4N3BA

Crystal structure of human o-glcnac transferase bound to a peptide from hcf-1 pro-repeat2(1-26)e10q and udp-5sglcnac
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
716
structure length
697
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HCF-1 is cleaved in the active site of O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/substrate
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 275
structure length 697
sequence length 716
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3bA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3bA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4n3bA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4n3bA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n3bA03
2PQNA 1WUTA 3L7DA 4AN4A 3CKBA 3S7BA 3ZGQA 2I6HA 1RZUA 4G2VA 1NOJA 3LY8A 3QOUA 3IAAA 4J8FA 3MV2B 3OTIA 1O6CA 3IA7A 4WNGA 1XKXA 4O6FA 2VCHA 4BQFA 1PN3A 4CTOA 3C48A 1ABBA 3NP9A 3TGOA 4UI9K 1TJCA 2ONDA 3G2KA 2ASVA 2HR2A 2KCLA 3LY9A 3O48A 5FZQA 2IFUA 1BX3A 1KT1A 5GPBA 3ZCPA 3WADA 2VGYA 4GZ6A 4Y6CA 1Z8DA 1HZ4A 1QKJA 2JJMA 4AMBA 2PRIA 1P5QA 4HORA 2F3PA 4PQGA 2YJNA 4RG6A 5BNWA 1FA9A 2GPAA 1FS4A 3T3DA 5LCWJ 3OKAA 4F96A 5CHEE 2PYIA 3CEMA 2Y4TA 1PYGA 1EXVA 2E2EA 3SZ7A 1IHGA 3MS7A 3H4IA 3ZHEB 2FETA 3MS2A 3OTHA 4KXKB 4LDPA 1KT0A 1Y6FA 2XA2A 4GYWA 1WW2A 2P6PA 2XCUA 3MSCA 3CVNA 1PC2A 1QZ2A 3CK9A 5CCMA 2QN1A 2R68A 3HYMB 3NC4A 3MA5A 1HLFA 3NPAA 1Y8ZA 1NOKA 1WV0A 3L7CA 1L7XA 4B94A 4RIFA 2HY7A 1XV5A 1FCHA 3GZ2A 1HXIA 2X6QA 3CK8A 2PL2A 2GW1A 3CUUA 3MRVA 4KQ2A 2C0LA 1L6IA 5TMBA 1LWNA 5G04C 3L7BA 4UI9C 3QKWA 4GA1A 2OOEA 2PZIA 4NRHB 1FTYA 2F3SA 4GA0A 2X0FA 4FKZA 3T7DA 1P4GA 4HOUA 4JA7A 4MI9A 4NQ0A 1JIXA 3L79A 4G24A 1Z62A 3GZ1A 3DDWA 3QWVA 3WAGA 3CVLA 1WUYA 4EL0A 4GYYA 3G2NA 3UYLA 2Q7FA 4G25A 3C4QA 4WUYA 3ZCVA 5JJ6A 3QWPA 1WV1A 1E1YA 3CX4A 3MS4A 4G23A 3MQFA 1B4DA 3E3LA 3NP7A 2QRHA 3G2JA 2AMVA 2XGSA 2AZDA 1E4OA 2IYAA 3Q47B 4GCOA 2QN3A 3MRXA 5LCWC 2FO7A 2JZCA 3DDSA 4QLBA 1PSWA 1C50A 3KS2A 4G26A 4N3BA 1IYGA 2QZSA 3MBOA 3BEEA 2QRGA 5IKOA 4J8DA 1GFZA 4M7PA 3O3CA 3HBMA 4CTNA 5KJLA 5HI7A 1E96B 2G9UA 4N9WA 2PQRA 4GA2A 2F3UA 4U0ZA 3T3EA 3MTAA 2UWJG 4JHRA 1J39A 3Q15A 1K08A 4I17A 3ZCSA 2XCCA 2GT1A 4HOTA 3OXFA 3GYZA 5FZSA 3HBNA 