4N3BA

Crystal structure of human o-glcnac transferase bound to a peptide from hcf-1 pro-repeat2(1-26)e10q and udp-5sglcnac
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
716
structure length
697
Chain Sequence
b'CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title HCF-1 is cleaved in the active site of O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/substrate
total genus 275
structure length 697
sequence length 716
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3bA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3bA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4n3bA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4n3bA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n3bA03
3BDAA 8GPBA 4KYOB 2QN1A 3DZCA 3G2IA 5IKPA 3FWVA 4FZRA 4WNEA 2QRPA 2VCEA 3O3CA 3L7DA 3MS2A 3NCHA 4I17A 2UY1B 2F3PA 2VGXA 4N3BA 2C4MA 2QRMA 2JJMA 4I2WA 2VYIA 3MS4A 2H1HA 4HOTA 1WV0A 1WUYA 3TGOA 2QRQA 5BW8C 1H5UA 1TJCA 2BISA 3BEOA 2IW1A 3Q4AB 3BD7A 3OKCA 1QQEA 1PYGA 4KQ1A 1P29A 2XCIA 3RO3A 1ZBPA 3CKBA 4RBNA 1B4DA 2QRHA 2HO1A 3T7DA 3S7JA 4UQZA 3UYKA 1KT1A 3H4TA 3Q3EA 3GPBA 4F97A 4U0SA 3KS2A 2QLMA 5BNWA 3S2UA 4X6LA 4I1AA 2PL2A 3GZ2A 3ZCTA 1YA6A 3ZCUA 3CUYA 3ZCQA 5ENZA 1QM5A 2KS6A 1P4GA 2IV3A 3RU0A 1L7XA 5CCLA 3MA5A 4HORA 3VDNB 3MV3B 3O48A 1XL1A 1JIXA 1PC2A 4RIGA 4EKYA 4KXKB 2L6JA 4F96A 2JLBA 2XCBA 3Q5MA 3EBPA 3RJVA 2OFFA 1BX3A 3OKAA 3ULQA 2AMVA 3OY2A 4GA2A 3RKVA 3C4VA 3G2JA 2C0MA 1NZNA 1QKJA 4W6QA 2XA9A 3OXLA 3S29A 2ACVA 2F3UA 3HBMA 2PYIA 2R5SA 3FFLA 3IAAA 2Q6VA 1E4OA 4WNDA 3BD6A 1NOKA 3TSAA 3LY9A 3CUWA 4AY5A 4MI6A 3NF1A 2QLLA 3CK9A 4XIFA 1HH8A 3C4QA 3CVPA 5TVGA 3OXGA 1O6CA 2LSUA 3L7CA 2VSYA 1W3BA 3CEHA 3ASGA 1GGNA 4CGVA 1Z8DA 4CTOA 5I45A 1ELRA 1PN3A 1WUTA 5EX3A 3SF4A 2R60A 2SKEA 1NA3A 2X0FA 3DDWA 3VUFA 1EM6A 2C1ZA 5DXFA 4ABNA 2BGUA 3UPVA 3RIBA 2ACWA 3DDSA 4M83A 1FS4A 4EL5A 1PNVA 3NB0A 3QWWA 3TOVA 2MHKA 2F3QA 2ONDA 3QDNA 1P5QA 1B89A 3AS5A 4RIIA 3L7AA 2XCCA 4N3CA 5KJKA 1E96B 3CV3A 4UQYA 4I9EA 4BTBA 3D1JA 2ATIA 5JJ7A 2AZDA 4HOQA 4IN3B 1SXPA 4G26A 1GZ5A 1FU7A 2XGMA 4HOUA 4U04A 3URZA 2F9FA 4KBQA 4BTAA 5A7DB 3NAZA 1FA9A 4U07A 3SYMA 4JHRA 2XGOA 3QOUA 5JJ6A 2C9ZA 2ZB2A 2QN3A 1IHGA 2FBNA 2ASVA 2LSVA 1L5SA 2HY7A 2V5FA 2GPAA 4XI0A 2PQRA 3LY7A 2IEGA 2YJNA 2FO7A 4GPBA 2R4TA 3QWPA 3CVQA 5C1DA 4YNDA 2IEIA 4NC9A 3BCRA 3CVNA 2QNBA 3FP3A 3DD1A 1ABBA 4UI9C 1ELWA 3G2KA 2KCVA 5HXAA 2F3SA 3T3HA 5GPBA 1Y8MA 2XGSA 1Y6GA 4F9FA 4U0UA 2IV7A 3MSCA 4J8EA 3PDNA 1SXQA 3PE4A 3VTYA 4N39A 2VQ2A 6GPBA 5TMDA 2GW1A 2UWJG 4JA9A 4NQ0A 3OTHA 2VGYA 3ASFA 3Q15A 4AIFA 4A1SA 3KAEA 1YGPA 1PSWA 1JEJA 3ZPJA 3AMVA 1K08A 2KCKA 4F3VA 2P6PA 4L22A 3NP7A 3K9IA 4QLBA 3VTXA 1WV1A 1ZU2A 2C0LA 3MBOA 2G9RA 3CUUA 4N3AA 4XI9A 2Y4TA 4UQXA 3MT9A 9GPBA 2PQ6A 1P2DA 1V4VA 2I6HA 5KJLA 2XEVA 2QN2A 3ZCRA 1L6IA 4AMBA 1Z6QA 2HYZA 5JTUA 1P4JA 1AHPA 2IFUA 3BCSA 4H7YA 3T3GA 3BCUA 3KD7A 4N9WA 5D0QD 2IUYA 3MT8A 3G2NA 2X0EA 4GZ5A 2PQNA 5HI7A 1JG6A 1KT0A 3R9AB 3Q49B 5D00A 2FEZA 4YVOA 2FETA 1YA0A 5BT1A 4RENA 3OXFA 3NPAA 1C8KA 3T3IA 4MICA 3NC4A 5LCWC 4X7MA 3PE3A 4NEQA 4W9RA 4BQEA 3OTIA 3TG5A 4I2ZA 2XCUA 3UQ3A 3Q3IA 4G25A 1NZFA 5D01A 3ASHA 5JJTA 1NLMA 1C8LA 5LCWJ 4G24A 3CUTA 1NOJA 4GCOA 2KATA 3CUVA 4J8DA 2SKDA 2DBAA 2VGXB 2YQ8A 3EBOA 5CCMA 1AXRA 1Z6PA 2X0DA 3HBJA 2O6LA 4MRAA 4Z5XA 4G2TA 1GG8A 5TMBA 4EKEA 4JL0A 1FTWA 3T5TA 2VSNA 2OOEA 3WC4A 2C2LA 4J8FA 2SKCA 3ZN3A 3E3NA 4BFCA 3WAGA 4EL0A 3SYRA 4AMGA 2KCLA 1HLFA 3QKWA 3CV0A 3COPA 2WQHA 3S7BA 3S0JA 2R4UA 2GPBA 3UUXA 1GPAA 1LWOA 5G04C 4N5CA 3MTAA 3OY7A 5DLDA 3JYSA 1IYGA 4KQ2A 4HOSA 3GW4A 3L79A 1P2BA 4MHSA 1WW2A 3G2HA 1KLXA 2J9QA 3ASDA 4O6FA 4BT9A 4GA1A 4CTNA 4GCNA 5G04J 2C1XA 2QRGA 3MV2B 3MS7A 1J39A 3MQFA 5FTPA 3RSCA 1A8IA 3IEGA 4U0ZA 2R68A 3LPZA 1FU4A 2XMPA 2AVPA 4UI9K 2FF5A 4G2VA 3MRXA 3OT5A 3RHZA 3BD8A 1WAO1 2G9QA 1C3JA 1E1YA 3ZCSA 1F0KA 3NP9A 2E2EA 3OTGA 1LWNA 4BWRA 4I9CA 1FU8A 5AYWD 1L5VA 3L7BA 4APOA 3HBFA 1WW3A 3ZHEA 3MRTA 4NESA 5JTTA 3CK7A 3MKRA 1XKXA 4UI9J 1M5RA 3GYZA 3ZGQA 4J0UA 5CHEE 5ARGA 3E4BA 1FTQA 5EX0A 2XA1A 3E3LA 3HYMB 2Y4UA 4WACA 4YI5A 3CEQA 4ME2A 2ECPA 5DU2A 3LCAA 1L5RA 1L5WA 1KTIA 4BQFA 4NRHB 4X7RA 2QN9A 2R66A 3MTDA 2G9VA 4LEIA 4GZ3A 5IKOA 3UYLA 4HLNA 2IYFA 3ESKA 2IF4A 2XPIA 1XNFA 5FZQA 4GYWA 1RZUA 5FT9A 3MT7A 1NZDA 2QFCA 2GEJA 4MHOA 4GYOA 3S27A 3ZFWA 4WUYA 1XC7A 2G9UA 4RIHA 2NC9A 4GZ6A 1FTYA 2GJ4A 1WM5A 4M7PA 3RT1A 3L01A 2QLNA 4AY6A 4YI3A 1GPYA 2VCHA 3AS4A 2QZSA 1HXIA 1FC0A 4CTMA 4HWGA 4EJ2A 2LNIA 3U3WA 3GUHA 4RIFA 4LEUA 1UZUA 4CDRA 2BFWA 2FFRA 3T3EA 1GPBA 2H1FA 4RG9A 5DIZA 4Y6CA 5TMEA 2FI7A 2GT1A 3CKCA 3LKUA 2GM9A 1L5QA 1JIVA 2PRIA 5ARFA 3CX4A 1QZ2A 4H7XA 2AV6A 2PRJA 3S28A 4G1TA 1Y8ZA 1C50A 1UQTA 4WADA 1F6DA 1XL0A 4Y6WA 1P4HA 2IYAA 3RSZA 1A17A 1HZ4A 2WPVA 3CEJA 4REMA 5G05C 1NOIA 4LDPA 3WADA 2GEKA 3TG4A 3S7DA 2X6QA 5HQ8A 1K06A 2UY1A 3ZHEB 5G05J 4B94A 4M60A 1VGVA 3MRVA 3BEEA 4GA0A 2VG8A 2X6RA 5KJNA 4FKZA 3S7FA 2AW3A 4N2QA 1P2GA 3HBNA 1NVKA 3N71A 1XV5A 5FJYA 3Q47B 3EDTB 5DBKA 2YHCA 3H4IA 1Z62A 3MTBA 4WHMA 2P58C 3WXXA 2KC7A 3MEKA 1JG7A 4YUAA 3TAXA 4PQGA 3GZ1A 3FROA 1JIUA 4RELA 5FZRA 1IIRA 1FCHA 3D0RA 5EKQD 2QN7A 3Q3HA 3LYAA 3ZCVA 4G23A 2WTXA 2XA2A 3CVLA 4GPKA 2HR2A 3E3OA 1GFZA 7GPBA 4BT8A 3G2LA 3ZCPA 2GPNA 4WNGA 3VDMA 3AS8A 1RRVA 3SZ7A 3QKYA 4WNFA 1OUVA 1IXYA 1Y6FA 4N2SA 2JZCA 1NA0A 1UQUA 4YVQC 3LY8A 1XOIA 4MI3A 2FF4A 5LQDA 4X7PA 3CEMA 2Q7FA 4EQFA 5KJMA 4BQIA 4JA7A 1EXVA 3OKPA 2QN8A 3QHPA 4AN4A 3C48A 3U4TA 4GYYA 3D0QA 3IA7A 4MI9A 5A6CA 2PYDA 4RIEA 5M72A 3QWVA 1RZVA 3CK8A 4RG6A 2BUGA 5FZSA 2PZIA 3RO2A 4AM9A 4CGWA 4KQMA 3VUEA 5D0OD 3T3DA 2BGTA
