3TAXA

A neutral diphosphate mimic crosslinks the active site of human o-glcnac transferase
Total Genus 271
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
271
sequence length
714
structure length
695
Chain Sequence
THADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A neutral diphosphate mimic crosslinks the active site of human O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 271
structure length 695
sequence length 714
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3taxA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3taxA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 3taxA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3taxA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3taxA03
5IKOA 4U0UA 1L7XA 3COPA 2Q7FA 2PYDA 3BD7A 3KAEA 5KJMA 3E3NA 2C4MA 2QLNA 3IAAA 5TMBA 1L5RA 3ASDA 2C0LA 3VTXA 1PYGA 1QKJA 3MRTA 2UY1A 1XNFA 4I17A 3LYAA 4KXKB 4N2QA 2F3QA 2C0MA 4EL5A 4EL0A 1C3JA 4U04A 1L6IA 5D0QD 4U0SA 3WXXA 2GT1A 4I2WA 4AN4A 2XEVA 1FC0A 3CUTA 2FF4A 2I6HA 2Y4UA 3MSCA 2VSYA 2HYZA 2Q6VA 3OY2A 3FP3A 3MRXA 1RZVA 1E96B 4W6QA 4GCNA 3HBJA 1FS4A 2PQ6A 2C2LA 5FT9A 4XI9A 1NZDA 2FFRA 3CK8A 1K08A 1XL1A 4EQFA 2QZSA 3CUYA 3RIBA 3AS4A 3OKAA 3CK9A 4B94A 4RIEA 5EX3A 3R9AB 1E1YA 1P29A 5LCWC 2YHCA 3DDSA 1PNVA 3T7DA 5C1DA 2C1XA 3HBFA 3NP7A 2GW1A 3S7FA 2E2EA 5BNWA 4CGWA 3C48A 3OY7A 2ACVA 1YA0A 2O6LA 4U0ZA 1UZUA 5LCWJ 3GUHA 5JJ6A 4G26A 3CVLA 3URZA 2L6JA 2P58C 2PZIA 1YGPA 4G23A 1GPYA 3D0RA 4KQ2A 3ZCVA 1IHGA 4Y6WA 2VCHA 4N39A 1GFZA 1FU7A 5JJTA 2BGUA 5EKQD 3GPBA 3MV2B 3FROA 4MICA 3RKVA 9GPBA 3JYSA 2G9RA 3BEOA 3G2KA 3T3EA 1Y6GA 1PSWA 2GPBA 5AYWD 3MKRA 3Q3IA 2XCCA 2Y4TA 2BISA 3NCHA 2PQNA 4WNDA 1FU8A 2XA9A 3ZHEB 1AHPA 3H4TA 1HZ4A 1LWNA 2WPVA 4G1TA 5I45A 4HLNA 3VUEA 2VGXA 1Z62A 4KQ1A 4X6LA 3LKUA 5G04C 1QQEA 4MRAA 2BUGA 3UYKA 3ASHA 2ASVA 2OOEA 5D00A 1M5RA 2F3UA 3VUFA 1A8IA 4X7MA 3VTYA 3HBNA 4CDRA 4LEUA 3H4IA 5G04J 3OTIA 3U3WA 3NAZA 4I1AA 2IF4A 2QN9A 1ZU2A 2XA1A 1P5QA 4N3CA 3ZCPA 4FKZA 4GZ6A 5A6CA 4WNEA 2QLMA 2SKDA 3C4VA 3G2NA 1WV0A 3GZ1A 3QWWA 3AS5A 2IV3A 5DXFA 3KD7A 2AW3A 2GEKA 4N3AA 2PRIA 4M60A 1KLXA 1JIXA 4LEIA 1EM6A 3U4TA 1QM5A 4YVQC 2VGYA 3S7DA 1B4DA 2FBNA 2QN3A 3NB0A 4REMA 3LY7A 1C8LA 2R4TA 4BQFA 3MT8A 4GA2A 4HOSA 4EJ2A 2VGXB 2XA2A 3MTAA 4RENA 3MEKA 5GPBA 2QRPA 3BCRA 1L5WA 3HYMB 2QN8A 4YI3A 3GW4A 2LSVA 4AMBA 3L7BA 3ZCSA 4I9CA 3C4QA 4MI6A 3RO2A 4G2TA 3S29A 2SKEA 4RG6A 5DBKA 2KATA 1B89A 4O6FA 3BCSA 4JL0A 4G25A 1E4OA 3ZCTA 5M72A 3QKYA 3OTGA 4GCOA 3AS8A 3NF1A 4AM9A 1WAO1 1RZUA 2GPNA 2LSUA 3OTHA 4GYYA 3G2HA 1FU4A 1Y8ZA 3DZCA 2KCLA 5G05C 5DLDA 2DBAA 2ECPA 3RHZA 4HORA 3MS2A 4UQZA 4BT9A 2R5SA 6GPBA 3CEJA 4RIIA 3E3LA 2FETA 3BDAA 4G24A 2VYIA 1JIVA 4RIHA 5ARGA 4RBNA 4RG9A 5G05J 4ME2A 3QKWA 3Q5MA 4RIGA 4YI5A 1FCHA 4BWRA 1GZ5A 3RT1A 2GM9A 5LQDA 3ESKA 1XOIA 1NOJA 4GA1A 2IYAA 3GZ2A 3L79A 3QOUA 1KT0A 2GPAA 1NZFA 3OXGA 4NRHB 5TVGA 4JHRA 5D01A 1FA9A 3NP9A 5KJKA 4MI9A 1EXVA 5ENZA 2HO1A 3O48A 3Q15A 2R66A 1NA0A 1GGNA 5FJYA 3WADA 2IEGA 2NC9A 5KJLA 3ZGQA 3S7JA 2F3SA 3MBOA 4APOA 4X7RA 2WQHA 1HXIA 2C1ZA 4F97A 5TMEA 4HOTA 4EKYA 1HH8A 2R60A 3Q3HA 4UQXA 1PC2A 3OT5A 3SF4A 2QRGA 1ELWA 1UQUA 4EKEA 5DIZA 3AMVA 1LWOA 3RSCA 3SYRA 2QNBA 3T3DA 2LNIA 3DDWA 3LPZA 3UPVA 1H5UA 2V5FA 4KBQA 2IW1A 3WC4A 2F9FA 4ABNA 2G9VA 4WACA 1FTWA 3EBOA 3RO3A 3CVNA 4XI0A 2AMVA 3MTDA 4RELA 4GA0A 4CTNA 3D1JA 3CUVA 2ATIA 3ZCUA 3Q47B 3CUWA 1P2GA 1FTYA 3S0JA 1P2BA 2H1FA 4UI9J 3VDMA 1XC7A 2QRMA 3CKBA 3MA5A 1ZBPA 2KCKA 2YQ8A 4N5CA 4BQIA 4L22A 2ACWA 2J9QA 1P4JA 2GEJA 1C50A 3Q4AB 2QLLA 4CTOA 7GPBA 2PRJA 3ZFWA 4UI9C 2XGOA 3ZN3A 5BT1A 4J8FA 2GJ4A 3IA7A 3LY9A 4KYOB 3FWVA 2AVPA 4I2ZA 1V4VA 2XMPA 2QN1A 4NC9A 1GPBA 3CK7A 2ONDA 1JG7A 3T5TA 3PDNA 4N2SA 1O6CA 1KT1A 3NPAA 3ZCRA 2QN2A 1C8KA 4HOQA 4Y6CA 4M7PA 4AIFA 1YA6A 3PE3A 4BFCA 2H1HA 2JJMA 1IXYA 1ELRA 3MT9A 2R68A 2R4UA 1XV5A 1F0KA 1FTQA 1TJCA 3GYZA 3QWVA 3MS4A 3NC4A 4W9RA 3CEMA 3T3GA 3CV3A 3MS7A 5FTPA 1BX3A 3Q49B 3OXFA 2XGMA 4UQYA 4WHMA 4WUYA 2AZDA 3CVPA 1NOIA 5FZSA 2JLBA 1Y8MA 3RSZA 5DU2A 4KQMA 2X6RA 4CGVA 3CX4A 4CTMA 4NQ0A 4J8EA 2BGTA 2XCIA 4Z5XA 3MV3B 4LDPA 4QLBA 3CVQA 1NZNA 2IYFA 4IN3B 2X6QA 2C9ZA 3FFLA 3ULQA 2AV6A 3G2JA 3MTBA 3QDNA 4GYWA 3LY8A 1K06A 1RRVA 1JEJA 1NVKA 1AXRA 4BT8A 5JJ7A 4NEQA 4MI3A 4GZ5A 4HOUA 1L5VA 3D0QA 4GPBA 3S27A 5IKPA 2F3PA 3MRVA 2YJNA 3DD1A 4BTBA 4NESA 4HWGA 5CHEE 1Z6PA 1WUTA 2XCUA 3MQFA 3VDNB 3TG4A 4F96A 2IFUA 1WUYA 3ASFA 3N71A 2P6PA 5JTTA 1ABBA 2VCEA 2SKCA 2QFCA 3EDTB 2HY7A 2FEZA 1P2DA 1WV1A 3TOVA 3MT7A 3EBPA 4WNFA 2VG8A 4YNDA 5HI7A 2FI7A 3O3CA 4WADA 5HXAA 4GPKA 1J39A 1HLFA 2HR2A 4U07A 4UI9K 1IYGA 3S7BA 1L5SA 2UWJG 4MHSA 5JTUA 1WW2A 1P4GA 3OKPA 3KS2A 5CCLA 2ZB2A 2XPIA 3BD8A 2VSNA 2G9QA 4A1SA 3TGOA 2IV7A 2KS6A 3ASGA 2XGSA 4MHOA 4BQEA 4WNGA 5KJNA 2FO7A 5D0OD 4FZRA 1KTIA 2X0FA 1Z6QA 4GYOA 5ARFA 2VQ2A 3TG5A 3BEEA 4BTAA 2KCVA 5FZQA 4N3BA 2G9UA 3G2IA 1SXPA 5A7DB 2X0EA 4N9WA 1QZ2A 3SYMA 3UUXA 1JG6A 3QHPA 3S2UA 4YUAA 2PQRA 4XIFA 2QRQA 3ZHEA 1WM5A 4GZ3A 1F6DA 1WW3A 4G2VA 4I9EA 3ZPJA 3LCAA 3TAXA 4YVOA 3ZCQA 4AY5A 4J0UA 3IEGA 3Q3EA 2UY1B 2IEIA 4X7PA 3K9IA 3BD6A 4AY6A 2QRHA 3QWPA 3L7CA 5BW8C 1L5QA 1XKXA 1SXQA 1NOKA 1IIRA 1XL0A 3L7AA 2PYIA 3TSAA 5TMDA 1Y6FA 1PN3A 3RJVA 1Z8DA 5FZRA 5CCMA 1OUVA 1GPAA 2BFWA 3L01A 4J8DA 2KC7A 3CKCA 4H7YA 3SZ7A 4PQGA 2JZCA 5HQ8A 4JA7A 3L7DA 4M83A 2OFFA 2IUYA 3T3HA 1W3BA 3CUUA 8GPBA 3E3OA 3WAGA 1JIUA 2MHKA 3CV0A 3S28A 3UQ3A 4AMGA 2WTXA 4F9FA 3CEHA 3OKCA 3UYLA 3HBMA 4RIFA 5EX0A 1NLMA 3G2LA 3BCUA 3T3IA 3PE4A 1VGVA 3RU0A 4H7XA 2FF5A 3CEQA 1A17A 2X0DA 1NA3A 1GG8A 3E4BA 2QN7A 1P4HA 1UQTA 2XCBA 3OXLA 4F3VA 4JA9A 2PL2A