3OXGA 2XCIA 3MTDA 1WW3A 3T3GA 2JLBA 5I45A 3Q5MA 4GZ3A 1JG6A 3CKCA 2IF4A 5BT1A 3TSAA 4BT8A 5LQDA 2J9QA 4MI3A 1XL1A 1W3BA 5D0OD 3DZCA 1F0KA 5KJMA 1UQTA 3ASGA 4BWRA 5M72A 3PE3A 3VDMA 5AYWD 3RO3A 4RIEA 3T5TA 1WM5A 1NVKA 2QRMA 4AY6A 4YI3A 4X6LA 5ENZA 4H7XA 2Y4UA 3CV3A 3OKCA 3AS8A 4CGVA 4AMGA 1AHPA 2VYIA 1FTQA 5D01A 5TVGA 2WPVA 4ME2A 4F3VA 3D0RA 3TAXA 1RZVA 4RIIA 2LNIA 3VUFA 2ATIA 3JYSA 3MT9A 1P4JA 4FZRA 2XCBA 4EKYA 2FI7A 4N5CA 4M83A 3CK7A 3OTGA 1NA0A 3E4BA 3N71A 5KJNA 3BD6A 5EKQD 4UI9J 3CVPA 2ZB2A 3ZCRA 3BD8A 2O6LA 2GEKA 3VTXA 4X7MA 3ZFWA 4HOSA 2KS6A 3LPZA 4KBQA 4N3CA 5A6CA 3FROA 3OT5A 5FTPA 1ELRA 2BGTA 4N3AA 3FFLA 1P2BA 1QQEA 2BISA 2H1FA 5IKPA 2FF5A 4APOA 4RIHA 3WC4A 3MT7A 2C4MA 3ZPJA 2YQ8A 1GPBA 5JJ7A 2ACWA 4I1AA 4WNDA 2GJ4A 3QDNA 4BFCA 1JG7A 3RU0A 3ZN3A 3S28A 3CVQA 1NOIA 2G9RA 3NB0A 2NC9A 5D00A 1YA6A 2PYDA 4RENA 1NA3A 3AS5A 5FJYA 1GGNA 3S7FA 1JIVA 3D0QA 1GPAA 3RT1A 4GYOA 2SKEA 2FBNA 4G2TA 2C9ZA 3AS4A 3OXLA 4JA9A 1XL0A 2VCEA 2XGMA 3AMVA 4RBNA 3QHPA 3E3NA 2R5SA 3KD7A 3GUHA 1IIRA 4I2WA 3S27A 4IN3B 3Q3HA 4BTBA 4L22A 2QFCA 5TMEA 3S7DA 1P29A 3OY2A 4HWGA 3EBOA 3ESKA 1JIUA 2VSYA 2XEVA 2YHCA 3S29A 2MHKA 1L5SA 4EQFA 3MV3B 2GM9A 3SYMA 1C8LA 4CGWA 2QLLA 3RSZA 4BTAA 4F97A 3G2HA 3BD7A 4AM9A 3G2IA 3MT8A 3ZCUA 1B89A 1WAO1 2VGXA 4AIFA 4RELA 1GZ5A 2C0MA 3Q3EA 3UUXA 4G1TA 3RSCA 3LY7A 3L01A 1NZFA 4WNEA 3PE4A 4M60A 4UQXA 2F9FA 4AY5A 1P4HA 4NEQA 4MI6A 2X0DA 2ECPA 5FT9A 1YA0A 4U04A 2GPBA 4N2QA 4BQIA 3URZA 1UZUA 2AW3A 3NAZA 1QM5A 3UPVA 2G9VA 5D0QD 3RJVA 4CDRA 2C1XA 4A1SA 4BQEA 2QLMA 2IYFA 2SKDA 4EL5A 4J8EA 5G05J 3UQ3A 2R60A 3UYKA 5BW8C 3TG5A 1P2GA 3L7AA 1ZBPA 2ACVA 5EX3A 1FU8A 3BCRA 1M5RA 1Z6QA 5TMDA 9GPBA 2IEGA 3HBFA 2IV7A 4YVQC 3LCAA 4MICA 2XPIA 4EJ2A 4HLNA 3S2UA 4EKEA 1SXQA 5HXAA 4I9EA 1LWOA 4GPKA 3WXXA 5G04J 1XC7A 5ARFA 2PQ6A 2C1ZA 4H7YA 3EBPA 3QWWA 3K9IA 1FU4A 1GG8A 3MRTA 3CUWA 4X7RA 5EX0A 1V4VA 1L5VA 2GEJA 3CUVA 4HOQA 1JEJA 2FFRA 2Q6VA 1VGVA 1YGPA 3G2LA 2VG8A 3S0JA 4NESA 2KATA 4I9CA 3CEQA 5JJTA 3VDNB 3RO2A 3LKUA 3U3WA 2SKCA 3HBJA 4ABNA 2QN8A 1FU7A 3BCUA 5KJKA 3FWVA 1C3JA 5G05C 5C1DA 3Q49B 1EM6A 4GPBA 2QRPA 1KLXA 2DBAA 4BT9A 2QLNA 4LEIA 5DBKA 1GPYA 4Z5XA 3NF1A 1Z6PA 3QKYA 1FC0A 1K06A 4J0UA 1NZDA 1OUVA 4Y6WA 1IXYA 5A7DB 5JTUA 2QN2A 3T3IA 1XOIA 