chains in the Genus database with same CATH superfamily
3RU7A 1P7CA 1C1XA 4LOAA 4NOJA 5BQ3A 4QUBA 3WIEA 4D25A 2UY1B 5ALVA 2EFCB 2ERCA 3SJUA 1D5WA 1FUUA 3M7IA 1IHXA 3QV1A 2X0NA 1TAGA 2BMAA 4YRCA 4B4VA 1AA6A 1NXXA 1DRVA 3KZNA 5TQ0B 4K05A 4MBGA 4QTZA 3RO3A 4L0QA 4LOLA 1DBWA 5EFOA 1PX0A 3COZA 4X6LA 1YZ3A 1KI1A 2B1QA 3ZCUA 2GJSA 3F6YA 1QM5A 3COYA 4LXIA 4P4TA 1DAOA 1YMUA 1EUZA 4B87A 9ABPA 4NOKA 1U8YA 4F3TA 4URKA 4K8RB 3CNEA 3L7KA 1T0PA 3CHYA 2P9NG 2WP8J 3L0SA 1H23A 1G41A 4LNUA 1TB4A 3IOEA 1NXSA 3WSVA 3VSCA 1S01A 1TMOA 3OOYA 2XSZD 1V25A 4LJ8A 1VDZA 3DPIA 1DKMA 1OHHD 5LB4A 2H0RA 1DT5A 3AS5A 2B5VA 1WDWB 2GHQA 4PQEA 4A55A 2I3AA 2PTHA 1Q7RA 2PLFA 4WY5A 1U5BA 2KI5A 5L9AA 4HDRA 2OO7A 1NUQA 1M1YB 4X8QA 5J47A 3QFHA 2GZAA 2AJLI 2PRYA 1M74A 3IILA 3OTQA 4N3GA 1TYZA 3BCRA 4ARZB 4B4OA 1FFSA 1NV9A 3FKSA 1OI7A 3FF4A 4J6EA 5TPWA 2VQ2A 4LERA 3U1BA 1J33A 3M82A 2EERA 2IUTA 4P7GA 1DKNA 2FMKA 2V5AA 2OHFA 3WE7A 4KK4A 4QDTA 4YCMA 3EZ9A 2G9RA 1LI4A 4FGWA 3NGXA 2D7DA 1LFAA 1KFJB 3QU7A 1RADA 4K81B 2GCOB 4IZOA 3L4EA 1FK8A 3ZQUA 2FEZA 2FETA 3NEJA 4PFJA 4B2IA 3HO6A 3R24A 1YCSB 4J0QA 3Q3IA 4ZCTA 3IRUA 3W1EA 3U7RA 2R4QA 3BWBA 4J49A 5H82A 1CP2A 3NTQA 4G4SO 2VBCA 3ABRB 2CYCA 3ZV6A 1E0KA 2CHEA 1A8PA 4FYIA 1D4ZA 4H3VA 3D9JA 4N7MA 3HNPA 4TKMA 4RKYA 1WY6A 2RI1A 3BH0A 5K2MA 2ZB4A 4CKCA 2R17C 4WBSA 3K9CA 4IUCS 2CXQA 3RSEG 1ZIOA 1UPAA 3IQWA 5LSAA 3EZ6A 5DYTA 5FA8A 4MH0R 2EGHA 5AJVB 1GVHA 2IOFK 4NURA 2A5UA 1EQAA 1HQKA 2WTNA 5IT4A 4DXAA 3JSXA 4JBLA 4Q66C 3ANYB 4ZEXA 5L40A 1Y3DE 4MYCA 5CDTA 4GDFA 1S3GA 2VQEB 1EVJA 1UW4B 1H4QA 3LPDA 4KE8A 3I4CA 3PDIB 2VTKA 2WWWA 3FYSA 1RQRA 1ZC4A 3BXXA 5J4YA 4H17A 1ZC3A 2R6FA 2JA2A 3HPQA 1SJ9A 2GN6A 4H0NA 3DAFA 1X7XA 3WLHA 2XCOA 4XX5A 4BXOB 3TW0A 1Q0UA 4AY6A 5FFNA 2Q62A 2V3WA 1VE3A 1J2UA 3IOMA 2BZGA 4QYIB 3UCEA 3IA2A 5CP8A 1Z63A 5LN1A 3E18A 1JIVA 3CX4A 1TI7A 1UP4A 4W5HA 4DJTA 3GCGA 4D99A 1W87A 2B7LA 4IINA 2JFWA 1OH6A 2OGZA 3T54A 4FN4A 1UKCA 4RE6A 4HFRA 3VJLA 1U1CA 2YFHA 3IQFA 1Q7TA 1J1UA 3ZIMA 2G1PA 3SR0A 4HAZA 1YMPA 3ILVA 4IDDA 2JARA 2ZS8A 3CH5A 4OUDA 7GPBA 4S2UA 4WNGA 1HL7A 4BVKA 2H9AA 4YTEA 1U6JA 3LNCA 1RXWA 1N3LA 1BRTA 4YDYA 5JSUA 5I6DA 3LHFA 2GJ9A 3A9VA 2OO5A 1M75A 4PU0A 4XX1A 3FPEA 3Q3GE 2AE2A 3FPBA 2HPZA 1RM0A 4CMCA 5CIWA 4TYWA 5BWNA 5L51A 2OGSA 3A05A 2WUFA 5M5BA 1MOZA 3RO7A 1RM5A 4EFMA 3QU2A 1AKEA 1PJTA 4JP2A 2QOEA 4NSNA 1N36B 4C6HA 3ANSA 1J4AA 1YQUA 5B3JC 3JCZA 4LF9B 2A4MA 3FLMA 2HU5A 2LCIA 1XALA 5DK4A 4Y2PA 1K4KA 5HS0A 2BEVA 1H2XA 2IVFA 4PZZA 1BS9A 4O2RA 2AMVA 1ENYA 1IEVA 2LKCA 5BOSA 2NXCA 2HKIA 3IOBA 4B6FA 5KIAA 5BXUA 4RZSA 1PT8A 3U61B 2UKDA 1UT6A 3VR5H 4XGRA 4OEHA 3GBPA 4DXDA 3V8BA 5I45A 4NCKA 4BECA 2Y93A 3K8YA 1IH8A 3RARA 1WE2A 3HB0A 2WUGA 3DVAB 4YP7A 2ACWA 4FE7A 4KXNA 1WF6A 1A98A 2O2YA 4C78A 3JYPA 3BRSA 3ECSA 1RRFA 1LX7A 4LNUD 3O8QA 5AKKA 3CQGB 3INTA 3CPJB 5JNUA 2AVNA 1I1NA 4CV1A 2HMVA 4INOA 5FBHA 4V3IA 3TZLA 3NALA 3ZBTA 3KJZA 1I9GA 2B1GA 2V5FA 4X41A 5DRTA 4TZTA 4BU0A 1GA4A 1Z2EA 5EJ4A 1CX9B 4PN3A 1MB4A 4W5RA 4IFEA 1X1CA 5C53B 3H2SA 4BNZA 5LQUA 4OYRA 2QUAA 4I7EA 1XJWA 1XTKA 3NONA 4I4NA 1R6DA 4FX2A 5EKUA 1ONPA 1PSWA 2CCJA 1GPLA 2GN9A 3JZFA 3WO1A 3GEIA 3FKSD 4R16A 2G5TA 1H9AA 3W5JA 3U3RA 5I48A 3BQNB 1U1EA 1TLLA 3RVSA 2G82A 4NYMQ 1MQSA 4U7WA 2PNFA 2B78A 1Z2CA 1D2EA 1DQRA 1IDN1 2HX1A 2Q41A 3RROA 2D2FA 4WQMA 3KE8A 2YWBA 2C3MA 4O1PA 3EEIA 3PBKA 5D7NA 4EQZA 2K5UA 5HE8A 4KDRA 4DYVA 1K5HA 3FDHA 3AGPA 4RVOA 4FJ2A 5KPDA 3V2OA 1OPXA 1QH1B 3B3JA 3G85A 3MMXA 3QNKA 3BE5A 3G1WA 1WD7A 1O0BA 4ZGBA 1HQCA 3WAKA 2GRLA 3OC0A 2F1KA 3P9IA 3QVGA 3W2GA 1YQQA 2IIQA 1U7PA 2DY0A 4GF5A 3CSFA 1T26A 3YASA 4X1IB 4K9LA 1P7VA 1YRLA 4WW0A 4RTNA 5ALGA 5LVAA 4WUTA 1JSXA 4UUOA 3JY6A 1ZD5A 4U6QA 4D8VA 3FNHA 3R5KA 4YRKA 3RHZA 1WAO1 2OV6A 4GOOD 1SBYA 1UK9A 3OM1A 3ND7A 2VC2B 1M5UA 2WU4A 3HBFA 3PZDA 2AZ4A 3KKLA 1C3LA 4PGHA 5DYGA 3RS2A 1M0EA 6NULA 4N5HX 4RTRA 1IHBA 1Z2OX 4TRRA 4FADA 4I6EA 1SBTA 3NM5A 4RIHA 5I9LA 3NYQA 3TWUA 5AVKA 2ERYA 5F4BA 1Q22A 3VU0A 1QCDA 2HA7A 1WHTA 2GPWA 1DG1G 4YHHB 3D9OA 3L82B 3V1YA 2VI5A 4YN3A 5ARFA 5ALFA 1OA0A 5JD6A 4AO7A 2AX3A 1R4NB 2PA3A 2I29A 1H0AA 4G0VA 3PL5A 5H4GA 2NYAA 4ND6A 2WMNA 4HDAA 1YB4A 2GNOA 3K9WA 2Z04A 3ICOA 3T06B 1NVKA 4MKXA 1T0JB 1MZVA 4FGZA 1XJ0A 1FCJA 1ZVQA 2CXRA 2O3JA 4JYAB 3VKHA 5T4EA 1GDTA 1XTRA 3ABOB 1ZUIA 4HC4A 4XUEA 1NRWA 1P9RA 1OIWA 3OZVA 1EM8B 1BO6A 4DMFA 1LLUA 4O2AB 4LC1A 1JUDA 3SHVA 4M0PA 4ER3A 2BCGY 5B57C 2XEEA 4PE5B 1NVVQ 3TD6A 5JZVA 4Y98A 1JI3A 4TYYA 1JAXA 3UMMA 1MFZA 3KIPA 4Y2UA 5GONB 4P3XA 4V02A 1CEYA 1S0PA 2QVXX 4U3JB 1QDLB 