3TAXA

A neutral diphosphate mimic crosslinks the active site of human o-glcnac transferase
Total Genus 271
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
271
sequence length
714
structure length
695
Chain Sequence
THADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title A neutral diphosphate mimic crosslinks the active site of human O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 271
structure length 695
sequence length 714
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3taxA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3taxA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 3taxA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3taxA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3taxA03
3NPAA 3OY2A 3T3EA 1GZ5A 2QLMA 4H7XA 3C4QA 1JG7A 3OXLA 3T3DA 2SKCA 3BEOA 2JLBA 2G9RA 2VCHA 1J39A 4EKYA 1FC0A 3G2LA 4YVOA 2LSUA 3CV0A 1WUTA 1PC2A 2QZSA 4M60A 3NC4A 8GPBA 1IYGA 3CK8A 3S27A 3LY8A 4UI9K 1NLMA 3E3LA 2C1ZA 2QNBA 3VTYA 3CVNA 3RSCA 1LWOA 2GEJA 4A1SA 1IHGA 4ABNA 2ASVA 2VSYA 3OKAA 2GPAA 1FU8A 4J8DA 3OT5A 1KLXA 5A7DB 2AZDA 3L7BA 3SYRA 3ESKA 2H1HA 2X0DA 2H1FA 3HBNA 2XA1A 2C0LA 2R5SA 4JA9A 3SYMA 3T3HA 3K9IA 5M72A 4UI9J 3ZCUA 2G9UA 3N71A 1L5RA 3E3OA 4NESA 3Q47B 2GPBA 3PDNA 2BGUA 4N5CA 1Y6FA 2XGSA 1SXQA 4G24A 3GYZA 5BNWA 1E1YA 2UY1A 1PSWA 3U3WA 1GPAA 2GW1A 4REMA 4KXKB 4NEQA 3CEQA 1GPBA 4HOSA 4WUYA 5BW8C 1JG6A 3MTDA 3NF1A 4GA0A 4G2TA 3Q4AB 1WW2A 2KCLA 3IAAA 5CHEE 4IN3B 3OY7A 3T3GA 2QN3A 5JTUA 1ELRA 2C2LA 1L5VA 1H5UA 2XCBA 4F3VA 3GZ1A 2G9VA 2IUYA 4N9WA 5TMEA 2QN2A 4CTOA 3AS5A 3Q3HA 2IW1A 3ASDA 1P4JA 2ECPA 5ARFA 5JJ6A 5DIZA 3IA7A 2SKEA 2KS6A 4M83A 4B94A 1PN3A 1L5WA 3SF4A 3L79A 4HOUA 3S7JA 3ASGA 3G2IA 3HBFA 1Y8ZA 4APOA 3CVLA 4I17A 1QZ2A 2C0MA 3PE4A 1JEJA 4G25A 4JL0A 5LCWJ 5HQ8A 4U0UA 1K06A 3DDWA 4RIEA 1E4OA 1NA0A 3CK7A 4YI3A 3RO2A 4AY5A 3H4TA 2ATIA 3D0RA 3OTGA 3ZCQA 1FTWA 3FROA 5ARGA 1XOIA 4L22A 5DBKA 1FS4A 2FI7A 3CUUA 1ZBPA 2E2EA 3TOVA 3Q49B 2OOEA 4O6FA 2LNIA 3CEHA 3ZGQA 3ZCTA 3L7CA 4YUAA 4W6QA 4KYOB 5DU2A 2XA2A 3GPBA 3Q3EA 2XCCA 4G26A 5D0QD 5G04C 1NVKA 3E4BA 4GPKA 2IV7A 3Q3IA 2QN9A 4JA7A 1TJCA 3MKRA 1B4DA 4X7MA 2DBAA 7GPBA 2PYDA 2IFUA 3DDSA 1HZ4A 3MS7A 4GYWA 3Q15A 3MS2A 4XIFA 2X6RA 2F3SA 4NRHB 1P2GA 3CEMA 3BDAA 2R4TA 4WNDA 4G1TA 1YA0A 4X6LA 1WM5A 4U0ZA 1AXRA 2YQ8A 5KJLA 1NOKA 4XI0A 3LPZA 5G05C 2QN7A 2Q7FA 2VGYA 3G2JA 3L7AA 3NCHA 1VGVA 4RELA 3LYAA 4GZ6A 2X6QA 3ASFA 2WQHA 1F0KA 2C1XA 5D01A 1PYGA 4BT8A 3HBMA 1A17A 4X7RA 5GPBA 4RG9A 3MT8A 4I9CA 4N2QA 1FA9A 2GEKA 1UZUA 3L01A 4KQ1A 4EKEA 1C50A 1GFZA 4WNFA 5IKPA 2Y4UA 1Z6QA 4FZRA 3ASHA 2XGMA 3MSCA 3S7DA 3UQ3A 1P29A 1RZUA 1Z8DA 5CCMA 1QKJA 2FO7A 4GCOA 4AIFA 4WACA 3VUFA 1L5SA 3HBJA 4M7PA 4HLNA 4AN4A 4AY6A 3Q5MA 4WHMA 2OFFA 3RU0A 3LY9A 2Q6VA 3S7BA 3D1JA 3RSZA 5HXAA 3T3IA 4EL5A 4Z5XA 3CKCA 5D00A 2PZIA 3AMVA 5I45A 2XEVA 1O6CA 2HO1A 2NC9A 1RRVA 2XMPA 4BQIA 3KAEA 2PQRA 3COPA 1F6DA 6GPBA 2UWJG 4AMBA 1NA3A 2MHKA 2FBNA 3CVPA 5FJYA 3S2UA 1JIXA 3MTBA 4RIIA 1GPYA 3OTIA 4WNGA 3WC4A 2QRPA 4UQYA 4EQFA 2AMVA 3CK9A 1FCHA 3ZCVA 1L7XA 4NQ0A 3ZFWA 3NAZA 1UQUA 3MRXA 3O3CA 4MHOA 5IKOA 4CTMA 2ACVA 3GUHA 1XV5A 2QFCA 4BQEA 3GW4A 2PYIA 2QRQA 3VDMA 4QLBA 2LSVA 5DLDA 3FP3A 3T5TA 1EM6A 1NZNA 2IV3A 5TMBA 3S7FA 4F9FA 3WXXA 3RO3A 4N39A 2XA9A 2XCUA 3QOUA 2V5FA 3O48A 3QDNA 4UI9C 1P4HA 3MEKA 5C1DA 2P6PA 3EDTB 3OXFA 2F3PA 3CUWA 2HR2A 2R66A 4UQXA 3QKYA 2BISA 3MTAA 4BTBA 3T7DA 4AM9A 4LEIA 5EKQD 2C9ZA 4LDPA 2IF4A 2C4MA 3R9AB 3QWVA 4CGWA 3AS4A 5BT1A 1M5RA 4GZ3A 5JTTA 4G2VA 3TAXA 2L6JA 2XPIA 2VCEA 3BEEA 4RG6A 4I2WA 2PQ6A 2PRJA 4FKZA 1C3JA 5EX0A 1P2DA 1UQTA 2PQNA 4GA2A 3BD8A 1KT0A 2JZCA 3MT7A 4BQFA 3RKVA 2FFRA 1C8LA 3FFLA 4N3BA 4RENA 5ENZA 2GT1A 2WTXA 2PL2A 3AS8A 1FU4A 3LY7A 5EX3A 3CV3A 1L6IA 4Y6CA 3VTXA 4X7PA 2FEZA 2QLNA 2FF4A 4YVQC 1WV0A 1RZVA 2GPNA 4EJ2A 4HOQA 2GM9A 3QKWA 2HY7A 3UYLA 5JJTA 1Z6PA 3S29A 3ZCSA 2QLLA 2AVPA 2R60A 2VG8A 2X0EA 3ZCRA 4F97A 3DZCA 4CTNA 4H7YA 1FTYA 4N3CA 4UQZA 1EXVA 3S0JA 4BFCA 3CUTA 5LCWC 1AHPA 2VSNA 3NP9A 3OKPA 2XGOA 4KQ2A 1B89A 1W3BA 1FU7A 4NC9A 4LEUA 2KC7A 2VQ2A 2HYZA 2JJMA 4RBNA 4RIGA 2AW3A 5FZQA 2PRIA 3NP7A 4KQMA 2FETA 3OTHA 5TMDA 3CKBA 5FT9A 2QRGA 1XL0A 1XKXA 1ZU2A 4U04A 2IEGA 5HI7A 2R68A 2O6LA 4MI3A 1P5QA 1WW3A 3ZN3A 3L7DA 1Y6GA 3MA5A 4WNEA 3IEGA 4I9EA 2P58C 4HOTA 1HLFA 1NOJA 4PQGA 1L5QA 3KS2A 1C8KA 5JJ7A 5KJKA 1WV1A 3QWPA 3BD6A 3H4IA 3RHZA 4U0SA 2F9FA 2XCIA 4GZ5A 3MV2B 4HWGA 1JIVA 5AYWD 1K08A 2KATA 3EBPA 5KJMA 4U07A 4N3AA 5A6CA 2F3QA 3E3NA 3G2KA 3OXGA 1NOIA 3FWVA 1Z62A 4MI9A 2BUGA 3VDNB 2VGXB 1KT1A 2F3UA 4RIHA 2BFWA 3JYSA 4GA1A 3ULQA 2G9QA 2I6HA 3VUEA 1V4VA 4KBQA 1HXIA 3MBOA 3NB0A 3MT9A 3MRTA 3TGOA 4AMGA 5D0OD 1OUVA 4G23A 4YNDA 1LWNA 3UPVA 1HH8A 2AV6A 2YHCA 5G04J 3LKUA 3EBOA 3ZPJA 3WADA 2IEIA 1BX3A 3MS4A 4XI9A 3BCUA 3PE3A 5FZRA 2YJNA 4J8FA 4J8EA 1WUYA 3UYKA 2IYAA 1FTQA 4MICA 2VYIA 5DXFA 1NZFA 3DD1A 3WAGA 4MHSA 3TG5A 3ZHEB 4MRAA 1SXPA 3URZA 2GJ4A 1PNVA 1XC7A 3CEJA 3LCAA 2J9QA 1IIRA 4MI6A 2X0FA 5FTPA 2KCVA 4WADA 4GYOA 2QRMA 3C4VA 3CUVA 1IXYA 2ACWA 4YI5A 2QN8A 1JIUA 2ONDA 3MQFA 2QRHA 4BT9A 5TVGA 1ABBA 3BD7A 4I1AA 2KCKA 1KTIA 1QQEA 3RIBA 4GPBA 3OKCA 5G05J 2FF5A 3D0QA 4J0UA 4HORA 2IYFA 4BTAA 1GGNA 3S28A 2VGXA 2WPVA 3MRVA 4JHRA 3UUXA 3GZ2A 3U4TA 3RT1A 1P4GA 3CUYA 3TSAA 2QN1A 3BCRA 1XNFA 3G2HA 1GG8A 4GYYA 1XL1A 5LQDA 1E96B 3TG4A 4F96A 3ZCPA 3RJVA 3KD7A 4N2SA 3CVQA 3G2NA 4CDRA 2ZB2A 2R4UA 4W9RA 2UY1B 1Y8MA 3BCSA 2BGTA 1ELWA 5KJNA 3CX4A 1NZDA 1WAO1 3MV3B 1YGPA 3QHPA 1P2BA 3C48A 4I2ZA 3ZHEA 4BWRA 1YA6A 5CCLA 1A8IA 4ME2A 3QWWA 2SKDA 2Y4TA 4RIFA 5FZSA 4Y6WA 4CGVA 3HYMB 4EL0A 4GCNA 9GPBA 3SZ7A 1QM5A