4WHMA 4MHOA 2KCKA 5CCLA 4NC9A 3BDAA 3MTBA 4KQ1A 3S7JA 2KC7A 2GPNA 2VQ2A 5HQ8A 3BEOA 3CEHA 8GPBA 3ASHA 1H5UA 3GW4A 2KCVA 3U4TA 3FP3A 4WNFA 3ZHEA 2XMPA 2L6JA 2IV3A 4F9FA 1KTIA 3GPBA 1L5QA 2BUGA 3BCSA 4WADA 5ARGA 2XGOA 4YVOA 3Q3IA 5JTTA 4U0SA 4CTMA 3CV0A 4U0UA 2QRQA 1XNFA 3H4TA 4WACA 4RIGA 4GCNA 3COPA 1A8IA 4YUAA 3MEKA 3EDTB 4LEUA 4XI0A 1L5RA 3IEGA 4W9RA 4N2SA 2QN9A 2WQHA 4U07A 2X0EA 3KAEA 4X7PA 2F3QA 4GZ5A 2X6RA 2XA9A 3VUEA 2R4TA 2AV6A 1SXPA 4MHSA 3ULQA 1F6DA 3DD1A 3CUYA 4YI5A 4N39A 2IW1A 3TOVA 1RRVA 1UQUA 4UQYA 1FTWA 1C8KA 3MKRA 5FZRA 2IEIA 4UQZA 4W6QA 4JL0A 2XA1A 4KYOB 3TG4A 2QNBA 4KQMA 1ZU2A 1NZNA 2C2LA 2WTXA 3CEJA 3PDNA 2HO1A 2VGXB 2R4UA 2LSVA 4I2ZA 3RKVA 3ASFA 2UY1A 3Q4AB 3OY7A 2G9QA 3SYRA 3OKPA 2IUYA 1A17A 6GPBA 3CUTA 3SF4A 3ZCQA 4MRAA 4XIFA 5DIZA 3VTYA 2BGUA 3NCHA 2AVPA 3RIBA 3C4VA 2FEZA 2V5FA 1P2DA 2VSNA 1Y6GA 1NLMA 2R66A 2P58C 3ZCTA 2LSUA 2FF4A 5DXFA 3RHZA 4RG9A 1L5WA 1ELWA 2PRJA 3LYAA 1AXRA 3D1JA 3T3HA 2QN7A 3R9AB 5DU2A 4YNDA 1PNVA 4REMA 2H1HA 2BFWA 2HYZA 2UY1B 1Y8MA 7GPBA 5DLDA 1HH8A 4XI9A 2OFFA 3E3OA 3ASDA
chains in the Genus database with same CATH superfamily
3CR7A 4NFLA 4R9RA 1XX6A 4PBRA 3IBSA 3K5IA 1LQ2A 2W0SA 3WYNA 4I9NA 3OM9A 1XHLA 3MV2B 2NAFA 5H02A 4UHJA 3WBKA 1IVYA 4BE7B 4V1CA 3OT1B 1ZWLA 2PFSA 3FKJA 1YRHA 4O6FA 5E0KB 4LJ5A 2AG5A 3FOZA 2W2MA 1RZ4A 3OEED 2VHJA 1P7VA 1EVLA 2VDJA 1L5GB 5KOIA 1NURA 2GF0A 1Z4MA 5ESDA 2XW6A 2XF8A 3RODA 3UF0A 3UUFA 4BGDA 1JU4A 5AVWA 4PG5A 5I7UA 4OQLA 3Q9UA 1DG3A 2R8EA 1OH6A 13PKA 2O5RA 4EJ0A 3S55A 1DJMA 2B9EA 3DTVA 2GHQA 3FXAA 3ZCPA 4NCIA 2JEOA 1GZ4A 1ZJJA 2IZ0A 5KX5A 3TRKA 2Q5IA 3ZHQA 2PEZA 1TFUA 3IRUA 1ZRHA 1SWWA 4NIKA 5AFSA 4U2EA 1O4WA 3VJLA 4RG6A 3DP7A 3HSKA 3OTOB 1HX8A 1P62B 2QTGA 4OHKA 2HV8A 4URFA 1UJ4A 1YE5A 3MTEA 1FDUA 4FADA 2P6NA 3CTPA 4CXMA 1AKMA 2C3UA 2IEYA 1JB1A 3OWOA 4E7PA 3R76A 2ZJ8A 3I5YA 1XYVA 3Q3JB 3HHPA 1FNSA 1M8KA 5CDHA 3BK1A 2CMHA 2IYOA 1AXGA 2IXBA 2QQGA 3F9CA 4FYHA 3DVLA 4Q96A 3A3PA 5JNTA 1KT0A 1T36A 1CUXA 3IQFA 4CLEA 1LD3A 4MW2A 2P6PA 3CF6R 3AG1E 1KEEB 2AJ8A 4ZWNA 4YGXB 5I9BA 3MWEB 2R68A 1M34E 1SH7A 1GGVA 3T0IA 4UHKA 1QFXA 4EB3A 3ZVRA 3VR2A 1MO2A 1SAYA 1NKTA 4W8OA 4OGWA 1AKTA 2QU8A 1ZNZA 5FHRA 1ZD2P 2A5DA 3UMVA 1RI5A 1FRFS 2HQRA 2VPTA 3H1GA 4ZC1A 1YR8A 