3ZY5A 3RD5A 1LJLA 4R7ZA 2IYPA 1BKDR 1PUJA 4LDJA 1MEJA 3V31A 3RAFC 4BZZA 1GPKA 1TZMA 4S1VA 1EB9A 2DWUA 1E90A 3NVDA 2YHUA 4WUVA 2PANA 4OJKA 2IKQA 1K3FA 4WA8A 2PUGA 5F2KA 3QJZA 4QLOA 5CPBA 2GH1A 5SY4A 3TWWA 3HUTA 4LWZA 4BFWA 5TT1A 4I1IA 1ESCA 4F2HA 4U2BA 1SKQA 1VECA 2XDQA 4GW3A 4TROA 3UT6A 5SY9A 1W3BA 2P5YA 3QUBA 1KY4A 4O4HB 3DLAA 3VBCA 3WBKA 4CMHA 1XIVA 4LDNA 3PQ4A 4IXTA 5EP1A 5KWDA 4OX9B 1UWVA 3RS0A 1PFYA 5LPNA 5DISB 4GR4A 3PI7A 4JIGA 1SPXA 4RXUA 1N6KA 3TTXA 4WN3A 4L75A 5M2QA 4RFVA 4ZV9A 3FBTA 1SOVA 5DNCA 2D1FA 1PZNA 1NNSA 1LK5A 3P9CA 1D6SA 4BMZA 2B5WA 3DXZA 1GSIA 5AJXA 4QXMA 2XZTG 5HFAA 1NLFA 2I65A 3U16A 2IYXA 1L3BA 1I5EA 4WFQA 1YR7A 3PQ5A 4DAOA 4CRWA 3DD5A 2Q4RA 2YMPA 1C7ZA 4BZQA 2UWJG 4MARA 1GAJA 1GN9A 4D9JA 1G5RA 3TK1A 4ND5A 2ONCA 2ZLBA 3A6EA 2OV4A 2CDCA 3OPYA 4OAVB 3KCQA 4XFJA 3HLTA 3GT7A 2HQOA 1PDOA 4A2CA 2JB9A 4W1PA 3Q49B 4IDEA 4RJLA 2AFIE 1RRPA 3T1YB 3E84A 3QUAA 2N47A 1M10A 3K6JA 3DB1A 4UWKA 1W88B 5CVEA 3Q8MA 3KC2A 3BUAA 3HKDA 1E8ZA 2R8OA 4GXRA 4D74A 3IT1A 1VFNA 1GPAA 1C80A 4QTUB 1MX6A 3IQXA 1GG9A 1KI2A 1GL3A 4LRUA 4BUJA 5IN4A 1FZTA 1C9EA 4ZT3A 3WYDA 3QMMA 2JIBA 2YIVX 3L0IB 2BFEB 5CR9A 5C8XA 5DBOA 1LTQA 4EUKA 4JQSA 3FTCA 2ZE7A 1WTAA 1YMVA 2JVIA 4S1WA 1R5OA 1HMPA 2PKXA 4CQMA 4GAEA 3HXDA 4DKJA 3H05A 3UF0A 3EDCA 5IWCA 5MDHA 4UEWA 4XFDA 1BYIA 1CQIB 1N7IA 3LRTA 2QM7A 1C1HA 3PKIA 2YN2A 2A9JA 3ETGA 4CDRA 2V7XA 3WFZA 4HDOB 3ICVA 3LW7A 5F73A 1RI1A 5EC8A 3A6DA 2Q3FA 2H18A 1MAAA 2PM7A 2P3QA 4F04A 2YDXA 3MINB 4Z68A 5AW0A 1KQOA 2IYSA 3OD5A 1A0OA 5G4KB 1E2GA 1OBOA 1DIHA 1PJ2A 3EFEA 2NO5A 1YBHA 5JMND 3LLMA 1CERA 3FGZA 5FNVF 1F0PA 1O96A 4B45A 5LJLA 2XXBA 3ZNOA 5ALZA 2VQ6A 4J0FA 3ACBA 3HU5A 2BBWA 1E7MA 2WILA 4GM4A 1E2KA 2ID8A 1UQUA 2V54A 5KKNB 3T7SA 2BFDB 4CKYA 4NOMA 5LZ4A 3AU8A 3DOEA 2GAJA 3EE6A 4NFHA 3HGMA 5SYAA 1WP9A 2A8YA 4KMRA 3HL0A 4ALJA 1ONNA 3EUFA 3D9LA 3Q9NA 1R6UA 4Q4JB 1T4DA 2O8BA 1YZKA 1DRJA 2VYIA 1NONA 4OLAA 1UJ4A 1N2JA 4TYPA 1G18A 4PINA 3TJMA 4BB0A 3IT2A 3PR2B 5FBLB 1OMOA 4QD3A 3UKOA 3CUYA 2AJ8A 3ZKAA 4HRMB 3IRVA 1ZZEA 3PE6A 3OIYA 4CM7A 3DO8A 3KSUA 5AW6A 3V1NA 3AG5A 3SQWA 4B2YA 2OHHA 4I1VA 4YFYA 4F84A 3ULQA 4J16A 4RHYA 2C82A 3N1UA 4KQCA 4ADSG 3A9CA 4TWBA 1WB9A 3SHWA 3MJSA 1JG2A 4BB9A 3T12A 4H7PA 3LP6A 4C0AC 3WBJA 3KV1A 4HH1A 1E0JA 1ATIA 5F33A 1ELRA 3JQ7B 3ZY4A 2WJGA 4UAGA 1MX4A 2I4TA 1JS1X 4ABNA 4X3CA 1V7PC 5T4HA 5ITVA 2ID9A 3LX5A 1YB2A 1L1RA 4GG1A 1Z4QA 1FU7A 1YOVB 3D4BA 2DTXA 4J9VA 1PV1A 2RGYA 4WKBA 4NLLA 4H6PA 2VDJA 3P2JA 2O48X 4CGZA 5DM4A 3EF3A 3B13A 1GQQA 2LR0A 4CXMA 2Z6QA 2QPAA 1VMAA 4FMPA 3CTPA 1WG0A 1N2HA 1P3DA 3QLEA 4PH4B 3WBFA 3C6XA 3LT0A 1CS4C 4NWIA 5JT1A 2HMYB 4Y2RA 4LXYA 3LUBA 3GLGE 1MX2A 3ZJ5A 5JPCA 1CY8A 1S8NA 2WSBA 2BIFA 4L5BA 2HTEA 3PEVA 2CKDA 2BFFA 1OCOE 3N0VA 3OZBA 4IPTA 2JLYA 4ILKA 2WA1A 2QUBA 2FZ5A 1ADYA 4H7DA 3S4YA 3W78A 4CTKA 4EHIA 2O8DB 1XLTC 2GAFA 3PT5A 3G0IA 2PPLA 1I36A 1T3GA 3E8XA 3INGA 1T5SA 3DOIA 2HDWA 3ROGA 3L06A 3WWPA 4D9NA 3G2UA 1Y8RA 1Z4LA 4ZEVA 4O25A 3APCA 4FINA 3ZDDA 4J8YA 1JCRA 4LRZA 1DIOB 2H08A 4WZAE 2WIFA 3AJRA 4YPVA 1ZM3A 2FCRA 4G36A 2D3TA 4O4JB 4L3WA 1HBJA 4AICA 3QPDA 4ZV7A 3A1UA 3FYDA 1IPEA 4UAUA 4EYOA 5FLYA 2ZTHA 2CZGA 1IY1A 4B7UA 6LDHA 3U6KA 2IO3C 3MJ4A 4NMWA 2XQ0A 1DL5A 2A5YB 3LQQA 5LKRA 2V7UA 2ZETA 4DW8A 2I6QA 5LOVF 1LPNA 3CLSD 3V1UA 2QX9A 2HPAA 1QH8A 3RTEA 3KQHA 3C1AA 4CQMD 2VWPA 2GM4A 5K8CA 2HJ9A 4I55B 4IICA 1914A 4DBLE 1BI7B 4TMVA 3NAQA 3SLRA 4CN9A 2PZGA 4PM4A 3GDHA 1V9SA 4ZJZA 2HIMA 3QK0A 4Z0PA 2JCGA 1S7CA 4N0QA 2ZIUB 3W6NA 2FK8A 1T1RA 3WKDA 3SSOA 3O83A 4P53A 5BUQA 4EHBA 2NUAB 4LDRA 4RPGA 1VLZA 2X4IA 4TM8A 5IDYA 4EJSA 3GFTA 1Y82A 3PC7A 1H3NA 3FPKA 3LXRA 3QA3E 2Y1KA 2ATVA 1DIAA 4YPOA 1Z7BA 2PT9A 3CH4B 4HDMB 4YVQC 2JHGA 1NYTA 3MBKA 1RJFA 4OQFA 4JEMA 3CLRD 4DV6B 3N3BC 2A1IA 4KXLA 4MI9A 4Q1VA 4QVIA 1UKBA 3DXYA 3CK8A 3QENA 2PGLA 2HZBA 2WM2A 3Q75A 3CTMA 1SD2A 4IDOA 3TIVA 2PS3A 3AM3A 3IIMA 4Z4GA 3NQ41 2LIVA 2EYUA 2B8TA 2KBXA 3EHMA 1IWBB 3DV0B 4MUJA 4IX9A 4KGVA 2E4WA 2FP4A 3NTOA 3C6ZA 3IVCA 2WJWA 5HKKA 3F8WA 3LPLA 2FY8A 3KKMA 3SM3A 4EYGA 2V03A 3GAZA 1YHNA 4LDZA 4RABA 1DWUA 4RK1A 2NZWA 2W8BB 1SNYA 3A26A 1TYCA 1X5BA 2CLKB 2W2KA 3SZLA 3DULA 4D4MA 1QQ7A 3R5FA 5AJYA 1T1SA 1XD2B 4B8ZA 1C7EA 4JMLA 1P4RA 2GBLA 2BUAA 4PAMA 4BFSA 2B98A 2JBAB 4Q9JA 2AF4C 3DOUA 3P71T 2R8PA 4B3JA 1IM8A 4LNHA 1WB6A 1XDSA 3NORA 1S3IA 5E9AA 4B0OA 1W36D 1RRGA 2EQAA 2ASVA 3NRCA 4EEZA 1E2HA 1E5TA 4G07A 3ZVLA 1N3BA 4QOEA 5GPBA 3DSVA 5FOSA 4QFMA 4B48A 4UJ5A 4L2LA 1SK8A 1B1CA 3KYCB 1S3SA 4U5QA 5C2JB 4MP3A 2FFJA 3H3JA 1RKUA 3VYSB 2ZPAA 4DRXE 1AB6A 1M6HA 1TVMA 1QKKA 4MUKA 3GXBA 1N5DA 2FFAA 4F3VA 1YRAA 2D0DA 4YIHA 4QAQA 4HNSA 5FR1A 2IEDA 2FAXA 1L5HB 3JYQA 1JXMA 1YD7A 4V0MA 2RAFA 3LP8A 2C42A 4CR8A 3ABKE 4L2IA 3I9OA 4R8RA 5ALMA 3ICWA 3L7IA 2W11A 3ZGLA 2FYTA 3ZHSA 1CUZA 4CR6A 4Q9KA 2IH4A 3S2ZA 3R6LA 4TQGA 2GCGA 1NU6A 4BAUA 3D3QA 5AM4A 3E0XA 5BNFA 1NURA 2PUDA 4D2IA 4NHEA 1AU9A 3VVLA 4CMBA 2H2AA 1TCUA 3O38A 3FWYA 1I0IA 3PQDA 1GGFA 2OLEA 4IXDA 5JVDF 5GQSA 3B5JA 2AEEA 2Y1WA 2QVGA 1IK6A 2MSCB 2WTAA 3JYSA 3LUHA 5BQPA 2YWRA 2IO2C 4HEA1 3PGLA 3MV2B 