chains in the Genus database with same CATH superfamily
1F2VA 1ZL0A 2NZVG 2H8KA 2B1QA 2VKTA 1RLJA 4YH1A 3I01A 2GMWA 1F8UA 2BKKB 1VJGA 4GLJA 4WERA 3LMKA 2RGYA 1VKHA 1E2DA 1P1HA 3HHMA 2H9IA 3ZK7A 3VTKA 3E81A 4FB5A 10MHA 1O96B 1N9GA 5EKSA 3FTCA 3PK0A 3NATA 2R2LA 4TQGA 1SKAA 3T7EA 5ES3A 3K94A 1JHQA 3SZMA 5GVSA 3TNLA 1BCRA 2VAPA 1P4JA 1J8YF 4QPNA 3DAPA 5IJ9B 1Z5NA 3AUKA 1R0KA 1C1DB 2RHCA 3I92A 4X1YA 3CVLA 4FHKA 3CLSC 2FUCA 4I14A 2VJ8A 4BJ5A 4QDZA 5AQEA 5BN1A 1T6BY 4E07A 3NGLA 2LV8A 3V97A 4CQLA 2K5UA 1XI2A 4Q9IA 1M8KA 5TY0A 1EZ1A 3HXPA 3ZHVA 2JLZA 1HDZA 3LPAA 1WDLA 1X74A 1N54A 2HJ9A 4PRZA 3K0CC 4YCNA 3ZE7A 1KBZA 4NRHB 2FA9A 1AV6A 5BPPA 3FYCA 5HIJA 1EVKA 5J5CA 4YO7A 2YYSA 1BA2A 2R47A 3UX4A 4CM3A 3N2KA 1GIAA 4MKIA 3ZVMA 1D1QA 3D02A 3L7MA 1V6CA 1J70A 2NP6A 2X6QA 2BZSA 1B74A 1K3FA 4NRDA 5I5EA 1E6UA 1I32A 1Q0QA 1WEHA 2R8BA 1Z5WA 3RKSA 1Q1AA 5AQ9A 4MUIA 2CNOA 1Z39A 4L50A 4BZWA 5I47A 3Q5MA 1PFUA 1N5OX 3OKFA 3JD2A 2W6JA 4EA6A 5KOIA 4M1OA 2GN2A 2WG1A 2QV7A 2ETXA 5CXQA 1E0JA 4C4SA 2IWHA 5IN4A 4LOLA 4BU1A 2QV0A 3C5EA 5KWIA 1ZN8A 4FQ5A 3IJEB 3UMFA 4HNRA 3R7DA 1V7PC 3AR3A 3TAHA 3ZJVA 3RJTA 4O2RA 4FBLA 3D5QA 3VTFA 3J5QB 1XKLA 1OFUA 2V7VA 1XE3A 3ICQB 2PZMA 3C8HA 3V4PB 2QROA 4QDJA 1YKFA 4J8PA 4I0WB 4BO1A 2RC5A 3RRFA 3ZIDA 5LFAA 2B92A 3AVTA 1EUDA 2PE5A 2OCIA 1E7SA 3AHFA 1W3BA 3PDIB 3FCSB 5K45A 2X42A 4TTIA 1M33A 3FWKA 4WZAA 1OJ7A 2O0JA 5ELXA 2XYVA 3HC7A 5DTQA 2VTBB 1QCDA 4DSUA 1Y1KE 2DR2A 1ESEA 3EWSA 1PTJA 4TGLA 5HRUA 3ZIMA 3OP1A 4KBGA 5FPHA 1ZK0A 2DQYA 3O8DA 4CODB 5FL7D 3LAWA 3E3NA 4MPRA 1RHKA 1ZM2A 1J0DA 2JCXA 4OJNA 4YCAA 1IM8A 1J0CA 2Y0PA 3T1VA 1ZAKA 2HFJA 2WK1A 5A7HA 1BS1A 4JJFA 1XIVA 3TWSA 5JYEA 3HVKA 1YQDA 1FXWA 3ONNA 4ARBA 3MWDB 4D9KA 5HCIA 3MGGA 3PXUA 1EGMB 3MWKA 3UI2A 2WAAA 5GWXA 4GTRA 3NAWA 1MOPA 4P3NA 2ZR7A 3PFHA 1ABBA 1P81A 4GPBA 3UVEA 2WM3A 5K03A 3UJ8A 1PUJA 4RE6A 1ECGA 1GGNA 2IZOA 3ED5A 4D3DA 2O8FB 1YI0A 1FDVA 1FB5A 3V8RA 3M0EA 3WLTA 5FIUA 3V2XA 3LA8A 4NZOA 3DO6A 5FEUA 3LIPA 4RQIA 3W2IA 2HF8A 1NZDA 2AHOA 2GXSA 2NMVA 3D31A 1BOOA 3SF8A 3EXG2 5KKNB 4FJYA 5LX8A 1VIVA 4UC0A 4YA6A 5JIBA 2OM6A 4LI3X 1SU7A 4LZAA 5DHQA 2WC1A 1APBA 1XA3A 4KXVA 3OURA 4TTSA 1GN8A 3EVBA 4JL6A 2PA0A 3BGVA 3ZLVA 4MVJE 4ZZ0A 2UAGA 3IKJA 3T3HA 2E37A 3PQ8A 4F71A 1BKDR 4OB6A 5BUCA 1EBBA 4Y1RB 4NYJR 4C08A 3HJFA 2ECFA 1Z45A 4QXPA 1PSWA 5FB3A 1DLIA 2KX7A 2XUJA 3IOYA 1B41A 3KQSA 2MR6A 2JH9A 2I65A 4X64B 2VYFA 3E37A 3VLDA 1U99A 2X86A 5H16A 2F7SA 4ZQEA 4Z4GA 4OH1A 1N2BA 1GUDA 3IT2A 4UJ5A 4KCGA 1IUOA 1NVAA 1SPBS 2OFPA 5F5LA 5FWYB 1WD5A 3V46A 1HZJA 1WZIA 5FL3A 1GZSA 3IR6A 4FULA 1VLJA 4OFBA 4MRMB 4J1NA 3ABIA 1KARA 2YHIA 1X1TA 3DDSA 3KOMA 1ZCJA 1DOZA 4AWAA 3RE1A 3HA3A 4I8IA 1F2UB 3CT6A 3ORRA 5LWQA 4XDHA 3P0HA 4V0SA 5AM0A 1ZJWA 4FMDB 3IEMA 1T1SA 4BVBA 1F4LA 2REQA 1X1RA 2BKAA 1ZVQA 5K8VA 3IEPA 1YK1A 3GLGA 3MRSA 4KQ1A 4NMMA 2B5VA 1O1SA 1SBNE 5EE1A 5L45A 3GIDA 4WKCA 3HFJA 1F14A 1JFTA 5JALA 1UZAA 5A4KA 2YXNA 5CRVA 5GJCA 5GTDA 3TS1A 3RHFA 2VQSA 1TC1A 2JKYA 1GU1A 1NMYA 1P5FA 2FKAA 5FULA 1WKCA 3ZGYA 4AEZC 3H04A 3NH6A 2C07A 1UBUS 1YQXA 1KH3A 1L7DA 3C70A 4OXQA 3H42B 3SD5A 4K6MA 5CG1A 2D54A 3NVKI 2BM8A 2ACVA 3LK7A 5IZCA 3OO0A 3AEQB 3AONB 4L9PA 2A7XA 4OUKX 2XCTB 4ID9A 1YDEA 3ENWA 2P77A 3L84A 4MGHA 2BM1A 5HF6A 4EW6A 5GONA 2FULA 4EZLA 1Y8RB 3L6UA 3U81A 4YT5A 5MN5A 2H1VA 3I6IA 3VC1A 1R6AA 2F37A 1VSBA 4BBAA 1M2NA 1OYYA 2ECKA 4BQSA 4L15A 2FF4A 3FULA 4DFDA 5I7FA 1MDBA 3T9FA 3QMWA 2FRDA 3U4IA 1WHSA 4BP8A 5FL7A 1F1BA 1OLXB 2Q3HA 3BXXA 3T8YA 3CEAA 2JZOA 2PT5A 2NLOA 5LLDA 3ZNPA 2QNIA 1IDOA 3H11B 1Z29A 5T8KC 5G3YA 4RF2A 4HTFB 1OI2A 4L1BA 3RS0A 3HN2A 1Y5LA 3DEIA 4J0JA 3CE6A 1N2CA 2J8ZA 2H7VA 4ED9A 3FWVA 4WBNB 4EPYA 2CT8A 3LTEA 2DOKA 2FFBA 2Q6LA 3MWFA 4JOCA 2VSFA 2QVBA 4CT4A 4MVJG 2VJAA 3EQ2A 4QT4A 3NV7A 4A2CA 1EX1A 3ZHEB 4H3HB 4MZDA 3TK1A 4XB2A 4XWYA 1MTOA 2J0SA 1G6KA 1TK2A 1UAYA 1PAUA 2J07A 3RSLA 3D5EA 5TARA 4B75A 3TD9A 1P60A 4KLRA 5HILA 1U0OC 1H93A 1HORA 2O7NA 3I2YX 1UFOA 3G8BA 4HAYA 1Z6XA 2XQIA 3BWMA 3S44A 5E1DA 2OGZA 3HV0A 4WLVA 4HFGA 4CDRA 3LVQE 1P33A 2DZDA 1ELWA 1T5OA 1N6KA 4L1KA 1D09A 3OMWA 1P0PA 3AIOA 5EIBE 2Q7XA 3FZQA 2AN5A 4CGZA 1MOSA 3BT7A 3KL2A 3LDHA 4E7OA 3CSTA 1KEWA 2R1TA 4YJGA 2R5WA 4IAOA 1P17A 4JITA 3UXHA 1O97D 2VDWA 2GBIA 4ZRNA 2OK7A 3FTSA 2BGIA 1ZSYA 2AG1A 4ZMRA 2H16A 4P5EA 1WPQA 3VU9A 2M6SA 4H7HA 4HBDA 4E0BA 3CUEF 1FUUA 1WB6A 3UC9A 3B1XA 1E7UA 4Q34A 3CX3A 4UBJA 1PO7A 3SF0A 2C5LA 1JKMA 4BLVA 4P98A 2YX1A 1QR2A 2WOJA 4LWPA 4MW5A 1KH1A 2ZJ7A 3ZTTA 2YJTD 1EGAA 3AJDA 1KYVA 1IN7A 2HR1A 2ZGVA 