4QTZA 3S2IA 1UDAA 2PQMA 2W9XA 1VIVA 4XSHA 1KEZA 3VYSB 5JVDA 5K0GA 3ZW9A 1F4LA 3GNTA 4ZVLA 4DR1B 2GW1A 3I1JA 4EKGA 5JBIA 2IVZA 3A7DA 3IP8A 4TUMA 4J2HA 1XNJA 3TIIA 4MW7A 2FJAB 1GSOA 2IKSA 5ER6A 4UTVA 3KEMA 4YECA 1NQTA 4MP6A 3GX1A 4INZA 5GQSA 3NU1A 4ZODA 3D59A 2WWTA 4N0PA 3O4GA 2M6RA 1C9YA 2OV1A 4MI9A 4NBVA 3LHDA 1H6CA 4DMCA 4BNWA 5JH7B 2OT3B 2O0HA 4ZAZA 4M9RA 3TB6A 5EILA 2R25B 3L0YA 4M8SA 1SKMA 2BMWA 4YS6A 4ESHA 3MWJA 4XUEA 3HI4A 4V0NA 3WXBA 2WXKA 4JEHA 1B8OA 2QUAA 2XIQA 4C08A 5A1JA 4OX9Y 1G21B 4G25A 4YC7A 4EHBA 2B25A 3GFOA 3DWLG 4UUMA 3KT8A 1UK9A 5CBNA 5D84A 3KZCA 1DAGA 2XAUA 3D3EA 3I76A 3PQ3A 4I19A 2PHZA 3E3LA 4W5WA 1A8HA 2XKBA 3D8HA 3CZMA 1GNQA 2EX1A 2E6UX 1ZM9A 3TDNA 1BNCA 1QGED 1KMHB 3FB4A 3FFBA 1S1MA 3PNTB 3LP6A 4C3OB 4MB2A 4ZZ0A 4Z4QA 4J0HA 5CA0B 3PD7A 3GO4A 4V38A 1YRLA 1KVRA 4UULA 3FIUA 4HQRA 4Y9RA 3RKSA 1ZCAA 1NW4A 3RK4A 4D8VA 5EMNA 3UAZA 2FNAA 4S3MA 4EVSA 1T8WA 3FR8A 1GPJA 1L2TA 3FOCA 4LYGA 3FPGA 3K16A 4DBLE 4L95C 3DM5A 3TNJA 3PE6A 1V5IA 4QM6A 1WRBA 5I47A 4JOBA 2D1FA 2WRZA 1VE3A 3URMA 1JI3A 1PL8A 4NOJA 4Z86A 2DUWA 4HNSA 3VYWA 3WGTA 3NFRA 4PYLA 1CNEA 3SSNA 4BUJA 3I9MA 3E53A 1XNRB 1TM3E 4RDHA 4C7BA 1MQ8B 3LQYA 4YXWD 4G63A 2X3MA 3D6MA 1OFIA 3WL4A 2COEA 3MWDB 3B8HA 3Q5MA 4NBTA 4F91B 5L7WA 2A4ZA 3TPFA 5EJEA 2IS4A 3OOHA 2WXQA 1YNOA 1W19A 3IODA 4IHJA 4DLYA 1FUKA 1H0AA 1LX6A 3DO5A 4X8MA 5FPYA 3AKCA 1E99A 1HGXA 1XYGA 2MYPA 2C5EA 4Q3NA 4L1BA 5M72A 4LRQA 4UNQA 3EASA 4KVMA 4ZOCA 4IDCA 1FSFA 4NK5A 4QQFA 4A0HA 4JLNA 4AROA 1U3GA 3ZQ6A 1FZTA 4RK7A 3EGIA 3OFJA 1LW7A 4CEIB 1DLIA 2CT8A 3W5CA 4CT0A 1Q0PA 3OX2A 1AHPA 1HT3A 3ZHTA 4EO9A 4URZR 5BWMA 2O1SA 2JFNA 3QIAA 3TS1A 1UZAA 5ALDA 1B6SA 5F1KA 3ADKA 3VNQA 2HEIA 3G88A 3WGQA 4RF4A 4BVBA 2ADMA 5ALNA 3ETCA 4O1MA 2W11A 1H4QA 3A6JA 2PUAA 1M8JA 3BE5A 4QJ3A 1QDLB 3ROMA 7ADHA 2AXPA 2W6ID 3HKEB 4K6MA 1TF5A 1G9XA 3C3OA 2VUSA 2LNIA 3OOJA 1J06A 1R18A 3VPBA 5JAIA 1GPKA 1WS6A 2CGEA 3AK4A 2HRZA 3T1OA 1DCMA 1SZ9A 3CRZA 1DJPA 1PFQA 1TYQG 5FADA 2WWHA 4GAAA 5JSKA 2GN8A 3CHMA 1DKQA 3P9IA 3EVZA 2BMEA 3I45A 3O3MB 3FEXA 2DT5A 3GVXA 3QH4A 1Y7IA 2ZJ1A 3OTGA 3SQDA 4AWBA 4RSGA 5J2UF 4HDNB 2IW3A 5JAPA 2P6OA 4UI9J 4F6RA 1EVQA 3GJZA 1N4RA 4R1QA 2QZPA 2NGRA 5LBIA 3UBTA 5B58T 1J8VA 4UFPA 1FFYA 2V7PA 3PC3A 3GLHE 1JHVA 