chains in the Genus database with same CATH superfamily
2A9KA 5KYYB 4U0UA 1X87A 1W44A 1LLFA 1C3OA 1QK5A 3KQKA 4CI9A 3QF4B 3CH7A 2ENWA 3U40A 1Z0KA 4OREX 3E3NA 2FPGB 4M9ZA 4KK4A 4FN4A 3FZQA 1X2BA 3A1FA 1NUTA 3JD1A 2UYGA 4JVNA 3VM6A 2P40A 3JALB 2Q27A 3ENQA 3T5PA 1UJ2A 3EQ2A 3LW8A 4L3VA 1Q0LA 3NHZA 4ASUD 3OD5A 1X81A 1TMOA 4PLPA 3VI4B 3HPRA 1I4LD 4DAEA 4PPGA 1H19A 3R0VA 4NZMA 2XBLA 4CM8B 3ZBPA 2GK3A 2Z3VA 2ZXUA 4CEIA 1P1KA 4PV7A 2AN1A 4ZT4A 1OB5A 5AJUA 5CECB 4US0R 2IGBA 4ALIA 1E3TA 5KJEA 1R5BA 4EH1A 1IN6A 3ZWMA 1XZCA 3GH3A 4AY4A 1ZSVA 4YS6A 2QWXA 3WBBA 4OQPA 2Q6VA 2RKKA 4A82A 3ZIDA 3JZFA 4ZEVA 1FS4A 1RYHA 3LA8A 1CF4A 1UODA 3U80A 4R9UC 3VJMA 3QKTA 3VU0A 4DLBA 2C5SA 3LBNA 2YXBA 3QNWA 3FPLA 4II7A 1EG7A 2PE5A 2ZJ4A 1HDOA 3CN7A 3EIQC 3RBZA 2J3JA 4B94A 1SXJE 2E85A 3CEPB 2A59A 3GJRA 4KZKA 5CT6A 4YAEA 3VZSA 3PUXA 1JWAB 5K0GA 3IOCA 2QTRA 1YVUA 4RFSA 1CQPA 5A9SA 6REQA 3ND6A 5C1DA 5ANRA 3ZR4B 4KYUA 3M4YA 3C1TA 3AO0B 2Q1YA 3IEKA 3BOSA 3V8RA 2F8TA 3MCTA 1EESA 2NUAB 2QSZA 2JLZA 2VDRB 3SXPA 1NNUA 3WLQA 5IXJA 3N70A 1TFRA 5KTTA 1RYBA 4HAXA 4K6OA 5KNHD 1KU0A 4A3TA 1C9KA 1E2LA 2R62A 4II3A 3THYA 1QBQA 1XRQA 1JPUA 5B3SE 1QE5A 2C42A 2OCAA 2YFHA 2ZUBA 3BSWA 3GIWA 3GLSA 3KUXA 2ISCA 1YA8A 4XJXA 1UWVA 1NW7A 2HT6A 1O2DA 2WJWA 2WVIA 4IGIA 1Q16A 4KLAA 2BGUA 2W5UA 4X1KA 3EQ9A 5AIJA 4E22A 4RHUA 4ND1A 2ZUDA 2FI1A 1OTYA 5LFAA 1N75A 1Q1AA 3GNQA 4BFTA 4JSYA 1I6WA 3FUUA 4Z3KA 3M4JA 1UXGA 1V43A 3L6OO 4PSCA 2OVFA 2JBAA 2FJ0A 1UFRA 3TVDA 2F8XK 4WY8A 1FU8A 2UZIR 5LQUA 1NVWQ 1IPHA 1VG9B 3BZUA 4FEEA 3TTUA 3UAWA 1WETA 3S2SA 2HRRA 1F2TB 3NU1A 4X64B 2ZRCA 1P45A 2QMUA 3HRIA 3L40A 3SNKA 5BMOA 5LQMA 2WE7A 3TRKA 1SEPA 3D4PA 1P7CA 3PC7A 5AWFC 3W78A 4FE7A 5KTKA 5LP6A 1G2QA 2LCQA 1N6IA 3M49A 3AP3A 4QYWA 3C3KA 2MYOA 5DJ5A 1M5RA 1PZFA 2CVFA 2WJAA 4UMFA 3THRA 1NBIA 2FUG1 1SKYE 2QIOA 5BURA 3J5PA 4V3CA 1IN5A 1UWLA 3IOYA 1B42A 1BMQA 3IKOB 1IM8A 1KIFA 2H54A 3FUWA 4TMYA 5C1IA 2WD9A 5A0VA 2Q5HA 4DC1A 2X5GA 2DTEA 1RKBA 3HYTA 4Y9SA 1HT0A 3UIEA 4EX6A 3PR2B 1MO4A 3RUEA 1EK6A 2NTYC 3TH5A 1RAHA 2ETXA 2X5JO 4IDGA 1DWUA 2BL4A 3GGSA 3NIWA 1ZIDA 4E6EA 5JALA 4R84A 4KX5A 1XQ6A 4TTSA 1EK0A 4M60A 1XZAA 3B7BA 3DCIA 3DVSX 5EYPB 4JNKA 1QM5A 1BJRE 3LHIA 4LNGA 1B4DA 2QD3A 4PVDA 2BEJA 2H7VA 3ZOZA 4LI0A 2VYNA 1SM4A 4IIVA 3MJTA 3HXOA 1E8YA 2WT9A 5MGNA 5DI3B 2I03A 3FNQA 4IIFA 3BAZA 1PQWA 3WYNA 2L69A 2XUOA 4M9CA 1DG9A 4RZQA 4B31A 1J5EB 3ABRB 1TYAE 2AOWA 4XB2A 2QRNA 5B3KA 3HY3A 4JA0A 5BW4A 3V7UA 4ZDKA 4B7AA 3UCEA 3OPXA 1E0JA 1UBKS 3CRRA 4JJ8A 4BRSA 1JHZA 3HL0A 5GPBA 2QN6A 1AM4D 2NPOA 1R7RA 2ZYDA 4A03A 3GLIE 1KZ4A 4YC7A 1HQDA 3WNBA 4RVFA 3H1BA 3A9WA 3BIWA 5NLLA 5KQGA 1MABA 1N0UA 1JA9A 2UV8A 4RTSA 1LTQA 2X6IA 3K09A 4HUQA 3NBNB 1S3SA 1K4MA 3DO6A 4GWGA 3GP3A 2V9CA 3DULA 2KATA 1B89A 3U2QA 1VCMA 2DVWA 4FX5A 1RPAA 3C5WP 3OZIA 1TQ4A 3EEFA 3ZK8A 2V5UA 4BPBA 4QGGA 1H6PA 4FYPA 2CJXA 1NNSA 3PVCA 4LBZA 1R3UA 3RVMA 2BMVA 3ZCTA 3PCXA 2P2NA 1FJXA 1RZUA 3FMVA 1WAO1 3Q9UC 3OJEA 4HH3C 1HTTA 3PFHA 3NBUA 4FI3F 1MMFB 4O4JF 1FVHA 4H1WA 3DZDA 2XZLA 1R0LA 3DZCA 3QMWA 2RGNC 4CL2A 3J7TA 1QIMA 5FTMA 4LERA 4C0EA 2VDWB 3K2BA 4IIJB 4KDFA 5CXUA 4RSRA 3QXGA 4PGMA 1NP7A 1S5PA 4Y6RA 2VF8A 1XWIA 2ID8A 4N5MA 3RVKA 2Q7XA 2HBYA 2W2KA 3G2PA 2CMKA 3I8OA 1ST3A 3UV7A 3WGNA 1KI8A 4P31A 3V46A 1CUWA 3LUAA 3NTVA 5C8YF 4OYYA 2IHVA 4A1FA 1GN8A 1LK5A 3PC4A 5D3KA 3U62A 2FFAA 2XZTA 3P0IA 2ZBFA 1SB8A 4ENRA 2YR0A 4UYKA 3TJPA 3L79A 1G9SA 1I32A 2PSSA 3L9WA 4B4WA 2GPAA 1V9CA 4I08A 3FHLA 2BT4A 1UPCA 4QA9A 1JFRA 2PU7A 4JHRA 1UR5A 3L02A 2I7CA 4GI2A 2LCIA 2X14A 1D9XA 5LA6F 4RHXA 1IXSB 1TM7E 1DX4A 1KJ8A 2DSNA 1FA9A 3VZCA 1R88A 2X5NA 3NHLA 1KOFA 4ROSA 1FX0A 2VSOA 3U3RA 1EXVA 4BEBA 2IY8A 1XF9A 5KPDA 3L9TA 3EVDA 5EYLA 1D2EA 3MRXA 3PICA 5CJPA 5KJLA 4U7GA 3COWA 3WIEA 4F3TA 2YWRA 3ZGQA 3HGMA 3LD9A 3S7JA 4H60A 3VC2A 5EZYB 2ZSIA 4ICIA 1OLOA 3BHIA 1Z0IA 2HIMA 1LZKA 1TQ6A 4P4TA 1N4SA 4QASA 1S8FA 2ZJYA 3VV2A 1JJFA 1PC2A 3OT5A 5AKKA 5DM4A 2C99A 5GVRA 3VU3A 3JZDA 1DUVG 3EVNA 4LQCA 1FSFA 4P8RA 4GVXA 3TTSA 4TKLA 5EG5A 4UOQA 3BMOB 3PZ4A 3OC6A 4A1GA 3OSUA 5AVXA 3C5CA 2JJYA 1PR4A 3NHBA 4YGYA 4OSOA 2GFHA 4URYR 4AMUA 5ENSD 2G5TA 3QLTA 3ESDA 1M2FA 4RMNA 4TWJA 4P33A 3NIBA 2ZSAA 3O7MA 3PPVA 5CFPA 4W5NA 3EIJA 3S2GA 4ZEMA 1GL6A 1LNQA 2AOTA 2VUSA 3CUVA 2FX5A 1KPIA 2J0UA 2W2VA 3DZ8A 4DIDA 3ZTWA 2V8SE 3N76A 3FGZA 4FOOA 1BOOA 3QMPA 4ZI7F 1DOHA 4A55A 3N07A 4J16A 3RQIA 5B3LA 5EXDA 4GX0A 5D7NA 2XB4A 1I4OA 3MJRA 3CG4A 2VZ8A 3ZVLA 5I7EA 3IMFA 1I1NA 3I6QA 1OXVA 2HK9A 2VJQA 4ISCA 3HN6A 4B3MB 1NLFA 1L8AA 4FBGA 3ER9A 