 1UM9B 1O77A 1Q19A 3GDGA 3PXUA 421PA 1V16B 1IB0A 4GI2A 4AJLA 3VR4D 3W6UA 2GRRB 2HA0A 1KBZA 3RC9A 4MWOA 5DBHX 1H0SA 1F2UB 1G1MA 3VSCA 1MGPA 3MYRA 4GBGA 5C8YA 2D5CA 2H7CA 3MA5A 3L0DA 1YJAA 4GM1A 1ZVMA 4WOJA 3ML1A 1VG1A 4EFKA 4I8IA 5D01A 3B1FA 3VR5H 2F8MA 3RK1A 1UJ5A 2QSJA 3PIRA 1WAMA 4PG7A 1USVA 4JVNA 2O8EB 3C48A 3KSBC 3D2BA 2FWRA 4Q12A 1YS1X 4P7BA 3GEDA 5JJCA 3RYFB 1VGVA 2YJ6A 5DOVA 3QA9A 1K0FA 4MGHA 5FI0B 4EHMA 2PZGA 3K1YA 2HNAA 5JE8A 1AUXA 1TA0A 4NBVA 5HIIA 4MVJH 3O8OB 4O2LA 1GLNA 5KQMA 2OTCA 1RWWA 4LJ4A 2VK1A 4MJLA 3B6ZA 4TTQA 1NZJA 2Z8YM 4MRRA 4ZOLB 3QY9A 4L8FA 1X8XA 2MWMA 1FIUA 2EJVA 4JQYA 1MA0A 4TYMA 4O1OA 4C4RA 3KOWA 4JNKA 3R74A 5IAOA 2FR8C 3TSCA 3OT1A 1Y1PA 1MIOA 4GIBA 2CL5A 1P9NA 5C37A 3NTUA 4FZVA 2CLEB 2XXAB 3T3GA 2OEVA 4TWZA 2COKA 2JZNA 1GAXA 5A4JA 4RGVA 4QLBA 5JWRA 1JCRA 3SZGA 1UCFA 2WHEA 3ZYLA 1UPXA 1YRHA 2JBAB 1I3NA 821PA 5IKMA 5LA6F 3WIVA 1GHTA 5AXCA 3G68A 1LTHR 2H5LA 4QXOA 1I1QB 5GVRA 1IM2A 3AHFA 1IHUA 3L82A 4KHPB 1O4VA 5C7YA 2FY8A 1VHJA 4IICA 3L6RA 2IY8A 1SHLA 4AP5A 4HLUA 1SEPA 2B8NA 4GU5A 1DFIA 1OFUA 3IPXA 3KZNA 4E1BA 4HDNA 4EFMA 2JFFA 2WPDD 4TXNA 4XVHA 4ZQGA 4GTQA 2D2EA 3MK31 5EE9A 1DO0A 2XJ9A 3QELA 4IIYA 2DZOA 3CEQA 3KX2A 2OCXA 1GRNA 4K9QA 3VU9B 4MW1A 3S8EA 4XUCA 2ETCA 1PJCA 4N2SA 2GHTA 5A9RA 4PQYA 3ZV6A 4JI7B 1UM8A 1MB0A 5AT1A 4MA4A 2UXBB 2ZZNA 3QFHA 5CLGA 4M98A 1JQBA 3V2OA 2POCA 2PGOA 4G0PA 1ECFA 3AIMA 5CLHA 4NESA 4AYTA 3ZJYA 4XGKA 2VHZA 1E9VA 4Y1GA 3CLTD 1H19A 2G5GX 3OPXA 4C4AA 3AR2A 4X62B 3J80A 1U04A 1IL0A 3IE0A 2XUOA 1DNPA 1ZIDA 1IBLB 4EJ0A 4I3HA 3GNLA 2C83A 4QASA 1YD7A 2R5FA 2LXMA 3KWJA 2VAXA 3D8SA 4CUZA 3D3WB 4O1PA 2DTXA 4WTOA 3N5KA 3L7MA 1IVYA 1K7YA 2WJAA 3ABRB 2V8BA 3IHTA 1K27A 5JCPA 4BMPB 2RAVA 1VOTA 4ENPA 3HEAA 2R25B 4TUUA 2VH5R 3Q3JB 4BQQA 4ASUA 4RFVA 4LOHA 2LR0A 1QVVA 3WZMA 5I4CA 1D0SA 1I1NA 4OU4A 4V0SA 3H17A 4XLLA 4OHRA 5F51A 4H3VA 4JI6B 1O6BA 1FFBA 2HQBA 4WY2A 1UKYA 2H8GA 2OWEA 3MFYA 1X42A 1ESMA 3NV7A 1SVUA 1UPTA 4H17A 3GLIB 4DLKA 3AJDA 4AKTA 1FY2A 3W06A 3UENA 3ZDQA 4UYJB 2AGVA 3OF5A 3DT6A 1MGOA 1N6OA 4PRYA 4OQQA 3EY4A 1GA6A 3TGLA 1CFZA 4DANA 3WYBA 4WLUA 5E7MA 3FETA 1KQOA 1MJ5A 1SUPA 3AUKA 3D0OA 4YECA 3HC7A 2EARA 3MS7A 3CPHA 2A14A 4O5AA 4PE5B 3IJPA 4TT3D 1Z4KA 1T8PA 1DAOA 3WL7A 1KETA 2OCDA 2NMVA 1P4AA 2ZJYA 2J0QA 3NC4A 2ZXUA 5HIAA 1QHGA 2H0AA 1BVHA 2R4UA 4IIXA 3M5PA 3ZCQA 4MGYR 1Y6IA 2H0QA 5BPHA 3D1LA 3PUVA 3LPDA 2J67A 2EXXA 1QVRA 1KS9A 3L18A 3H9EO 4BLRA 3U9SA 2JVJA 3K2BA 3DZBA 4YP0A 2V6GA 3TEJA 4PX2A 3OJFA 3R9KA 4YONB 4E13A 1FUEA 2GTPA 1WF3A 1PGJA 1VIDA 1UJMA 4TTIA 1X1EA 4KMRA 2E4UA 1AHHA 4O2BB 2ZSEA 3FYCA 3IBSA 1SU7A 1L5HB 5LYJF 2YWXA 3ZNQA 1JLLB 1NAHA 4ENQA 5LJIA 3TOSA 2GQ0A 1N9ZA 1XNHA 1GADO 1CY2A 4K9KA 4I5DA 3TW8A 2FQ1A 3WQBA 2XD9A 5BSEA 4I4TA 3S7TA 5AYWD 2JK1A 4D97A 1RYMA 4P32A 1XRSB 2LIVA 1FPPA 4L75A 1BDHA 2CNOA 5BQPA 3QEAZ 2FRDC 4ATZD 5DTMA 3R7DA 