1C3LA 2OAQ1 3EOAI 4BSXA 2WWFA 3KYJB 3ZK8A 1K5DA 3HVRA 3BWVA 2OVBA 5FTPA 3M6MD 4HFJA 4RS4A 3TQIA 4D7AA 4CYMA 3V3LA 3GDWA 4IOKA 3NHUA 1T3SA 1KDVA 3DFZA 4RHCA 3WXMA 1Z2PX 4LFCB 1J2TA 1E20A 2I3GA 4NBSA 1JJ7A 2I71A 2EILE 3AFOA 1NJ6A 4IY1A 4OH7A 4U2BA 3IEMA 3FI9A 4JLSA 2JANA 2AGVA 1D6MA 3EQ9A 2ZSKA 3PICA 1PX2A 4CE6A 9LDBA 3RRJA 1LXCA 5JATA 3LPCA 3ZN3A 1KPGA 5KSPA 4BLVA 3QELA 1O6FA 1WB5A 3ULKA 2A5GA 3RVJA 1EXNA 2EBUA 3MD0A 1F8GA 5I9MA 5A3VA 4AS3A 1ONOA 1U0JA 1VI5A 4ARBA 3DDHA 1Q3TA 4QFMA 1VGRA 2RC6A 3HR7A 2WUFA 1GGNA 4I1VA 4XB2A 2P9QA 3D0QA 3ZU7B 4LIPD 5IEBA 3MWGA 2MT9A 4UZFA 1WOMA 4ND5A 2AMJA 3L22A 3E7FA 1VFNA 2N1MA 4LOAA 2WM9A 1TCAA 1E61A 5HQTA 1YBMA 2XGMA 1X7XA 3M81A 3QHPA 3MOSA 3D7KA 2R5SA 3OPQA 4GPIB 2OPHA 4NK4A 4OKNA 2I4RA 2XXAA 2C92A 3H5VA 2I7TA 4V0MA 1M2KA 4PCVA 3U80A 4PGGA 3M6XA 5DCYA 2BI8A 3H1PA 3H7AA 5JXWA 4MGIR 2HU8A 121PA 1EZ4A 3S7DA 2KPOA 3HKDA 3TXAA 4F6CA 3IYLW 5BSMA 4B8ZA 1V3VA 5HZKA 2IQIA 1YTUA 3OLCX 3FU0A 4B4UA 4FSDA 1IAVA 5BR7A 1V8BA 2QYUA 1R6UA 3GJ5A 4A55A 5KYUB 1PR4A 4JQYA 1ODKA 1XHEA 1GUFA 1ZZEA 4NAVA 4G0VA 1M2FA 2BGRA 3ORSA 3SD7A 4MB0A 5ETJA 3VX3A 1F2VA 1WAMA 2B5WA 1Z5NA 4DRXB 1C3XA 4JJ8A 3V5NA 5K0JA 1DFGA 1XVIA 1L8QA 1C2TA 4M60A 2ANBA 3EIUA 3X1JA 2FWIA 2UYQA 2QMUA 4BWVA 5HQ3B 4CMCA 4KGXA 2AZ4A 4XGRA 2Y0CA 5BMVB 2UZ4A 1Y33E 1ZN2A 1F2DA 2WJAA 3EEFA 3TNLA 4U04A 4LOLA 1G2OA 2AQ8A 4N2QA 2VN8A 2XQKA 3OQ1A 3PGLA 5JQGA 2D06A 3ABRB 3PV0A 2N46A 1IUKA 4ND8B 4LSZE 1CR0A 2GROB 1LF8A 4D92A 4PUCA 4Q1EA 3FUFA 4CDNA 1U2ZA 2GBGA 4UPDA 2RG8A 5ENTD 5ALFA 1RC0A 5BW8C 1EHYA 3DZ8A 5E9WA 3RG2A 4P08A 4FCCA 3TM5A 1WDMA 2QF7A 4TTJA 1J0AA 3G17A 5CD1A 4BESA 2LCIA 2WG1A 3FW1A 3E1KA 5ICEA 4PO1A 1MNQA 1XLWA 3HCOA 3V33A 5HM8A 4UOZA 3CLHA 3ICCA 2XPIA 3IUMA 2OBFA 3OFSA 4YNBA 3KVYA 4I1UA 1S8AA 1F7VA 4IUBS 2CCGA 3AI1A 2VRNA 3MXOA 4D6PA 4F6RB 2D2EA 4RS3A 3CF2A 2C1ZA 4F21A 2AXVA 1J21A 3A2KA 1FL9A 1FU4A 5LZ8A 5JC1A 2QG4A 3OZDA 5EX0A 3D8TA 5KOHB 1XMIA 2XBMA 2A86A 1QQ5A 3G8DA 3BHJA 2VGEA 2Q8QA 3QSGA 2NSZA 4MS3A 2WV9A 4PPNA 5FO1A 2Z9BA 5TGDA 3S99A 2HMYB 1AQNA 2D3WA 4D3ZA 3WIDA 4ITUA 2FEKA 4RLSA 5E7JA 3PL1A 1NMEA 3CIAA 3P2EA 3GGCA 5EIFA 2BCGY 2IEAA 5JXHA 4ABNA 3AU8A 4G4IA 3BVPA 5KJFA 2IXTA 4E5MA 1EQ2A 4PYQA 5CBOA 5JNWA 2M63A 4XGNA 3DE7X 3UOGA 4A16A 