2MYOA 3T9KA 2J6IA 1PDWA 4MW7A 1DJQA 1TDJA 1BKYA 3DV9A 4F04A 3ZCQA 3JVVA 3X2FA 4I81A 1H2FA 1KDZA 2WJYA 2HDHA 4O2LA 4IIGA 5FBQB 4HFNA 5FQ8A 4JKIA 3ZHBA 1O6FA 4J9VA 1KMHA 3BFJA 4O2BA 3N1UA 2P9EA 1MABB 1P0CA 5ICCA 2YQ8A 3I4LA 3ACBA 4IV8A 3FI9A 1F7UA 3UIOC 3WB1A 2AJBA 3PD0A 4HADA 5JDCA 1RYFA 5HKPA 1TU3A 1QRTA 1MX4A 3IHKA 3OOWA 4KGZA 2X23A 1TEVA 4POOA 4N5QA 2PTHA 4B3MB 4AG6A 4HXYA 4MIEA 2VF4X 1FMLA 4F53A 3ONDA 4DV0B 1X70A 3C5WP 4XCVA 4V39A 1XZNA 3S2ZA 2PQRA 3CH6A 1GADO 5AOVA 2VUIB 4FNMA 1TUBB 2RK4A 4C4XA 1TCAA 4EQ6A 2FMTA 5CLJA 3HPRA 1UQUA 2PGDA 1FX1A 4XYEA 3EYAA 3I9OA 1IZ9A 3HL4A 3K96A 2AI1A 1D9ZA 3QE3A 3QDNA 5J2TB 4UVGA 3PWTA 4QTUB 4P9NA 2YIMA 4GWLA 1SU8A 2JLWA 5K9ZA 1UPAA 3BB1A 4IGAA 2B7CA 4HV4A 9ATCA 1LLCA 1THZA 4CL2A 1X7YA 4YRPA 4R16A 4X93A 3A2NA 4F97A 4U3JA 4H7YA 4HWTA 3V1NA 5KCZA 5CYFA 2C92A 3LOUA 3GZTB 3GG2A 1KKUA 4A0SA 4LHWA 5AJXA 3TLBA 1Y5NA 3WB9A 3EXFB 4K2AA 2FETA 3F3YA 2VRCD 3NZUA 2I7XA 3SYKA 4DWVA 1Z6TA 4I4LA 4IDHA 2B35A 3HFGA 2WXMA 1Q91A 4G81A 2XCIA 1M0WA 3FD8A 2GYYA 3JYSA 2XQVA 1SKMA 4JSTA 5D1NA 1U3FA 2JIRA 1M6YA 3WS7A 5LQRA 2R17C 1SVXA 2AZ4A 4U7WA 3KKMA 4ZREA 3CY6A 3GJ4A 1LF5A 2JFGA 5KYUA 2BP7B 5MFZA 1U2QA 3EIOA 2LTAA 5F12A 2OV8A 4U6SA 4AJ1A 1SZAA 2J30A 1XD9A 3IOCA 1EVLA 4GDMA 2YASA 2R65A 4GT1A 1WPRA 1CUEA 2BI4A 2JASA 5A0FA 1EQ2A 3TB4A 4BC1A 1NBIA 2PS1A 3UMCA 4MA5A 2XRYA 1G38A 1H2TC 1ZUNB 3E7FA 3ESRA 3L5KA 1H22A 2QS9A 1QC5A 1Z7BA 2F1OA 3LIIA 1GPLA 1XZCA 2BY4A 4A8JA 1L5NA 5AW5A 1A69A 4JDPA 1CSEE 3IR5A 2XWPA 2PU7A 1V54E 3SNXA 4AJ4A 3K09A 4YUZA 4IQ4A 4DQUA 2TSYB 1ZM7A 2Y1GA 5TPZD 2LKDA 2HUPA 4LMBA 1DX4A 1XCPA 2AUNA 4QUAA 1ABEA 3I6ZA 1LDMA 2H57A 1H6BA 4ZI5A 3AB7A 3GP3A 4K86A 1KE1A 1YUMA 4NJMB 5AMXA 1CE8B 2QI9C 4LMRA 4IJKA 4II7A 1FP4A 4N9WA 4FDUA 1U7DA 2FWJA 1QORA 3SE7A 1EVQA 2XVZA 4L02A 2R11A 1XQXA 2PUTA 2J3DA 4UAVA 3SF4A 3TJPA 3PV0A 4HOUA 4N5HX 4B35A 1N5KA 3GYGA 3KQKA 3UKJA 4E09A 1IZYA 1FSZA 2WB4A 1FP7A 3ZWMA 3O92A 2BLLA 4R2HA 4U0UA 4X8HA 4KDEA 4AC9A 4H4DA 4DZRA 2OBYA 3ZBTA 2PMKA 2M2IA 3K9CA 3MM4A 1Q0UA 1HK7A 3LW7A 2HXSA 1TM7E 2YW9A 3FPLA 1SK8A 4LJ8A 1A2BA 4IIVA 3LBNA 2OXCA 1V1MA 1IXSB 1PNOA 2PZBA 2WD8A 3JXJA 2RGCA 3LPZA 4Q7JB 2GD0A 3BJMA 3ASZA 1MENA 1LU9A 5HJ7A 2OCBA 2Y1OA 2O57A 5DTEA 2YC4C 3NBQA 3L01A 1GP2A 5FNVF 4E14A 2QRVB 3EPRA 3OUUA 4Z4HA 1T8YA 1NRXA 1UADA 3IDAA 3RAGA 5B6IA 4MNTA 5HR5A 2DCPA 4GOOD 1P0QA 2ZT7A 1OLUB 1XCBA 3TX2A 1DC5A 2QMUA 4BNFA 2OD2A 5IJWA 2DLNA 1OVGA 5E8JA 1CQWA 2H7YA 2YHUA 3ZEAA 2WE7A 5AYVA 2VUSA 4KL8S 4MUXA 4UCXA 1ACJA 3LDZA 1TZJA 4WCFA 1TFUA 2OMEA 4CHGA 2QAGC 4TMWA 4KGXA 2H92A 3WGGA 2I29A 3P4UA 1NP6A 1EM6A 5JLJA 4W9MC 3QLUC 4FILA 5CNJA 3EDTB 2F3PA 2X9VA 1OLSB 3GN1A 5ECWA 1NBEA 1GL3A 1CR2A 3T12A 2GZ3A 3PEEA 1EK6A 1AKNA 1I13A 3KR2A 2E4UA 4GC5A 3B1WA 3W5IA 3ZD6A 2AHRA 4Q7LA 3P4XA 2VRCA 3C15C 1XNQB 2FCRA 2I5PO 1RZVA 1HZZC 1RWMA 4H7DA 2Y0BG 3GYBA 3PTZA 1KWGA 1L7RA 5LDGA 4OSOA 3UCFA 1EFRA 3IP6A 5HIIA 2ZRGA 3IVCA 3T4EA 3JQFC 3KKQA 1C7JA 2AW3A 4C5BA 1YMQA 1MHTA 3AYZB 5HDBB 3DLAA 3BDIA 1EIWA 1X9IA 3HI4A 3KTOA 3EASA 3GAMA 2CHXA 4BVAA 1EUCB 4RY0A 5IBCA 3I3NA 2RKBA 4JI5B 4HLQB 1CXZA 4J0KA 4B46A 3ZGOA 4HB2A 1FMCA 2BIFA 2WKSA 4WY8A 1TOAA 3FH0A 1NDUA 1WSDA 2Q41A 2VRWA 2AC4A 3WWDA 3RADC 2R8RA 2O6HA 2ET6A 5EFZA 4KBYA 5ECDA 4DIKA 2OCGA 4JI1B 4LG1A 3QRWA 4Q1VA 2F1HA 1X92A 2VUTA 2AD1A 2UVDA 1DIBA 1WXFA 1NXOA 3BULA 4RGYA 2QN8A 1Z6GA 3A9UA 2FZGA 2P4QA 4A0RA 1K6IA 3FBTA 3WXBA 1JHMA 2CFUA 4JB3A 3ZBUA 2IT1A 2B9EA 1Y4AE 4LXQA 2W2OA 2WXFA 4UHCA 4ERXA 1H1TA 4HPXB 4A0FA 5CT6A 4GMKA 5TPZA 2Q3JA 5CDUA 5C2JB 1XCLA 2Q1YA 3DM9B 3LSYA 5ALDA 3KFLA 2X8JA 5IXJA 1LVHA 3UAWA 1MNAA 4FDAA 2D2IA 1UBTS 4M1ZA 4F9TA 3NIGB 2C5EA 3I5YA 4FGZA 2POCA 5HJEA 3UM0A 1MB0A 5GGXA 3LT0A 3RHTA 2H1FA 3G0OA 2A3NA 2GPJA 4MLPA 1MYOA 3R3XA 1DFHA 1U0EA 3WGQA 4ETIA 3BE6A 2W42A 4DK5A 1OTHA 4Q3BA 5H7PA 3U9LA 4U63A 2F64A 4A9AA 5F21A 1E6CA 4IDPA 1YFKA 2B99A 2QDKA 4IIFA 3QFHA 3CT4A 1EP9A 2J6HA 2HV9A 5EHIA 2GZAA 4OGGA 3SLGA 4RVFA 2RK3A 3H1EA 1QH0A 3L79A 3GELA 3IURA 2YZ7A 1NVBA 3CK7A 4F2DA 2AR9A 2I8CA 2IU0A 3ANTA 2QUIA 1LVGA 3EHRA 4FX5A 4BNVA 2DUUA 4ARIA 4AKTA 4IIJF 2FPXA 2X4GA 2Q7OE 2YWXA 4GMHA 2QQGA 2MMGA 1BVYF 3E18A 4DR5B 4F1WA 2GK4A 4IQ8A 4MWCA 2NVUA 4FMCB 5G05C 1NLYA 3IB3A 1GL6A 1BJTA 1CY2A 4H1VA 5KSOA 1NF2A 3E5RA 1JZSA 2QM0A 3LUPA 4MPDA 5KPJA 4JUAA 2IZZA 1YFLA 2P6OA 1USGA 1P29A 1RIFA 5CCMA 3ICCA 4PS0A 1TA9A 1IC6A 3AM3A 3CC8A 3NG1A 4L8VA 5IAGA 1M2WA 4PO3X 2XDWA 3NHAA 4KWEA 3FPGA 3QHAA 1BXGB 4CUJA 2P0AA 1PHPA 3UK7A 1NDQA 5G0WA 4WFIA 5HK8A 4OHOA 2J32A 5SYMA 3MMXA 4FD2A 3ND7A 3RV4A 3TZKA 5A6SA 2RI1A 3BIXA 3PHCA 3T9BA 5DGCA 4MCJA 5KWVA 2O1XA 3U56A 1NR5A 7REQA 2A67A 5KMGA 2XB9A 1P1BA 2C8LA 3NDRA 1NBMD 1EGQA 1U2GA 4HRAA 2WMNA 2FOXA 3W7BA 4EB3A 2YTZA 2PGLA 3CX6A 2PL5A 2R6CA 1T10A 5I4KA 1UBSB 3EC1A 1IHDA 4B79A 1NURA 2GSDA 2GTPA 1LKZA 3FDIA 4CF5A 1BW9B 4EHBA 3H2JA 4EEKA 3PTLA 3JQ7A 5ADUS 1EUQA 4RTSA 2NU7A 3OZXA 3JASA 1YE5A 2IVFA 5LN1A 3L2OB 2YWJA 3QXJA 4CLDA 2IYYA 2J4CA 2V7PA 4OBWA 3CQ9A 2WYUA 2ZRHA 4YLYA 4BE7B 1T5BA 1BIFA 4H16A 4KO8A 1V3VA 2MCFA 4BN0A 3TSYA 1E1DA 3D4BA 1AURA 