2HK9A 2OM6A 4N8EA 1FTNA 4MGEA 1E7SA 3CK7A 2EFGA 4GPTA 3ULKA 4NYJQ 2P9GA 5KNLA 4N48A 3A9WA 3W2FA 3HWX1 2PZJA 3V8BA 1ZS9A 5H59A 5I45A 3F6CA 4JJ7A 3T1HB 2XUKA 1VB5A 1CUAA 2JA2A 3I5MA 3P5SA 1AHNA 1ORIA 1N5JA 3CUWA 5EN4A 3FPCA 4FU0A 4D8YA 2L0XA 1L8OA 3OU2A 2XGGA 4RYDA 3EGWA 3E7DA 1CRLA 2R7LA 3VH1A 2TSYB 5L4LA 4IFIA 4NSNA 3MCTA 4X1IB 1RPTA 1EGAA 2AC2A 3KZXA 3FOCA 5FFNA 2O2EA 4DV6B 5CLJA 2Y3AA 1HNXB 4K6KA 1L7EA 2MYUA 1AQJA 1CG6A 2Y6VA 4R81A 1F4LA 1U6JA 3L49A 4E5MA 3FU6A 2XDWA 4RETA 3PUJA 5EJ9A 3IQXA 3F49S 3CVXA 1TRHA 1RKQA 3W6NA 5I9SA 4DRZA 3RNLA 4GW3A 1A69A 2CXNA 1VHDA 3I5PA 1NL3A 4RCYA 5GONB 1IQRA 1VXRA 5CVCA 4E6HA 1XDBA 4Q3LA 2VDJA 4Q3CA 2FQQA 3I0NA 3ZV7A 4YNDA 2WYIA 5FT9A 2O54A 1PJ2A 4DM7A 1P1HA 4XGIA 3UGJA 4LQ4A 3OLCX 4TGLA 2B4QA 5ES4B 3QKTA 2XHZA 3BXGA 3EZFA 3MV2B 5IU6A 4R8RA 4RE5A 1XL1A 1XE3A 1XZCA 5L7YA 1GD1O 1Y3HA 4N1AA 2VQEB 2XUHA 2JLVA 2QL9A 3OTNA 1NT2A 4EY7A 1W48A 1ZQ1A 2X8AA 4G84A 2NXCA 3R23A 4P31A 4ND8A 2I2FA 2CJFA 3P71T 3PZ1A 3WNQA 3AHJA 3CTMA 1TGVA 4PCVA 1YMVA 1JEAA 4LVNA 1ZN2A 5DGDA 3RROA 3O9ZA 1U8TA 2GD6A 3MWJA 2BF0X 2A0FA 3C3PA 4K6MA 4FFBB 2RGYA 3UBMA 2Q1UA 4XCVA 1KC3A 5LBUA 1E7QA 7REQB 2F64A 4CL3A 2WHQA 2G9RA 2KM4A 2PWYA 2W6PA 2JI8A 4LC9A 4Y2QA 4KPEC 5KC8A 4KFUA 3CNEA 4PUCA 4JC8A 2R4QA 1XKLA 3DSUA 5ALFA 2X15A 2DETA 2LO6A 3CXUA 2ASEA 1Z06A 3ACDA 1N3BA 2FMKA 2V5VA 1E99A 4S1WA 4CMJA 3UAGA 3T8KA 4X6YA 3KEQA 3FSRA 2FI1A 1PF7E 1C7FA 1EP3B 3QWWA 3ISTA 3SXUB 4UVDA 1NJ1A 5AHWA 3TGWA 3PYLA 2DSTA 3P9RA 1GLGA 4RFSB 3LCJA 1LDMA 1QG4A 1ZOLA 3PNVA 1G66A 4YRPA 1PY1A 2FZGA 4HL6A 3ZW7A 3LT1A 4H6XA 1RAEA 4DM4A 2XOXA 4YMGA 5E6UA 1J8YF 4MQ6A 3UKDA 1HYBA 4PBRA 4XLTA 3PEVB 3E22A 4IKOA 2HO1A 1PHPA 3QFFA 3WSTA 2C5GA 4LBWA 5KX5F 1NKVA 5MN4A 2VHCA 3APDA 4Y7CA 5FI3A 3WGNA 4Y6CA 4D74A 5HW0A 4EQ6B 5EGSA 1OBFO 3PUZA 3PT5A 2EHJA 3PNKA 4U9IS 4OREX 4RF5A 1MW8X 1ZWKA 2WIFA 1KRXA 3GEGA 3DDOA 4MYTA 3WGQA 3DSWA 1NP3A 4C48B 5ABPA 2DBZA 3TXYA 1RZUA 2YS6A 2DQSA 1S8AA 2WQ7A 5I8PA 1EWRA 4ZJZA 1R5NA 4NMXB 4KAAA 2QGFA 4QRIA 2EKLA 4JSYA 1ZEMA 4DLAA 2G9VA 3F6QA 4FI3C 3NM5A 4RK6A 2BGIA 1DB3A 2WD9A 5DLYA 3KALA 1DIAA 1CR4A 1KZ9A 4N7BA 1XU4A 1ULAA 1YQXA 4O4IB 5EZSA 3HY4A 4WGFA 2PX2A 2VJMA 5DM4A 4BPBA 3U31A 3OQHA 4K26A 3C3QA 3BKXA 4X8OA 3FOAA 4KE7A 3CE9A 4HB2A 4B8ZA 1Z8FA 4PDXA 3PSHA 2IYQA 2BGWA 4KV7A 3PE3A 4DEXA 1G8HA 3VCXA 1JJ7A 2FO7A 4C0XA 1NONA 4G63A 1D03A 3GEIA 1IJKA 2V9CA 1OX4B 4DCMA 3P9YA 2GM3A 4MVXA 4P4SA 2NTEA 2G76A 1FP4A 1U1GA 2XZTA 4Y0NA 5GWXA 5JAQA 1JIUA 2ADFA 2IHNA 3Q11A 3ZHOA 4N41A 1RLOA 1SCQA 4JLUA 1ZMTA 1O87A 2NYJA 1QZ2A 2IOYA 2XZOA 3DOUA 5G0VA 3H6KA 3BBPA 2JD2A 5T57A 3ZDBA 1T25A 1JWAB 3V3TA 3OF2A 4CIXA 1MO6A 3WLFA 2OG1A 2MSNA 1HLFA 2PNJA 3TINA 1TAUA 4JI1B 1VSQA 1L7XA 3PH0C 3OO1A 5AJTA 4DF3A 5JJKA 2X2EA 3AU9A 3EZ7A 4JXTA 4P29A 4BX3A 4YIHA 5HJ5A 2O52A 2WU1A 2W43A 1W46A 4BRZA 2GXUA 2NSYA 4J75A 2J5KA 3GJTA 3OIUA 