4I5FA 1QU3A 4AF6A 1FVOA 2XMPA 2YXLA 3VU9A 2VZ0A 3LXMA 1E1KA 4UVEA 2AN9A 1AG9A 1QG0A 4MGHA 4GDMA 4A0HA 5K3FB 5BO5A 1CUUA 2X15A 1S8AA 5MGBA 1CUVA 4OREX 1EFVB 4RZXA 2EWMA 3DWIA 5A9SA 2FDXA 5ENPD 4MKRA 3DS8A 1JAHA 4XVUA 4H08A 3KDPA 4OBWA 5I5GA 3GEMA 5LCXA 4L4SA 2J0QA 3CRMA 4IHAA 3REQA 4EHMA 1W4ZA 3EEYA 1EKXA 2UYHA 2QG4A 5AM0A 1YE5A 5EJ5A 4APFA 3INRA 3DFFA 3PSAA 3FGOA 2IPOA 4MVXA 2PIAA 4P7KA 3TQTA 4KQ9A 2WE7A 1J0AA 3FPFA 1Y80A 2HJRA 3IP8A 3FU3A 2P58C 4JK3A 2HYIC 4LF8B 4DWJA 3TAXA 1V3VA 3SLGA 1OI3A 1I94B 1UJJA 4KQHA 3HUDA 3NVMB 3ZE6A 1X77A 5IT9A 1Q0QA 2IXBA 2G8LA 2AXZA 2J09A 2Q0XA 1ENOA 3LT1A 4GWLA 3PS9A 2NZ2A 5BQOA 5KWEA 5EJAA 3SICE 1TM4E 5CEJA 2W2LA 4INPA 5D84A 3AU5A 1PEKE 2G1KA 3OQMA 4CM1A 3IUYA 1QHEA 2B1RA 2XRZA 1W2WB 3D8UA 1M2VB 2AQHA 3OA2A 2EZUA 1GM5A 4E12A 1ZISA 1JU4A 1KU0A 2VJAA 3E9DA 1VSBA 5HJ2A 5CB4F 3ZLBA 3QF7A 4UDYX 3UH0A 2IFTA 2WQZA 3CNLA 1VJRA 3WGUA 2XNHA 5C0OE 1YB1A 1A71A 4KN6A 4LV5B 5EP2A 5DCYA 4MUBA 5BXQC 3WRYA 1H69A 4UBMA 2OWDA 5K6TA 2OVBA 3LO5A 4QL3A 1AUXA 2QYOA 4L9WA 1P2VA 2C5FA 2QHXA 4RSRA 2EQXA 2FTKE 5GOZA 1JI0A 3AEXA 4JVLA 4O1OA 4R3UC 5HKKD 1WPGA 1HZZC 4E2XA 2IOSA 3LHIA 1IVYA 3WLLA 4XIFA 3R40A 4BO5A 4JOCA 4N6OA 3EVDA 4RM3A 1Y8QA 2CLIB 2C1ZA 2I2DA 3SDBA 3QJ5A 4ARSA 2RB4A 1TEZA 1SXJE 4HDKA 3B7PA 2ZULA 4N54A 4KPGA 3B6EA 4NCXA 4QULA 4QBHA 3JXEA 4HEA6 2RDMA 4PO3X 5IS2A 1Z75A 4NZNA 2GASA 4BMPB 1V8FA 4JASB 3WA6A 4OYLA 3OG9A 2E48A 5JXJA 2CUZA 4E5KA 1TYBE 5KQMA 2BI4A 4CF5A 1S1CA 2YJNA 2X9GA 5DE3A 1KYQA 5KOHB 4C48B 3R44A 1JDBB 3EGEA 3CZRA 2C0PA 1ZJ6A 2PEYA 1WX1A 2OK7A 3E05A 2RGXA 3D3WB 1XQ9A 2FPGA 3QXXA 4QODA 5JD5A 1W5SA 4P35A 4J90A 4E70A 4IKPA 3IXMA 1Q95A 5KMGB 5AVUA 3TB6A 3W9SA 1YZTA 4J2HA 2BE9A 4GQAA 3NVAA 1P2DA 3M6WA 3B20A 1O5OA 2CBZA 4EH1A 1J5XA 3H5WA 1XTVA 1SIOA 3RS5A 1ELOA 1PSDA 1GIAA 3V8MA 2DWZA 2OFXA 3VR4A 5KREA 2P91A 3CVXA 1UEIA 1VHTA 2Z9DA 4QU9A 5EP4A 2BGJA 1B8UA 2GRNB 2GK4A 3DKKA 4D0NA 4I2ZA 2B4TO 3KQWA 2ZYDA 1AHHA 3EY4A 4L50A 3N05A 5C8YA 2IDJA 1TKCA 2ECOA 1KPIA 5K0NA 4YROA 1HDCA 3Q79A 3KBOA 1FUIA 5AVYA 4BVFA 1L7AA 1HYEA 3HSSA 5ILOA 3GLFA 1IL0A 1KKLA 1MHTA 3S0JA 4HSEA 2O2DA 4HOSA 3PEFA 3AUUA 2IE0A 1IB0A 2JLSA 3D54D 3AR7A 4GLOA 4P4GA 4TXQA 4FR0A 3FAKA 2Q1YA 2G7ZA 1UZAA 1R27A 3PLRA 4D4IA 4WACA 4XVQA 3WWOA 3L8YA 4LYFA 1IQUA 4F60A 3MTDA 3W5UA 4S05A 4IRXA 5LM3A 3C1TA 4GC5A 4EZKA 1OLXB 1T8TA 5HQ3A 5DNAA 4FCTA 1N8TA 1J25A 1PFVA 3UK2A 3W7VA 1BIFA 1DUSA 4FHEA 4IHJB 3ZVRA 1ESDA 1QR6A 2CFOA 4IXNA 3ZHRA 4RIFA 4G84A 3PFCA 4XR4A 1EP9A 2AW6A 4H7XA 5H68A 1L8XA 1OXUA 2H2GA 4CLOB 4M4SA 2GAOA 3D0KA 1YVUA 3K9QO 4RY0A 2AOXA 4RVFA 4QNMA 1KEUA 3AJ8A 2FHSA 1UADA 3CW2A 3ZGXA 4NBWA 1KL7A 1I32A 4ZYTA 2YJ5A 3LNTA 4NDAA 2VJMA 5SYNA 4RMNA 1K5PA 3DL7A 3NOCD 3NANA 4JJEA 2YCBA 2QN7A 4RWZA 2BT4A 2QP3A 1R8YA 5F3RA 3TCXB 1OCEA 4WEQA 1FX0B 3IPYA 3VJMA 4Y0NA 1M2WA 3CZPA 3U4DA 1SCUB 3JAMA 5JY6A 3T41A 3ZE2B 2GK3A 3OCXA 4I3FA 5AW2A 3QHPA 1E9AA 5H9WA 4BNTA 1AF7A 4JOBA 4JENA 3G2IA 1YZLA 1QFXA 3MF4A 4H59A 3BA1A 2R2LA 2HF7A 1SHJA 1USIA 3KLPX 2Q3LA 3T3OA 1N4SA 4O6VA 1VLVA 4EEXA 1HUQA 2YRFA 2ZBPA 1H8ED 1Z2DA 4XKCA 2GTPA 1BD8A 3HCBA 5JCZA 3UYKA 4GUDA 5IASA 5EUMA 3VTAA 4LWQA 4BKUA 1CUDA 3A31A 5JS1A 4RGQA 4JJIA 5I7EA 1C14A 1ISMA 2Z08A 1J8YF 4DSTA 4NBUA 2WQ6A 2L6JA 4ENRA 2AJBA 3R9KA 3OX4A 1JHPA 1QIEA 4WNDA 2QTCA 1FL9A 4YPFA 2PL1A 3ASGA 3PXCX 2VH2A 3DPSA 3BMOB 3KXPA 3BMCB 4QBGB 5TSDA 3KOUA 3JR7A 3QWWA 2MHKA 1V8PA 4EGAA 4MV5A 3CV3A 3ANLA 3OI7A 2P7IA 3V3TA 5B2FA 5KDDA 2KLHA 1HM5A 1Y7HA 3PQCA 2R5FA 4BTAA 1NDUA 2QGNA 2BGNA 3KUXA 1HT2E 2HY7A 3ITKA 4FEGA 1ZLYA 2X7XA 1KJIA 3TLZA 1JN0A 2FSSA 3CSDA 1I2CA 3G0HA 4C30A 2OXTA 3OA0A 3EX7C 1RXCA 1E3TA 4TXRA 3W9YA 1PR5A 1F4LA 4CM4A 4X9XA 4C5BA 4I5GA 4QX6A 4PG7A 1G42A 1YGPA 4IQGA 5BW4A 3NBKA 3OX2A 4QYSA 4IRUA 4TTJA 5HRCA 3H9BA 7YASA 2G9NA 2HA5A 1Z5GA 3NDRA 4DG8A 3VJKA 3THWB 4OY3A 1EWKA 3RK0A 2ODBA 5EE3A 2OYSA 5I4IA 2ZRLA 3AG3E 2BF4A 1U3UA 2CXHA 3ISMC 1J99A 2NU7B 1LY1A 4YWJA 1UJ6A 2I03A 3HBJA 5JLJA 1B00A 2W2QA 4Z5XA 3VR4D 3ZC3A 1L1FA 4YMLA 4NARA 2X2OA 1CY7A 5AQAA 2ZJYA 4AYTA 3OZIA 2Y0BA 2ZUEA 2DWCA 3M2TA 3FPLA 5CJPA 1K7CA 4YJ2B 4GA1A 1U0OC 2IYQA 4UHEA 4M1MA 5D1NA 4MUHA 3HJUA 3IPLA 3BD8A 4QJ3A 4BWRA 5AM3A 2ZYGA 3BL8A 4M9XA 2BHTA 3K70B 1H1DA 4KU4A 2ZI4A 4AKGA 4TWIA 2ONJA 4I8XA 5KAPA 3DL2A 5L3QB 4OQLA 4BO4A 5K8UA 1HWYA 4EG3A 1FT2A 1G8GA 2WAOA 1G59A 2I1JA 5E2BA 3CHQA 3GGOA 4ZGWA 3H5NA 4U2FA 4BNIA 4FR2A 1V0JA 2H4JA 3BG5A 3WL4A 2WFAA 1P1CA 3AYXB 1JLRA 2BTDA 3MMZA 5E6UA 3CKCA 4Z9BA 1QVAA 4RD1A 1SRQA 1ISPA 3WYNA 1M83A 1SGWA 3ORFA 4CIWA 4TMXA 3MZ0A 1MO5A 4KLAA 4HHEA 2FKAA 4GYJA 4UBKA 3D4OA 4LY6A 1BDHA 4YV7A 3H1AA 1JG7A 1QBGA 1B93A 3UVEA 1P6QA 1FCHA 3NFRA 4RZHA 4ED9A 3D9KA 3GA7A 2NTYC 2DJIA 3L6UA 4MWZA 2RJOA 3SIPA 4MVJH 1O1TA 1SVOA 1M8GA 2PLWA 2RK3A 4KI0A 4HZUB 2Q5HA 1L4YA 3ND9A 2NVUA 3AKCA 4CVNA 1E20A 5M72A 4UCFA 5B1AE 4Y2TA 3TN7A 3U4IA 3T5DA 2ANBA 3T3DA 1MC8A 2ZRIA 2WJZB 3PNMA 1ZM9A 1DV2A 2BEJA 2OB1A 1PLJA 3TIXB 1TC2A 2H1HA 2OB2A 4RVCA 3Q4AB 3DXXA 3TAUA 2DLCX 3JQRA 3O8DA 2I8AA 2D5CA 3HUEA 1OXVA 4H7KA 1I7PA 5DBGA 3JXJA 3QOFA 3WLEA 3HXOA 5ENZA 