1N95A 1WPXA 3VKUA 3CLSD 1NE7A 1EWVA 4DXDA 3EXHA 1JAYA 4P93A 4FP7A 3IP9A 3EIUA 5JNVA 3RH0A 1KC1A 1I1QB 1N3IA 3LC7O 5T4FA 4HMQA 4N0DA 2C4UA 3UW3A 1FFSA 3CXRA 4NEHB 4BV9A 1ISHA 1DCQA 4J49A 2XENA 1N6OA 3AEKA 3OETA 5EZQA 4DDWA 2IEAA 1Y6QA 4WEQA 1ZD1A 3OZEA 2NUAB 3NIBA 3D6FA 1N3YA 3ENKA 1B0PA 1Y6JA 2Q5QA 1OBVA 5K0SA 4BMYA 3IELA 1UANA 4NENB 5JYDA 2VJQA 3QB2A 3GP8A 2J0UA 3PUXA 2ZIAA 4N49A 2Z1MA 2I67A 3ILSA 4BSZB 2MU1A 3OP4A 4YMWA 3RVNA 3CCFA 2L0IA 1M7GA 3NHJA 3MB5A 4Y2SA 1D5WA 3BJIC 1CNFA 1SKYB 3W2FA 4MDHA 1W5FA 4RA9B 1XLTC 2Z8XA 1NNUA 2CEAA 1NT4A 4KH1A 2C58A 4RJKA 3MFYA 4MZXA 4Q6WA 2AOUB 3MAAC 1QCCA 4UOZA 2QPOA 2PBLA 4LK3A 2EZUA 5A62A 4QT0A 3HJHA 5AI0A 3PT9A 4Q66C 4M9ZA 1IXVA 3JQAD 1GZ4A 2FGJA 1C81A 4DBLC 4TLAA 3ZD8A 3BJEA 1K5DA 2OD9A 3BGDA 3FNGA 1JTEA 3N2GB 4EJ0A 1VB5A 3WQHA 1J1UA 4ON9A 2B78A 2FB9A 1NP7A 4RS4A 3SY8A 2O48X 4LJKA 1UMBA 1J07A 3UHFA 4OXKA 1WU8A 5CMYA 3QVOA 4PBRA 4BBZA 4UBMA 3GNQA 4QPCA 3FYSA 5FR1A 1YRWA 5JU6A 1LJ8A 3JWHA 4P92A 3CB4A 1EZ4A 1UC5B 1J97A 1KY3A 3MT8A 1QS0A 2XF2A 3F0TA 1REQA 5F3WB 3ML8A 3LW8A 4E46A 3QK0A 3MSCA 2EATA 2PZLA 2FWNA 3IUSA 5I7RA 5TJHA 2ZBFA 1RM0A 2AL7A 5H59A 2Z2KA 4PYRA 2ALJA 3PENA 3DYBA 2AEFA 1V37A 2N47A 4ETNA 3N39C 4IO1A 4RQUA 5A9TA 4KX5A 4D43A 3SE0A 4KH0A 4ROTA 1DVRA 1P7CA 1CJUC 5ITWA 3NAZA 5FWDA 1ZGHA 1L4GA 1ELKA 1E6LA 1AG9A 3OOHA 5AM4A 2H54A 3GPCA 4LOIA 1W2GA 5AQ1A 3S1LA 2VZEA 4NDAA 5JXWA 2BFEB 1RYEA 2WAMA 2W6IA 2D2VA 2PS3A 3HMQA 3KZXA 4LV6A 4NACA 5BXYA 3CUWA 4NY1A 2DTXA 3EHEA 1QX4A 1NBMA 2C2MA 2XE7A 5IC5A 4EHKA 5JS7A 3WGZA 1B8UA 1CJKC 2WZCA 2JEZA 4U4AA 2PPVA 2D2XA 2C4WA 2QJFA 1C3JA 1W1UA 1D03A 3LS2A 3AF0A 4HEA6 3REQB 1PE0A 4ZFHA 1DKOA 3AS8A 2W43A 3VAAA 1QRAA 3D9OA 3QKWA 4D80A 2PZFA 2R03A 4TMKA 4UUBA 4GTPA 2DFTA 2O5EA 5BXUA 1DC7A 3KCNA 2XGOA 3M8KA 1NXTA 3BK7A 4LDNA 4UDNA 2VJLA 2PSFA 1BROA 2OBNA 1XFDA 3LWBA 1ZNZA 3UPDA 1FVOA 3WGVA 4UEKA 2REOA 3QVVA 5FOVA 2A5JA 4F2GA 4PQEA 2IH5A 1YUNA 2DFDA 4WKGA 2EBWA 1EKXA 2KLBA 2FX2A 2JB9A 3FTPA 4PPNA 5A6CA 1A5BB 3Q4GA 1OTXA 1IWPB 4DIBA 1AB6A 1TIBA 5HJ2A 2PUWA 3RSQA 2EQ5A 3AF3A 1IU9A 3E61A 1PWEA 2ZI7A 3EEQA 4W99A 5CB4B 1WZNA 5DO9A 3K0CA 1U3DA 1QHHA 1BX3A 2RGBA 3TIFA 4BOYA 1AUXA 3E1KA 4XX0B 3OCUA 2WXHA 4K1XA 2ZK7A 3AM1A 2UXBB 2QTCA 2X58A 4WADA 2ACWA 3GI1A 4F4UA 4D81A 4ZCRA 4D2IA 2OXEA 3PDUA 4BCCA 3JWIA 4DJTA 2FVYA 1G19A 4BNTA 4ZZ3A 2XYRA 1QFSA 2WZDA 3OZRA 5JYCA 4DLVA 3LZCA 4UMDA 2ZW9A 2OP0A 3VAYA 1IHOA 3R7WB 5TE9A 4JY7A 1ZMRA 4XGRA 3ZU6A 2VQEB 1JDNA 1F3OA 3NPAA 5E3IA 4EYKA 1U98A 2DQ4A 2TMGA 4MHTA 1T5SA 5AVRA 2I2DA 3FB4A 2Q5LA 1QPGA 1IHGA 4L07A 4KBFA 4ARZB 3ONKA 4AJEA 3KZMA 1D0VA 2P2SA 2HU5A 3KYBA 2PSSA 4DLSA 2WMYA 1GZDA 3JQAA 4GR5A 4O2AA 4G2TA 2OECA 1G3RA 3HUEA 3F1LA 5DTRA 4AZ0A 3GPIA 1IMJA 3AG6A 1E9SA 4RORA 3GFFA 5BNZA 2R05A 2SKEA 3FWZA 3AI2A 1DB3A 3FGNA 1Z3CA 4XIYA 3K30A 1JEJA 4ZQCB 4B5KA 5G4KB 4UM9D 1GL7A 3FFWA 3RO2A 2OGUA 2KYRA 1FTWA 1ULAA 1LPOA 4LPSA 1VYTA 4Y9DA 2O4CA 5B1SA 1K8YB 3K0BA 3DZDA 2XZDG 2JGMA 3MS2A 5MHTA 3B51X 2A4KA 2JLUA 1DJMA 1CX9B 2ZIRA 3OAAD 1XT6A 3WLAA 1XXLA 5DYGA 4C0EA 4NJEA 2YICA 4Q4JB 3MKQB 2D00A 1D1PA 5CERB 2D1RA 3ZJ5A 3VX3A 5E0OA 5KNLA 2B94A 3CRVA 1U0NA 3VR2D 1UBJS 4E12A 1YZUA 2ZJBA 3VZSA 2GJAA 4HEA1 3TXXA 3QJGA 1RZRD 4ZCLA 1L5KA 4FLMA 1L5SA 4F9GA 3KSBC 3ZK8A 5AXDA 3HYRA 4R2KA 4WT7A 3QITA 2WDPA 5FV4A 1XTRA 3PGJA 1PL7A 2PX5A 4NCJA 2VSOE 3P1JA 2YBEA 3H5AA 4PYQA 4L0QA 3ER8A 1CUFA 2WG2A 2BUCA 1DRVA 2APJA 3PNLA 3TRKA 4F60A 1CY4A 1Q44A 3HU2A 3CZCA 4WNAA 2Q07A 1W5SA 3U7JA 4RVCA 5H80A 5A5DA 2QVCA 1KQPA 2Q4DA 5H82A 2O3UA 1Q92A 1ZRHA 5HFNA 1YQEA 4TS3A 3A4YA 5FWXB 1K5GA 3AI7A 1ID8A 5E7IA 4FVTA 2H1SA 1HRDA 3ZK9A 1TM3E 3ZS9A 4UTNA 1UK9A 4B7UA 4KR2A 3AVPA 4FYPA 5TQVA 3FUEA 5DDIP 1R0XA 4DZZA 5EX0A 1XJ0A 3CU5A 3JQPA 3L16A 4PC7A 4FGKA 3S2AA 4EJ2A 4Q9KA 2AFHB 5DRTA 1XELA 4NZYA 4EVSA 1GTRA 3O1IC 4K7JA 3RRNA 4LECA 1ZM9A 3VYVA 3NIFB 2X5OA 2NADA 4ZAFA 1RPJA 3C43A 1S3FA 1EEXB 3GAZA 5FWNA 4BXOB 2ZU6B 1XNHA 5AVZA 4OCZA 4LE0A 3OTHA 4R1PA 3EF3A 2IEDA 2L0XA 5J3JA 1Q57A 3OIUA 4IJWA 4QQRA 2QTWB 1C8KA 1M9NA 5JJ7A 4Z99A 4R83A 6LDHA 3KTFA 4FOLA 1T9HA 5CBOA 2R0QC 4ZDKA 1V7QA 3ZH9B 1EX7A 3HSYA 3SJ7A 4I4NA 4I5IA 2ZVJA 3W5SA 2D8MA 1MA3A 3RVLA 1JLMA 3K3PA 4NU8X 3DBRB 2YHSA 3IKVA 1C30A 1EVZA 2DP4E 2IOFA 3VI4B 5JE8A 3LCAA 1G291 3GRPA 4TTRA 3OZIA 4LRZA 4JR0A 3V2GA 4ZU3A 1P91A 3N0VA 1RLMA 1DDIA 4YUXA 1NX6A 5A1TA 1FRQA 4HVTA 4KTVE 2NV0A 1P72A 3I5MA 3K70B 4QFBA 3OX1A 4GZMA 3OM8A 5AIAA 3E58A 4S3MA 4WZ6A 4D98A 1AUPA 2DF8A 4GRDA 5TQ0B 1C9MA 5CFPA 3SDSA 3KUXA 2WJWA 4BO8A 4MUGA 4QJ3A 2J59A 2Y69E 3MIIA 3KJGA 3SZ7A 5BORA 1CETA 5ALQA 3A9WA 1FK8A 4H3SA 4IOLA 2VCHA 1JVNA 5KYXA 1KOGA 2B6CA 2KPOA 2XNSA 5ISMA 4HFJA 3C7KA 3HWWA 2VC2B 4ND5A 1IRXA 2WM8A 2I34A 1AO3A 3IESA 4WQMA 1YB6A 3IAS6 2C3YA 1UFKA 1I7DA 2ZDHA 1HOTA 3R24A 4WUYA 5CEEA 5KWEA 1ELRA 1H2BA 2R6FA 3DOFA 3N05A 2AG8A 3M4JA 1GNPA 1SXIA 3U7IA 5I7WA 3L7YA 1QZTA 3UINC 4APOA 2IZ1A 4I17A 1Z5UA 2OBMA 3FFAA 4LSGA 2HXYA 3OAAA 2QBYA 2VUUA 3S6JA 5G2OA 1SVNA 5T8KA 3COZA 4A1GA 1MN6A 2EZ4A 2QYHA 1S0PA 2CGEA 1PJLA 2VK2A 2HBQA 3HG0D 1E66A 2Q1WA 4E7PA 4XPZA 1CDEA 