4D9GA 4DCOA 1ZD8A 1KZOA 4K28A 2OD2A 3JQ8A 4G8JA 3GJ3A 1HH8A 3FFWA 3THYB 6REQA 1DCEA 1CDDA 4JUFA 4FDUA 1H93A 1QIFA 4ZO8A 1EZ4A 4CL0A 4OQYA 3QEKA 1GQRA 3VRHA 1V3QE 4UHHA 4C0LA 4DX6D 2W6JA 2NU8A 5CFNA 1N2CB 4E4YA 1W30A 1W2HA 5GP1A 4K87A 3PPIA 2XR1A 1YFJA 3Q0EA 1NBEA 4WERA 3VV3A 1VHWA 3ZCPA 3EVBA 1LTXA 1RQ2A 3X0DA 1IK4A 1OC2A 4LCBA 2P9UG 1RWOA 3E5RA 1XVIA 1IZ0A 1N94A 5FBQB 4LRYA 1JUQA 3ZGYA 1G291 1KDVA 1MC4A 1ZU2A 5HGJA 3OOHA 1GG5A 2CFCA 4AV7A 3SP1A 3NHWA 2JKYA 2X4DA 3NDRA 4UQXA 1H2YA 4LJ6A 1VBFA 2F9FA 4D99A 3OTIA 4CEJB 3GQBA 4PQGA 5LA6B 3DW1X 3UM3A 4BL5A 3V3KA 1Q0TA 3HR7A 2CBXA 2Q2WA 2VT2A 3EXIA 4IZ6A 3S3TA 4NDZA 1T6NA 4MQEA 1LBEA 2OZLA 3ADPA 1UEIA 4IM7A 4WBNA 2L2QA 4MUMA 3CV0A 4MQFA 2WVAA 3HRKA 1CUVA 3MQ2A 3KR9A 3QXHA 3CHPA 1GUFA 2Z6UA 2G4CA 2QJFA 1EDZA 4UUQA 5IDQA 5JSQA 2YICA 2Q3EA 3MIIA 1Y1LA 1MW9X 2BRUA 5LDDC 1E4EB 1J1UA 1G38A 5AUPB 3KHTA 3H1GA 2DWQA 4MI9A 3HVHA 1MRNA 5LQUA 1MRZA 4NHOA 3TMYA 4XJTA 3WQQA 1YZNA 2DVMA 2QJRA 1EWTA 2D0PB 1DAGA 2QDKA 3RBZA 1JHUA 1S2GA 3S8MA 1DHTA 1F06A 1DT3A 2NZ2A 3WS7A 1KH1A 4ZCSA 1YZYA 1K6IA 3EU9A 1KAOA 1YQ9A 3EMDA 1LF0A 1XZFA 3B13A 3IV0A 3R8CA 2RK6A 2A1IA 5M72A 2YWBA 3SU8A 2Z5LA 4GMKA 3RIMA 2EBUA 3G0GA 3WWYA 1RM4A 2PLRA 2C0LA 3SLKA 3MM4A 4R3NA 1N0RA 4D8VA 5AK6A 2Q9CA 3AVUA 3PRYA 1UWCA 2G04A 4KLAA 1FE8A 4IIGA 2DKFA 2R85A 2IY7A 1SQ5A 5DXAA 1VLJA 5JFOA 4YCSA 3C1UA 3LLUA 3WKCA 3LDFA 4LHYA 4MUKA 1WVMA 2ET6A 3LUJA 2IFUA 3V1KA 3IMGA 1Q3KA 4M53A 3UPTA 5HCIA 2NWQA 4AI6A 4FS3A 3U3RA 4LMAA 3LPMA 2E2WA 3NGLA 1GP2A 2P9HA 2AUNA 2QTCA 3IP8A 4J1TA 1SVMA 3AUUA 4BWRA 2DBYA 1SZPA 3TQFA 3HIZA 2IOLA 4JKYA 4V1CI 2VLBA 4YGXB 5CCXA 5E2IA 1N0QA 3ZJ4A 1E5DA 1OLXA 1YAHA 2HPZA 1VMIA 1G20B 1X8KA 5LXTF 1Y7TA 1NC3A 4NDNE 3LKDA 1G8MA 2UUCB 3QX8A 4H35A 1QXSA 1DUIA 4HNRA 3QOWA 3ZV4A 3H5OA 3PXCX 1N5KA 5CFZA 2I6TA 5CBNA 2PMDA 4NJOA 1FTWA 3C6ZA 3DZ8A 3SSNA 4UPVA 1KJ9A 1E8YA 3KT6A 3B7UX 2ODTX 5JMTA 2AMVA 2P8SA 5AESA 3HA3A 3FTCA 2EIJE 3FMVA 3IRUA 4FHGA 5TF0A 4Z9YA 1WW3A 4J43A 5T41A 2CJWB 3WLQA 2G0AA 4LY6A 2XAAA 2KQUA 2ISSD 1OD6A 3T3OA 2O2HA 3RUIA 3H9GA 1U3FA 4E6EA 1U65A 1EWVA 2YDYA 1UWLA 3IB3A 5LYJB 1KXZA 3Q9LA 3LUFA 1Z07A 2IX3A 1FJXA 1CEXA 1O7JA 4B4VA 3DP9A 3P9CA 3EIUA 2W6ZA 3R0JA 1P18A 2GLTA 3TQOA 4ZI7A 4UOZA 3K7EA 1SZDA 4QICA 3SHWA 2R6CA 1SCUB 4PCLA 3OT4A 2WYWA 6CHYA 1AKNA 2IF2A 1J5PA 5H4HA 4LFAB 3ZOZA 1DEOA 4G1MB 3ZVKA 3B48A 3ZW3A 1HFWA 5F2KA 3B82A 4FKMA 2AG5A 3QGMA 1MJ0A 5IYZA 2WWXA 3HRHA 2CHVA 5JNLA 4G24A 3N7TA 3GLIE 2H1WA 1VBKA 3K8ZA 3NAGA 4HO1X 5A9TA 1W0JA 2JANA 4JCCA 1JQDA 4RORA 4LCTA 3C3RA 2IWRA 3HLYA 3KOZA 2FRDA 5I7SA 3SZ7A 4UCWA 1JLSA 2OFPA 1WM1A 3UUEA 3T1NA 3KSMA 2VH1A 2R6ZA 4CCYA 4MUYA 3I4RB 4ARZB 2DFPA 4BFTA 4RJTA 5LOZA 4HC4A 4J8YA 3UQYS 1EGHA 5EQDA 1O1TA 1IN8A 1JU3A 4RVBA 2GEVA 1ZPDA 3VOAA 4IJWA 1NY6A 4UCQA 3TIGA 3TMKA 1Q16A 2H1LA 5HFJA 1RWMA 3NDPA 1GGKA 4ETIA 3HXTA 3RRBA 4M0MA 4C22A 