3GVHA 4ZPJA 3JZDA 4RVHA 3RRBA 3VDNB 4IIVA 3I83A 1BX3A 3KOWA 2C95A 4M46A 2Z8YA 3S2FA 3OU6A 3LECA 4KAJA 1MJNA 3ZKWB 1PT6A 3I2GA 1JFTA 5T41A 1H66A 3CK9A 1ZN7A 2GGSA 3NXKA 2ZAMA 2YQ5A 4AJWA 4F3RA 4NFLA 1GW6A 3GRAA 4V39A 3ETHA 1J7JA 4J91A 1KEPA 3F6RA 3UKJA 3JYLA 4JI8B 1A72A 2GK7A 1VJTA 3V3KA 4O2BB 3RM3A 5F64A 1YHZA 1N3IA 2BH2A 2XJ4A 4ARCA 1N2GA 5AKLA 3K0SA 4KL8S 2QD5A 1NVUQ 4CI0B 4YALA 4KAAA 2HIHA 2G1AA 2BFAA 2DKFA 1ZGBA 1OVGA 1DE0A 1NLUA 2BY4A 3QW2A 3TLGB 1O2DA 3PT9A 2PSHA 4GPTA 3ZE9A 4JAVC 1T8WA 2O2IA 4YJ3B 4MZXA 5PGMA 2FN7A 1KIFA 4KK3A 5EL0A 1N32B 1SUIA 1K0UA 4LXXA 4BJ3A 1K5GA 5A1JA 1HNWB 1YZHA 4Y30A 3HCEA 2WIDA 5ILGA 5IANA 4ZVPA 3ZVMA 3GJ0A 3A1TA 4KN8A 3DOHA 3KUUA 3ZE0B 1C9MA 1JMVA 4DARA 3TSOA 3GGPA 1EK5A 3TTUA 1G17A 2CDRA 2BJVA 1WB5A 4HTFB 3LA8A 4Z54A 3R9AB 5D00A 4JKOA 1XEAA 1BWRA 1SA0A 2MRIA 2WSMA 3V8VA 5IYZA 1XAHA 1PGNA 4P29A 3OMLA 2G4LA 4MB2A 4AMYA 3KLMX 3CXUA 5A4AA 4QQIA 3WKBA 3T3MB 2JAOA 4YCJA 3KVNA 2JJYA 2I6SA 1R6XA 1G19A 2FR8A 1LJ8A 3VHLB 2CNDA 4YWHA 3E23A 1RZ3A 3IUBA 2G9ZA 3ABLE 4BUCA 5JEDA 1QHYA 3A1WA 3OOJA 4BX3A 1RD4A 1JV2B 1W29A 1RJ9B 4M89A 3H3XA 4U2GA 5T8KA 5GOTA 1YI0A 2H29A 4AULA 3OUTA 4G2VA 4D79A 3IJ5A 5EMNA 2K7ZA 3RADC 1YQ9A 2ZI9A 3ADCA 1YDGA 2VO1A 5DI3B 5FO0A 421PA 5HMLA 3V79K 4ROSA 5DMXA 1PDVA 2B3DA 1SU6A 4XIJA 4M7CA 2IYFA 3F9RA 2VHWA 4XM1A 3VX3A 1TRKA 3EG5A 1KVSA 3I05A 4GC9A 4MWBA 3U5ZB 4GR5A 5I5EA 1RXIA 1EWTA 4ZOQI 2X1HA 4AV7A 5B6PA 1E92A 1N34B 2J45A 4JYPA 2YFYA 4GLBA 3AO0B 1Y1LA 1O6ZA 5F52A 3RKSA 4CF6A 4DLRA 1J7KA 4IF4A 1E3LA 3C3XA 5BMVB 2QK4A 3SEQA 3ZZMA 2PX0A 1DMRA 1N11A 1NIJA 3UMCA 1F3LA 2ZI7A 4XX0A 3UG7A 5EIAA 3TG2A 3LGXA 3IVRA 1FVXA 1ODIA 1KP9A 1FUEA 4NK5A 2IHUA 1AKTA 2RJNA 4MKTA 1EUYA 3A25A 3APDA 4YAFA 4FFSA 1P1BA 3CGHA 3V6LA 4XRRA 1ZMRA 4AJ1A 1KOLA 2H57A 3GZ4A 1R6TA 2X6FA 4C2TA 3UKRG 1E8OA 4YJGB 4IOJA 3EQZA 3DA8A 1LFDB 2QI9C 3HXBA 4IIJA 3WMXA 2KW5A 2HM7A 2FMTA 3I9FA 1Y3CE 3SGHA 3E53A 1L8LA 1Z6XA 2DC1A 4MJLA 3T1OA 5J2UB 2APJA 4RY8A 1XZHA 4FYVA 2RHMA 5CB0A 1P9LA 2BP7A 4X63A 2VHXA 4TN5A 2C94A 2FWNA 3FWPA 3K05A 3JAWA 2LXNA 2OCPA 2HHAA 4TVSA 2P9IG 2NG1A 1XRMA 5L3ZA 2XYGA 1ZBQA 1SUFA 1EGVB 5HOEA 4D9FA 4DT1B 3SDSA 4FUQA 1A4UA 2FSVA 3VR0A 4BIMA 3F8SA 1DI0A 3F6SA 3F46A 4OH1A 4JLMA 2QMOA 1PL8A 2XXJA 2GVDC 3CR8A 1VJ5A 2GZMA 3AUFA 2DZOA 1VXRA 3QBEA 4MYUA 3I1FA 5E1MA 3CEHA 3TLBA 2Q4TA 2ZIWB 3JZAA 4KPEC 1MU0A 4JKIA 3RIBA 3CQ9A 1JLHA 3NB0A 1K75A 3RQSA 3R7FA 5K3AA 1XJQA 3KQQA 2HF8A 5FF9A 2H4FA 2B4QA 3JRNA 1QVWA 1Y8AA 5JH7A 1A5EA 3HVEA 1T34A 4FFBA 4YHBA 2ZIXA 2BKAA 3L0CA 1WKCA 2O0KA 2TMKA 4AMVA 1FS5A 3GT0A 2O1SA 3ER9A 4F7DA 4J9UE 4WX2B 4DV0B 4Q3AA 3WGGA 2DIWA 3LC0A 1BCRA 2GW1A 2AN5A 2HEGA 3TZBA 1TR4A 2OVFA 2YNQA 4LWPA 4WIAA 1K08A 1DOHA 3OZFA 4IIUA 1MABA 4GMGA 5EJIA 4B79A 2ZYIA 3SNXA 2BW0A 3QHQA 5K0LA 5LZ5A 1SA5A 5LWHA 2WJYA 2IFUA 5JAIA 1OTYA 1NSFA 3AVQA 1IEWA 5B7PA 3T5AA 2VRNA 3Q7FA 2XCUA 1TEXA 4KNVA 1VCMA 3EFHA 4WVFA 2C7PA 4N01A 2Y68A 3KOMA 1NI4A 4HEQA 5CIYA 3SU8A 1N6OA 2NTEA 2X76A 3AEQB 2OO3A 4C0KA 4ZCMA 4FB4A 3G6WA 3K0FA 4OQQA 3EEQA 2AWIA 4NPHA 1UXKA 2QP9X 2HK6A 5H8WA 4Z1MA 2XKJE 2R05A 3ZBPA 3IUPA 1IYGA 2QUKA 4UJ3A 3ZIAA 4DA8A 2J4DA 4YDHB 1OU0A 5FTPA 1ZCJA 3LY5A 3COVA 2I6UA 2CLHB 1OZAA 4U02A 4DFDA 2G9QA 1PL6A 4LYJA 4IFTA 4P34A 1Y48E 2IYLD 3R0JA 1XVIA 3UB4A 4XUDA 4CL0A 1O94A 3NNSA 5DU2A 1R0SA 2VXYA 4G67A 1KDPA 2ID7A 4KG7A 1V1MB 3OU2A 1H6OA 5B53A 2O8EB 5M04A 2QFCA 2GEJA 1VSQA 4BFVA 1BQ3A 3WB0A 3ZXSA 3AW9A 3JQFC 1WKVA 2IYZA 1FSFA 3HFJA 2HW8A 3LMKA 5IAKA 3H42B 1SOMA 2XHZA 1ECBA 2PRIA 2FXVA 3CG0A 4QPNA 3NB2A 4EG8A 3GDFA 3ZU6A 3GWGA 4MQUA 4UARA 3SC2A 3GUVA 3RUDA 3ZJUA 3LQRA 2JZOA 1PWZA 3MJDA 4W5NA 2BM0A 1NOIA 6REQB 3S7DA 2QYHA 3SAJA 2QVCA 1BOOA 1QCCA 1TAUA 4DA9A 4W8GA 4FGSA 4GP7A 4ND2A 5AVSA 3S2SA 2M98A 4S1TA 1MGOA 3VM6A 2IY9A 1V2GA 3L8HA 3UT8A 4DIFA 3W5AA 1WXFA 1LBTA 1YB7A 4UWHA 1K8ZB 4KFRA 3H5LA 3ASOE 2A3RA 2FDCA 1P81A 3LBNA 3PXXA 3FKQA 5DMHA 4LSWA 3TWOA 1C30B 2XMCA 5ALYA 1E3QA 2Y2VA 3IR5A 5KX5B 3P5BA 5JQGF 1PAQA 3U4TA 4I1MA 1G8MA 3TWQA 1NQTA 4HNRA 5D0OD 2KM1A 3TW8A 5IKPA 3DXKG 1L4EA 1HEIA 3CR3A 4BMCA 1BQ4A 3PDUA 5CPFA 3P9NA 2P9JA 3QWIA 4HRVA 2XT6A 1QRUA 1JNZB 3PVSA 1SCIA 4YJDA 4Z7OB 1FRNA 7ADHA 5FI3A 3UI2A 4JGBA 4LZPA 5DI9A 2VA8A 1YA6A 1JQJC 4BPRA 4NBTA 5JD4A 1IY0A 2HTFA 1YK0A 5ECDA 3CNOA 1RCFA 3OFJA 3ORSA 3CLUC 1F1BA 4HWTA 3U7EB 3WBBA 2ZZMA 4IYRA 4ZDWA 1XELA 2PYIA 3O91A 1K7YA 1QYWA 4C0EA 5FPPA 4OHCA 5BN3A 1XQYA 1UXGA 4G5SA 3O26A 3L16A 3ETLA 5H4HA 1PCXA 3ELBA 5D3ZA 3VYTB 3JQ0A 1FSPA 4YJKA 4UASA 5LQCA 2QQGA 4N3CA 2V6MA 2JEYA 2V6FA 1VP3A 1GG5A 2MDTA 3OWOA 1E1DA 1L5ZA 2RIRA 1EXDA 1L8QA 5JJ6A 1BGVA 1TTQB 3G6KA 3WA7A 2C03A 1W96A 5DLEA 5KQPA 1R3UA 3TDMA 3C87A 1K5DA 4D9BA 5DX8A 4Q9AA 2HRZA 1CRLA 3FUKA 1E1LA 3WDMA 3VTYA 3FN4A 1BFUA 5EUCA 2HN9A 2WAYA 3LUJA 2ZAGA 3LRPA 1PR3A 3GP8A 1ND5A 1SU8A 1TJFA 3LJKA 5JNSA 3GJRA 2HDOA 1N3YA 1HF8A 2CGEA 5IVDA 5BYAA 2RKOA 1KPHA 4EG5A 2I66A 3ND8A 4X1KB 4D4KA 1V95A 3I73A 2JFXA 1Z3XA 1P7YA 4BASA 3BTSA 1T2EA 5KNBA 1FT1A 3HTXA 2Y8EA 4GZ5A 1I24A 2X9VA 3VC1A 3NC4A 1OXBB 1CDOA 2A0KA 4RTKA 3DBHA 5TV2A 3B51X 1UOEA 