1SCUB 4O1OA 1RZRA 2QYOA 1QFMA 5TSDA 3AFOA 1KBQA 4WINA 2CB9A 1SRQA 2VT3A 3FWNA 4BTVA 4Z9AA 4EYSA 3IDOA 2ZRJA 4GRAA 3U66A 4JGBA 4O5OA 4FYYA 3O5AA 3T3PB 5HGXA 5TXGA 2YZ2A 4M1SA 2OZPA 5DEOA 5LNK6 4QG7A 3VYTB 5BY2A 3TL6A 3AXTA 4YP9A 3SYTA 4RD3A 2OR3A 4U96D 4MQ6A 3PKZA 5LA6F 1QLJA 1MEEA 1OFGA 3UF0A 3CCCA 2EARA 5EXDA 2KZTB 4BNMA 4W82A 2VTVA 5EQTA 4LCTA 2WHEA 4A6DA 4Q24A 2IS1A 3D7KA 3AU4A 2I22A 1Y6ZA 3M3PA 3C3RA 3T5BA 1AE1A 4GD3Q 3TAXA 3JR7A 1AKMA 4TRJA 5AUPB 3ACCA 2JGIA 2FFRA 4UDYX 5P8WA 2OC4A 4ZOLB 4HRLA 3HYTA 1UK6A 1Z6PA 3DZCA 3PQ7A 5B3KA 1PHRA 1ZRMA 2Q7DA 3M9WA 4E08A 5E4TA 3VPDA 4PC2A 1NM5C 4BEPA 1SU4A 3RAEC 4X9XA 1HV8A 2H4WA 3HU3A 4ZYYA 3RYTC 1F0PA 2FO1E 3L7DA 3SZ3A 1BSVA 3B38A 5CA1F 3TQHA 4DSAA 4QG3A 5LMUB 1YHNA 1VYHA 1O08A 1Q2UA 1HDOA 2CLMB 4LYJA 1W6RA 2VTDA 4INJA 2EFHB 1SUFA 4WJZA 4E4RA 3NB0A 3MRTA 3U7HB 4HVBA 1CP2A 3SMQA 4I1RA 1UBFA 1HC7A 2Z8YM 3Q87B 1E8DA 1E7MA 4RW0A 5DSTA 4ER3A 5KC8A 2FX3A 4OOEA 4FFWA 2GWHA 1R9NA 4WY2A 2IY0C 3RYHA 4HDMA 3BWXA 1QQEA 2YS6A 1QGUA 1NFIE 3OLZA 3RG8A 3IAS1 5DYWA 1GAQA 3KTAB 4Q9DA 5REQA 1N36B 2H11A 3GZ2A 2IYQA 1KDVA 4TS1A 1MA0A 4KJXA 2YRXA 4GI5A 5TPWA 5LQDA 2G8NA 3DNPA 3AFIA 2E2WA 3EDCA 3AR8A 1UXJA 4Y1EA 5FZSA 3TQRA 4FOTA 2Q6TA 4V3BA 5LR6A 4JENA 1ZVMA 3TWVA 3UK6A 4NE2A 2MINB 1CRLA 3PU6A 4G56A 2GSWA 2C59A 2WUGA 2DAPA 4TV3A 4W8GA 1V45E 3U3RA 5JXGA 1BMTA 2EAUA 4RVOA 5G0UA 1SA4A 4LZZA 721PA 3B7RL 3UGQA 4WPGA 4INOA 2VDLB 4MITA 4OI0A 4Z4EA 4C2TA 4DR2B 3MQ4A 1M1ZA 1S4MA 2G1KA 4O4HA 3SNHA 4P1ZA 3O90A 5CT4A 5FBHA 4R81A 3FYTA 1KP3A 1ZJ5A 4BFWA 5JJ6A 2VF2A 5G3ZA 1PZFA 1DAKA 3HCCA 2BTQB 1J7KA 3A9RA 3IODA 2G80A 2I1VB 1LBIA 3KOXA 3D9LA 1CZOA 1G20A 2JHGA 3DXMG 3F6QA 1VA4A 1E1LA 3L6EA 1TW3A 3D81A 1BDBA 4H4CA 1VE5A 5FA8A 3A6PC 4MRVA 1M1YE 4XR9A 4KR9A 3BQMB 3ZZ0A 3WK7A 5AWFC 2ZJ2A 2H0QA 2WKRA 1L4MA 5DXJA 3HP7A 5AI6A 4UCFA 1I36A 3OJWA 3LUDA 1R4NA 3IMGA 2EFDB 3RFXA 4OLJA 4TKUB 1KHHA 3KYCB 5CITA 2VO1A 2QRJA 1YCDA 3E5HA 1X1CA 3W9UA 1TQ6A 3H8SA 4KZPA 3QKRA 3ZDDA 2D5BA 2FXVA 1KZ7B 2FWPA 1O94D 3NJ8A 1GZ6A 1N2JA 5F9MA 4F4IA 1I10A 2XNJA 4CI9A 1YNOA 4RM3A 3W8EA 4CKXA 4GI3A 4UOQA 4JP8A 3OZ7A 3MJHA 1YDHA 3GFVA 3ZX5A 1A8HA 4RF4A 1P9NA 1KPSB 1Z3YA 3EHQA 5KQLA 3PXDA 1PS0A 1LBTA 4JH0A 2QD5A 3SLRA 1SKBA 4YROA 2X19A 1I7NA 4G5FA 3QMMA 5KOYA 1QH8A 1NN0A 1SVOA 4O1IA 4MMZB 2V1UA 3ZCRA 3SXJA 1QIFA 3CGHA 2BW0A 2XPYA 3JZDA 4MIKA 1TUGA 1V4NA 1DX9A 2P9TA 3GLIB 4HZUB 3ST7A 1H0KA 3G5TA 1RQRA 3HZRA 3CCBA 3M3HA 2MR5A 4KE9A 2ADFA 2B0JA 1RABA 2WTMA 1FW6A 3OEYA 3O47A 4G8KA 3QE2A 2DERA 1NTRA 3BEDA 2VGEA 4JI0B 4I19A 5CBKA 4HEJA 3RC9A 1UDBA 3R8FA 2XJ4A 5A4IS 1TRHA 2VGXB 2JARA 3R9XB 1SEVA 4R8KA 2HIGA 1Z35A 1HS6A 2DPYA 1Y89A 1GLGA 2HHAA 3SHOA 5D0OD 4DZTA 1MD9A 3NETA 1PJSA 3IV7A 5DIFA 1ORTA 3QUTA 1XB2A 5KI6A 3O94A 3KPYA 1KI7A 4IVPA 2HPHA 4QSHA 2ONDA 4GYJA 2XW6A 2Y1LA 2BFBA 2CHVA 3UHJA 4BP1A 5AKGA 1Z6YA 4CKBA 2P35A 4KN6A 3BTSA 2ZS9A 1QCZA 4TWJA 3Q6NA 1O54A 1I51A 2G70A 5K6AC 1SWWA 2G88A 5BV2P 3KSAC 4RXMA 3LLMA 5HE9A 3L6CA 5KYTA 4CKCA 2DWCA 3NKVA 2Y2UA 3Q1LA 3FVRA 2KE5A 3S55A 4EHAA 3TM4A 4JXXA 4H1WA 5FJJA 1ZVVA 3RAPR 1TYEB 3T3EA 1CQIB 4RYLA 2QAGA 3ADCA 4DX1A 4EZIA 4BESA 1ST2A 4CM6A 2XMZA 4LZNA 3OESA 3NC4A 3QLUA 4TMZA 1YVDA 3VTYA 2ASVA 3UTDA 1VECA 2E5FA 3NPMA 3ADOA 2XCQA 1BXZA 3JU3A 3PDNA 4M8NE 4TYPA 5EKTA 3ZQ6A 3HU5A 2EHJA 1OSNA 2PFSA 2VAVA 4MQUA 2GW1A 3AVOA 4F7AA 4PXSA 1SEPA 4A92A 3TEMA 3VSAA 5DBFA 3B7GA 3NKFA 2FPGB 1HZZA 2Z5FA 3R7NA 3A9SA 1CR6A 3LQ4A 2IC5A 4EBAG 2ANBA 4JOQA 5EERA 1YKGA 4DMLA 3JX9A 4UWLA 5FFMA 1UJMA 1VE7A 1I4LD 3ESZA 3OT1B 4I36A 4ZCTA 3RC2A 3EXG1 2VXOA 3JQFA 4RK0A 4QDKA 4HX2A 3CUUA 4RTMA 2J08A 2PSJA 3CRRA 1BEEA 5AKYA 2OO3A 3CW9A 1HY3A 3B3JA 5DM2A 1B6GA 2DB3A 1U2EA 1GA4A 1K8ZB 4G1TA 3U13A 3JWPA 3LQRA 6NULA 3R7AA 4RS3A 4MS1B 3NCHA 3VR5D 4D9MA 2QRKA 1GJRA 3E4CA 4WXHA 3CE9A 2CXSA 5E2BA 2W2KB 2GZMA 4Z3DA 1XVVA 2FO7A 2C0PA 4JYBA 1G8KA 3NB2A 2P6RA 1AHIA 2XUGA 3KAEA 2Z2ZA 4OGFA 3UJ9A 4U02A 3MTEA 1NJ8A 1BS2A 3LZ6A 4Q7KA 2OQIA 1EDEA 4Z6KA 4ZOAA 3FTYA 4OUDA 3V7NA 2A78A 2Q0XA 5FNZA 2RAFA 3QU5A 3WHLA 2BEWB 2MSKA 3DBLB 3TLMA 4FJ2A 4CL8A 4ZMBA 4YRAA 3HDTA 3CLTC 2HKIA 3AEXA 1Z13A 1N5IA 2PL1A 2DLDA 3M6AA 3AS4A 4G2VA 3JARA 4CEJB 3B5JA 3E30A 9LDBA 2H2FA 5D51S 2NM0A 3VKHA 3CSFA 1KGDA 3E1GA 1UBNA 1A88A 1SHZA 2ZIGA 4WVFA 3PJDA 3UYLA 1HI9A 4QZVA 1X80A 3QPBA 3QELB 3OIGA 2FZKA 2ZJAA 2J9GA 4LEUA 4W1RA 5SYNA 2R7MA 1UOOA 1UPTA 5HKAA 4B80A 1PEYA 3Q11A 3D6JA 4EHDA 1ABFA 4GPD1 3DNFA 4NBUA 5AN8A 3ZE1B 2DMRA 4NMXB 2PLAA 4NZNA 3LYHA 4A1OA 3F96A 4M87A 4X6UA 4CQNA 4RPJA 4S1TA 4Q69A 4MPTA 3CZ9A 5AVQA 3GQVA 4L4YA 2C2ZA 4DGQA 3WGMA 1N4QA 4D4MA 3MQ2A 3MCZA 4LE1A 1BI8B 3FKQA 4TVOA 4E88A 2FN4A 4F8YA 2B5WA 2O2ZA 3F73A 5L3SA 1U9JA 3FWPA 4K0KB 3U0VA 1X1BA 5ELLA 2RH4A 5ENDA 2E0IA 4LK2A 1Y8QB 4TKVA 3EG9A 2XMSA 2ETCA 3WLJA 3Q7IA 4WBXC 4YP1A 1IONA 3VYWA 2DECA 1GO2A 3IJ5A 4URZR 1RRCA 5CH8A 2O3RA 5C52B 1CRQA 2WR8A 3FGOA 3UQZA 2LD4A 4DYVA 4UUAA 3ZDQA 1Y4ZA 3EZFA 4MUKA 3FFTA 3R9IA 4FINA 2JFBA 5H9WA 1JEEA 1SBHA 4NCAA 1FQWA 4C0JA 1HMPA 1ZLYA 1IJKA 4C3ZA 3O2JA 3MMSA 4BKMA 4YLEA 3IC5A 1Z34A 1G8AA 4EP1A 