1ZOSA 1RKBA 4ZVSA 3RR2A 5KC9A 3IB6A 3ENKA 3SY2A 5EHNA 1EWYA 2YN0A 4A2PA 3GA0A 3BJZA 4ZGBA 1RLUA 4BB9A 4II2A 3CSUA 1N9GA 3KOOA 2GB4A 3TWUA 3N7UA 2WF5A 3N0XA 2IUTA 2QV7A 9ATCA 2EX4A 3EDQA 3ED1A 3RVNA 3HBMA 5DHTA 2VYCA 5CVEA 1PTKA 3LZ6A 2SKCA 2QT0A 2ZJBA 4HTFA 3U0VA 1KJQA 4YDSA 3QSYA 4Y7DA 3U0BA 3GCZA 1CWUA 4YQYA 1U31A 3ILVA 1VHLA 3BWXA 3M6MD 1P8JA 3S2EA 1GL7A 3PJDA 2G8NA 3T5XA 4OX9Y 3IHKA 3LDAA 5GJCA 1KQPA 4HLUC 3HZHA 3QWFA 3HLTA 1PAUA 1NQXA 5G1NA 4EL5A 3T0GA 3KV1A 1O0BA 3E34A 4B73A 4CLHA 1UL1X 4MHTA 5DE3A 4Z0HO 1K2VN 2A6PA 4MB2A 1L3BA 1VC2A 2FHPA 1EFAA 4DCUA 2NNWB 3ZGXA 3BCUA 2XA2A 2PG3A 4DZRA 2B20A 4FILA 3D6UA 4BVGA 4K9OA 1FXWA 3DKRA 1H1LA 2VPXA 2XNSA 3RIGA 1I6KA 1WULS 3NR2A 3IP3A 3G9XA 3B1KA 2H31A 3EA5A 2H0RA 3OXGA 2C99A 2A5UA 3GPDG 3FMPB 1S2NA 1N78A 4W8OA 2IOHA 2IEIA 3A7DA 3VDMA 1YNOA 3FUUA 3LD9A 3O4IA 2ZVDA 4IJUA 3PTAA 1I3LA 5CHEE 1M2HA 5DRTA 4E2WA 2ZBDA 1RHJA 2PMBA 1JZSA 5K0BA 2NZXA 4HQLA 4FCWA 2ONCA 1UDBA 3S2SA 4HAOA 1P1CA 4TKMA 4GC5A 3CLSC 3FH5A 4TV9F 5E3JA 2ZYGA 4CXMA 3V80A 1LK5A 3IPCA 1Q7CA 5DGTA 2O2XA 5EYPA 5K4GA 1U3TA 1G2OA 4JL5A 1RC1A 4ZVRA 2XV1A 3DTYA 4DIFA 5IK2D 1M2JA 4G1FA 1BAPA 2OL4A 2W2PA 5KX5B 1XOIA 3ZWCA 1DL5A 2F55A 3NASA 1UAYA 4IG9A 5CM8B 1TYCA 2ESRA 2VUHB 5F4ZA 1AU9A 3MC1A 3JD0A 3RRYA 4MGZR 3TSYA 1XZQA 2CB9A 4S04A 1YZGA 5IKOA 3V30A 1TADA 3DMHA 3MBKA 5A06A 2EZUA 4ID3A 1VJ0A 3OY7A 3WGHA 1P4RA 4MI1A 4P0QB 2J0SA 5BUZA 3NHUA 5CT4A 1SO8A 4PLGA 4HVCA 3KWLA 1K1AA 1JZTA 1A3CA 3L0YA 4BNJA 1DAKA 2R84A 2N1BA 4BGDA 4FTWA 3HUEA 4IH1A 4QXPA 3EK2A 4K6CA 4KVMA 4EHIA 1V41E 3E9CA 4EATA 2JZCA 3K9IA 4BXOA 4DCPA 3ANNA 1T1JA 4L4YA 3T7KA 5J5AA 3ONNA 3TRJA 3OSUA 3GEMA 2LDXA 1Z0UA 3OTWA 1RYFA 3Q3EA 2XGOA 2ZUUA 4I8DA 4S35A 4HNTA 5A4FS 4QU8A 7GPBA 1CQJA 2AOVA 3RFUA 1LVHA 1MZVA 1W4ZA 1XJ5A 4L6IA 4BZPA 1AE1A 1LBHA 4ZPXA 1X7XA 1P2GA 1JNXX 2LNDA 2CNNA 3WNBA 5LU9A 1YR3A 4DSUA 3K2EA 4NJEB 3V79K 2CWWA 3HMKA 3L92A 1IEQA 5KOJB 4C78A 4CIVA 1V8FA 2R4TA 3ER6A 3S27A 4C0WA 3VDRA 5CVVA 3GMTA 3O3OB 1EM6A 4X97A 3CSSA 4D0LB 5ITVA 3A6DA 1ESCA 3I05A 1U2DA 2TMGA 3R8XA 1VCMA 1SVOA 3EVTA 3UMSA 3KVVA 3VYWA 3SS8A 1SIOA 1IPFA 1Y8RB 2IP1A 1RQPA 2TRSB 5COQA 1IUNA 2PKWA 2QNIA 3AJRA 1ADBA 1UPCA 5CDGA 4A0GA 4FQ5A 3DAYA 4DFDA 3V34A 1IRIA 4QLAA 4W5JA 4YP1A 1VLMA 3VU3A 3VHXB 2HA4A 1Z4IA 3G8AA 4C7BA 1WEKA 2QGNA 4J07A 5E7QA 2I1KA 1R3DA 4F6RB 1SEVA 2P68A 4AECA 3R2JA 2ZRCA 2JFQA 2P30A 2NUTA 3BWYA 2I91A 3VNBA 4AC9A 2C2XA 5L6LB 2ZTVA 3UG7A 2FWIA 3PD1A 1E1RD 3FVTA 2XZLA 2QM8A 4P3YA 1UBGA 3BA1A 2ORVA 4A6XA 1M6HA 3YASA 3FPKA 3GG9A 2VKTA 4QQFA 4L5CA 3FTWA 5K0EA 2EV9A 5HQ3A 4PSCA 1DG9A 3O3NB 3GJ7A 4A7PA 3QE4A 2IDMA 2UVPB 2VK4A 4A1SA 3HKEA 5AKHA 4K8RB 4TM8A 4AT1A 2MJLA 4TKZA 1TO1E 3CEAA 4ESHA 2JJQA 3TH5A 3O93A 1BE8A 3IAM1 1MB2A 1YJQA 5B3SE 2ROQA 4LZWA 3PFCA 1SA4A 3GGCA 4TT8A 1I24A 5D3MA 2BKGA 4AIRA 3UJ9A 5EYLA 5HQTA 2RHCA 2J6BA 2P4HX 2OFWA 