2FSGA 4BLRA 3EXHA 3EUFA 3QWBA 3QBJA 4UHCA 2XGOA 5A06A 1QQAA 5BT1A 3BA1A 2Q4DA 5GMOA 4LC1A 3V3TA 3LY9A 4GU5A 3FWVA 4IOJA 2QN1A 3ENKA 3R5HA 3GLGE 4BNVA 1NE7A 3HZOA 3QIVA 1WULS 1EFHA 2X0NA 3KPVA 1P1FA 1R8JA 1VYVA 3P9XA 2QN2A 3AJ9A 5IZCA 4ZQCB 2HNKA 4BFCA 1IVYA 1FMLA 1YJXA 2Y6VA 2A0UA 3THYB 3HVJA 2IPOA 2GGFA 1XV5A 3D2AA 2ZS7A 1R6TA 3M0EA 5F2OA 3TBKA 1VRVA 4KOEC 3UAGA 1RZRA 1Z68A 4XGRA 3L82A 5DX1A 5JQGB 4OQYA 4GIBA 5IEJA 5KNBH 3TW8A 4O4LA 1O5MA 3G79A 1ECGA 3G5AA 3PJDA 4KR9A 3IXLA 1P9NA 1VB5A 1JSLA 2PXCA 1GFIA 3UAOA 3LOUA 2VJMA 3T1YB 3VR2D 4WHMA 2NLOA 1VSBA 5C31A 5G1OA 2AF4C 1BQEA 5HFNA 1DXQA 4TYMA 4CM5A 1D4AA 1XTRA 3EZLA 4G5RA 3MKQB 1B2LA 1DC3A 1H2FA 1Z37A 2ZAOA 4CGVA 3FMOB 4X8QA 4I55A 4BSZB 3O75A 4XPIB 3ZUGA 1YE8A 1N95A 3A9CA 4GNKA 3ZWOA 1DKUA 1SGWA 2Y4NA 4D3SA 3PX2A 5IDQA 4R81A 1PZNA 2QPAA 1WE2A 2YXLA 3DFIA 1DRWA 1NUSA 4RKYA 4YJKA 1SVUA 1Z5PA 1G8MA 1W5AA 3VC7A 3IP1A 5KJ1A 2J0EA 5ICGA 2H52A 1URPA 4MQ4A 2DM6A 5JHHB 3SJZA 4UREA 3DYVA 3I2KA 3R77A 1G0OA 1XSEA 3ZWAA 2X6KA 2WM3A 3ESBA 1H2ZA 2RBEA 4X9XA 3VH1A 1ZGCA 1J7JA 2QTWB 3O4HA 3QSGA 1P0MA 3F98A 3ZUVB 2Q3BA 4IEFB 3P9CA 2ZS8A 2GD1O 4IVPA 4O25A 1ELOA 3ZWBA 1W0CA 5KS2A 2VYND 1J1ZA 2FEPA 2OKGA 2FW9A 4GZLA 3ENZA 3M5WA 1WUTA 1TA9A 3VDNB 3F6CA 1Q7RA 3W7AA 3DEJA 4ARZB 5BT9A 2VUUA 3CO5A 1YOVA 1TCVA 3ASFA 1I33A 1SU4A 3WL6A 2WKRA 2P6PA 3CLKA 1KIMA 2EZUA 1E7SA 5E6SA 4E3ZA 4X45A 1T5OA 4Z54A 1QYCA 3BGSA 1MFPA 1E18A 3O3MB 1WDMA 2OO7A 1C30A 3H11A 4BIIA 2BZ0A 4TSRA 1V1MA 4YMGA 1H4VB 2PLFA 4ML3A 5ER9A 4XH9B 1J2EA 2JFPA 4LRXA 4ESOA 4AROA 1QHFA 4JAVC 4PNZA 8ADHA 1DV2A 1IONA 4F6LA 4GQBA 3ZJUA 3E6AA 1YZLA 5A5FA 3FKJA 4B8ZA 2R7AA 3B5JA 3KSZO 4BFUA 2QAJA 5HQTA 2YQ4A 4ZZ2A 3WNQA 1C14A 3CTMA 4YDYA 2XRYA 3HXLA 3O1HB 2VP6A 4EJSA 1KHHA 1XZMA 1Z73A 2FWIA 5AJYA 2IP4A 2JAUA 4C7KA 3VV3A 1G1MA 2NYUA 4OJQA 4LWQA 1BLXB 5HF6A 1IATA 4QJ4A 5FLEX 4MHOA 4EKIA 2GILA 3G17A 3QELB 3H99A 1GPKA 3CHPA 4AICA 3ZDBA 1N3YA 2IYNA 5LDHA 4J0FA 5E8RA 2O23A 1LX6A 2CUZA 1ZOLA 1K3UB 1WZNA 5CA1B 2PBRA 1B74A 1XDUA 4N3BA 1JQEA 2ZRGA 3HDVA 1AMNA 2J59A 4KIFA 4J1NA 4J0GA 2VHZA 3SYMA 1XTQA 4IL5A 2GVNA 2RK6A 3BMOA 2B7LA 3M5PA 5JD6A 2L17A 1XPUA 4G2VA 2WQZA 4URZR 5J4KA 3W5BA 2QORA 2K7FA 3R4CA 3ZCQA 2Z58A 2ZWAA 1QP4A 2OUKA 2Q2OA 3JVDA 3F74A 5IF3A 1W1WA 5MHTA 3N87A 1UOQA 1PT6A 3UGKA 4IFEA 3JY6A 4CEJB 1UFVA 3F5DA 4S1VA 1R00A 4UFOA 2PL3A 2OCIA 1QR2A 3S44A 1EX1A 1FDTA 3GZNB 1XAGA 1Z2CA 1G20B 3WBFA 2W4IA 2IV2X 3E33A 1PN3A 4XGKA 2R8ZA 3EDMA 1NSFA 5FZRA 2FWMX 5CLIA 4RXUA 3ZHUA 4BOYA 4ECEA 1VPDA 4FFPA 2KC7A 1OI3A 1TMKA 3P0EA 4HEA6 4HN2A 2WXIA 4M1SA 3WGHA 5M7EA 4WN3A 1GL9B 4RW0A 5F64A 4DIFA 5AVTA 2J0VA 3AY6A 5JYEA 1JPLA 2EKZA 4IVQA 4MKFA 1TK9A 1NC1A 5L3RA 2WXFA 2A7QA 2V74B 4MVWA 3TZHA 3Q98A 5FPTA 5AO9A 2NT3A 1E9VA 4OHPA 3IJRA 3T41A 1R4MA 2NSDA 3B2NA 3L8MA 4KZPA 3TLZA 5L4SA 2RI0A 2ZYAA 3OQNA 3FOEC 2IBSA 1WZIA 2FUNB 2JCVA 1U1FA 1Y8QB 1PFKA 2YNQA 2DY0A 4U2FA 1T9DA 1Y7TA 2J5RA 5HF9A 3TNYA 3UYLA 4F9FA 4B40A 4MIYA 1RVDA 1PJ2A 3VPHA 1T3GA 1RWBA 1DC6A 2ZAIA 3KXPA 3LAWA 1NBAA 3EG5A 4XVQA 1ZMOA 2X76A 3FOBA 3R3JA 1GVHA 1ZNYA 1GTL1 4ZRMA 1V8ZA 5DKFA 2C04A 3O4GA 4JOSA 4FADA 4CM1A 4DIKA 5CA0B 2JI6A 1ZB1A 2X0DA 4KR6A 1K92A 2BLLA 1B43A 3EHRA 2FW7A 1AVTA 2P9GA 3GJ3A 1XD2B 4QGFA 3W1EA 2FXIA 2EL9A 3WK5A 2NO6A 3ZGYA 1JR4A 1PYOA 2H4YA 4RXTA 4UAJA 4CG2A 5K0BA 2JH8A 2H4JA 3JPWA 2OOSA 1K98A 1IBKB 1A9ZA 3T3MB 2VZLA 2QMYA 1YNOA 1Q50A 5H3CA 2ZB7A 2X3FA 1O6ZA 2G1JA 3CBGA 2XUDA 4CM9D 3KAEA 1H9AA 3FDFA 2HXSA 2YQ5A 3BWBA 1PNTA 3N8DA 3NH9A 4IP0A 5EJ8A 1T9CA 1YZVA 1YZUA 4OYRA 4W5WA 1FW6A 1TECE 3K2QA 3O26A 4K3UA 4NYJR 3UK7A 3TF5A 2X7HA 5I47A 2A6PA 2WM8A 1KAGA 1QZXA 5BPHA 4Z4QA 1FJGB 3ECAA 4KPUA 1S7CA 2HIHA 1G2PA 2LO6A 1WSAA 3BN3A 5DHPA 4ZMSA 5JR3A 4RD3A 1FTNA 1RCTE 2BEKA 2KQUA 1E69A 3DZBA 3ZY2A 1FXWF 3L07A 1DLIA 1NJ8A 1SBNE 3V8QA 5I7VA 2DP4E 1YCDA 4FLMA 4MO9A 3NHKA 5LA6B 2HYZA 3BGWA 3TL6A 4GR5A 1YRWA 3OX2A 4XEIG 3HCFA 4HPXB 1EFDN 1AA6A 3B5IA 4WT7A 3DJFA 1O87A 3MIZA 4BNTA 3RNLA 2PRKA 1MPXA 1IUOA 2WWXA 3OSZA 4NATA 1QLWA 5CIWA 3ZYZA 3C3MA 4FFSA 4QUGA 2QT0A 4HB0A 1XL1A 4GPAA 3PXDA 4EPWA 5A6SB 5JC8A 4JP3A 1X0VA 1W1UA 2VJMB 4QPPA 2FNAA 3H5TA 5B5SA 1FCJA 2WHRA 3A4VA 3NWEA 4ER7A 5C2JB 2PSDA 4ZOQI 3E9DA 1D2CA 4EX7A 1E1YA 1RYMA 4OUDB 1RQNA 2NYRA 5L45A 4BNNA 2X42A 4U2BA 4C01A 1Y1LA 1CY0A 1GTZA 1I4DD 1VZ3A 2C1XA 4OHVA 4IIJF 4P4SB 4DQVA 3KYCA 4BJ1A 1IWOA 3Q7AA 2VYQA 3NOVA 2EYQA 4QGAA 3UATA 1AKVA 3BRSA 3FFBA 4HFMA 3RWMB 4QUAA 1YA0A 2R8BA 1OU4A 1UZUA 4O33A 1E7WA 1ZCAA 2EFYA 1QZTA 3S2AA 4BY6A 1T9ZA 1PQYA 5EHQA 1TPYA 4F1JA 3QPWA 3OF2A 3BH0A 1YGPA 1VMKA 4UXHA 5FL7A 3ZHYA 2JLYA 2DUMA 2FZWA 4LRYA 5BSUA 5CERB 4K8RB 1EIZA 5EE0A 4YUYA 3AM4A 4ZCQA 5A9RA 1Z8NA 5HZMA 5EKQD 4B3CA 5IULC 2Y0BA 5CTAA 3SWWA 2PZBA 4S1NA 1ADJA 1Y98A 4LY0A 4RL6A 2GRAA 3N1UA 1RKXA 1XMJA 3C87A 4BLQA 2VA8A 3KB8A 2ZJ6A 4H1HA 1DJLA 1HEIA 3ER6A 2DUWA 1PFYA 3L1KA 4C3ZA 1X1SA 4FYYA 2QBYB 3MF4A 4KXQA 2J4CA 1JHMA 2XA9A 1KYQA 4QELA 2XVAA 4I2VA 1SBYA 2BFMA 3A6FA 5FCDA 2FMKA 3EDYA 4C29A 2WPVA 2AYXA 2QP4A 4JQCA 4AJLA 2X3YA 1CWUA 2BGRA 1J23A 3LC7O 3MFYA 1UG3A 1ESDA 