3TQFA 2IITA 1LWOA 1EYHA 1LB1B 4COKA 1HE3A 1SCNE 4I1UA 5YASA 3WYNA 4F3CA 5DHAA 5ADVA 5I9TA 5KNDH 4DS3A 2HRZA 4XGQA 4NEQA 3W4KA 4B87A 5I7SA 2WWWA 5TS3A 1L5MA 3THYB 2DBZA 3NHFA 2ZXEA 2JGDA 1AT1A 4ZO7A 5FADA 4JXTA 3BMNA 2EBFX 1Q17A 4EPXA 2FJ0A 4FUTA 1OUMA 4OHZA 3DVSX 3CGGA 4CMBA 4WESB 3QPUA 4QAQA 4I50F 1QYRA 4BB9A 5EYLA 1D7OA 2LNIA 1AF7A 3VR5A 4ZDIA 1PS8A 5EWJA 4URWR 4N3NA 2CDCA 4KAJA 1TLFA 5JG7A 3WFIA 1UC9A 4KAFA 4PX9A 4D92A 1ZLXA 5LBIA 3F47A 4ACLA 4FJ1A 1NOKA 4Q15A 4PG7A 4LDZA 2PZGA 3F9RA 1NI1A 4CDNA 4JP1A 3PQEA 3DBVO 1Y0BA 3OPQA 2V65A 1A17A 3DTTA 4Q96A 1KDOA 1DBRA 4A0QA 4EUHA 2P9JA 1WDYA 2JH8A 3WBBA 2WJPA 1SUIA 1NBOA 2XTZA 4C5AA 4C4PA 1KI2A 4M7PA 5HXAA 3S7BA 2ZSUA 2BCGY 2ZBPA 1P77A 2Z43A 2CXTA 5A3JA 3IUMA 4QJ5A 2N75A 1EFCA 1MZCA 4P4GA 6GPBA 1L6RA 2G5CA 1TVEA 1NULA 5KSYA 1EHCA 3EISA 3P2OA 4R2LA 4JC8A 2G6TA 1NBHA 2I91A 5BNIA 1IQRA 4PWYA 1O94C 1ZD3A 5AICA 3GHYA 3ML1A 1G9XA 4LWOA 3TEFA 3VH2A 2XEDA 5JHAA 1K1AA 5DV9A 4C48B 4X94A 3O4FA 2CXNA 3HABA 4BNKA 4GLBA 1RKBA 1XU9A 2GI4A 1D1SA 5AQ7A 4POAA 4RVDA 4CMAA 1W4RA 3KWJA 2N0SA 4MCAA 2PQ6A 1PGOA 1V71A 4URXR 1XQVA 2IKSA 2R8XA 1Z0DA 2R02A 3LY7A 4WKOA 3NOOA 3VTXA 3HKDB 4W5TA 4FFBB 2RH8A 2R60A 3PZ2A 4P08A 4XTRA 3VHQA 4B0OA 5LCWC 4ZFNA 1XLTA 4XQ0A 4CV2A 2YBDA 5FYDA 3DAGA 4LJSA 2CHZA 1G3QA 3WNBA 4QOJA 5JNRA 1ECFA 1DDGA 4JYMA 1ENYA 1S7GA 1IJEA 2J7PD 1GA1A 4Y2RA 3NDIA 3FHLA 1WW3A 3C97A 4MBGA 2GBGA 4XWAA 1V25A 3LVFO 3QWPA 3E27A 3GFPA 4OIFA 1PY1A 4HS9A 2NT3A 4N6OA 3TTUA 4RDHA 3GN2A 1N8SA 4QO8A 3UJDA 5JSZA 2BFCB 2HJVA 3K4PA 4GS5A 5TMPA 5T3YA 2AZXA 3EX7C 1UZMA 1NONA 1J22A 2NUPB 2B1GA 4R1NA 3FVTA 1OASA 2YZMA 1YZHA 4R3WA 1VXOA 2XT0A 4HSEA 4XUEA 4APFA 4KYVA 2J5QA 3S5UA 3MF4A 3JAMA 3L0DA 4PTLA 3R74A 3EZ6A 3MG9A 1QGDA 2HSDA 1V2HE 3HB5X 1P2TA 4WOPA 4Q47A 3FB1A 1U8ZA 1YNSA 2ZIFA 3A36A 1A9RA 4REQA 5JH7B 2X41A 2FP4B 2IPOA 2HDNB 5CB6A 1CUJA 4EI7A 3JYOA 4QU8A 5F5NA 3NYQA 4O02B 1BO6A 3PS6A 4TS9A 4UASA 3ZG6A 621PA 3WLQA 1EQUA 2HHHB 2VH1A 4JCCA 2RBKA 3W5VA 4M7CA 4PICA 3JSXA 3EEIA 5JNTA 4PLFA 3S27A 2J49A 5DT2A 3OTNA 4B9AA 3FYHA 3FMOB 4DLZA 4YCLA 3OEHD 2X5HA 1MBZA 1TM5E 4BYMA 3ZW8A 1TXGA 1E1KA 2I55A 3EJ6A 3H2GA 1WZCA 3BXHA 3EGXA 3GBPA 2JPDA 2LDBA 1A5AB 5CHEE 4C7JA 5JCZA 3HKEA 4BMZA 4ND3A 4NF2A 2JGKA 2C61A 3OJOA 1XRSB 4Q3OA 2ZUWA 1XPUA 4ZI7B 4UW9A 2OCYC 2JATA 3NQ41 1T0IA 5ALEA 3T5AA 3WSVA 1AD2A 2A9KA 3H5LA 1ONSA 1NPYA 1OKKD 4FFVA 3SXPA 1HG5A 1WO8A 3AKYA 2RJNA 1I1NA 3TXNA 1RRMA 3PPYA 5HDQA 3EODA 4TTTS 5DGHA 3HXFA 1A2OA 2IHNA 3AR6A 3OCYA 3DSRA 1NVTA 4AWXA 3I83A 5HQ3A 2HQRA 4X8OA 3A6ZA 2CNWD 5ANLA 1JJAA 4WNDA 1H0HA 4EUFA 4QODA 2BGGA 4PSKA 1L1QA 2CDBA 1ECLA 3PLAE 1JHAA 5D3QA 4TXLA 2Z6VA 2OT3B 4JT9A 3WNQA 2IX9A 2XOXA 5IKPA 1G5PA 3GHHA 4KO4S 1T6ZA 3R6WA 3ZXYA 3SGHA 1E6KA 5MN4A 2HA0A 1OTYA 5BMOA 2R8YA 1WULS 3SSMA 1NMEA 2FKNA 5FUMA 1QYMA 3FDJA 5SY4A 5ENSD 3NOXA 3UAGA 3D7MA 3SM9A 4Q19A 5EL0A 1SOWA 1ULTA 4UAGA 1K5HA 1B8OA 1RKXA 5JAHA 3ZWOA 1E7WA 1JXMA 3LUHA 2FPWA 5HRCA 1K6JA 1U0FA 5E6RA 3TR0A 2QX8A 5IAKA 3WFZA 4MRRA 1GRQA 2FRXA 1LV8A 3B3FA 4RKQA 4JLKA 2DX7A 2ZROA 3OE1A 2IIBA 4JKOA 4BETA 1KT0A 4LVUA 3RU3A 3TGWA 4X1IB 3FUCA 2UU9B 2J7PA 3S81A 3B48A 5K4HA 2X4DA 1BXRB 4ENWA 4DWOA 2BF7A 3IA2A 1G8PA 1L5HA 2PUEA 3NDJA 2WMOA 1G16A 3W3AH 1WG0A 1CP3A 4UPEA 1C2TA 4YRQA 3IAFA 5DZSA 2Q3LA 3K1TA 4MMXB 2V98A 1U3TA 3ND9A 3OKPA 3F8WA 5IASA 3P2JA 4HTAA 5IC6A 4U7HA 3PC7A 1YOVA 3UNXA 3HY4A 1ESCA 2Y0EA 4PIPA 2C2GA 1Q15A 2P9PG 2FW7A 2G17A 1SQ6A 3AOGA 1Y42X 2RKWA 2E3JA 1Q0RA 1XN4A 3U4QB 4PQGA 3ZWDA 2VHUA 2IYVA 3OJFA 3GT0A 1YZTA 4TXJA 1ZOSA 2G83A 5SV2A 2XDQA 3QEJA 1X1DA 3VNBA 1WUHS 3UT7A 2P0YA 4NATA 1W94A 4BGDA 3INTA 1DPFA 1RC1A 1ZXLA 4XX5A 4ALNA 5A3QA 5JRJA 5BN4A 3P9PA 3HDJA 1IBKB 4KNYA 4DLLA 4AJJA 3RYFB 1EBUA 3CNEA 4D8YA 1WY6A 3JALA 4DUZB 3SR4A 4U9HS 2FRVA 2VF5X 4UEJA 2RHOA 2WWIA 2CLKB 4R84A 3MA0A 1GTMA 4ER7A 2P1DA 4ZT5A 3SO8A 5B6PA 3RRMA 4Q9AA 1NBAA 2AOTA 3IBSA 4DEVA 4QYIA 3IPLA 1XZ8A 4DTCA 3HYNA 2PQ0A 2W6ZA 4ZAGA 1NUPA 3QYPA 1Q1ZA 2ZTLA 5CCBA 5M2QA 3JATA 3TB6A 3UB4A 2CVQA 4HXGA 1E6WA 3AG5A 4DMGA 4IGFA 2H2WA 4EFNA 2CXPA 2NACA 2D6FA 1G1MA 2F0YA 4D82A 3WIDA 1NX9A 4GICA 3OEHA 5E1MA 2IXDA 3L9WA 5CX4A 4Z7JA 3QWWA 3EWIA 4CGVA 1E5LA 1EM8A 5HZKA 5CD9A 3F8SA 4RKRA 4BV3A 3TIVA 1FTGA 1PR0A 4KXLA 4ZC1A 2Q8PA 5B7GA 3FF4A 5AOXA 3FU3A 2EG5A 1W85B 4BNNA 3DT8A 1P5HA 3OT5A 4AU1A 2COKA 4ALMA 3HBNA 1RT9A 3WNVA 4PYIA 4F4HA 5BNWA 1JBQA 3K0FB 3EEOA 3N9IA 1OW3B 5ALJA 4DQVA 5LP6B 5D7BA 1OKKA 2QN3A 3ABRB 1TAHA 4EVQA 4JYCA 1R4MA 3O82A 5LUBA 2ZI6A 4PGAA 2C4VA 2GZHA 4TSKA 1YBVA 5I4BA 3ER6A 4NBWA 4CUZA 4B6JA 2ZITA 2QGFA 3PDWA 3WKEA 3HJTA 5FWAA 4MCHA 4IJVA 4IRUB 1U1GA 1DARA 1TCCA 3CJRA 1SXHA 3F71A 4UEOA 3ZCTA 3I8SA 1OY3D 3R0IA 3CNHA 2A0XA 2XB4A 2IOSA 4IHJA 1HSOA 1Z5PA 4XE5A 4L8FA 3VVLA 4HUQB 1HLGA 1QK3A 3W8FA 1H4TA 5AJVB 2QTAA 2ZYRA 4NCIA 1WM5A 4UWKA 3AKEA 4M0UA 4PYNA 1A7AA 1XU4A 4RV9A 2C1EA 5ENPD 4JIGA 1TPYA 2G5GX 3EUWA 4X62B 1W581 2ZCVA 4F9EA 1JEOA 1TA0A 4HAVA 2A1IA 3RKUA 4ESHA 4U0KA 4GI1A 2BFDA 1KI8A 3RSHA 1R15A 3GCGA 1DTEA 1VCHA 4HR7A 1JRLA 2EQBA 1XZFA 4FX2A 4BO3A 2OHVA 2V1XA 1P1FA 3IEVA 