2F6RA 3WBKA 1XZEA 1KY5A 5DN6A 1R2QA 4REQA 2R2LA 4B76A 3G7UA 1OU4A 5TC4A 2VJYA 5HS6A 4BO3A 3V4PB 4G2VA 2V55B 3IQEA 1UBNA 3NDBB 4L6CA 1CETA 3UKJA 3QVGA 2Z9CA 1R0WA 4JMLA 4K6OA 3M9XA 4HVAA 2NXPA 4CT4B 1ZXBA 4P3NA 4YRKA 1VIAA 4EABA 4CDMA 3VYUB 3BAFA 2XCOA 2PN1A 3PNOA 2Z30A 4F06A 4J29A 2I76A 2UYQA 3TWTA 4WFKA 3H16A 2B69A 1RXYA 4F04A 4RTPA 5CB0A 3AHEA 3F4KA 1Y7PA 4UAJA 5FBZA 3C3AA 1ZJ4A 3V48A 4GXTA 4DPKA 2PSDA 3T7DA 1XXHA 2HV9A 1N2CE 3A0RB 1LSJA 4L3VA 5BSMA 2H2AA 4C4YA 1P9OA 3S4YA 3FGZA 1EIWA 4I1MA 1E3JA 5E95A 2W70A 5HBRA 2JFPA 4B82A 2CVQA 4NU8X 1YC5A 3ILXA 3EIWA 5D3KA 4UPDA 1TW3A 3JALB 4Z4IA 3PVSA 3SNKA 1JFFA 2B2CA 3RS4A 1MG0A 4C0JA 1Q1BA 4JI0B 3BGWA 4FK8A 3ZY2A 4GZMA 4EHDA 1P45A 3QVJA 1E7VA 1SHJA 3L6EA 4IDCA 2V7UA 3VPAA 4UU1A 4HOSA 2ZPAA 3A6KA 1EJ0A 1PL8A 2IZ1A 4EO4A 4U2DA 1NVKA 2RGNA 3LHKA 3T7TA 4QYTA 2WSLA 1J2EA 2WSBA 4UEJA 2Q1TA 1U7HA 5BOSB 1KFJB 3CLVA 3HDHA 1XTZA 2GILA 5BVGA 2IXFA 3WZ2A 1EXNA 4WOKA 5LZ8A 4J8PA 3CW9A 2XF2A 3C5EA 1QHFA 4AUEA 2QUAA 2OOSA 2QM3A 3U7IA 4A23A 4KMOA 3S1AA 3L04A 1KEWA 2HT6A 4BTBA 3LUKA 5F21A 1QZTA 4CMAA 5ALOA 3RVSA 3E0QA 2Q6IA 1DHRA 3W2EA 5LXTB 2VK2A 5DZSA 2WICA 1UK7A 4BYGA 3SYMA 4RJLA 3WGTA 2PX0A 3TLAA 3NQPA 2B1RA 1NLFA 5FJJA 1L4NA 1M5UA 2WF6A 1BXRB 1P17A 4YP5A 1TNBA 5HRCA 4R8KA 3MLEA 3EQ9A 4PSKA 4P38A 5K99A 3SEFA 3FW1A 2E7ZA 1R88A 3DBLB 5E76A 2G9ZA 1EK2A 3PUKA 1UH5A 4JVSB 4FIZA 1I5RA 2F4VB 2JJYA 3ZZNA 2GYUA 3T38A 4YLGA 3K3PA 2BUCA 3L05A 3HN2A 4XFDA 1SUEA 4GMLA 3GJ0A 1DV1A 3K31A 5HZGA 1NW9B 1ENYA 1F1JA 2HHHB 4EF6A 3INYA 4LNUB 2F8LA 1REQA 1E66A 2LAHA 3KWFA 4NFLA 3VR4A 3TUZC 1UKBA 1CR6A 2I1WA 2JLAA 3KUKA 1OF1A 3EMBA 4IJVA 3ZR4B 5BUSA 3QFSA 5EFOA 2HZ7A 2OO3A 2B98A 4B8WA 4QM6A 3TEMA 4L50A 2CJYA 1VLHA 1P7YA 3BE5A 1SWWA 2GCOA 2LKCA 4W1SA 1JTFA 3NORA 4QE3A 4S2EA 1Z6PA 2H07A 1P7PA 5T64A 1NDHA 1CUYA 2BELA 4KGXA 1GN9A 4AZ0A 2ZRMA 1IQ0A 2P9JA 3ZE2B 2PWBA 2QVXX 2EWWA 4BVHA 3QOUA 3ZDFA 2JL1A 2F3UA 2JF0A 2L19A 1P19A 2NVOA 4KBYA 1ZP6A 1AKRA 4QKQA 3H8SA 1T5BA 2LE0A 2BN4A 1PFGA 3BRSA 1KH3A 5LN1A 4JL6A 3WDLA 4JXJA 3ZNOA 3E4DA 5LZ5A 4LUNU 3CU5A 2RD2A 1DKLA 5ARGA 5EDSA 2I2XB 5DHSA 2ATIA 4QRHA 3E35A 3VH3A 1G20E 1NBWB 3KXPA 1EEHA 4ARUA 3TDNA 3HJBA 1I7PA 2HNBA 1JTEA 2KBXA 1QB7A 1BD8A 4B2IA 4RG9A 2ILTA 1CEQA 1NY5A 2V0PA 2FK7A 3OP4A 3N74A 4XRRA 1OKKD 2IYYA 3KBOA 1CC1S 3AV3A 2X3FA 2ZJZA 2MSWA 4MKGA 1HKHA 1HDOA 4DA8A 4RPHA 3O47A 2ZTHA 2XX3A 1I36A 3AXSA 1HM5A 2B36A 4XAQA 2VEDA 4LHVA 2HPAA 1L5LA 5DM1A 1Z0JA 4DLZA 2HSJA 3IBGA 3I8SA 4KSYA 5BVHB 1OWPA 5BR4A 4LQLA 5FNVF 3BFJA 4HXFB 4ILKA 4XX1A 4NZZA 1VSBA 1RNLA 3MUNA 5IM5A 1SD1A 1U8XX 5I6DA 1IHBA 3L6OO 1ZI6A 2VBCA 2WPDA 2PGJA 3O74A 4I4IA 1U9YA 1Y3CE 4RTNA 4ZAYA 2AZTA 1JJFA 1D1PA 1EGQA 1OCRE 3WO0A 2NP6A 521PA 4UNPA 1G21B 4ZZ0A 2W42A 3EIOA 4F4DA 1CJBA 1UPAA 4LKOA 1QGOA 3ASOE 4BU1A 2FHSA 1M6VB 4IRUA 2DQYA 3GJZA 3ZDAA 1EKXA 1XDDA 3CBGA 2FEKA 1VRVA 