4IQ0A 4LQLA 3DLHA 4HGNA 4I50A 4QPJC 4W9NC 5B7PA 1TT5B 1Y5NA 1IXRC 2HM7A 2PRSA 4MUYA 2NQTA 3FLMA 1A4XA 4RH1A 5H70A 1KY5A 2CEKA 7MHTA 5J4LA 1D3AA 2AFHB 5JS8A 4OKIA 4DILA 3JTMA 1NVFA 3U3OA 1ZN9A 2FUCA 2AG1A 4OI0A 5HIAA 1YC2A 2EFJA 1RRMA 2HCTA 9LDBA 4OXYA 4ZJUA 1DJMA 4M87A 4D3FA 3DAGA 1I5RA 3JD2A 5AKXA 1RNLA 1POXA 3CSTA 3RUCA 2JEKA 4MX8A 2HADA 4NJEB 3VH3A 2OSVA 3NYIA 1KYTA 2DBVO 4B4UA 4G84A 1E3IA 3K32A 5D51S 1M1XB 3EQZA 3EVEA 4Q01A 4DADA 2C3OA 4P5EA 3B78A 3RYFA 1TJNA 3UHOA 3A3KA 3PHLA 4J4TA 3AM3A 3ENEA 2O14A 1MJGA 4L2YA 2VNAA 1V8PA 4XSHA 3VR0A 3S7DA 2QXTA 1QGED 5BRAA 5FBWB 4NQRA 4Y6PA 3O84A 5D3ZA 4MKHA 1XEWY 3U44A 1G21A 3QKSB 4IILA 5UKDA 4DQDA 3IAS1 2I7TA 3MT8A 2WUGA 4GA2A 2X4GA 5LPNA 4D80A 5HRYA 2WAAA 3EG9A 2VWHA 3M1AA 4I19A 4F45A 1Z34A 2VBFA 2XF8A 4KNYA 5B57C 3MTAA 3MEKA 5EIAA 1JSRA 1KH2A 1V37A 2RH9B 3FNGA 2OV4A 2X6FA 2A1TS 4FW8A 3HYMB 4JUAA 2WHXA 3AB8A 4YRLA 4HQFA 1PJSA 2H7YA 4KLRA 4XIIA 3ZH9B 4QTYA 3AI2A 4ZOEA 5ALDA 4JZKA 1BMFD 1EJBA 1PFUA 4RVOA 1QGAA 3C3DA 1TYBE 2P9JA 4G3XA 2Z9BA 3GEGA 4G65A 4KXWA 3I52A 4UTOA 2O8BB 4TS9A 3KWMA 2CHGA 1LVHA 3PLRA 3DPDA 4E2FA 4GSKA 4JKIA 5B7NA 3U9TA 2PGOA 5K0JA 4C4PA 3GLFB 2WIFA 2ZE5A 4N3NA 3A31A 4DTCA 4WWOA 3AF3A 5LM3A 3F6QA 4FUQA 1S4QA 5M72A 1XDBA 3K31A 4TKMA 4TL9A 1RMQA 1XX6A 2WJVA 1F4PA 1G7CA 1T8RA 2I2DA 3BK2A 4IXMA 4MVCA 2BHTA 5ETJA 3ZG6A 5A1JA 3FSRA 4UM8B 4EZLA 1W4RA 3BERA 2JAPA 2VDUE 4FDLA 4OLHA 4HTFB 1ZS9A 3L6BA 1M0EA 3FOWA 3DSRA 4GPZA 4CRWA 3R7WA 3VNAA 3WKBA 2C5LA 3GL9A 2HSDA 1GAXA 5FR1A 4XKCA 1R8XA 2FETA 1VLZA 1R6AA 3BFVA 3FPKA 5FUXA 3ESYA 4UFPA 3U64A 1T4CB 4PNPA 3GHHA 2C5BA 3JX9A 8ABPA 2JCSA 2F7SA 1U5CA 1EX9A 2YZNA 3HFJA 4IBOA 4QECA 1PL8A 2ETBA 2O7RA 2QMZA 5DTJA 3SX2A 1PL0A 1LPBB 1QC5A 3CR3C 4JI6B 2QAGB 3T94A 5A6VA 3VHXB 2HR1A 3GZ2A 2QRVB 4J3NA 4BB5A 3BL6A 2Q8NA 2CLIB 1NRJB 3B1KA 4WCFC 1E2PA 4JU8A 5CCDA 1UM9B 2ZBVA 4CKCB 4XVHA 3TN7A 4CM4B 1BXZA 1IBSA 2C29D 2IC5A 1GQFA 2F1KA 2WUEA 1E0SA 2Z9DA 4FVTA 2K87A 1N3IA 2X4DA 3ETNA 3TSZA 3ROQA 2JABA 4CV2A 5LUAA 1STOA 3QMVA 3OU2A 1DKPA 1V16A 4JR2A 4BCCA 3ZZ1A 4B5KA 1UF9A 4PS8A 4D4IA 4B1FA 1VL5A 1O6FA 3AH8A 2C83A 1SEVA 2Q4OA 3X1KA 4CWAA 3AHCA 3O8RA 2KYRA 3UJ6A 1LDYA 1H23A 1Q1QA 2XE6A 1L1RA 2HHJA 3GD5A 3H42B 2WUFA 4OQNA 5LB4A 1KR5A 5IJ9B 4HQRA 1J99A 2H8GA 4H7HA 2GN0A 5ALNA 2DWQA 3CLHA 1CJBA 2NVOA 3FWYA 4WERA 3W5CA 3EXHC 5A2GA 2LNIA 2B8EA 3FPJA 4OP1A 4TPKA 1DKNA 1C1DB 1PS0A 2OE2A 4M3NA 4UARA 5BV8A 3PNPA 4MOWA 3P52A 1GRCA 3SK1A 4FFDA 4OOFA 4OYSA 3VR4A 2VDMB 1ODIA 4IH4A 4DW8A 5KWVA 2M98A 5JROA 3ZCUA 1CZLA 3IIMA 2C2HA 2C84A 5F7ZA 3ZU2A 1C1HA 2GERA 4HL6A 1VGQA 3C4JA 3VVMA 2JLXA 1FP4B 2H5JA 1XC7A 1Z9BA 5K8LA 4GM4A 4FBMA 4PG5A 4QAQA 2ZIRA 2BN4A 4M1YA 4G56A 1LGYA 2J9FB 1ZGHA 4I5GA 5CM9C 2NM0A 1KBZA 1W6UA 3HXBA 4WBNB 3I9FA 4AKSA 1E8WA 1BNCA 3FRIA 1M5TA 4EY3A 4NMXB 1N8NA 2PMCA 4OHYA 1UK7A 4R9VA 1NBME 1Z47A 4Q3NA 2EATA 4MA4A 4YP9A 4PHCA 3RVSA 3N7TA 4CU2A 2VO1A 3JQFC 2WSIA 4BMDA 1KJ9A 2VRBA 2VHXA 3ITEA 3CK7A 4UKDA 1JG7A 2MSEB 4EGSA 5ENNA 4P81A 4N2SA 1E2NA 4ENTA 1WKCA 2IRWA 2UAGA 2J7KA 3PVLA 821PA 1I7DA 2P8SA 3FTXA 1IXYA 1KE2A 3QVMA 2Q28A 3AJDA 3BPSA 3WRXA 3GYZA 3QWVA 1AUOA 3NC4A 3VMFA 1QV7A 3CH6A 1WJGA 2EW1A 3CSUA 4MQMA 5EIWA 4BKMA 2ZGDA 4QFVA 1KAQA 2V65A 5KVVA 4Y9DA 4EMSA 3ZD6A 4XWGA 3T0GA 1E6KA 1AOXA 4UM9D 3ITDA 4UWHA 3GGPA 1CZUA 1UT6A 3O92A 2G0AA 4EHAA 13PKA 2BMDA 4QX6A 4W1SA 3W2GA 4EQ6B 4DV6B 5AK6A 1I8TA 4ZEXA 4JODA 4UQYA 2F90A 3ZV3A 1WHTB 4XPZA 4DWOA 2F55A 3OEEA 1V8BA 2QT1A 3FYUC 3JS5A 4IIEA 3RAGA 3E9MA 3RDPA 1UWCA 1ZL0A 4UAVA 2XIQA 5EERA 1UJ5A 4MYHA 2VJAA 4IJ6A 5HNKA 4H1UA 1C7RA 4Y2PA 4DMLA 1X1DA 4I66A 1D1QA 2DYRE 2ODAA 5BY2A 1SKMA 2KWIA 1FBNA 2GDZA 4TV8B 5CW1A 3H2HA 5KTOA 3RRUA 1YI0A 2YOHA 1OASA 2RGDA 3GMSA 3PGMA 3U4IA 4QQNA 3JQDA 3E82A 2FJAB 1G18A 1QWOA 3EUVA 5LBIA 1LVUA 3INGA 2JIBA 2R17C 3BAFA 3O38A 1AUVA 1WDTA 3P71T 3Q9UA 4N3GA 1IYZA 4QC2A 1RBQA 2G4LA 4MRSA 5FNVA 5JYDA 1YB6A 4Z4EA 5D5PA 3KJEA 1QCCA 3FNIA 4N8SA 4B2YA 3S27A 3D0QA 2BHRA 1DV1A 4UTXA 2F3PA 4YUVA 1CDDA 1JTVA 5E3IA 5TLSA 4B76A 3A6DA 5FOWA 6PFKA 2XIJA 4BTBA 4HWGA 1T35A 4Z0HO 5JJ5A 2GH1A 3NBAA 4BO1A 4F96A 4HB5A 2HCJB 5JZOA 3UEOA 2ZIXB 2ZJAA 3EFHA 1PT7A 3PDCA 5CX1A 3IR7A 3G5LA 1XGWA 4OQFA 1Z75A 3OCXA 2IDZA 5L3SA 4ILGA 4PU0A 1RZ4A 2CHUA 2HH9A 2YRWA 3O9ZA 4U7FA 1WU8A 3HNOA 4G5YA 4D97A 5AHWA 2O8DA 1GR1A 2V7TA 1VBKA 2QY6A 2XQGA 3EXEB 3BWDD 4IICA 4V02A 5DIFA 2FW1A 1Q0TA 2HJHA 1XWFA 3BB1A 2V7QD 4EF5A 1RABA 3KAPA 2W2LA 4AJOA 4ETNA 3EBPA 1IBCA 2R6HA 2BF0X 2J5XA 2EG9A 3FYHA 2ZBGA 2XYRA 3RFFA 2FSVC 3IVCA 2ZFUA 1F2DA 2JK0A 3ND7A 4FFVA 1WVGA 2NYVA 4IRUA 3LUKA 1MOSA 1CIVA 2CL7X 3UTDA 3NEJA 2Z8XA 4BQOA 1G3NB 4QO8A 5FBKA 2JLVA 1DE0A 3FB4A 4J7UA 4AZTA 3C2QA 3N39C 1EFCA 3ANMA 2WYIA 4HXEB 4PLFA 2GB4A 2JIMA 4R9RA 5EAIA 3H5RA 4QRDA 3OKPA 2J5QA 4F1KA 2BCEA 4QSMA 4EB3A 3W4JA 2C3YA 2LXMA 4W7IA 5HIIA 1P9RA 3F8WA 4PSDA 4HLQB 1N9ZA 1V6SA 4WKGA 5E7JA 1AY0A 1H85A 1GZVA 1H3NA 1RC0A 1G8HA 1W49A 3OQHA 1Z5VA 3V4ZA 4UBKA 1VHTA 2C2ZA 3TEJA 5L51A 2NAPA 1WMFA 1KI1A 3T7CA 3VKUA 4DF3A 3SXUA 4LOKA 3WWZA 5FLXA 2KCVA 3CW8X 1NXSA 1UOPA 3RFVA 