3FOFC 1TJ4A 2R8PA 2O0LA 2NQ2C 5IYZA 4HYEA 3ZHYA 1UC8A 4Z3OA 4PF1A 4BO9A 2B0OE 3D54D 2PHZA 3URMA 4WN9A 2W8BA 2YY5A 3PHBE 4MQFB 3WI7A 3H8VA 3ZWPA 2I4NA 3L4SO 1I2BA 3WXXA 1M2VB 1A9YA 1U5AA 5I4IA 4YIHA 4ZYXA 4BP3A 5GMOA 1OREA 1CUXA 2AH5A 3SS9X 1M6VA 3KE8A 5J23A 4JLOA 5FQNA 4MROA 1GTL1 4JEHA 2OP1A 1T4CA 2GJSA 4RJLA 4Q4CA 5DP1A 3BXEA 4UZFA 5A1JA 4NH0A 4BTLA 4ONEA 4XGNA 3GOQA 4DWJA 1UP6A 4IG9A 3RO7A 3O8OA 1E99A 3GGCA 1JHVA 1IY9A 1L4NA 4OGWA 4KFCA 1WVGA 2J9XB 2NPOA 3MGKA 1NQAO 3LPNA 1JKXA 4DCGA 2I7TA 5DYNA 1UBMS 3E05A 5J2UF 1E18A 4LVCA 2ZXWE 4B44A 5FI3A 1B15A 3DT9A 5ICEA 4R7GA 4C2UA 5EIOA 1IHPA 1A9ZA 3EHDA 5T4EA 3X43A 2PNNA 4FYKA 5CNMA 1ZQ1A 4AG3A 4Q4HA 3JZFA 2O3SA 4JEMA 4IQ0A 1FNSA 2H9YA 2JBHA 3HO1A 5HBRA 1NXVA 2F3UA 4HQDA 1C3OB 3ADDA 1MC5A 4D8UA 4IHKA 1UODA 2VJOA 3O26A 1HH8A 3D9QX 2C5BA 4J7WA 4RSYA 1SVMA 3HDGA 1DIOB 1SGWA 1KAMA 1J06A 3ZYKA 3KWFA 4P4TA 2J0QA 1U80A 1IXYA 4YJHA 1KOLA 4IMIB 2KM4A 3HJAA 1L4KA 4HGOA 2HYDA 5C53B 4F3RA 1RM4A 1I7QB 3U9TA 4CIVA 4HOYA 3TL2A 2P8JA 3TSAA 1UBKS 4DGSA 3Q78A 4XPIB 4HPJB 4MEAA 4P29A 3TOCA 4EHLA 5CEJA 2IYWA 4Y8VA 3T34A 4IH9A 5JC8A 2ODBA 3PQ3A 4DM7A 4QDXA 2P2CA 3UIEA 5J1TB 3ORQA 2M63A 4L73A 4F45A 1P6QA 3NZSA 3FPBA 4PFQA 2B69A 3UGTA 2ZUDA 2A9JA 5GV7A 2FQQA 2JAUA 3S70A 4C0XA 3HTXA 4MGZR 5EXSA 1M0EA 5T41A 5LKRA 4DBZA 5IVPA 3L7BA 4A27A 4XKBA 4G36A 4EGSA 3ETLA 5A2GA 2IZ0A 3AEUB 2UY1A 1XCJA 5FJIA 4ZU1X 3QU4A 2DFKB 5FYQA 1NMQA 4S0ZA 3VR4D 2JGEA 4PFJA 5HIMA 4YC7A 1KMIY 2EKLA 3TDKA 2R00C 3BE5A 3E84A 4X44A 3WIBA 5LQCA 2HTEA 4J1TC 3UN1A 1NM5A 4I8DA 1ZC4A 2HM8A 3N28A 1ATIA 4F5ZA 4MVJM 2P9SG 3CIFA 4CMHA 1YQQA 2GNOA 3U3MA 2FPIB 4ZJUA 3A26A 4W6QA 3ZDXB 3UAZA 5KYWA 1WTAA 4CCYB 3HDQA 5HG0A 4BKQA 4IJQA 1AKYA 1UOQA 2JI7A 2QPTA 4XIFA 2CZGA 4QOFA 5NLLA 2Y67A 4BKPA 1RKVA 3GXBA 1XF1A 4OBEA 3UKUG 2ZZNA 5JS2A 1NGSA 3LYLA 4HG2A 3JVEA 1VG9B 5AVKA 1PR3A 3EQ8A 2ZCUA 2H17A 4JP5A 2KHZA 2J3IA 1XVIA 2O20A 5CB8A 1TMKA 2UDPA 4TUYF 1AOXA 2D5LA 4H17A 1J8DA 3UQ3A 3QVUA 2PT7A 1L4HA 4G1MB 5A3SA 3HR7A 4W9NC 2AN1A 1RYHA 1C3LA 1K89A 3Q7RA 4B33A 3FZNA 4JR2A 4CU5A 1UWVA 1XTIA 4QBGB 4E4TA 1Q0SA 1XHEA 1UFVA 2BZ1A 3EEYA 1SG6A 5BXQC 3UAXA 2F43B 3WC4A 2AQ8A 1SBQA 2VJMB 2WM9B 4ZTBA 2RJOA 1RDFA 5AHWA 3H75A 3K6SA 3EEFA 1RKQA 2I6TA 2IVZA 5HGJA 1C4KA 1SKYE 4ZWNA 2P9HA 2JFVA 1J09A 3A32A 5G2NA 3W04A 3FHOA 3ZZUA 1MX5A 5EIFA 5EFOA 4GOJA 3ZDCA 1MNQA 4QUJA 3O9VA 1NW7A 3V8MA 3C7CB 1ZH8A 3H5NA 1EFPA 4YAWA 1HQKA 3HNRA 2MYTA 2PUJA 1R10A 3C3PA 2QWXA 2HLPA 1D6NA 3PREA 1AHPA 5JZMA 3IH5A 2HBRA 2JD0A 3FTXA 4DA8A 1AIPA 4RBNA 1T3ZA 3PITA 4OK3A 3O8RA 3L1IA 2P3SA 2VDMB 1EK0A 1NHWA 1XJCA 2YWBA 3EARA 4B8WA 2XT6A 4NQZA 4XB6B 3NBZC 1I2MA 3OA2A 2Q3EA 2DYRE 5F7JA 4OQ4A 3QTLA 1CKEA 4OP3A 4IXTA 3SDZA 4CV0A 3DMTC 2QVZX 5FLKA 1ZDMA 1U2VG 4M86A 1LPMA 4QARA 4L9WA 2ZI9A 2ZYSA 2GPSA 1LI5A 2ZIUB 4YI5A 3V00A 1ONOA 2XMDA 3EW9A 4I1AA 4CR7A 2EW2A 3HCPA 3IMEA 5CK4A 1S64A 2WP0A 4EKGA 4RVGA 2O2IA 2I4OA 5BRNA 1USIA 5F33A 3DV0B 3VR2A 5LYJB 3DPYA 4YGYA 4C29A 3LHDA 5LWHA 2JBAA 3B2EA 4X1KB 1QM5A 1ZRNA 2LAHA 3BQOA 5B64A 1JLLA 4MQEA 4K6HA 1JS1X 1CHNA 4GC9A 4BX0A 4FHCA 4NU6A 4YVOA 1C7EA 4WXEA 2I3BA 2VRBA 1TW2A 5BR8B 1O3YA 1TTQB 3AINA 3TD6A 4HNHA 3C1UA 2IU6A 1OV4A 1Y7LA 2H3HA 5AHKA 2ODAA 3SYMA 3VOBA 4QX6A 1UKZA 2XGSA 4OXXA 1VL2A 3GYZA 4S2EA 2BZGA 2W6QA 4Q9NA 2I2OA 4GECA 2DH5A 3O1LA 2O7SA 3IS3A 3M6MD 1UFQA 1PLLA 2QN2A 4NS1A 2JAQA 3ASDA 3EMBA 4DMHA 4TYYA 2QVLA 4W8HA 3CLTD 5AI4A 3NWBA 5EYPF 5GZ1A 3DD5A 3A4IA 4BPRA 3RT9A 4TMFA 1N25A 4C2BA 2ILTA 3IX7A 5LOZA 3IULA 2Z1NA 2R86A 3OF3A 2BHLA 4RIEA 1UPCA 2NG1A 1WD7A 3B9QA 4RZ3A 4Y0NA 1PD0A 1QQBA 1GUYA 1S9DA 4EH1A 4CLOB 2FZLA 3N70A 3D59A 2QN9A 1FMTA 1VI5A 2IWRA 4D74A 1XD8A 4UMVA 1JJBA 3KEZA 3FFBA 3H5OA 1PRYA 4WGGA 5B58T 4DPKA 1KY4A 5ANRA 4C06A 3BG5A 2VNIA 1ZD8A 5IU6A 1KMMA 1PEAA 1R88A 1R64A 4TVKA 2A1UB 4YAOA 1Z7WA 3GF4A 1T9KA 1KXJA 4IV0A 4IUDS 3Q1KA 2VYND 1UZLA 1KJWA 2GZDA 4KACA 1ZKMA 1E0AA 3D3KA 4WA7A 3FZEA 1FX0B 3IUQA 1YKSA 2XAUA 2ZB8A 4IIBA 2NGRA 3DG9A 3HA7A 1KU6A 4O59O 2W4MA 5BQPA 1FDIA 4GMRA 3I2FA 3KPWA 3G6WA 1M8PA 2YDXA 4WOJA 1CQJA 3E03A 5K6AA 5COQA 3L4JA 4JI6B 4E3ZA 3DHEA 3DCNA 2YQ4A 3MJWA 3HIZA 4ZAVA 3ZHRA 3HXTA 1TM2A 2DHEA 4NQ0A 4ZU6X 1IJFA 4HN2A 1T8SA 7MDHA 4J3JA 4PEVA 1GQFA 5AUOB 1EFDN 2LDXA 5DLDA 2B1JA 3L0IB 2ZU0C 2TECE 2OLEA 4MUBA 5B5SA 2V5FA 3TSZA 3E15A 3BERA 3RC7A 4BDTA 2AR7A 4W5JA 1YRQA 2FLVA 3FNFA 1EE1A 4RWZA 3FUHA 3D3WB 2WXQA 3Q9UC 4BQFA 3UM3A 2G9NA 1C8LA 3FSJX 4N3BA 2RKOA 5ERYA 5E6UB 2JCBA 4EG6A 3S2GA 1JTVA 1POWA 5I6DA 5MN6A 2O05A 5K05A 1KRXA 1FRVA 4O4LA 3B36A 4X5OA 1IQUA 3FMPB 4LBZA 1A5EA 2LWIA 1HURA 2R8ZA 5BVHB 1FXSA 2WSSD 4TWBA 3FOWA 1O8CA 4YK7A 4UFOA 3HVJA 4RVBA 1E3QA 4I9HA 1N2HA 5FO0A 1JFFB 1S2IA 1I6WA 2P2GA 1TQ4A 1J20A 3BK2A 4FW9A 3QG5A 1Y6GA 2WXPA 4I9EA 3HKCA 1ZH4A 2XJ9A 3ROEA 5BVGB 2QAJA 3T95A 3E5NA 1K08A 3B2QA 4I5FA 4OQEA 5CA0A 4U7FA 3TWRA 3RFVA 2AFIB 1LX6A 1H5QA 4KWCA 4DLYA 4MUYA 1AS3A 2FVXA 3Q8XB 3QK7A 1RFLA 3V1YA 4XZ4A 3UH1A 4D0SA 1EMDA 3U7QA 1NJ2A 1WMAA 4G2NA 3K8OE 1O9BA 2IIQA 4FU0A 1WHTA 3Q0EA 3URZA 5JADA 1NTOA 2EIJE 2H85A 1YR9A 4NQRA 4FCTA 