3VC2A 3KE8A 4NQZA 3QJZA 2PKRA 2O0HA 2Z04A 5CD1A 5A7FA 4RZHA 1LZLA 5DLPA 3B52X 4KXYA 2X1VA 3BT3A 2ZB7A 3SC2A 1Q74A 3WG7E 3SNXA 1V1RB 2X0IA 4FR5A 2I1JA 4GI5A 1M1YE 3GF4A 1YE3A 1OXTA 2HJVA 2PEYA 3FWVA 1J9EA 3I42A 4LW8A 2FH5B 3WFJA 2IIBA 1SXHA 1DIGA 1WAO1 4Y2YA 3GFRA 4MRMB 1WR8A 1SGWA 3FB1A 5B2EA 2H7YA 4QOIA 2BRUC 5B58T 1FP2A 5I7AA 5DX1A 3W5JA 1N11A 2BEWB 3UOWA 4V2IA 2Q4EA 4JA0A 1VE6A 2ZR8A 4R40A 1XCLA 1EM8A 1JHPA 3D3QA 1UKZA 4C0BA 3QBEA 5C5DA 1VPVA 5ER6A 1J8VA 4J4BA 4MTCA 3UMYA 3BWVA 2DQ4A 1G4UR 4ZXFA 4NZNA 1VKRA 1V8ZA 4EHHA 1EDBA 2EGHA 1B8PA 5T8KA 3HS3A 1Z22A 1H23A 2I6XA 1U80A 3BRQA 2ATEA 3JAKB 2X5TA 2CMFA 1N0UA 3WXXA 2GDZA 3ZDDA 4RC9A 2P6UA 3BXHA 3QJYA 1JKIA 4TV9B 1NE7A 1QC5B 3JYOA 1LVGA 2BHNA 3WA7A 1TD9A 3JU3A 2PLAA 4E5SA 4AIFA 1IXZA 3G2LA 1Z3YA 5K3DA 3KAEA 1J7JA 3IUPA 4C03A 3FM9A 4RDXA 5JSFA 5BN4A 3LKZA 2UY1A 5KS2A 4Q39A 3LC0A 4CV2A 1TVKB 3R3VA 4ZDIA 3R8FA 2FKNA 4FEGA 3GD7A 3RRUA 4FD2A 3A9TA 1P0MA 2C97A 3DAOA 5E4JA 5K6RA 5C5EA 2O3UA 1PNTA 5F12A 4Y2PA 1OUVA 2FZVA 1ULBA 2J7PD 1PKXA 1VHTA 2G1AA 4YQZA 4YUAA 4CKCB 5CH5A 2G1PA 4J1TC 3ABSB 2YCBA 3QKSB 3IDAA 3GVHA 2FFGA 2CD9A 2QRNA 2C2ZA 3K8YA 4TT3A 4X66B 3B95A 1Z56C 4K5AB 1KDOA 5TVGA 1MD9A 4BV3A 2PMFA 2H7VA 3BQ9A 4YRIA 1KEPA 3ASUA 5KUTA 2GK7A 3KAPA 2WXNA 4WNYA 1W8DA 4YCAA 1ZISA 2WWGA 5FWXB 3ZFWA 2RARA 1JPJA 3VJMA 2AI2A 4FQ8A 2OUKA 2IV3A 4JGBA 3CUVA 3TR6A 1Q1AA 1T1GA 5TS2A 3UJ8A 4P84A 2Q3CA 2CNBA 1UT6A 2VUIB 1T2CA 3ES9A 2J09A 1T8UA 1VCNA 3PTZA 2ZE7A 5FOQA 3ZQKA 1A8IA 4D4IA 2PV7A 1BKSB 2XCQA 3A58B 4UYKA 5AJHA 4XSGA 1SCJA 2VR1A 3W4KA 1E18A 4EKNB 1YZKA 1FFAA 2YZ2A 4I6EA 3B8EA 3PA8A 1VZ3A 3OPYI 2AYXA 5J59A 3IEGA 1HY3A 3HJGA 1OYYA 1W94A 2QG9A 3TZLA 4EHNA 1OB2A 4OV6B 5CCBA 1KA9H 1V3VA 1RPZA 4MV3A 3TLGB 3KT8A 1NNLA 3KSDO 1G7SA 1N5LA 5TEWA 1XZLA 4YJ2F 4RD1A 4RMNA 2ZAGA 2X3YA 3HJUA 1DC8A 2XMZA 2HO5A 4WFQA 5JBIA 3KJXA 3U4GA 4W4TA 3PQ5A 4BNZA 3AU5A 4WASA 3C4JA 2ECFA 3IILA 1G3NB 1XKQA 2J9FA 3O8LA 4HWSA 4ARVA 3ORSA 4AJ9A 1P4GA 1IHGA 2H9AA 5ESDA 2X4GA 3DEFA 3EAFA 5JAUA 1BG6A 4EKDA 1C3OA 1MO2A 3HCRA 2F9LA 4GS5A 3GJ5A 3HADA 3M1LA 3K71B 5HE8A 1BDMA 4BKRA 1M34B 1JXAA 4TLAA 2X6TA 2JVKA 4F3CA 1X7HA 3AI1A 4XDGA 1K7EB 2VDWA 3TM5A 5DIZA 1EU1A 4IOKA 4LDQA 3KVYA 1HG1A 2IBSA 4M2LA 1C3XA 4RW0A 4RMJA 3T9KA 1A2QA 4BZZA 3O83A 4ZV9A 4PRLA 2BONA 3KKQA 3F98A 1XQWA 2C8KA 4ZPJA 3N71A 3EOBI 4AURA 4IWYA 4R54A 4HLCA 3I1FA 3IAEA 3RK0A 2QU7A 5CNIA 4V0NA 1DCTA 4Y2JA 3GRPA 1Y8MA 5TPWA 1RM0A 3LW8A 1H2FA 5KYUB 2IEBA 1N8NA 1WXHA 3DV2A 1F6WA 3PWSA 5HIKA 2QW8A 1K5PA 2I3GA 1CCWA 3W5IA 4WKBA 5B4VA 5KQGA 4UWFA 3RIBA 1ZLXA 3NTOA 3KQMA 2WQZA 4YRAA 5FYDA 1CZNA 2Q4OA 1P1FA 2BGRA 2XHEA 1NBME 4KWIA 1NJ5A 4Y8VA 2DFDA 3Q47B 2EJCA 4N3CA 3R7LA 3A0UA 1UP6A 3CUSA 3LT2A 3Q2KA 2G0TA 4TXQA 2V7TA 4JKOA 1L1RA 4ZFHA 2J9XB 2FXVA 3BIFA 3FTPA 1UG3A 1TT5A 3HU5A 1ZB1A 2FP4A 5HGXA 1YZ3A 3CKLA 3MWDA 1NW4A 4HAVA 4D0SA 