3AM1A 3DR3A 3GAFA 2P27A 2JA2A 4A0SA 3DDCA 3GJ4A 1XN4A 1EM8A 5ESWA 3MEQA 1WW3A 4GZ3A 1U0OC 1OF1A 3CLTD 3HB0A 3RJMA 2DQZA 4NX2A 5DTQA 1JIIA 1OA0A 3LUDA 3KLOA 4GE3A 4JLWA 4C0KA 4EZBA 5JPCA 3WO0A 2A8YA 3IKVA 3KQYA 3PF9A 3W34A 2NTNA 3VYSB 3F4LA 1ADFA 3JALA 5GGYA 4BO6A 1K7YA 2P3QA 1UBEA 1X7YB 5IT5A 4DS3A 3LC2O 1EHCA 3DCJA 3FBTA 3GG9A 1ISRA 3PP8A 4G4SP 1JYSA 5TS3A 5CIQA 3X1YA 5IS2A 1YBVA 2AUMA 1DC8A 2PVSA 3IRUA 1HE5A 2EKDA 4YDWA 1JHAA 2GJ9A 2NU8A 4XFDA 2GD0A 4L76A 1GOTA 5TB5A 4F5YA 1O1YA 1XMOB 3O8QB 3L8HA 2IVZA 4R7ZA 5I7WA 2XTNA 3KVNA 4R7LA 1X6VA 1R8SA 1JBQA 1N5DA 2DTDA 2WWHA 2JFGA 3GJQA 1BGWA 4JA7A 3RBAA 4MPDA 1LB1B 1ZOSA 3TXYA 4PUCA 1M6VB 3KTOA 2VBIA 4D42A 1L4MA 4QVKA 3E23A 1W3BA 3TQFA 2B6NA 4HSEA 4QBKA 1NHWA 5ES4B 2AZXA 2YNMD 2CHFA 1W5SA 4TOIA 3DE6X 4NZPA 1EQUA 2UXCB 2VJCA 1TU0A 4P3NA 1LDNA 3V8EA 1OY3D 3UQ3A 5KYWA 1NVTA 2BM8A 1DXHA 2H3HA 5IJAA 3HBMA 3ESQA 3PLAE 5LXTB 3U3KA 3AOEA 4F4DA 3TBFA 5EMLA 3FE2A 4WFIA 3HZZA 5IKMA 5TF4A 4OXKA 3HHEA 1FLVA 5G0UA 4Q03A 1VGVA 4HBGA 3PHBE 4BVEA 2GGSA 3M1YA 2MSNA 3FY4A 3RU0A 1U6KA 2Z1MA 3IHLA 4GH5A 1L1EA 3UJDA 2VTEA 3E18A 3PBKA 4M8KA 3KDAA 2D06A 4URFA 3WQSB 2Y1LE 1J7KA 4P2BA 2HTEA 1R3DA 5C8XA 1MTZA 4DV3B 4JGGA 4IV5A 4Q4DA 2TYSB 4G1CA 3WISA 1S0PA 3FHEA 2UZ0A 2A90A 4H7JA 4MW5A 1CZKA 1EE9A 5HG0A 3WK6A 3HKBB 1DC2A 3HP4A 4TVOA 1R9MA 4FYWA 3HEBA 4PR3A 3R0XA 1P4RA 2YMMA 3PV0A 5IJ0B 1VDYA 2DUNA 1PGQA 1SC9A 1T5DX 3BD7A 4UU7A 5B58C 4JVMA 1JU4A 3K8QA 4K6KA 4Q37A 5IJWA 5A7FA 4E94A 4MUFA 3OVMA 2SHKA 5HOQA 3VTXA 3F1LA 4XD2A 1ND6A 4JP1A 4AWXA 1UMBA 4A26A 2QD4A 1VXRA 2CYAA 4BRUA 3B1JA 3IKTA 2CHWA 5F3RA 2ZQZA 1P7WA 4MROA 1GIAA 2QC9A 2IPXA 4PINA 3KEMA 4Y2RA 4EL0A 2CYCA 3UA3A 4I1MA 1T9BA 1E9DA 4HR7A 3IPAA 4I6JA 1AIPA 2Q6KA 5AVJA 2D2IA 2H0AA 1BVUA 4Y2XA 4AN4A 4L50A 4EVSA 2J67A 4C43A 4LSWA 4B82A 2XEVA 2XNSA 6ADHA 5K3FA 2Y4UA 5ICCA 3VPGA 4ZVPA 2CLLB 4QDZA 1E2UA 1TQ8A 3H9EO 5F35A 3CX7A 3IBSA 1JLMA 4R1UA 4BO2A 4TWAA 2ZKIA 3MWDA 3PENA 4XI9A 1D2MA 1RBYA 2ISQA 3ILHA 4FMDB 2FFBA 5KNBD 3JASA 3CK8A 4W7HA 2PKYX 4WCVA 4Z9FA 3TINA 1O95A 4GP6A 3AS4A 3D3NA 4M2LA 2EW8A 2EX1A 3FH0A 3OKAA 2EBUA 1CNEA 4MAMA 4DLVA 3KSAC 2D7DA 2TSYB 3G9ZA 3HI6A 5EE3A 2H08A 1CB7A 4WY5A 4HI0E 5EJ5A 1I0LA 2PT7A 4NBTA 2A5JA 3AX6A 4R1PA 1WDYA 4K9LA 3BJIC 3W5AA 2R9VA 3NKFA 5FUWA 5J23A 5J58A 1SBZA 1NNEA 1BFDA 1F8FA 4C0WA 2OBYA 4N6OA 5A5GA 2ACVA 2QAGC 1WP4A 5FQ6A 2VPQA 3DDNA 1SA0A 5FUYA 1O0SA 3PXGA 1I7QB 4TWIA 1WHSB 2VR1A 4QREA 1VA5A 1VLVA 5E75A 1J9ZA 4MLCA 3AHIA 4CM8A 3LKDA 2E7ZA 4UZEA 5CDHA 5IKXA 1F2VA 1Q92A 2PZKA 2Z2IA 4G1VA 4UD6A 5NULA 2WJ4A 4PC7A 3IE1A 4O3MA 3KSMA 3TCKA 1D09A 3VX3A 2VTDA 3ML9A 3K35A 4Y9RA 3ZZ0A 1H0AA 1KU6A 3HLYA 3I45A 1WMBA 4I4LA 4WECA 3U60B 3IV9A 2VF2A 2OWDA 5T64A 2HA6A 1EEXB 3TLGB 1RWQA 3LIIA 5EDSA 2AVDA 4N12A 2QGNA 2YRXA 3KTDA 4OAOA 3ZHEB 1JHRA 4PTYA 4INPA 2GAJA 4RF2A 3M89A 4MPPA 5ERYA 4B8AA 3JQGB 1G7SA 4G1TA 4YTEA 2PS9A 1CERA 1R6UA 2WYWA 2Z5LA 4GTPA 3BWCA 4LOHA 3EPKA 4O2BA 3MYVA 4HB2A 4X6LA 3RUFA 2JJ8A 2DT8A 2B21A 2BUGA 2EKQA 3A10A 2VP3A 3NTRA 4XFKA 3UENA 3O2JA 4FTWA 3GW8A 3IDFA 4ZVRA 2YN2A 2ASVA 3GLIA 3AG3E 4KR7A 3UM0A 3MERA 3EDRA 1RWMA 2CCKA 3OPQA 3OWXA 5D00A 4JL8A 1NZJA 3W9FA 1JAXA 2A9JA 2MMGA 5ELXA 2UKDA 2CY0A 4NL4H 4FINA 4H59A 3CVJA 3FCAA 5LR6A 4GOXA 1EX6A 1UPUA 3M2PA 4P36A 3SHTA 2YZGA 3EOAI 2IOLA 1M6HA 4JDUA 1L1QA 3G6WA 3ZU4A 2E5WA 1XBTA 4LF7B 3L4JA 3GLRA 1AV7A 1WBJB 3GD7A 4AF6A 3AZQA 3VR6H 4R5MA 1SVIA 4KEAA 2YBDA 2BPOA 1WUJS 4HBZA 1U0GA 2JJ2A 2ECKA 4D82A 5BSVA 5F3WB 5LIPA 3AM5A 1GSIA 1CLEA 1TZKA 1NP3A 1TM4E 4EI2A 3ISMC 2FEMA 2Y1FA 1W36C 1KBOA 4C22A 2D1RA 2VK8A 3DZHA 3JQ0A 1T24A 3T8YA 3BSSA 4F7AA 1C8LA 1R0CA 2JEOA 3QAQA 3U39A 1GN9A 1N5OX 5CRUA 1MABB 2O2XA 1G5FA 3K30A 3L6CA 5THQA 1POWA 1PAQA 1ATIA 1IHUA 3DONA 3OH8A 3X0DA 1FTGA 5DX0A 2ZRMA 4P84A 1L6RA 2VGXB 1QO9A 2Q6TA 1ZVKA 3O82A 5I8ZA 4A2CA 5KWIA 1GV1A 2WDZA 3M8KA 1TCBA 1X1AA 3AHFA 1D5WA 4J76A 3M83A 1PYDA 3MWGA 2ETCA 3UWMA 1M7GA 1Y1SA 4LWZA 1TOAA 3PJFA 4U2GA 3REGA 4OKNA 4CT5A 4YCNA 1E64A 5IBQA 1L9KA 2HZBA 1PL6A 1QH8A 2UYOA 1FUIA 3HIZA 4FR2A 2HOQA 2FN9A 2Q5FA 2PT6A 4TV9F 3S29A 4EFKA 1W36B 1QBKC 4HVAA 1QIKA 3RRYA 5FFMA 1A9SA 3KQVA 4ZMBA 3T38A 1TIPA 1DS6A 1LX7A 3FBWA 4FLFA 1ODTC 3B95A 2OCDA 3TPZA 5HUHA 4FGUA 2X0IA 2N1BA 4TXMA 3WV4A 4ZU6X 2NT4A 4JMLA 3UK2A 4D5GA 4GCOA 3O8CA 1GQOA 1AKTA 3AKZA 4A6DA 1NV8A 1U65A 2WOOA 2BBTA 3SJAA 5CMWA 2BI4A 4AJHA 4V1CI 3CVYA 4D46A 2ECPA 3R7BA 1Z17A 3ASOE 5EIHA 1AGXA 1TKCA 5IY5E 2XQFA 1R2QA 3L43A 1NW4A 3OLZA 5IDWA 2A5DA 1Y1RA 2POQX 3P2EA 3R40A 4JXTA 2P9IG 4I4TA 4XSVA 2NP7A 5DEIA 4I14A 5I7HA 3PRJA 2GX6A 2AEFA 3C97A 1JH8A 1DG1G 4POOA 1LJUA 1JDSA 4AS3A 1XXHA 3RHSA 1V47A 1HBJA 3LPDA 4G01B 1BXRA 4OAUC 5HBGA 3UKDA 1ECCA 3STXA 1NATA 3MWDB 4W8OA 2CNKA 2QRUA 4HXYA 4QM7A 5GINE 3BIXA 2B4AA 1LK0A 3S5UA 3G5TA 2Z6VA 1XDGA 3UG6A 1GEEA 2WD7A 2I1JA 2GASA 1A96A 2VH2A 4M36A 1DIRA 3B8HA 1RPTA 1E1CA 1JG1A 4BO7A 2CV1A 4L9WA 4CF6A 2JAHA 2VHYA 5D7BA 5INTA 3BU8A 4M0KA 4V03A 5F73A 1M66A 2IYSA 5CLJA 4Z4IA 3VTKA 3I8SA 3P7MA 3K4HA 3SQXA 4YIHA 3Q0TA 2A2ZA 1WXHA 3BBPA 1X42A 3GRPA 4WLNA 1ZW6A 3A1DA 