3O74A 5ENQD 4OQLA 1JKJA 5LXTA 5LNK1 1MH9A 1CUHA 3DR3A 1U7PA 2F17A 3LV8A 1PYOA 1WKBA 2C84A 3LLCA 1L4BA 1Q74A 3TXYA 4I9GA 3OQPA 5KQMA 4AZWA 4GOKA 5DMHA 1RQ2A 3OTWA 1J00A 3HB4X 3LBAA 4P2GA 2C4NA 1JL3A 4IYPA 1YQWA 2CE7A 5H5JA 4PSDA 4GGPA 4EG7A 3KB1A 3PLRA 4Q3CA 3ADBA 2ICAA 1H94A 4NYIQ 3WB0A 1W5BA 4R68A 1P2BA 5FTNA 3G0GA 3WXMA 1Z2PX 2JGRA 5PNTA 2QP4A 3NRJA 4IDQA 4UHKA 1T5DX 3OPYA 3KEQA 4JZYA 3CF4A 5JZBA 4UU7A 4XFDA 3BTOA 2IF2A 1NU8A 2JLAA 3KP1A 1NL3A 1IK4A 3H5TA 3JD0A 2AFHE 3NAMA 3FUUA 5F1KA 3DSSA 4HRVA 3BQNB 4DIMA 2FLKA 1C9EA 2HDWA 1YC5A 1UDXA 1X7DA 2OC9A 2OCDA 3KOUA 3SPXA 4B1FA 3D6AA 1KI1A 3CF6R 1Q5PA 4ZQGA 4OXYA 5KBYA 2XCBA 3OX3A 3IIKA 5EIBC 2OZLA 1D4OA 2I4RA 3MJVA 1RPAA 3OQVA 1GQOA 4I55A 3CHSA 1AA6A 3KEFA 3GLHA 4RA6A 1TT5A 5KDLA 1G9SA 1BE8A 1YRBA 1G41A 2GD6A 5CVJA 5JISA 4BNHA 3IDZA 1QF6A 1DU4A 2FPLA 4EF4A 2PR2A 5CDFE 2X1HA 1W30A 3PP8A 4RXUA 3DOJA 2OUKA 5IM4F 4WOCA 2YFKA 4LX8A 3KO8A 2W2TA 4JASB 1LC0A 5BSVA 2F3SA 2PVSA 2W93A 2Y27A 2Q8QA 4OXRA 4CKEA 1R37A 5IHXA 1UP7A 3JZIA 3M9XA 1TNBA 3V5NA 3OAWA 1ZD4A 2V58A 3MUOA 5KJFA 4BRUA 4H15A 4EB6B 4QYMA 4E30A 1HDYA 3Q75A 3EDYA 3W7VA 3OWOA 2IODA 4QXOA 5L7YA 5JCXA 2IY9A 2EJCA 5F5XA 3HCDA 2OFFA 1XQWA 2WT9A 4HZGA 4N1AA 5EIXA 3ANYB 1JMKC 2ADOA 1C7RA 3BHNA 1LC3A 5LQMA 3LM8A 4OX9B 3AILA 3R7QA 3D8HA 5AIBA 4CF3A 2FSUA 3WHIA 3EG5A 2P5SA 5FRDA 4PWZA 1TU4A 3OLVA 1K4MA 4E1VA 2PWYA 1H5NA 3CLVA 3DOCA 1XDBA 5JD5A 1UAGA 4S0XA 3ACDA 3M34A 1PK8A 5E4YA 1T2EA 1N92A 1T2CA 4YQYA 1MJGM 3RWMB 3WKDA 2VR1A 3PQFA 1ZITA 2WSSA 4DRXA 1KTVA 2XLCA 2HRRA 1EA7A 4J1QA 4PYKA 4YCSA 1VJCA 3U44A 5EE5B 3L5OA 1TNZA 5ALLA 5FLYA 5AVTA 1YQ9A 2AVPA 4F06A 3R0QA 3FI0A 3MNFA 2H9AA 4Q3DA 3OIDA 1YONA 5DNDA 2ZLBA 2XE6A 3PC3A 3G1TA 2R96A 4JLDA 3CVUA 4XGIA 2CWDA 4QVKA 2RHDA 2V55B 5AR1A 3LK6A 1TN7A 3AVYA 3GEHA 5DNAA 4CIAA 1F06A 5HQJA 1IBMB 2B25A 2HADA 4LA4A 4BZQA 3L6RA 4AYWA 3PTAA 1EDDA 1I5EA 3SZOA 1W87A 3GJZA 1FSFA 2JK1A 4BGIA 3PUVA 5J9FA 2Q99A 1QYIA 3NRBA 3D4IA 1X8LA 5COAA 1CY1A 2QTHA 1K63A 4D9NA 4FNAA 2ZYIA 3EK2A 4KG7A 4CEMA 2BF4A 5T7BA 5AJLA 2YJNA 3L3BA 5ULLA 1NMXA 1E89A 2CHQA 4DNQA 1VRCA 1IY1A 4LKRA 1VBMA 3TFOA 3U3DA 3IQZA 4FQ8A 1FDTA 1KTIA 3EPHA 1GPDG 3B9BA 1NVMB 2WW8A 3QX8A 1JILA 5ALMA 4Q1BA 4G1FA 3WLIA 4HKTA 1LZKA 4KEAA 3QBJA 4LRUA 2PIDA 4JC5A 4FFSA 2ISSD 4GYYA 1LDBA 2EJVA 3P20A 3ET5A 1Y5IA 1H66A 1YBHA 3RQIA 1A50B 5IUNC 4R9UC 3JQGA 5CM9C 4XA8A 1WLYA 1G4UR 1T6NA 1YR1A 1SZPA 1V11A 2G9RA 1O94A 5J47A 5FA6A 4ECEA 2XI4A 2ZSBA 3MWEB 4BFLA 1MAAA 3T5GA 1XTZA 3MJSA 2VPIA 3OPXA 2C9BA 2UXDB 2WVIA 3EU5A 3GCWA 4CNQA 2NVBA 1EFKA 3KU1A 3FR7A 4HH4A 3EE6A 3ERCA 4G5YA 1N2EA 3UM1A 1Q22A 5JBNA 1JR3E 5A7FA 2PH7A 3OH8A 4G01B 1L7MA 5FA5A 3W79A 4D02A 4ROSA 1KZPA 2NPFA 4RZ2A 5CFZA 1ILWA 5E76A 2VLBA 3GVHA 4GU5A 2IYOA 1BZYA 4PLZA 1EWKA 1DG9A 2ERXA 1N11A 4UXIA 3QI2A 1HYQA 2YFQA 3L92A 4ZDWA 5HUQA 2XXAA 3QVGB 1DEHA 3LCMA 4MKRA 3CZAA 2AYZA 4NBKA 2ZE5A 2O7VA 1WBJB 4B7XA 4JBYA 1SELA 3SP1A 3SI7A 3LWZA 1P2FA 3OPMA 4K6FA 4LOHA 4G5XA 5CM8B 1S01A 4MTCA 1TAQA 1JQJC 3DO5A 4YJ3A 1ZH0A 2QE7D 1E7RA 2HA2A 3F74A 5FOSA 1ZGJA 4Q3KA 4MS3B 1HR0B 3D2CA 1A8UA 4JUIA 3TLYA 2VGYA 3L7AA 2HYIC 3QLTA 2QRLA 3MPOA 3ZTWA 1T9BA 5EVCA 3IQEA 2Y4UA 1MAUA 1R8YA 1M2OB 1CB7A 3UAVA 4MKXA 4HN9A 2WY2D 4EO9A 1IUNA 5JWOA 4TLDA 1IAQA 2IYRA 4EJSC 1T8UA 3BL6A 5C3UA 4JJ7A 1F6DA 1JUDA 4M4SA 4RK7A 2XR1A 4MKHA 3IOMA 2H4HA 1Y37A 3DHVA 4CNBA 2ZWVA 2QY9A 4TV9B 1U31A 2IX3A 1G17A 5D7NA 4TMTA 4CTMA 4M9CA 3NX4A 5IKEA 3RGWS 4WXMA 5DISB 1GHTA 2XGGA 3QOUA 3O48A 3PUHA 5ESRA 4JC4A 1JLKA 3S8YA 1JSLA 1RYZA 3AY3A 1MX3A 3T1HB 4K9RA 3DPUA 3LQYA 2CUTA 2FFJA 4MKTA 3QEOA 2X3FA 3L8ZA 4W7HA 3TSCA 2RKKA 1XEWY 4NAUA 1U2DC 1G60A 3N8GA 2EF1A 1OH5A 4EBFA 3UFBA 4WWPA 1KK3A 4LXGA 2H08A 1N32B 4J0FA 5K7SA 3PNKA 5KAMA 4AUMA 1RI2A 5BW6B 2GF0A 4Y6PA 5LVAA 4ZK2A 4AQYB 5A02A 3OCXA 1SUBA 3OQJA 3T4XA 5L51A 4BNLA 3ID6C 4Y1FA 4AF6A 4ZT6A 1PFQA 3Q9NC 1PP4A 4IO0A 4JJKA 3ESBA 2XBLA 3SX0A 5FWQA 3QE4A 2F55A 3ZXUB 1CEEA 2ZUFA 3KVRA 4UFPA 3KJNA 5JZ9A 2QTVA 1OIWA 3RGGA 4XYBA 4EX6A 2PMEA 4ZODA 4LXXA 1UJKA 2AX4A 3R44A 2P2DA 2VNKA 2ZUBA 2HWKA 4I1VA 3CLKA 2IXEA 1WCXA 3DZJA 4ALJA 1NN1A 1MHQA 3DMFA 3QJ5A 1PJ8A 1A95A 1C9DB 2WHYA 2JFOA 1RXVA 2IOFK 3OQ6A 4R31A 4C7BA 4IXDA 3F8TA 4NOKA 4Z8YA 3T3OA 2Q28A 5KX5A 4MI6A 2E1PA 3LUFA 3IKTA 5CLFA 2V7UA 1QLWA 5DF1A 4EHMA 2PO5A 1OXBB 4D4LA 3CKMA 1FQKA 1UF9A 3U4TA 1RLIA 5K0FA 3G2WA 1XNFA 2QTRA 3CGWA 2OENG 4MQBA 1TECE 2DVMA 4B7CA 2ZB2A 5EWLA 1YRYE 4EG1A 5CP8A 5KTKA 4G63A 4PQFA 2QMEA 4PAWA 2NAFA 3E9EA 4CVNA 3WR5A 3U3ZA 4QD3A 1NSTA 1PJQA 1Z36A 4BP9A 4I5GA 2CL0X 2FN3A 2OHXA 1HXHA 1W7AA 4Q6BA 2YYZA 2YIJA 4Y0AA 4DSZA 3M6WA 5EY5B 1KRHA 4KKXB 4NMHA 2NNLD 5HKLA 1SG0A 3GLIE 4KSYA 3N2IA 4GVPA 1DAMA 1JA1A 3BWYA 4B6PA 3RS3A 1OYOA 4F3VA 3GRVA 2CLCX 3IE2A 2QR3A 3TVYA 3Q3JB 2HN9A 3PHHA 4H7IA 3C6QA 3M4YA 2HWXA 1Y1LA 1QHFA 1MX1A 3LLVA 3S1AB 2DQZA 5CW1A 1W2HA 3KOZA 2GKSA 4X20B 3H83A 4G5HA 1H1LA 2V7GA 2QX9A 3EOAI 5KWSA 1N4SA 4C1BA 3MZLB 2QUHA 4C7OA 4FGSA 3HCRA 2Y3AA 1BHJA 2JIBA 3NHKA 3Q79A 4GG1A 4BGEA 1OWMA 3WDKA 1TD9A 2HX1A 2FPRA 4YJ2F 1I8TA 3CG4A 2CFCA 3PNBA 2D5AA