1MAAA 2R97A 5D3ZA 4YAOA 1I7LA 5DLEA 2XENA 5C52B 4D0RA 5FI5A 4EMBA 5EPEA 4WAFA 5A9SB 4D82A 2KHZA 3A32A 2ZW9A 3ZH9B 2OHVA 1NVFA 3GFSA 3WLEA 4FUTA 4IXWA 1QHIA 2YUIA 4P08A 1KI2A 4NBUA 2BFDB 4ZZ2A 4Y2TA 4EJFA 4EHLA 5IT4A 2PTGA 2Q1XA 4XSHA 3N2EA 1OI7A 4ZAWA 2Y93A 2P4QA 1V6CA 1KYYA 1AGXA 2FYTA 2IYFA 3PNYA 1UFQA 4M1QA 2E2EA 4AF8A 4UVGA 2W9JA 4UI9K 3M6LA 2P2CP 4KHZA 3BSWA 1TJYA 1ZY2A 1K4KA 5GIPE 4LE1A 1QIJA 3S29A 3WISA 1Z33A 2QTFA 4YJFB 3LE8A 4IDQA 4IIUA 1D2RA 4JBNA 3QQ5A 4KN6A 2PH7A 2YWGA 1GZVA 1OZHA 3D2CA 3FX2A 2I4RA 4GCNA 5HTKA 2IXAA 3PA6A 5EJ2A 4HB4A 3TE6A 1IY9A 2QSUA 3RU0A 5FUBA 2YOFA 4KPUA 1I2ZA 2GJKA 1F9AA 2GW1A 3LGAA 1WXEA 1ST3A 4I43A 2FGKA 4R0MA 1HEUA 3AZQA 4LYEA 4B3DA 4PZPA 2WUWE 4EG8A 1L5WA 1HLGA 3H0KA 2WT9A 4GOMD 1HDEA 3QBJA 2FPUA 1KQNA 3N6VA 4IIDA 2GZMA 1WETA 4MAAA 1CE8B 4EEXA 2I5PO 1Y37A 4MEAA 1ZONA 1OGJA 2VTEA 1E6LA 1BU8A 1OBHA 5JJBA 3MUFA 4GB9A 3WTCA 4RIGA 4WNAA 1P39A 1K3ZD 1DO2A 4J7UA 4RSMA 2IYZA 3HACA 3RBAA 2PO7A 4PRZA 5B3LA 3GLTA 4DC9A 3LT4A 5CNJA 8OHMA 1K68A 4AMBA 4Z3OA 2HHLA 4BSZB 4W63A 5BO5A 4Z4CA 5THQA 1N6KA 4M9XA 4HN4B 2D7JA 1Z4JA 1Z13A 1IMJA 5I9BA 3HG7A 3MJRA 4KPGA 4ZVQA 3AFMA 2CHZA 5KIAA 1E9CA 2XWPA 2PXHA 3PK0A 1GDTA 4CQMD 2C0CA 4Q7JB 3M81A 4AZTA 2IJGX 5B7GA 3UKOA 3IKVA 3K20A 3AFOA 4EG7A 4TZ0A 2QAGA 2B5VA 3N70A 1N4AA 3CZ4A 1FDTA 4RH3A 1ML4A 3H2SA 2NSHA 4Q00A 3ETCA 4MCHA 5F33A 5BRAA 4ZRNA 3VX3A 1WG8A 5EIFA 3MPUA 1HG2A 4KYTA 4YH1A 3ZX5A 5JC8A 2QRKA 3HXBA 5E9AA 1GARA 2H5IA 5DHQA 3OFVA 1YHYA 3O92A 3BHNA 4LDPA 5CTAA 3FEXA 3KDPA 4C3VA 3CF2A 3GC6A 1Z2AA 1F8XA 1Q11A 3GYZA 2BHTA 4NOMA 3S70A 3AW9A 2KPOA 4IDOA 2IS1A 3K9QO 5IVIA 4GZ6A 3DMGA 3I23A 1OW3B 3PIIA 3HCWA 4RH0A 2YWFA 3RO3A 3DV9A 2GDJA 2C8LA 3IUJA 3OY2A 2O3RA 3JQ7A 3UCXA 3OPYA 3NHJA 2XNCA 4JA2A 1U2DC 4E15A 3F3KA 2P4SA 2RB4A 4ZP1A 3FUCA 4K9MA 2O20A 3KL4A 4MWGA 2W22A 4G4GA 2ZRDA 1I5EA 3Q7TA 4CGZA 4BC0A 3NKLA 2ZYSA 5A71A 3KT3A 1R8SA 4WPGA 4MYDA 3SM9A 4BX2A 1O03A 3X1MA 1OYVA 4H6PA 1RJ9A 5HP4A 3F3MA 3QF7A 1SBYA 3O90A 2B78A 2QM7A 2XITA 3LX4A 1IZ7A 4P5DA 1A5SB 1Y1SA 2H4XA 2AG0A 3WB2A 4EPWA 5EILA 5AOVA 3ELYA 4FT4A 5FUYA 3LT5A 4MS4A 1YDMA 3SD5A 2BZ0A 4DMMA 1V7QA 4E07A 4CKYA 2WHXA 1B2LA 2ACEA 4K0RA 4NPHA 5BN1A 1XO1A 2AR9A 4DUIA 1R12A 2O5EA 4EMSA 3KWMA 5F5LA 5TGDA 2UWJG 3PFWO 3QHQA 4UTZA 4WCVA 4WHMA 1JG3A 4CM5A 4R2WA 4A4DA 1U9IA 3WVNA 1M66A 4BY9E 1HGXA 4Z49A 3CHQA 2A4ZA 2J1LA 2PUAA 2ACVA 3G88A 4EKYA 2P11A 1XRLA 4CIDA 3TPZA 3GW4A 4MR7A 4DCNA 2O6HA 1Z88A 4GKKB 2FF7A 2I62A 3QZUA 5FNVB 1SKMA 3HGQA 3SQDA 2J30A 2O7QA 3F7OA 2MYPA 2QMZA 3UXEA 1DU4A 5HX7A 2NUPA 3R9XB 4G6ZA 5DHUA 4F8YA 4FSDA 3ZGNA 2CF6A 3ZWOA 4R98A 1O08A 2IEAA 3RSGA 3V1NA 1RADA 2IKSA 3B5JA 3UT5A 4DBLE 2R6R1 2XCRB 2C4VA 5KYYA 1X7GA 5SYAA 3W1WA 3A2LA 4BB6A 3NRJA 4B6SA 2C7GA 1KDPA 5EHIA 4MDYA 4NJMB 5CB4A 2AQHA 2FSFA 3KLOA 2LCFA 1G42A 2GYVA 3BYZA 5EZYF 4CM8B 2YYSA 2WFLB 4KACA 3ENQA 1Z15A 