5JNRA 2BYTA 1ZFNA 1SGWA 3BSYA 4KU4A 1RYHA 1QOQB 1QV6A 4YTEA 1EM6A 3JALA 3NBNB 3D02A 5AUOB 1A8UA 1B43A 2PA3A 2VH5R 2WNSA 4P53A 3WTCA 2QZZA 1EUDB 1SKYB 1ZNYA 3GJXC 1LTHR 2AKEA 4MTCA 2ZAIA 3FLEA 1EQAA 1OHHA 3L5KA 3AFGA 5DN6A 4AMYA 4MUXA 1I30A 2P3LA 2ZYUX 2GRPB 4KQ9A 3M89A 3HDTA 2R87A 3A6KA 3CZPA 1V5FA 1W5BA 3JS5A 3R0QA 5KYKA 2ZWPA 5AQ9A 1VTKA 2QN2A 3VU1A 5LZ4A 5MFPA 4O33A 1SCBA 4RVSA 3O1IC 4W7IA 2F64A 4NE2A 5JE8A 3EWAA 4QUEA 3UJPA 4ARSA 2EXXA 1UBHS 1X0XA 4RGVA 4RF2A 3FRJA 3JPYA 1KIFA 4KR9A 4K9KA 1HO8A 2IH4A 1EVJA 1QUFA 5JA4D 4J4HA 4PYKA 2G8NA 5AJWA 2Q4RA 3SZOA 3E9ZA 3WJ1A 1N95A 4BPBA 5GV7A 4EF4A 1D0SA 2R4QA 2JAOA 2VO1A 2FRDC 2ZPAA 4KQKA 2OCGA 3L0OA 4OU5A 3FGZA 4QPNA 3CV0A 2PT5A 1U3CA 1D2MA 3GGOA 2GBIA 3IAFA 3LP8A 4V24A 4WACA 1J70A 3CG4A 2AYYA 2C97A 1RHMA 3VH3A 4KUEA 4P0QB 1N9GB 5FV4A 2JW5A 4XIIA 3JQ7A 2XUPA 3A9UA 4KQWA 4OGFA 3TK1A 5HRAA 1F2UA 3RU3A 1KVUA 4RHYA 3V8NA 4MYDA 2O8EB 4L72A 3VC2A 2FYTA 1NXTA 1X42A 4X7PA 4HPWA 5ADHA 3KEAA 3OZSA 1KK1A 1LSUA 3KZXA 4TV8A 2JLRA 5B6IA 3EDCA 4DC0A 4YAEA 1HPLA 3E8SA 1SXPA 4O4HA 2H7VA 2PUHA 1O95C 1MFPA 2CDNA 2WXIA 1T5DX 4LF9B 4HUJA 2CLOB 3KSUA 4IF6A 2XZLA 3IVRA 3LWZA 3ZTTA 2AJBA 3ZHUA 2QD2A 4GVXA 5GONA 5ANRB 1D5WA 2QSZA 1UW4B 1ZESA 3A6HA 4W1PA 5KYWB 4G81A 1NZNA 5JDCA 4ACKA 1DI0A 1W4CA 2CK3A 2Y77A 4KRFA 3E9RA 2P2DA 4BNVA 3KBBA 1NUAA 3HVKA 3M6AA 3PUKA 1QPBA 4EVQA 4EJFA 3COJA 1NVFA 4HS4A 2CXSA 5K3EA 3EIWA 5BN3B 1PJQA 3RNOA 4PNHA 1KEKA 1JQLB 4UVEA 4YJHB 3OSUA 4YUZA 1SURA 5ELXA 2LIVA 1GA4A 1KJQA 4PGAA 3LDAA 3FTWA 3UY4A 6GPBA 2OZLA 3O03A 4PZPA 1I7PA 3DXKG 5KMGB 5KYYA 4G8BA 1PFYA 2NTVA 3UXEA 3AVTA 3FTQA 4HBZA 3VRHA 2R7LA 3RIBA 4RXMA 4HWTA 4CVNA 4BFSA 5L53A 1YHYA 2CZCA 5K8CA 2IO2C 1ZC4A 4TXJA 1N1GA 5CCEA 4JR2A 5AW6A 1UG3A 2YN2A 1N6LA 1KI3A 2QDXA 1L5FA 2GRNB 2W2XA 4NURA 3I72A 3ZCTA 1A9RA 1DPGA 1MDFA 2CNNA 2ZKIA 3FSEA 2HPZA 3GJ4A 3IB6A 3TVDA 5C4IA 4EY3A 5BUCA 1JDZA 3ONDA 3ZK7A 1T36B 3SZGA 3U44A 4O1IA 4F5YA 5FBLB 1R5BA 2AG6A 1EG2A 2EIXA 5EXTA 1LLFA 3Q3CA 2OGSA 4P8RA 3NHSA 5D6OA 5FBZA 4E1BA 2XODA 5HBGA 3R5HA 1LUAA 4NCNA 3KSAC 1ZXLA 2W71A 1W59A 2R44A 5B30A 2CUNA 2CCJA 3P2BA 1LFAA 3G9QA 1U7ZA 5ALTA 2Y9PB 3W8EA 4PW0A 4IDEA 3DV9A 1YMUA 4WRRA 3KVVA 4EGQA 2AN3A 3IOCA 4RFSB 5IH3A 5GJCA 1DS6A 3W9SA 4AN4A 3VR1A 