3TZQA 3HDYA 1WBJB 3HCPA 4MAMA 4CMIA 3RHTA 4IIEA 4URZR 5BUCA 1RMYA 3OOWA 1R8XA 2Z57A 8OHMA 3CV0A 2EQBA 1T5HX 1YACA 2OQVA 2WB2A 3MOGA 2AJTA 1NN3A 1YZUA 2AMJA 4MOWA 4BRSA 2F8TA 1LPPA 4NJOA 3DDZX 1QFYA 2I1WA 1X7ZA 1Q2ZA 4M3OA 5EJGA 3AXSA 2ALJA 2KXPC 3EXFB 5CD1A 2F6RA 4OV6B 4Z1MD 2PR2A 4E33A 1CY4A 1W94A 1HT0A 1DFIA 4HCJA 2QW1A 2VJKA 4ENTA 1W1IA 1GTMA 3OJWA 3N74A 2MTBA 4E2ZA 3LCVB 2AUMA 4QFVA 4LN1A 1GTRA 1Y9EA 5FNZA 1H05A 3QMPA 4OVUA 5D7BA 3GMDA 4YLEA 4J1QA 4Q15A 1PTJA 1EH5A 3WGVA 3TRFA 1O94D 1AGRA 4OAUC 3ZVVA 3H4VA 1V71A 2EX0A 1P73A 2BFWA 5LXTB 2WV7A 1RE0A 1SO8A 3H9GA 5AQ1A 3C8UA 2HU2A 1AS2A 1KC3A 1H19A 5LJIA 1S02A 1XL0A 1XTSA 4Y6WA 2PWBA 4N5MA 1ATZA 2DSNA 3KSMA 4BLOA 3IYLW 2R8EA 5KYUA 4B84A 4P82A 3JD1A 3A9TA 1PWXA 4EHKA 4BYGA 1GUDA 4FBGA 2UY1A 3KP1A 2PD4A 2AZMA 4A3VA 5K3EA 1FP7A 1J8DA 4ZO8A 3QEMB 4EF4A 1HT1E 1W4AA 1AM4D 1JKJB 3CVWA 2J0VA 1BN6A 2G28A 4A92A 1TZCA 1C3EA 5SZIA 5FFMA 4WOCA 1T9GS 1O0CA 4NATA 1TYQG 1IXYA 4LSMA 2AOWA 1AMUA 2NV6A 3W3AA 1US8A 2JCBA 3X1ZA 1CUJA 1QHIA 4AN0A 1E7WA 4G56A 4D1YA 3RIXA 3M0EA 4QHSA 3M34A 4KXMA 1SXHA 4OFBA 4M8SA 1K8XB 4NNPA 1DAFA 5DFAA 2YWCA 2XIJA 3PVZA 3C3WA 2PSDA 2G0TA 5JMTA 2VHVA 1DC5A 2P5SA 1HC7A 1W49A 2ZUVA 2JAUA 3ZI7A 2YWDA 1AF4A 2OBFA 4FNOA 5IAAA 1DKLA 4Y9TA 1XPRA 4I50B 1AURA 4RBNA 3V48A 1T8YA 4UUPA 3HZZA 4P9NA 1OCRE 1K4YA 2WG2A 1M1YA 4OGGA 1J5EB 4WA7A 4IRMA 4PO8A 4PEVA 1MRNA 4GZDA 1ODTC 1L1EA 3F4LA 1SKYE 5FADA 1NPYA 2DH5A 3HHPA 4KKVA 4F56A 4LGCA 2GESA 2N1MA 4HD8A 2E37A 3RVBA 4JUDX 3PWKA 3H99A 2ACVA 2FLKA 3DB2A 2GILA 1O97C 3GLRA 1KORA 3AR4A 1MT3A 4I08A 1GLVA 1PV2A 1GV0A 4ILGA 4JNKA 1XXLA 4CIXA 2R60A 2J85A 4F1SA 1H6BA 4I99A 4M83A 3ASUA 4Q19A 3PNLB 1XUOA 2FVYA 1TNDA 3EGXB 1V9LA 3AIKA 2WI8A 1M6YA 4Q39A 1CULC 2VHQA 4IO0A 2P62A 3FLEA 1D6NA 5CA0A 2GCOA 3BT7A 3LDAA 4DADA 2DK6A 3SC3A 1H5QA 1GTJ1 2CNBA 4JD5A 4LMRA 2XCRB 4RPLA 5JAUA 1EFCA 2X5TA 5HYVA 1EJ2A 3I5MA 2J9YB 2YVLA 4GMKA 2LBPA 2UZAA 5B5SA 1M0TA 5DM2A 3SIRA 3LQKA 5A23A 1BVHA 3IAM1 4C3UA 4H3KB 4TVOA 5CLLA 2Q4EA 1RBYA 2WD8A 3FWKA 2E49A 4RETA 1P31A 4G4GA 1GDDA 1YFJA 2ZCVA 3GU3A 1Q77A 1EJBA 2JGRA 1UBRS 3MQ2A 4JYCA 1O0SA 3FU6A 2DFKB 3C3AA 2DPGA 3HCDA 4QGHA 4ZOCA 3DE4X 3EW9A 3KYDB 3ZWCA 3Q9UC 4GPEA 2E2WA 3RFCA 4A0GA 3PDIA 3CW8X 5KNBD 4BTVA 2ZRGA 5B4TA 4XGKA 4DCUA 5ETJA 2IS6A 2OD2A 2C2LA 2ZRKA 1W47A 4BXOA 1BEUB 3JQ9C 4LCJA 4F5YA 4V1CI 1ZK3A 4ZAFA 1ZEJA 3G2HA 4YT8A 3PVLA 4P83A 3UZUA 4QG3A 4WOPA 1ZRHA 3ZIDA 3K09C 3EZFA 1II0A 5KSZA 1NHGA 3C7CB 2DERA 3IAFA 1EG7A 4D3FA 4BP3A 4C03A 2MYUA 1MX1A 5KJ1A 2A9KA 2ZUWA 4IO1A 3P4XA 1GPNA 3OUUA 2BEKA 4QPCA 5AI6A 5EJ2A 2ZWMA 3BWMA 1AK1A 3HWSA 4JJGA 2L82A 4HB4A 2J32A 3ZFWA 4NH4A 2QLNA 4DLXA 2QY7A 3H8WA 4Q3BA 3JARB 4MKIA 1HXIA 1H93A 2VYFA 5FBWB 2COEA 1EEHA 3AEUA 2Z8XA 2ADMA 4DLWA 1TZJA 1Z0UA 1J8MF 3V30A 4ND7A 4ZZ1A 4EHFA 2XLCA 4RO0A 5ENOD 4Q7KA 2NGRA 1DOAA 2WLSA 5DEIA 3Q6MA 4GPZA 3HCFA 1HDRA 3WXXA 4LZWA 5EHQA 5DHPA 2WU8A 3LYAA 2XA2A 4I5DA 2VPIA 5FUYA 2YRXA 5C51B 1G6Q1 5H70A 1ZVVA 3OFVA 3HP4A 2P3LA 3TR6A 1SD5A 5IXJA 5EYPA 1GRRA 1NVXQ 3EUAA 3DFZA 3OKPA 4OCZA 4PAOA 2IHYA 4CKBB 3I5UA 3P2KA 4KQMA 4LZJA 1L0BA 4U0JA 3W3AD 3IAM6 4WNEA 4BCBA 3D7NA 1LW7A 3GAAA 3FPAA 3ID6C 3DVAA 1FLDA 3GAMA 3KUCA 3UJ7A 1A9PA 2DB3A 1ZL2A 3RSSA 2OCKA 3IESA 3E03A 2M9MA 3KS2A 3DKVA 4J7AA 4JJ4A 1W4CA 4UNNA 5DWVA 4CMAA 3GCXA 4JI3B 4P54A 3VC3A 1MMFB 4A6DA 5JJ5A 4RH1A 3EBPA 4XCQA 1Q11A 4FI3C 1V7QA 4IIYA 3C3OA 5ICSA 3U44B 4BFZA 3WG7E 3PEUB 4BKRA 3D2LA 3GBVA 3DT8A 4AMZA 2IS2A 5TVGA 3P96A 2I7XA 3DLPX 2YH2A 1PN3A 1KHHA 2VHTA 2AI3A 5CT8A 4JGIA 4H7HA 4M1YA 1E99A 4V0OA 1K9SA 2IGTA 1ECJA 5ARCA 3AQIA 1PJCA 3K0CC 1JJBA 4TT3A 1DWPA 3AJIA 3B38A 4KZKA 2VT6A 2F2TA 3BWDD 2IUUA 5ELXA 5HRYA 2WM9B 1J6UA 1IOLA 1IU9A 5J1SB 3MPUA 3B3GA 3W5VA 1IBKB 3ERCA 2VVTA 4FLHA 5LLDA 4F9FA 4NU6A 4JYMA 1QH1A 2H3EA 5K0EA 1BX1A 2VPYA 1DBIA 1TM5E 1E1CB 2RH8A 5DW0A 4D3ZA 4L3OA 4R9VA 2DULA 2ODWA 2QS9A 4M0KA 1U8UA 4R1OA 1P45A 3T0GA 3W1VA 1JP7A 2P9UG 4UQXA 4X1IA 3DPUA 3LOPA 2HYZA 5AJDA 4F3YA 3CIFA 2ZWPA 1YB5A 3CW9A 2NVOA 4FZJA 1EBUA 5HF9A 5KTOA 4RTPA 4I4CA 1ST3A 1KSFX 1EE9A 1W8DA 2XGJA 3SZUA 4MP8A 1U7DA 4O3FA 2VDQB 3V42A 5AVJA 3P5SA 4GQBA 3WHLA 1HK7A 4KOEC 4EITA 1GFIA 3RUCA 5JWRA 3AHHA 1KS2A 5JRDS 4AKIA 3F96A 4IDHA 2X5GA 2JD0A 1MCZA 3L82A 4NZZA 5E4YA 3A70A 2R87A 4EDHA 4LQ4A 1FUKA 4F4IA 1R4NA 1ZOOA 1AOXA 3AVYA 3C1OA 3ZTTA 1U9IA 1G6HA 5KTPA 4B4KA 4M9SA 3MRTA 3QE2A 5I9MA 3TR5A 3MKRA 3IAXA 4UI9J 5B1SA 2FQ1A 4KREA 1P5RA 5AVVA 2FPUA 1M2FA 4ISCA 1BU8A 1RYFA 3PB3A 2NWQA 5BT8A 4YS6A 2DZNA 3PC3A 1U8EA 5E3IA 4QFDA 1ZS9A 3OOHA 3LDZA 3R5JA 3J81A 4CT0A 2WFLB 3GC6A 1HYHA 1W25A 4HJRA 2XT0A 3QELB 2P9SG 1N7HA 2VTVA 4JEHA 2JD1A 4KTTE 4KDFA 4F6RA 2PV0A 5KYYB 3RVDA 3LFHA 1XVAA 5GONA 1XRLA 4DJFC 3EPPA 1EDZA 2VRBA 5HIKA 4FKZA 1O87A 5ITZA 3M5CA 4PLCA 4YV1A 4FW9A 1E9CA 3SG0A 1WXQA 2AC2A 4YUXA 3PHLA 3ZHZA 2J59A 4F2PA 3ZUPA 2D59A 2JFNA 4JWKA 3C6KA 3NOGD 1YZQA 2ZJAA 4LJRA 4MPRA 5MHTA 4W9NA 1ZD8A 5BN1A 1MTZA 2XUDA 1R5JA 4H1WA 3TGWA 4HNVA 3L92A 3QZUA 2G5CA 2Q5QA 3KXIA 1NQWA 4KXFB 5E6RB 4MUIA 1RZVA 1XKTA 2BHSA 1PKEA 4PXSA 3F6CA 4KYOB 2C4KA 