4H4CA 4BKPA 1X0XA 3L93A 1MGOA 2ABWA 3ABIA 5PNTA 4WAFA 4HOTA 1LCIA 2PLNA 3M6AA 1GP2A 1FFBA 1YRBA 3EW9A 4R8MA 3KOXA 1DWQA 3CYFA 4TTPA 5JS1A 4IDPA 1ZM4A 1P3Y1 2VDWA 4UM9B 1NR5A 4NDAA 1BG6A 4HNRA 5JCJD 1SCNE 2IOYA 4Y67A 1UMCB 3WG9A 3THXB 1OZ0A 3CKMA 2WF7A 3MCZA 2CD7A 5JH7F 3QC1A 1G6Q1 3WC4A 4PNEA 1GNTA 1VKJA 1X1RA 3SY8A 4AQDA 2O07A 3HKDB 2ZUTA 3TW4A 4JJFA 2JASA 5C4IA 3AFMA 3CVNA 3KZVA 4KUGA 4JGBA 3RC2A 3GFPA 4EWLA 5B1DA 1XZFA 5HCIA 3LX6A 1FTYA 1V5WA 3EF0A 4O2AB 3SKYA 3REQA 4L6IA 4AZWA 3I9V1 1W25A 1FJHA 1T13A 3IELA 2V7PA 5KNCH 1R5OA 1BGVA 1M0WA 3LZDA 2I80A 4P3PA 4EA9A 5KNCD 1MD9A 4XSGA 2CFCA 5LOVB 4K2HA 2C7PA 1K2VN 2J49A 1JPJA 4X1IB 4ETMA 2ZATA 4QJ5A 5KC9A 2PNNA 4PXSA 2P9KG 1Z6TA 1MORA 3BK1A 1OLSA 4DLRA 3C24A 1A9XB 1G2OA 2Y66A 4AI6A 2EZ9A 2XDQB 5I9SA 1NP6A 3NOXA 4DBLE 4YMUA 1OD6A 4GMGA 5LUBA 3FWKA 3DO8A 4EF4A 1RJDA 3OLVA 3R0ZA 1UKVY 1M33A 1AKMA 4S2EA 2RHGB 3CSDA 1IDN1 5F5XA 3EU9A 1H1DA 1XYGA 4GM0A 3VI3B 4MHTA 2ZIGA 621PA 3HHMA 2AC2A 4CL0A 1C1XB 4GSLA 1Z33A 1AQUA 4TZTA 3MS7A 3FMFA 4YFVA 4FFRA 2QX4A 2C0QA 1A9RA 1R8YA 1AO3A 4EGJA 4IQGA 4MWEA 4YJ3F 4D74A 1CD5A 1CNMA 1YTLA 3FR8A 4HEA1 3SSOA 1CUCA 1TADA 5A0TA 1X19A 1RYNA 3AP2A 3GEBA 3SOPA 4BMVA 4RMIA 3M3DA 2X6RA 2VZEA 3H04A 4PGHA 2DUJA 3TE6A 1H3FA 2EGHA 3W2TA 1N2HA 3R3HA 4ESVA 4N03A 2CXSA 2R6DA 1JE0A 1NVVR 2FGKA 3PSAA 1RHUA 5M04A 2G76A 3G49A 4LY3A 4HDMB 3ZIUA 4U2EA 3ONNA 1FFEA 4WOCA 2L6BA 2P69A 3BTOA 1GYPA 5AJWA 1ZGJA 3B6ZA 4TT3A 5JZVA 5IABA 2ZSDA 3R76A 4I1OA 1A9TA 1XTVA 3ZBTA 1T9KA 3HDXA 4EHNA 1P6XA 1JDUA 3SF8B 5ARBA 2NV2B 3ULYA 4ESEA 1QHHA 2IF2A 3EHDA 2PIDA 1NVKA 1P0IA 4ZZ3A 4GTOA 5JJ7A 1U2VG 1N1GA 4ZQBA 4AUEA 4IGFA 1L5VA 1R18A 2CBZA 1TUBA 2OK7A 4WBNA 1QHNA 2HREA 1NW6A 4NZYA 1LBIA 4TKVA 2PH7A 3CQGB 1RKQA 4H6XA 4XWAA 1ZU4A 4Y6LA 3S7ZA 2AG5A 1VHWA 2HDWA 4FGLA 4XYGA 3TTVA 1WF3A 2PS0A 3TG4A 4ER3A 3DSVA 3DOCA 4TZ0A 5DGCA 3WRYC 2MR6A 3EAQA 1DC7A 3HB1A 3VKVA 3GP8A 3RFXA 3HUFA 1AHHA 5DX8A 3BQ9A 5HX7A 2H85A 4RJKA 3OP1A 3EVGA 2WY2D 3HM2A 3RHFA 1R64A 4BETA 4YRQA 4TT3D 3H2IA 4RACA 4B0OA 3KNZA 3TLEA 1MVNA 4HAOA 4US2R 4MDFA 4BB9A 4ABYA 1ZMBA 2N75A 3CC8A 4G0PA 1QFMA 4A23A 2XWPA 4TLMB 1A8HA 3U66A 2QJFA 4BNDA 2PL9A 4EZIA 2F00A 4KKXB 3T1QA 3VKGA 1EA5A 1A2BA 5BQFA 2CJPA 2DHRA 1EHYA 1AX9A 3D81A 3G2SA 2VP4A 4CE6A 1U80A 1EUDA 2VWPA 3QPVA 3GJ7A 3H5WA 4K8OA 2D0OB 3V8NA 5LSAA 4GP7A 2O5CA 1RXYA 4MHSA 4PXYA 3KVVA 1ZGGA 5ALKA 2VPTA 4B6JA 3RAEC 1HGXA 4PVCA 2VSNA 2VRWA 4WOPA 1H66A 4QXMA 2ZDHA 4A1SA 3JYPA 3TGOA 3IT0A 5EJAA 2IV7A 3SVLA 1OR8A 3LT1A 3FU3A 5GJVC 5KJNA 4JJAA 3VGPA 1TI7A 5B2EA 2FO7A 3K4QA 3PGLA 4MRUA 4X71A 1JEOA 1LU9A 4Y7CA 4EELA 5KWJA 4L4SA 4FN5A 2GN8A 4PC3A 4UWLA 5JMOA 3RADC 4BTAA 2R47A 1OFVA 2ZGVA 4ZXFA 3HU2A 1PF7E 2QRVA 4Y1RA 3FTYA 1YDFA 1ZL2A 1S8NA 5BQXA 3HJUA 5BSTA 1Z3XA 4EYSA 3Q4GA 2K5UA 4FFOA 4FR0A 4QIHA 1COWD 4GF5A 2IUUA 1X3LA 2GLXA 1TVKB 2DCMA 4A15A 1QNLA 4YVOA 2WLSA 4MB2A 3KOYA 3M9WA 4Z86A 3EOBI 2A4KA 3RSOA 4Y6GB 5KI6A 4P53A 4D9CA 5EHZA 3WRWA 2UY1B 1FFWA 1ES9A 5HS0A 3LBIA 3N75A 4L8FA 4X66B 3K9IA 3UW1A 5MF6A 1M1NA 4ZU3A 2QRHA 2C8VA 4RK5A 1RXWA 2PUAA 4GC9A 2BGMA 3IFSA 4EVRA 5BW8C 1KPGA 3JD3A 4DM4A 5JO9A 2PH3A 4BXOA 2VLIA 4UXIA 4AJ4A 4OTZA 1IIRA 5BORA 4BESA 4NBKA 4PHHA 4PNHA 2FQXA 1J8YF 2LIVA 2Y1OA 3DZFA 2I5PO 4LG6A 3GELA 1BE8A 4HRVA 3UT5B 5AXAA 2L2QA 5AW9A 3ZHCA 4J8DA 1NQXA 3IHYA 3TLJA 1Z4KA 1L7MA 1YIAA 2QNIA 2NVUB 4DRXB 2HMUA 2QJTA 4Q12A 4QNRA 3TPCA 2JZCA 2XMBA 4JD5A 3PWKA 4BERA 4LMBA 4A5OA 4DQUA 1NW3A 3DAFA 4C08A 2AD5A 4PX2A 2E5LB 3ZTTA 1CUYA 1IM5A 3NHRA 3B1WA 5FTWA 5CA0A 1WW8A 4ACLA 1HWYA 3CUUA 3QPDA 1JUDA 4HGZA 4WNIA 1A9XA 1AK1A 1AUPA 3L18A 5T6BA 3WRYA 4ZAGA 5BSGA 4J16C 2VDQB 4JQYA 2J6BA 1OCOE 3DMPA 1RQGA 3GGJA 4GW3A 1YONA 4NABA 2BKUA 3EXFB 4WNCA 3ZLVA 2NNWB 3KKNA 9ATCA 5F2EA 3F6EX 1I1QB 1KXZA 1XRPA 4BTLA 1T0UA 2KBEA 5AVRA 2O48X 3W79A 1Q1BA 3C3CA 3GR6A 3DXFA 4B3IA 1JDTA 1GG8A 1ZEMA 3IKJA 4HOYA 4OPMA 4TRRA 5E4TA 1P4HA 3DW1X 3WHKA 4EGCB 4ZHQA 1II8A 1UQTA 3KTFA 1JSCA 2R59A 4RHFA 3OXLA 1A50B 1TM2A 1JVNA 1SQFA 4ZVLA 4JA9A 2B9VA 2J3IA 1OLXA 2QZZA 2Z1NA 2J48A 4MVYA 2ILRA 3WX0A 3OZGA 4M99A 1W85B 4RSMA 2ONCA 2J87A 2ZVQX 3T5BA 2QTVB 3QEBZ 3GUCA 4QL3A 4HNVA 1LFAA 3PRHA 4I9GA 4REQB 1JCRA 1Z7GA 2D13A 3HH8A 5FWQA 2Q3CA 3K8OE 4YRDA 2Q2VA 2EARA 4EP1A 3GDWA 1QK4A 4J0JA 2BMEA 3UT6A 2C0LA 1WPRA 1LVGA 5C37A 1A7AA 3AY0A 3A8TA 5EPUA 2YDXA 4Z7NB 5AJXA 1BD4A 1MX4A 2FSSA 2I65A 4TLAA 1NN1A 2ZJ5A 1LBHA 4TM8A 4CLXA 3NM4A 721PA 3B48A 3I64A 5KREA 1WXWA 3KHTA 4K1XA 2PUWA 3WQQA 3I5YA 1AE1A 1U3FA 2V7GA 2I1VB 1HOXA 3HQ4O 4Z68A 3G9UA 4RUKA 4BQPA 1JE1A 3ML8A 1NT4A 5B1HA 4G86A 3M4NA 3OAAD 1XR3A 1EFVA 5HW0A 4Z53A 3WYFA 4BN4A 1GGEA 2PMDA 3IVRA 2AXUA 4EB6B 4UTNA 1MZCA 3FP3A 1MR3F 1QG6A 1D2HA 1YIDA 2C9OA 2ST1A 3AXSA 3FPSA 5A3VA 5KTMA 4OOEA 1WEKA 3Q73A 2R2GA 3CF2A 2QG9A 3C5VA 2ZJ1A 2WM9A 2NQ8A 3A11A 3LKVA 4FA6A 2GF2A 1SOUA 1YQDA 4WZAA 5DHTA 4PYMA 1MUUA 2E89A 2LBPA 1L5NA 3ZDRA 4EPYA 4PX9A 2A33A 3U1TA 1XXHE 3S2EA 3FA2A 4NCBA 3ITNA 1PBNA 2BEUA 4AECA 2X1MA 2B1JA 3QE9Y 3WLTA 3CK9A 3A05A 1VP9A 3DEPA 2JIRA 4G8BA 2CG2A 3ONKA 1DBIA 2JFZA 2JGNA 3AEQA 