4HN2A 1GRCA 1ADJA 1CQJB 1NOJA 1FQWA 2V7XA 1M2VB 3C7AA 1HE8A 2UYOA 4RK0A 5KKCA 1YJXA 3DUWA 4XDGA 3TG2A 3GVIA 4CV2A 5IKMA 3KQNA 1U0LA 3MJHA 1E8WA 4Z4CA 4GQBA 3LS2A 1PN3A 1YS2X 1BZYA 1DTWB 1H05A 1KP2A 1SKQA 1WZEA 2QTFA 1WL8A 3CQGB 2VUHB 3QPDA 4ZEXA 5DF1A 4F4DA 2PJRA 3JQ9C 4RGQA 2HB6A 2IPMA 3L0ZA 2DY1A 4AECA 5BPHA 3IHTA 4RJLA 3QV1A 3ANLA 1H93A 3G82C 2GXQA 3WNQA 1UJJA 5F3WB 4DR5B 4Q24A 4P7JA 3VZCA 1RWPA 1ZU5A 3B13B 3D7MA 4HNGA 1NG1A 4WW0A 3OT1A 2QW1A 3VBEA 1M8GA 1HZ4A 3UOWA 4V1CB 2Q4BA 1Z0FA 1KY5A 2ZRMA 3MA0A 2XEEA 4PWYA 1P5QA 4Q19A 1KU0A 2HC9A 3L9TA 4Q1BA 3WBJA 3WQBA 1LVHA 5B1SA 2Z2KA 3FH5A 2AYZA 2PLFA 4L3OA 4O0LA 3KCQA 5DNYB 1U0EA 2ZJ3A 3IOBA 1TNYA 1Q20A 5CG2A 3CH5A 1SXIA 1XRRA 3SJ7A 3N70A 1AKVA 2Z43A 4KB5A 2HIHA 1ZBDA 3BIOA 3IUNA 4GEKA 3WSWA 4ZHQB 3FWYA 1QGDA 1OF1A 2ZPTX 1W25A 1RKVA 3O2JA 2X5KO 2IGTA 3K3PA 3MBIA 2RHWA 3CZAA 3VKWA 4RQIA 2QP9X 4B2PA 1MTZA 2AUMA 3CNBA 2P6UA 3NC4A 4AXXA 3L7OA 3GLFA 3E15A 3UT0A 2HA3A 2CJPA 2AF4C 3AW9A 2IPXA 2VCYA 2QTCA 1E9RA 2XNCA 3K0AB 4GOKA 2R79A 3KFXA 2ZYGA 2MINA 2J3MA 2VSFA 4QJ5A 2ZYIA 4TZKA 2P41A 4CR6A 3KO8A 2QVLA 1PBTA 1K0FA 5JASA 1FUUA 2AG0A 4W7HA 4MR8B 4TYWA 4BE9A 1PYOA 5EIDA 3O8NA 4Y2PA 3QVMA 1JCRA 2FULA 2YUTA 2HXGA 4BNTA 3ND9A 4BTLA 4AVXA 1G2IA 1O5TA 2EC5A 4GWKA 3Q8MA 4Y1RB 1RP7A 4DX1A 3LT1A 4JI5B 3JXIA 1VIYA 4OHFA 5FEMA 5JCZA 2FWBA 2C7GA 3CVVA 1IBCA 2HUPA 4MKFA 5DTIA 4WY5A 5IT0A 1XPUA 3S2EA 2PD6A 3DMFA 1MV5A 4IGAA 4AYTA 3R23A 1KVSA 4X41A 4IHKA 3VC7A 1ORVA 2PSSA 3IKVA 1X7WB 1BQ3A 1JLKA 1A9QA 2HF8A 5HTOA 3G3EA 3DLHA 2A4MA 5K8IA 2J0SA 3IEPA 3Q3GE 4A6EA 4BO0A 1RKUA 4OQEA 5AOXA 3R6TA 1C8BA 4H59A 4IMRA 4MQ6A 1FRVA 1L5KA 3FOEC 2PD4A 1UODA 1UJNA 3W9YA 1G9SA 1QH0A 3VR5H 5BORA 4K5BA 2X5OA 5COBA 3UAWA 2VWGA 1QIIA 1PJ4A 1FX0B 1XDWA 2Q5OA 1ZZGA 3MS4A 4QU8A 3ZD7A 2WVAA 1WNFA 2CDAA 5KVVA 3EU5A 1JJBA 2WT8A 2PXAA 3MGKA 1A5TA 4M9CA 5FOXA 3GARA 3KVOA 2FR8C 3IDSA 5P21A 1YHZA 1ZG3A 1EDOA 3A2LA 4FKBA 5CVJA 1M7HA 4JHJA 4JZKA 1UMKA 3W04A 4ARZB 1WDYA 1Q74A 1JYSA 4D82A 6AT1A 2QSUA 1IOLA 3GEIA 3PRHA 1GFSA 2I6SA 4KXVA 3SDZA 3EG9B 4QLBA 4O8CA 4WXRA 4EGJA 1VL6A 5JQWA 2UYHA 1E7UA 1X3SA 5JMOA 1L4LA 4QSHA 4N3BA 3COZA 3LG2A 1NW3A 4NHEA 3DEIA 2PZAA 4G0NA 3HBMA 3CVXA 1ELKA 3TTVA 5HI7A 3VU3A 4D74A 3P20A 4GA2A 3DEFA 4JI1B 