4REQA 1AGNA 1M1XB 5AYVA 4O4HA 3IQHX 3Q11A 4HPWA 1R0BA 4JUBA 3S5UA 1F6BA 3ZGVA 4G81A 4P81A 2ZUCA 1FY2A 1J20A 2NAPA 1VPVA 3NAMA 4R2IA 2UDPA 4FC8A 4RV5A 2MMGA 1OJ7A 3UK1A 4HNAB 4E2FA 3OT1B 1T6YA 3V55A 2IV3A 5F7OA 2JI7A 5C5DA 4PC1A 2QAGC 2EX4A 2HV9A 3PUIA 2FQXA 1Q1ZA 2PRKA 4NHOA 4XDZA 1T6NA 5G1NA 4EUNA 3VOAA 4KXWA 3HNRA 2QZZA 2WMOB 5ALDA 3P7MA 2ZQZA 1E8WA 3DSWA 1JYFA 3AG6A 1Z8DA 2IA5A 2ZU0C 2YY7A 1XZBA 3LPMA 2L42A 3I6MA 3PQ8A 4AI6A 2BGUA 2JFHA 5FKJA 1DT3A 4EJMA 2ZUFA 5KBYA 2OT3B 1U3FA 1U6IA 2GRAA 3PKZA 5KI6A 1D2RA 3E4CA 3SBXA 2AJCA 2XY4A 1Y5RA 1ZGHA 1Y6RA 4XDYA 2AX4A 2QD4A 3SZOA 3K9BA 4GWKA 3AY6A 3CB4A 4UVHA 1ZGCA 4QOJA 3AUAA 2GOYA 4BBPA 5E4TA 4B74A 4HEHA 1NVFA 3QYJA 3B53X 2KCVA 5L7YA 3I64A 1RPJA 4RTOA 2I22A 4TT3D 3BYZA 4MGKR 2C9DA 1Q0PA 4ETNA 5ES4B 4E7PA 3H5IA 4ZI7F 4Y2HA 3UAWA 1NJ6A 3TWRA 3I32A 3FB1A 1KXJA 1NY6A 1D9SA 1JPNA 1COWA 3A1VA 3JD0A 2XQFA 5E9WA 4TLCA 5FBRB 3FDIA 3JATA 5JPIA 1AKUA 1VYHA 1BWQA 1ARZA 3DVRX 1HPLA 2BFEA 4HR7A 4EGJA 4L02A 3K16A 3L6RA 3KVRA 1YAHA 3VAYA 2QTRA 1LDYA 3K4HA 4L73A 3EIWA 4DCJA 4M9ZA 1AVTA 3NHUA 1OAOA 1NUAA 5CCMA 3C5VA 5FPQA 2FEKA 3NTXA 3CRQA 5EQDA 3DE1X 3Q7QA 4V0ME 3P9SA 3COPA 3E7PA 2JGDB 2VKTA 1SHUX 1L6RA 1SQ5A 1XWWA 4B31A 4KQ2A 3CN7A 2OCDA 4J3NA 4D81A 3ASDA 4TV9A 3SLKA 1ZI6A 2OTCA 3CUEF 5AW8A 4CODB 3N59A 1G20B 4MQFB 1CVIA 5GVSA 1NL4A 1GD1O 2R6HA 3FMVA 3DEZA 1YO6A 1DAHA 3B6JA 1LPOA 3IHYA 1TUIA 4LUNU 1KJYA 2W2LD 1XZAA 4P7FA 3W3ZB 5AW7A 1GPYA 4EJ2A 2M1XA 4D5GA 3LJNA 3T3EA 4CKEA 2KBFA 4O1MA 3KJHA 3OQNA 1MB2A 4H16A 4JP3A 1VXOA 5G41A 4DLPA 2VYQA 3JWPA 3I1JA 1P8JA 4Q4JA 5CURA 5ESWA 3QLJA 4KYUA 1IZ8A 2H1VA 4F6RD 4C87A 4BNYA 3RLIA 3SJAA 2C4UA 2B36A 5EQFA 2G67A 1QV9A 3ZLTA 5FXMA 3S2GA 3AVPA 3DLCA 2NSLA 3UUGA 3BE4A 2V59A 2XLBA 1A96A 4Q37A 1QIHA 2H0QA 4MK4A 4DPMA 3GI1A 3NIFB 5J40A 4BESA 5EZYA 5TF4A 1KO7A 2WJAA 1ECFA 2IRWA 4XWKA 1ODJA 3BB3A 3F4KA 1PV4A 1Z5ZA 2BM9A 3H97A 5LU9A 4LOJA 3A6KA 2X5NA 3RVQA 1VDMA 1PSZA 3E2IA 1O9BA 3MMPA 1U28C 3ZWMA 3ZYMA 3SFXA 2C2KA 4ANUA 4PSVA 2YHBA 3JQ7A 5AVZA 3DW3X 4JI7B 4AG3A 1RXVA 4BMYA 1POXA 3OEYA 3TL2A 4TRNA 3ELDA 4UHKA 4FNAA 3B82A 5AOVA 3A1NA 2ZRBA 5FJJA 3STYA 3S7JA 5T4FA 2I1LA 3PUWA 3C5EA 1KQ3A 1GTL1 1KE1A 3KOYA 2P40A 1AB5A 2O2JA 4N49A 2XGGA 3Q5MA 3I3OA 2GCPA 1TKAA 4BETA 1RVDA 1EGQA 4R5HA 3VKUA 2YCLA 3TTWA 1E4OA 3K9HA 2JEOA 5EWLB 3KTFA 2VF7A 4L27A 2GRPB 1WJGA 2GBPA 4F38A 2Z3WA 4XOIA 4IGEA 4D4GA 4J0JA 4HVLA 1CVRA 1ULAA 4KWIA 2AT1A 1YDMA 1RHMA 2W71A 3QWBA 4OSOA 4OXIA 4YDEA 1MX3A 3EHNA 2J3IA 1P5QA 3TVYA 3UO8B 3PX2A 3N2YA 3G2MA 2YWHA 2GDZA 3A4NA 1I10A 2PM8A 2OQ2A 1ZI9A 3RPEA 3TKAA 3ZHQA 2RGEA 1IBLB 3F9IA 2BYTA 2EBHX 2BD0A 5IY5E 3NHJA 4HY3A 4OHVA 5IXSA 1Z0ZA 2O8DA 3PUJA 1FFAA 1QOPB 1EP1B 3C3EA 4BV3A 3AKYA 4H4CA 4YAOA 5C8DA 4IILA 2VGYA 4BO9A 4S12A 2UYYA 1CZUA 5H3LA 3AH8A 3DZJA 2Z5VA 3B9BA 2N1BA 3IVXA 2I4MA 1WBBA 4NBNA 4HYTA 5EIXA 1NP3A 5HCUA 2YHIA 3KJQA 2ZIZA 2CHFA 2QN2A 3CYFA 2GLUA 2AOVA 1KFKB 4JUFA 2B9VA 4A1OA 3U39A 3PWTA 2E3JA 1JIKA 2NU9B 1UJKA 3NDIA 1XKLA 1YNOA 3KZMA 3TM4A 1YJQA 4JVSB 4EGSA 4F5EA 4UMVA 2YQ4A 2NQTA 4MRPA 4RTSA 3H2YA 3ITNA 1ZIXA 1KDVA 1L8OA 1WVIA 1P5ZB 1UBTS 2YY6A 1XRNA 3ZGZA 4N5CA 1FZQA 2QR2A 4B3RB 4I55A 3H2HA 3CBQA 3E2MA 1BFDA 5FQOA 2FPOA 4X97A 4Z51A 4LGMA 1TUBB 4NQZA 4L5YA 3GJ6A 3ZDQA 2JIOA 3UW1A 2IEYA 1L5GB 1HSZA 4O1IA 4ZO9A 1VMIA 2AC7A 1JILA 1OZ0A 3GLFE 4DJAA 1VKJA 1GSOA 4OHXA 3GA0A 4BCCA 5CNJA 3N53A 3B7BA 1RC8A 4W7IA 2NUAA 1G60A 3R4VA 4H27A 4YVFA 3RVJA 1ISIA 4AB1A 4MQ5A 4EHJA 2L0IA 1G5TA 2O3QA 2NU8B 5DDIP 3GVPA 3ZW9A 2EZ8A 3ZXXA 5IRCD 4AJHA 2JRCA 1L5QA 13PKA 2A58A 3KSBC 4EF5A 3D3MA 1JLLA 4J0KA 3BBLA 2ZSUA 3DZ8A 3KLNA 3I2KA 2FOIA 3Q0EA 3QU5A 2FW0A 4L4YA 3Q88A 4ZMSA 2WHEA 2O7SA 3B7RL 3N8GA 2OQRA 3G88A 3FEYA 2VZ9A 3OJEA 5DP2A 5LX8A 1IIRA 1AQLA 5AJHA 1AKQA 3ND5A 2LNDA 3ONVA 1H6KA 5A04A 2VHYA 3NLLA 2JIRA 3FTSA 2QTTA 2YJGA 4GIBA 5D86A 3CLJA 3GH1A 4E5SA 2NN3C 2W8BA 5BV7A 1JL3A 3JALB 2V74B 2X3FA 4A6EA 4EHDA 1YQEA 4KQWA 4C89A 4TKLA 3D6TB 1IZYA 3RJTA 2R9VA 1A2QA 2I2WA 2I78A 3RC1A 2ZR8A 1T9HA 4WN9B 2ISCA 3AF5A 4KUEA 3AKDA 5BNZA 1I2MA 2W8ZA 4MW6A 2FLVA 3OFKA 2IDMA 1MF7A 1DNPA 1Z36A 2JBAA 5FCDA 1OYOA 2A7QA 2HO1A 5HZGA 1IHDA 1MP0A 3GRYA 3LX4A 2FMIA 1N8SA 4L5JA 5EYLA 2GWHA 4HORA 1UC5B 1PC2A 1MC1A 2HIGA 3I04M 5I3ZA 3OKAA 1Y1KE 3S7TA 2X5JO 4C0QC 5EHZA 3DGEC 2I87A 4N47A 2ZZKA 5F9MA 3I6ZA 1H0RA 3KYCA 1V39A 3L7CA 3DNMA 2C97A 2WXLA 4PIPA 5A6VA 4QU0A 4KMSA 2BFOA 2ENWA 2CV0A 4BTEA 2NXNA 2P75A 4GPMA 2BSQA 1AKNA 1R00A 2ONDA 3N0WA 4PLZA 2X9LA 2DFNA 4PLHA 3MAGA 4Z3KA 1QIDA 1FNCA 3URZA 1THGA 5B4UA 1Z3IX 2XGOA 5ECWA 1U8TA 1HDEA 3D8TA 3U4CA 4WNAB 3E7DA 2O54A 4MV8A 3ILSA 4RV9A 2I1QA 2CE7A 1DBSA 3UK6A 4Z1OA 4E15A 4BJHB 1XDWA 5EQJB 3EDOA 4AKTA 3MCVA 1W19A 1QGOA 1UXHA 2XMBA 4PX3A 3FOAA 4C08A 5CVUA 3B6IA 5B1HA 5I9TA 3PCTA 2C0LA 3LZCA 4DQ0A 3FUDA 3MCZA 3PPXA 5IJZA 2MYNA 1BMDA 3MT9A 4JITA 521PA 4OQPA 4DUPA 3HDVA 3KT0A 3UV6A 2XUOA 1RNLA 2C4VA 3HN7A 1J70A 1D1PA 5IJ9B 1JDNA 3EVGA 4RENA 1M2GA 3T1VA 2Q5IA 3SSNA 1S5PA 3I34X 3VDXA 1DVRA 4FFVA 2ZSKA 4XH9B 1Z4KA 3CRRA 3BOSA 4XTRA 4FFWA 2LCQA 1KI7A 3CUVA 1EFVA 