2UZIR 4WDQA 3QE9Y 1SXIA 1CJMA 2IY9A 5T4YA 3KQTA 1DWOA 4RGQA 4IUYA 1XN4A 3CO5A 3JD2A 4YRDA 4XB2A 3GEBA 1NI4A 4KKVA 3PX7A 1Z5PA 4R2XA 4CLXA 1G64A 1QO7A 4HH1A 5D1NA 5KTRA 5ARBA 1JDPA 3C4QA 3I6MA 3SM3A 3DFZA 2CNKA 3BK7A 3MOGA 2ZUCA 2GLXA 2BFEB 3X1DA 2RK4A 2WU0A 3U7RA 2FFRA 2YX1A 1WMAA 4RD2A 1XTBA 2ONYA 4PN7A 1YK1A 3QYFA 2XTNA 3PQFA 4F96A 3WL3A 1O96B 1X7YB 1F0YA 1ABBA 4R71A 3UMGA 4XE5A 4TS4A 2Z98A 2PLFA 3UUXA 3P9ZA 3IKLA 1QRRA 4XUDA 3K0KA 1T2UA 2D0OB 2EJTA 1GV1A 2H29A 3EXEB 3RFXA 5LL6P 3W3AH 1THZA 4WZAA 5KSYA 3T99A 5JJ5A 1NURA 4D42A 5B6JA 4I3FA 4BJ6A 4IN3B 4PVDA 5KOHB 4IWNA 3KQLA 1OVGA 4R3WA 4UAUA 4MO9A 4PYLA 3GN2A 5B1SA 1C7IA 1MDFA 1QHEA 2V6BA 1YU9A 2D5LA 4E31A 2H6EA 2RHJA 3ZE9A 1EFKA 1EBFA 1TNDA 3RG2A 1G21E 2J9RA 1ISRA 3C7KA 3W8FA 3FEYA 2RGNC 3WDMA 1XQXA 1T2NA 2H6FA 2Q7FA 4J49A 1BCSA 1L5QA 1OWOA 1W6RA 3FPFA 2ZBRA 5FQ7A 3VH4A 2LCIA 3VKGA 3GLGB 1MUUA 1CDZA 3RIYA 4CRWB 3L0BA 1P3JA 2A90A 1QOQB 1N9KA 3KJHA 3DXFA 3H8VA 1R0ZA 3A1FA 3ETDA 3TCNA 4BO7A 2AN3A 4ENWA 1TNOA 3EEQA 2QJOA 5H8WA 4O3FA 4KU4A 2HEIA 3I37X 3ZDXB 1KDTA 3DSRA 1JIKA 2NZ8A 1S1CA 2BY4A 1AS0A 1A8PA 1NMEA 1JYSA 3U6KA 3RU3A 2XNDD 1XP5A 4HGQA 1MO5A 2GCNA 4DIMA 4AOFA 3H0EA 5JATA 4RO0A 4V2UA 1E7WA 3U66A 1QQ7A 4DQKA 3UATA 3FTXA 2HC9A 4DUYB 1BS2A 1E2FA 1DAFA 4BJ5A 2WLSA 3LMKA 2ZVQX 4ZO6A 3UAOA 3O82A 5KBAA 1SWVA 3UINC 5EVJA 3MLAA 4OP1A 1MX6A 3KTAA 3NTVA 4BEJA 4B6QA 4M36A 4RENA 3VU8A 3AUXA 4GWLA 1KEVA 2C07A 2X6FA 3CW2A 2VDLB 4IHAA 3JYQA 4EQFA 1PR6A 4YJ2B 1PBNA 1MB9A 2VHQA 2WIKA 4FJ2A 1JDUA 2PQ2A 1SG0A 2I2WA 4AJOA 3RVQA 3H5IA 5K0TA 1ZITA 3V7YA 2ZTLA 4KZKA 3KBBA 3DDZX 3D9HA 5KB3A 4BB0A 3OU7A 5CRUA 3USCS 2HLHA 3GHYA 3FDZB 4Z3DA 1EJ6A 3IPAA 3IUNA 2WAAA 2FZLA 3FVRA 4BMXA 4TUMA 4BNWA 2GHQA 3NOQA 2X0NA 3O2JA 4RJ2A 3TSWA 1SXJB 4R1OA 1M2VB 4I08A 1L4GA 3LT0A 5C7IO 4E09A 1RU3A 4YAKA 2PDAA 1RAIA 1EEXB 4Y6QA 1SKBA 3EWIA 3L4SO 4ID9A 1XTTA 1THGA 3ZHTA 4G89A 5LYYA 4NYIQ 3LIIA 1TN7A 3ZY5A 2BBSA 2C04A 2VJBA 2AN9A 1WCWA 4DMFA 1OXJA 2R1ZA 2ISQA 2OCCE 1CNMA 3HWSA 2B8TA 2NV0A 5G2OA 2RGEA 2CE2X 3U9WA 5BMOA 1T9ZA 5CXSA 3DV0B 1PP4A 4L16A 1Z2DA 1K9VF 3ZKAA 4NV3A 3FTUA 1HV8A 4IDEA 3DONA 3BL5A 2J4DA 2UUOA 3CVQA 2FTKE 1GEGA 2AT1A 3J81A 2A5JA 1ODCA 2EIME 1ZCFA 3FUJA 2Q5JA 1JGTA 5DLQC 1WABA 4P7KA 2JCVA 1A95A 5GM2A 4FOTA 3EVFA 3RYIB 1O9GA 3OAWA 5IDXA 1KARA 4QSMA 5UKDA 2VSXA 1I4DD 4R41A 4TVOA 4GICA 1FFCA 4MVJF 4M99A 3AF3A 4QHSA 3C39A 3FVQA 4PN3A 1SZJG 1AWCB 4DGQA 1JQAA 2NV6A 1HFJA 3GRVA 3VVLA 3JQCA 1R8XA 5JUWA 1QB8A 3F78A 4NHEA 3ACCA 2ECOA 2QRVA 2QUIA 3VKWA 5D7BA 4R7ZA 3BX1A 3ZNNA 1ZJ6A 3AOEC 2G9UA 3WLJA 2HA6A 2BF7A 2ZIVB 1WB6A 5SYNA 3TWVA 5SV2A 1RQ7A 2R8EA 3TLMA 1EB9A 2VDRB 3VVMA 3EOAI 4MPPA 4RZUA 4NABA 1UMDA 3CLTC 4EYGA 1W34A 1T91A 3ZKWA 1M34E 2FMUA 4TYQA 2SBTA 3JV7A 5C8DA 4JI5B 4WKCA 2WB4A 3BXZA 5AJWA 2A57A 3V5NA 2QQ0A 3U81A 2E18A 3VSBA 3QG5A 4L8VA 1NSTA 2ICAA 3F3YA 3L54A