3OCCA 5FOUA 4ZEOA 3RS8A 3QEOA 4C7BA 4F3RA 4ENWA 4WXHA 5HUQA 3THWB 1CR4A 2ZTSA 3GNTA 5AI0A 4BNXA 2C2BA 3IR5A 4PO3X 3OUTA 4Q1CA 5KDLA 1T9GR 4CYMA 3C48A 3KOUA 2OBBA 4D8UA 3OY7A 4ZI2A 1IY8A 4QXOA 1K8KG 5IAOA 3EF1A 2ZI6A 3IS3A 1T3ZA 5LCWJ 2UVPB 4NFHA 3L4SO 4JK3A 4BFVA 1N6RA 1Z8HA 4DX2A 1Z6AA 4O2RA 4P7JA 5BSWA 1EG2A 3TDKA 2OCPA 3L0PA 1Q7TA 3TQSA 4AQ7A 4W5OA 4EM6A 3GAMA 4C03A 1FS6A 1TNBA 4KG7A 4YLGA 5CEFA 4KQ9A 3IQGX 1NI3A 4FWBA 1RLOA 3GPBA 3DWEX 1A5TA 3FROA 2B1IA 2PH1A 2RGWA 1LPAB 3NETA 3U81A 1CUXA 4PAGA 5SY9A 4XWOA 1GUFA 3LPAA 4OM7A 3B70A 4RHTA 3DT6A 1AS2A 2LP4Y 5KOJA 1Z7BA 3EEIA 3MJWA 1ZESA 4WDRA 2WWYA 4PCVA 4X94A 2DERA 4O5AA 5DNYB 3MN1A 3MGBA 1ZNWA 2AEMA 3C6QA 3LH5A 1JHXA 1FRFS 4OBWA 3G0CA 5BSEA 2O8FA 3EHEA 1B8VA 3D9KA 2E48A 2IDJA 2WAYA 5JZ9A 3TWUA 4YR7A 3Q7IA 3V42A 2VGXA 4JLUA 4YQFA 5CRVA 1Q74A 3BRCA 3KETA 3W9GA 1A71A 1KY2A 1VRWA 1Z35A 2QGZA 5B30A 4KAAA 1DG3A 5TQVA 1E8NA 4U7WA 4ZU1X 3STHA 2HSZA 2P91A 4NACA 5A2QA 2JHAA 2PS3A 3WGMA 5KTYA 4F6RD 2XNDD 3PXAA 4EDHA 3VTYA 1N9GA 1QH8B 1NL4A 1SVNA 4BNYA 5IU6A 3C5EA 4Z9AA 2IP2A 1RYYA 1TJFA 2ENUA 4IJMA 4R4JA 3Q7EA 4AF7A 2I7VA 2CFZA 1W4ZA 2YINA 3TWSA 3CH5A 1DP4A 3A3OA 2LNDA 3FGOA 2VTBB 2FN3A 3OD1A 4L95C 4G0UA 1QQ6A 5JHBA 2HA3A 3OA2A 3CISA 4YUXA 4FKBA 3DL0A 3QWWA 3B3JA 2H2DA 3H83A 3FMIA 3LNTA 5G0SA 3NVKI 1F51E 3W8FA 3EXIB 1EM6A 1JQAA 2J5KA 1VIYA 3U9WA 5GZ6A 3STYA 4AJNA 1NPTO 1PR5A 1UQRA 2NO5A 1OQAA 4TUYA 5J2TA 1QU2A 3LY7A 3DMFA 3CKKA 1LV8A 1ACMA 1TQDA 4KDRA 4B09A 5F9FA 2O57A 1TAHA 3GHYA 3NV9A 3S7TA 4C7OA 1B6RA 3V4VB 2XA2A 2C9CA 2I34A 4WFJA 4KC0A 4Z9XA 4L8WB 3GCWA 4GHWA 5JH7B 3ZYKA 4GOOD 3U4MA 1GD1O 2QJOA 1KEEA 1DAFA 4IULA 2VH5R 3KBOA 3NVDA 4K05A 5TJ9A 1CIJA 3WTCA 3EIFA 3UJ9A 4AG5A 5IHPA 4A2QA 1J0BA 5CURA 3SXJA 4AMBA 1H2YA 4JJIA 3RJTA 1QAOA 2P9NG 2VCYA 3EJNA 2H59A 4CLHA 1FUUA 2PGDA 2SKEA 5T4HA 4QJIA 4IH1A 3UXEA 2BGKA 3SM3A 8OHMA 2IO3C 3R8CA 4HNAD 4EKGA 3UJ7A 1IH8A 4UDYX 4G25A 2CNWD 1ZH0A 1NVDA 4IOKA 4DXDA 3NBFA 1H9BA 2AOTB 4JWKA 3TTYA 2J0UB 1PU2A 4TN1A 3KALA 1GSOA 4IHQA 2WT4A 1G1AA 3MHPA 3PVSA 1KMIY 2FPIA 4ZV7A 3KSUA 2AZ4A 2I9PA 2ODWA 2VDOB 4Q9IA 3TL3A 2NXCA 3LV8A 1GPMA 3AR8A 3MUNA 3NOOA 2JVJA 3D6NB 2ECFA 3DNFA 3MS2A 5E1MA 1NY5A 5GY7A 4LN1A 1I51A 2G0TA 4IMIB 1ULSA 2H7XA 3E1KA 4BU1A 3L54A 3BTUA 5L95A 1CB0A 1CRPA 3IA2A 4DARA 1IG0A 5D6OA 2NZJA 2DFKB 1YJQA 4Z3OA 2DBZA 2FHSA 1YZQA 2DECA 4JELA 1ZH8A 3LT5A 3NBYC 4I5EA 3UH1A 2W9JA 3JYHA 3QKIA 1GNLA 3NBMA 4KMOA 3KDPA 2IWRA 2JKZA 2GRUA 1Q0PA 2JKVA 2EFEB 5KYKA 1T8WA 1II8B 1CR2A 1XQXA 4MEJA 3FWNA 5CCXA 4YRIA 3HE3A 4FYMA 1MPTA 1H8HD 3E9EA 3GMTA 5B1IA 1P80A 1SZJG 3X2SA 1DCTA 3CJTA 3I0MA 1GXSA 3DTTA 3K5IA 1XA4A 3LX4A 2F37A 4I6GA 1KO1A 1S64A 4U7DA 3UMVA 1WY7A 4OB7A 4ZO4A 2XADA 4LJRA 3QTLA 4MGEA 5F23A 5I01A 2X7XA 1SCUA 4QEZA 1VP3A 1KMCA 2F8LA 3I2IA 5TT0A 4X7RA 1P60A 4J3JA 1TUEA 1A76A 2HSJA 4F97A 1JDPA 1S3IA 2ZIFA 1PFWA 4DI3A 3F3SA 4X93A 5DE3A 1ZJJA 2GPSA 4J0HA 2BEDA 3FR7A 1Z39A 3WLFA 3PG5A 1WD7A 4BZQA 1ELWA 2CNDA 4KO4S 4P98A 4ARIA 5IANA 4KCGA 2QNBA 3ESRA 3SLKA 2DPHA 1M54A 4XRGA 4D45A 3DE2X 1TNUA 3DXYA 4O6VA 5I4BA 3PQFA 3DMHA 3ITKA 3U09A 3F4KA 5K01A 5IMBA 3LWDA 2AJLI 4MKRA 4CFZA 4JA2A 1WZCA 5GZ3A 3MELA 2VT6A 4WACA 1FFCA 3ZE9A 4LF5B 1RAFA 2GARA 3AVYA 4WK6A 1XZHA 4UVHA 2EX0A 5EWLB 1G6HA 1UXJA 2HGSA 4YMTA 3WWEA 1P2GA 2I87A 5I9NA 3H8JA 2KSQA 1TC2A 3NOCD 1D8EA 3I9NA 2JK1A 3LGXA 5DISB 4YRPA 2XPCA 4EG3A 3UOWA 4YT2A 3R0JA 3FX2A 3EGEA 1EAYA 2W0SA 4OJMX 1ZK2A 2ZUUA 1TF2A 3GJZA 3MJDA 4XWTA 3VA7A 4UMEA 4BLPA 5HKAA 2D2EA 1ZK1A 1XZLA 1JIKA 2GEJA 4CEMA 3R3UA 1GU0A 7GPBA 3UPUA 2GN9A 4TS3A 4U6SA 4Z49A 4H7FA 2XT9A 4OGWA 1TF5A 2JDID 1CZRA 4LHWA 5G55A 1M7HA 2COEA 3MFQA 3K6SB 2K4NA 4O02B 1V4VA 5L3VA 3HEAA 3QHQA 3TZKA 1FBTA 1QK3A 5COBA 4XJTA 3T4EA 1RXIA 1CJTC 2VT2A 2EIJE 3ZK7A 4XUGB 1V1RA 3G2MA 1XROA 1F14A 2Q5QA 4M7PA 3ETDA 1QGDA 4X60A 1FNBA 3DPYA 2JJMA 2NPFA 4DWJA 4A8HA 3FTPA 1D04A 5IDVA 2VPIA 5ICFA 1JFSA 1KI4A 1IBLB 5ALSA 4ZRDA 1HE4A 5FO0A 4Z1MD 5ER6A 1I4WA 1IRXA 2FLWA 3W1WA 3ZI7A 3P9KA 3IP8A 5BNIA 2MIIA 1CUBA 2B8TA 2YIVX 3B38A 5TS2A 1NVBA 1QS0B 4F9EA 5CBKA 2YZMA 4LFBB 421PA 3SFTA 1SA4A 3KM0A 2ESRA 1YE5A 4UCXA 2P5YA 1SZPA 1WBBA 3KJXA 1XVTA 4B0ZA 3DWIA 3BHNA 2PJZA 4RSYA 3OTWA 4BP9A 1QGUA 3JQQA 3PK0A 4MRNA 5F33A 2MJLA 4OM8A 1KH1A 1NOIA 5FZSA 2XE8A 4JT9A 2JLBA 4PYKA 4EFLA 2R1TB 3BE8A 3RJ9A 2NSZA 2DR2A 5ALUA 4OLAA 3K0KA 1K1EA 3L8GA 1KE1A 1G5QA 5AI5A 4MSUA 3LJKA 4LDPA 2FRDC 2X15A 3WL4A 3LT2A 3C3XA 4CHTA 1I3LA 4UYJB 1NKSA 4LZJA 3Q5EA 2B82A 3FPAA 2AEJA 2C9ZA 1EZ4A 4U95D 2YMQA 2JCBA 4MVJF 2QROA 4HYYA 4XGIA 3CHYA 5DTRA 4Q4AA 4YONB 4E14A 5C8VA 3ML1A 2IIBA 2R8PA 3BREA 3OU7A 1BWSA 3B8EA 4MYDA 3M82A 1JKFA 5JMPA 3V2HA 5KINB 2Y67A 3ANYB 5EJ2A 3APFA 1EIWA 1OYVA 4NAVA 3TZCA 4AS2A 3DFKA 4KKVA 3UW3A 3OCYA 1JYFA 2YJNA 5BW6B 4BE9A 3Q6IA 4DLQA 1KDYA 3AT1A 1H8EA 3TG8A 2Q4TA 1J90A 1L3BA 3CZAA 2XCUA 1ZN2A 3LCJA 5CRIA 2FUKA 4KH1A 3V2IA 4BBAA 5K8JB 1NFRA 5CBPA 2O3SA 2IU6A 2NNLD 3P26A 5AM0A 1Q1ZA 3EXAA 2B1QA 5EN5D 1H42A 2EWMA 2OL4A 3A1VA 3Q2OA 3TM4A 1L5HA 3MSXA 4ZK2A 1W35A 2P5TB 4A91A 2PZ8A 3LSTA 3H8SA 1FFHA 3HJNA 