4LCEA 3GOHA 4WLEA 3LF1A 5D1HA 3EISA 4CKXA 1N4QA 2H4ZA 3THYB 3ICCA 5B2ZA 2QL9A 2AKAB 1XZJA 1D0SA 1UXOA 2C4NA 2UXDB 2CVZA 5J4VA 3CVUA 1GR1A 2QM8A 1TM7E 3CZMA 4F2GA 3T7IA 2QPTA 1XWFA 4DZTA 1OE0A 2IWHA 4AF7A 4S0XA 1UJNA 1CZLA 2RGGA 4RJIA 2OL4A 4RDHA 2C99A 4B81A 3EMVA 5HPYB 1LK0A 4L9PA 4L8YA 3JQ6A 3RH0A 4HKTA 4R6WA 5JMPA 2KJZA 3WK9A 1U7ZA 1M1UA 3QE9Y 3A1SA 3K9LA 4IULA 1BEZA 5JARA 5AQ7A 3WIUA 4GYWA 3BXFA 1YFZA 3NOQA 4HI9A 4TMFA 4HB3A 3IGFA 2EJUA 1FFWA 1WQ3A 4U7DA 1CIVA 1V8ZA 3MM4A 5LLTA 4GEGA 1TGVA 3M5WA 4CTMA 3DCNA 4OHYA 5U9CA 3U7QB 4RU1A 4Y6CA 3NYRA 3DVSX 4BKOA 7ABPA 2XWPA 4OI1A 2ZK7A 3BB1A 2QSUA 2P2NA 4N5QA 3C1UA 2AR9A 4BGEA 3DWEX 4B17A 1NMYA 3BFPA 5JADA 1M2VA 4DREA 2GEKA 3TG4A 2QG6A 3EH2A 1YL5A 1H9BA 3TOZA 2OK8A 3MRVA 3ONNA 4URHA 2DVMA 2AW3A 1Q21A 2IK8A 1EHYA 1PFWA 4PZAA 3S40A 1KI9A 3GIDA 3AX6A 3J80A 3KTAA 3JV7A 1T5DX 3WGMA 4PPYA 4EENA 5FINA 2QMZA 2QZJA 4IHKA 2I1VB 2YASA 3TAHA 3D8BA 1O8BA 4GLFA 4QU8A 5ERGB 4A8TA 3AF6A 5E0OA 3RVRA 2OV1A 2FFQA 4UYKA 3FOWA 2X4GA 3GFVA 3C97A 2H92A 2JS7A 4RD4A 4EM6A 3IQDB 1PK8A 3BHJA 3DEJA 1FJGB 3I6BA 3MS4A 4EG1A 1N1GA 4YCCA 3AV0B 3S2EA 4MAAA 4RYLA 2H5EA 2K2WA 3AF1A 3SP1A 4TVKA 3VYUB 1ZH0A 4JP5A 3EGDA 3AM5A 1QGZA 3PU6A 4MUEA 2IX9A 3FB4A 9LDBA 1SWVA 1EXMA 2Q3BA 1X80A 2HLHA 2ATXA 4IJKA 3Q85A 1KGSA 3RU0A 2HADA 3OZAA 1AGYA 3O48A 2P3SA 4CEJB 3WQQA 2WC1A 5HP4A 1QP0A 4BX0A 1MRSA 1MEOA 1EX7A 3BD6A 5FIOA 1AKMA 2G88A 1DLJA 1UWKA 4S1PA 3LGSA 3RYCB 3HDHA 4M9QA 5EWJB 5IARA 4R2JA 4YRLA 4BNNA 2VP2A 4HPJB 4NAUA 3AFNA 5A4FS 3V8NA 4C76A 3B5IA 3PJEA 3L7AA 3BXGA 4Z4EA 3RYIA 1CUGA 3WLQA 3WKAA 3CGGA 1WXXA 2J31A 3SR3A 4CM8B 4JLAA 3LUCA 1E2BA 2QIPA 1HSOA 4EY5A 2Z1DA 2R4TA 3TZCA 3DBRA 1Q0RA 3ZHXA 4C4RA 4X1OA 2W90A 2Q7OE 5JHHB 4N0EA 4RLFA 2IL1A 3GVIA 3MSCA 3SQDA 1CVLA 1XU7A 1SXQA 4N6NA 3CNBA 2I5PO 1H42A 1MGPA 2OLJA 1AXEA 1BDJA 1KVQA 3QVVA 2EIJE 3DC7A 2I8LA 1YBAA 3NKVA 4DM3A 3C15C 2RAVA 2X7HA 4EPWA 1JQDA 2CG3A 3PJRA 1G16A 3S5JA 2VBFA 2DE0X 1XRSB 2X0EA 1I1OA 4QSHA 5BT1A 2ZSDA 1ZKDA 2F8XK 3ZCXA 3D8HA 5NLLA 3FWHA 1SAYA 3IPCA 5A5VA 4BV9A 2YMMA 2BRUA 3SZRA 1XTPA 1R74A 3PJFA 2P7HA 5DM0A 2QLFA 3ZE7A 5EIBC 4FIDA 3PDWA 1NYRA 3C24A 3SS9X 2WINI 1X2BA 2C5SA 5E7QA 3P20A 5G04J 2RBKA 4QRIA 3EHQA 3R7RA 2KHZA 1EFPB 2PXCA 2E18A 1A77A 4C2AA 4C7JA 3H0CA 2JKVA 4TOIA 2BELA 4UHDA 2Z1MA 3DOOA 4K2AA 2BEWB 3SBOA 1SC1A 4FFRA 3ZZTA 3GYZA 3CZQA 1DFHA 2W2TA 2VDRB 3M9XA 4DG9A 4E6EA 2AIRA 4MGYR 3Q6IA 5DW3A 2DRIA 4MHOA 2OHXA 4DDHA 2CHUA 3K9FC 1FX0A 1ENZA 1RVV1 1CYDA 1QF7A 5TARA 1SCUA 4ZHQF 5E38A 1INZA 4NJEA 5CCXA 1JJIA 1HF3A 4PZEA 3H1TA 3RR2A 4L6CA 4NYJR 4QUKA 1WZNA 2VK1A 3PICA 3KL4A 4S1NA 2WF7A 1R9JA 3EIOA 4L51A 1F4VA 1NVEA 4J75A 5FBZA 3MGBA 5CEFA 1E3MA 4A15A 2PX4A 2I91A 1WCIA 2CVHA 1Y6ZA 2IDKA 3ZBQA 1N6RA 2PO5A 5ENSD 4OM7A 3E5NA 4CV2A 1UJRA 1QCZA 3SI5A 3FROA 1LW6E 5C46F 1GAEO 2V58A 2WF8A 2QMHA 4G4JA 4G97A 2I6GA 1I7SB 1YDWA 4DLZA 2AE1A 1KVRA 4E07A 2GX6A 1L7DA 3K2BA 1SXIA 3CPSA 1X6VA 4OQXA 4JL8A 4BATA 3SHTA 3C5WP 4OTZA 4EX6A 5T3RA 4AN4A 3KT8A 3OJLA 3TB4A 3GEPA 1OROA 4RTLA 1GNRA 2LRHA 2ZANA 3LKZA 5K2OA 4LYDA 1EVEA 4KVGA 1QZTA 3BMCA 5JI2E 4INJA 4W8OA 5BSFA 4RKEA 3MWFA 1FW8A 2IYTA 1T43A 3ORQA 3L8DA 3WOHA 2P2DA 1RWOA 1VSUA 3CZ4A 3GCDA 3UCXA 3DAGA 2ZWOA 3HFRA 3TQOA 4C07A 2DR0A 4RPKA 3TLCA 1CWUA 1D1TA 4ER6A 2IP1A 4I1UA 3DZIA 1MC5A 4LDAA 1XL1A 5FI1B 1XN1A 3LW8A 4D26A 4D96A 4OQEA 3IAAA 4PGFA 4F1KA 2E5WA 1NI1A 2PZ8A 3AJ9A 5KYXA 1Z2NX 3HNOA 3CE6A 4KLCA 1GA1A 2GD1O 4UOEA 4BDTA 5HRUA 2G1UA 2PCJA 3DE2X 2AXQA 4R5MA 3RYFB 1QAOA 4FU0A 4EEKA 1LF5A 1HY3A 1WUHS 3ZZUA 1EA5A 3UPVA 4XASA 1BH6A 2QW0X 2JJQA 3FZNA 1U0JA 4JI6B 4QOIA 3IJRA 3MYVA 3QPVA 5DM60 4IEEA 2W93A 5D6NA 4D8WA 1Z2AA 1N2CB 4RK7A 2ODAA 3VNAA 4B3FX 3ULYA 3THWA 1SXPA 4KYIB 4OP3A 3ML8A 5J5VA 4KLNA 2FQYA 2VSOA 5CERB 2PK3A 2GPAA 1LNQA 2DYSE 4AUKA 5LDGA 2QNBA 2XMRA 1ZU4A 3RRYA 1AWCB 4L8WB 2NU7A 3ZIAD 1W4RA 1NLYA 2CF6A 1WDKA 4HAWA 1Q84A 3B6MA 4UQOA 4IYPA 3X1DA 3AL0C 3X1WA 2BCEA 4CM9A 3MBOA 1RQPA 3QARA 5AXAA 4JQZA 4NS4A 2AS0A 5CXUA 3ZCRA 4AMBA 4ZOLB 2VH1A 3E9NA 1YTLA 4FP7A 3TRIA 5JAHA 1D2GA 5LKAA 5KUTA 3M6VA 3ZU2A 5JCXA 1SEPA 2X22A 3LQFA 5BV1A 1UJ5A 3PE3A 3JQQA 1C8LA 2IQIA 1B15A 2Y3AA 4CV3A 3K73O 2BBSA 3IMGA 3AI1A 1SURA 3WB9A 2EJWA 1Q1QA 1T1IA 2KCLA 3L43A 3F49S 5TQ0A 1Q14A 3OM0A 1M76A 4OQ4A 4U9HS 2AUTA 2A9PA 1AN0A 3AUJB 4TXLA 4UBNA 4XA8A 1Z6YA 2CJFA 5EJ9A 1OQAA 2IONA 1FU4A 1XQVA 4KAXA 3PSHA 3D1VA 3NM6B 2Z6UA 4I1RA 1H0KA 2F48A 1Y9AA 2Q6LA 3H9JA 2HREA 1X87A 3T5BA 8AT1A 1UBUS 4NAHA 3N2EA 3USZA 4QDZA 4ZZ2A 2QTBA 1XA3A 5AHXA 1UQRA 1TTTA 1RXEA 4OPMA 1XDBA 3O0DA 4MGIR 1IWOA 4O8ZA 1Q6ZA 1B26A 1MOSA 2OKGA 3ML1A 2ZU6B 2A14A 3NTUA 2QTFA 1TVKB 1MO3A 3OH8A 1KGDA 4YI3A 4B73A 4O4LB 1FC0A 4FQ7A 3P9PA 3JCKC 2FWJA 1H4TA 3ROXA 4HZUA 4WBNB 3LLSA 1HE8B 5HG0A 4FBMA 1CY1A 3NBFA 4MDFA 4E13A 2X23A 1RS0A 1CZNA 3A0UA 4ARZA 1SQMA 3QKRB 2WJJA 4LFAB 2NIPA 4L74A 1U1FA 1MG5A 1G4HA 2JLVA 5IG2A 3TXXA 4NU0A 3JD2A 4AKSA 3QEJA 3THRA 1GGHA 1JDUA 4G8LA 4HXFB 5SV2A 4IWNA 4NCNA 4MV1A 1VJ0A 5JDCA 4N7BA 3FWZA 4B3SB 4XLTA 4GPKA 1PNTA 3ILYA 1UJ2A 2DUMA 4ZTZB 2CK3A 3AOEA 4LSGA 2HB6