4CZ2A 4D9GA 3JZMA 1LTXA 4IXTA 3H5OA 3RTEA 2BHSA 2ZYIA 4U0KA 1YD7A 1WM1A 2C2WA 2NU6B 3KJQA 4IDOA 2AXPA 5ARDA 2XZDG 2QD5A 3PS6A 3KQTA 2FR8A 3JQ6A 2RJNA 4K9SA 1H6OA 5CDTA 2FI7A 3LE8A 4UDOA 4UULA 4DT1B 1EVYA 2ZTMA 3UAZA 5DW0A 3T1HB 1FMTA 2BUAA 2XX3A 1II0A 3X1XA 1ZD9A 4ACAA 4IRXA 4Y18A 3CKLA 4FD2A 5CG2A 3LF2A 3A9TA 4PFQA 2QJRA 5E7MA 2WZCA 1E2GA 1RE0A 5JZMA 1QH0A 3H2SA 4XR4A 2Q5EA 5EL0A 1NQVA 1NQAO 2P7IA 2CL0X 1OAOA 5JOQA 3UBMA 1EM8B 2E49A 2W6MA 4YASA 1EFTA 2AWNA 1B1CA 4UJ3A 3WGTA 5KC8A 2A5YB 2UU9B 3U61B 2R751 3DBIA 2LZ0A 1PW7A 3B20A 4FU0A 3CGGA 4L3OA 4DCOA 2X0FA 2X8WA 2Z0MA 4IMRA 2FQQA 4XB6B 4Z6KA 5EILA 2VYFA 3BIFA 4KVGA 3VTFA 4BNHA 1XHEA 3DBLB 2I4TA 3L0SA 1YRYE 2UVQA 2NACA 3AV3A 3FNRA 2P77A 4P22A 2Q9BA 3AJ8A 3SD7A 3SP1A 2PT9A 5B1SA 4TZKA 1LA2A 3GV0A 2XENA 1FUYB 1DHTA 2O0LA 5CFOA 5CX4A 3S8EA 4Q9LA 2V5QC 5CBOA 1Y6QA 2RG1A 2REQB 4IH9A 3EEBA 3JYLA 2VPWA 4DNPA 2GA8A 4JFRA 1B0UA 3UB3A 2W48A 4MDYA 1O94A 4CLDA 4DUGD 1B8OA 4Q94A 4AJWA 2BFBA 2OYRA 4PYQA 4OVUA 3TPFA 1LXCA 3R41A 1OT5A 2IXDA 1JQ3A 1F5NA 1Q19A 5D2CA 5B4UA 2DK6A 3ZDZB 5BXYA 3W4IA 2XECA 3KIPA 2PGNA 3C7AA 3CNBA 4H35A 3RFUA 3D1LA 3WE7A 3WQBA 2XZOA 3N8GA 5ED4A 5GWXA 4NFYA 2R6CA 2J31A 2RCNA 3AJAA 4GC5A 5CCMA 1E3SA 3D8RA 3IURA 1Z56C 4X92A 1Z82A 2H1RA 4CMGA 1T4DA 3HRHA 1VRCA 5JRDS 3AUKA 2YYYA 1KAMA 2DLNA 2ZRQA 4PQGA 4BS9A 2FFGA 1JKMA 4RQBA 5TQ0B 3DR5A 4J1TA 3WL8A 2P1DA 1RAGA 2JF0A 3AVOA 4XAQA 5F7JA 3CNLA 1PJ3A 3R75A 1SIWA 5JY1A 1KJJA 3QX3A 1R4AA 5HFAA 2EBFX 1GZDA 2AOUB 2X58A 3DFFA 3RBVA 3VVCA 1YVDA 4E33A 1P6UA 2ZE7A 2FW8A 2WPDA 1AQNA 1PGPA 1VTKA 3C1UA 4B6QA 1KY4A 4UTRA 4LYHA 1A2QA 3OEHA 2F43A 3B3QA 5C7OO 1T15A 2ZRDA 3CEHA 1S89A 5TXGA 2J8SD 2GBFA 4OYHA 3WGKA 3SHOA 2G17A 3DXZA 3G2LA 4RLYA 4MZDA 4YQEA 2H18A 3W2HA 4D79A 4W9MC 4B3JA 3N0VA 3QVJA 5KHAA 3HXKA 3OCWA 5JAPA 5AW1A 3NS7A 1U4NA 1G66A 3VOAA 5COAA 4ND2A 3ADKA 3IUJA 3RAJA 4CT4B 1T9HA 2YXNA 4IZOA 5BMVB 1ESMA 4OAVB 6CHYA 4GXNA 2ZITA 1JHUA 2OXEA 3LQQA 2XCBA 4E3WA 1MAAA 3ST7A 3UX4A 2NSHA 1P8JA 3FPHA 1JKXA 2MRIA 2PL2A 1VPVA 4HWPA 3QVGA 1IZ7A 1QVZA 4TKUB 1J07A 2X13A 1W9MA 5K3BA 4CMCA 4Y0NA 2DCUA 2A0YA 1Z4IA 2B4YA 3FTCA 3KQQA 2XNCA 3ZI4A 3PQ7A 3MXOA 4BEVA 4WBNF 5JAQA 4S05A 4INOA 1N2CE 3UWPA 1Q0ZA 3ASDA 4UNRA 3GCZA 5FDFA 1C1XA 1N0HA 1Q3HA 2YJZA 1JNYA 4URXR 3IUQA 1FMJA 3TQCA 1XNQB 2HLDD 3L77A 3HNPA 4MI1A 4QFMA 2AJ8A 4LXUA 4C6HA 3ZJTA 1TJYA 3U19A 3RFCA 2LR0A 4EL5A 2NOAA 4DR1B 3LDZA 4ATZD 2P2CA 3DRAA 2PNFA 4JJKA 1XLTA 4WNYA 4JXJA 2DZNA 2FMHA 2OCKA 3ZE0B 1VKOA 3DVAA 4TWBA 3RRMB 4YDQA 2W2XA 1HMPA 4O2BB 3KEQA 4ZMRA 1W9HA 5JUWA 3GA5A 3RH0A 5KYUB 4DKJA 1KS9A 2PKWA 4LJAA 3W7BA 4BGDA 1MDBA 3DV0A 4MRMB 3AB3A 5K51A 1SG9A 3SR0A 4XKBA 3VR6D 3PC2A 1HFWA 2G6TA 2I6FA 2LW7A 1BDMA 1C0PA 3C70A 3MJEA 2QL7A 1CLUA 4Z7QB 1U7HA 3JARA 3LCRA 3BGOS 4I1UA 4IIUA 1J24A 3ONWA 1D2GA 3IV6A 3NAQA 5KPJA 1VKZA 1YH3A 2FN7A 5BWLA 4J29A 4RAOA 4E5DA 5LP6F 3OE1A 5I4CA 5LQDA 1XLWA 1JT9A 4Q00A 5HP4A 4EHDA 2IHUA 1ULZA 1LPMA 1C7JA 2BKEA 2VF7A 3GFFA 3LRXA 3AU4A 2OZPA 4M7WA 4BCDA 3AU9A 1W4AA 2EJTA 3TWVA 4HG2A 4L75A 5H16A 5IKEA 2AE2A 2C5HA 4FU3A 1EVIA 3HBFA 3B7SA 2VIIA 5KUTA 1OBHA 3L16A 3IHVA 2P4HX 4DRYA 1LRLA 4C21A 2PJRA 2UDPA 3Q85A 1Y4UA 2OHOA 3FTDA 1V41E 4UPVA 3IBYA 1UJ6A 2C54A 2NW6A 1V4BA 1E79D 2AUNA 2WKWA 3L92A 3L6DA 1PWXA 4ZDWA 4LRWA 1KI9A 5GM1A 3VR3D 4KQ2A 5HRAA 4LJYA 1YAHA 2VCHA 4N39A 2DAPA 1FDIA 1HMYA 1DAOA 3DBVO 1WTCA 3KKQA 2FPLA 2FXVA 2WE8A 3MAJA 2Q8PA 1GGFA 3BIOA 3HJCA 4NP6A 3VDXA 5JJCA 1GPNA 4YREA 1V5FA 5G4KA 4A4DA 1YUBA 4LX0A 1LS6A 3JZAA 1WOYA 1S9HA 3CX8A 2YHEA 4KSBA 3MCVA 5DTMA 4DY4A 4BNMA 4KLZA 1GZHB 2OCLA 3OE5A 2PO5A 2YBEA 4MCIA 3U4CA 3HPQA 4X0EA 4D6XA 5AJDA 1P9LA 2KZTB 4Q21A 3X44A 5K0NA 2BMWA 2Q1UA 2F64A 2R65A 3VPSA 2AXEA 2Z98A 4G8CA 3VLEA 1ESNA 1PZEA 1VFPA 2JFFA 4U5XA 4F6RB 5CT9A 5C3MA 5I4KA 5EIBE 1Z2EA 2RAPA 3VUEA 5CD1A 2QRZA 1W29A 1ORTA 4KQ1A 1F5SA 4F06A 2OP0A 1YR8A 3N53A 3ORQA 2G04A 3DF9A 3R5TA 4WKOA 4QATA 4S1TA 5KB3A 4YLEA 3ASHA 2QZ9A 3H5LA 3FUXA 5LQCA 1TO6A 3E22A 4QICA 1E61A 3EZ2A 4IW3B 2ERYA 3RVNA 4G0OA 3WMEA 1KL7A 4H6WA 4R1MA 2WU8A 2QY7A 1PKEA 3U3ZA 1JEAA 5KX5F 3NAZA 3UJCA 1XVLA 4I5DA 2W58A 3IJEB 3LYHA 3OJXA 5D84A 4QG3A 1YBFA 5JFOA 2F67A 1O96A 2PG3A 1F8GA 3D7RA 4WVLA 1GAQA 1GTJ1 1DADA 1WV0A 3LWZA 5FB3A 3G23A 1A5BB 4RZXA 1P1BA 4LC0A 1NWHA 4B7XA 3AC0A 5JD4A 1TYCA 1H5NA 3RKUA 2V55B 1MT3A 3SQVA 2R44A 4GG1A 4KQCA 4PWYA 2OYCA 1SQMA 4YWHA 5KMGA 2FEXA 2FR1A 1VKNA 1KK0A 3CLSD 3F2IA 3H1AA 4B45A 3NOQA 1N2CA 1P1HA 3PKZA 4C2BA 2JBHA 4OHZA 3TNLA 5JYCA 3QU4A 4IAOA 4A73A 4ZCRA 1JEYA 1ZI9A 1H9CA 3DBLA 2PPLA 1WCWA 3NEPX 1MV8A 1KP2A 1S2DA 1HLGA 1K9VF 2QA5A 3KZCA 4JB8A 4FHDA 3UWDA 4QNNA 3AI1A 2ZRPA 5FI3A 4EI9A 1P18A 3RAPR 3LQYA 5L7TA 3C8MA 1SCBA 3L8FA 4BUJA 4RENA 1M1YA 4J90A 2QI9F 2NO1A 2BKGA 1T4CA 2WVHA 4J0CA 4BRZA 1CJSA 1D8TA 2JHPA 2FKAA 3V79K 1XNHA 4J0QA 3PZ1A 2H1SA 1MQAA 4C04A 2JFWA 1WCV1 5CDGA 1FFXA 4HNSA 1MX2A 2G8NA 5IN4A 5FHQA 4K86A 4RADA 1E20A 3A9UA 3OTQA 2IE0A 2RBGA 2IVFA 3C8HA 2RHBA 2X2PA 3KDSE 3FSJX 3KYIB 2GOYA 1MB0A 3ROPA 3RUHA 5CITA 2EBHX 5SV2A 3TO5A 1UP7A 3EFBA 2NPIA 4V1CA 2NU6A 3NUZA