1L4BA 3LL4A 4JHRA 3HC7A 1N33B 3NBFA 4IIBA 3HCFA 4Y1RA 4FEYA 3JTEA 4QYWA 4HNAA 1W34A 2EYQA 2GN1A 2JFBA 5I7FA 4UYJB 3F97A 3SX2A 3ZGZA 3PDWA 4DXDA 1ZY2A 1UKEA 3AHJA 2R8XA 3NHWA 4FIZA 5TIIA 1Z25A 5JCPA 4H3SA 2BEUB 3IVAA 4LOKA 3MG9A 4J3NA 3TSAA 1QZUA 5DYIA 4DA6A 3K0AA 3VCXA 4WKGA 1QXSA 1T6BY 4P5PA 3ZHBA 4HNRA 1FE8A 4ENSA 5ADWA 1D2AA 2QTVB 4IULA 2FRVA 3NWPA 2Q29A 3AR7A 1V7QA 3D8RA 3WGKA 1E6LA 1TN6A 2A6PA 5HIAA 3E0XA 1EUQA 1WM5A 2QS9A 3V8RA 1O54A 1Y6RA 1JT9A 5ELLA 4ZEMA 2GMWA 5ENZA 1YQTA 2POQX 2PIDA 1M7GA 1C7JA 3FLBA 1YQWA 1FK8A 5BVGB 3FNEA 4BLSA 1PDWA 2ZJZA 5SZKB 3RVPA 3S2FA 4GI5A 3AU5A 1KO7A 2I3DA 4ME2A 4WCDA 5C8YF 5TB5A 3FSRA 2DPLA 1NJ2A 1OCEA 5C4MA 3DEJA 4LOIA 4DMFA 4E13A 5ALUA 2V59A 2YVUA 4YUYA 3TAXA 4YJ3A 2Q8NA 2QJOA 3DGEC 1MRNA 2WSSD 4UFOA 3FWKA 3EMDA 3ST7A 4A6PA 5JSUA 1T5OA 1X87A 2WT4A 1GGEA 2IOQA 1QO0D 1N2CE 1NNLA 1WKVA 2FZWA 4CLOA 4DUYB 1W5TA 3AKYA 3EFBA 3TM4A 5LKAA 2I6UA 4D8XA 4W5JA 4EKYA 5MGNA 3EODA 5DCWA 3B13A 2E4AA 4ALJA 1UBLS 4L4RA 3U3ZA 5HIJA 5EIBE 5JH7F 2XYQA 1WMAA 3BBLA 2V1UA 2FV8A 1R5JA 1QCYA 3R7SA 1JTEA 5FH9A 4TPKA 1MOSA 2NYRA 4Q05A 2J3IA 5FBWB 3ZFWA 1NL3A 5EP3A 1REQB 2I54A 2G04A 3NANA 4F72A 4MKTA 1SOUA 5CFOA 2C0QA 1H2XA 1GYRA 3R8CA 1E4VA 2C00A 5FBQB 3AG2E 3D4OA 3FROA 3NBYC 1MEJA 1B6RA 1W5AA 2Q5LA 3IOMA 3N59A 2WTMA 4IRUB 3KUCA 5EE5B 4NQZA 1R3UA 3O0TA 3OJEA 5JD4A 1HG1A 4C2AA 4U02A 1QGUA 5KUTA 5IKPA 1OFUX 3U6KA 1GTRA 2FF5A 4W6ZA 2EIHA 4JJEA 2H4YA 4C7JA 4W7SA 5JJ7A 4TTAA 2C0PA 3LVFO 4HFRA 4KQFA 1BQEA 2HH9A 7AT1A 1SPXA 2BCEA 3GXOA 3RU0A 4H77A 1GSAA 4ZOQI 3FLAA 1ZKDA 3R9KA 3E82A 1Z45A 3A1DA 1E0SA 3LWNA 1PEKE 4MKRA 4MP8A 3JQ0A 5D00A 5EKXA 2PLAA 1NVAA 1CETA 2WMDA 3DFKA 4B09A 5KVAA 1JHQA 3L9WA 5KKAA 3S7FA 1XZGA 4X92A 4XE5A 4GECA 4ZAWA 3MOIA 1Q6ZA 4GYOA 4JUIA 1OYWA 4L16A 5AK0A 1VLMA 2ID7A 2A14A 1X2EA 4MW9A 3ISTA 3MFQA 2QQ5A 3AMVA 4UMFA 5H3HA 3VU9B 1OY1A 1PUJA 4OAOA 4LRSB 3DWIA 4DG9A 5CDSA 5JPDA 4NQRA 2FSUA 3HFJA 1KO8A 3U60B 3Q11A 3A70A 4K8OA 4CIXA 3JXJA 1RU3A 1CHNA 2QX7A 4ALMA 1WULS 4OI0A 1GDHA 4XPIB 5BW6B 1TECE 1OASA 4FGJA 4DYHA 3F4LA 1P7PA 1TNOA 1K6MA 2W2OA 4YRZA 3HKCB 1SXJB 1JAYA 1W93A 5CDFE 2CHZA 2UAGA 4C30A 1MIHA 4V0QA 3DWFA 4P84A 5ALQA 5LQAA 4BFXA 3ZX4A 2ZCVA 2ZRAA 4RELA 1G4AE 3UUXA 3PKZA 1EGQA 3PEVA 1F51E 1FFXB 4D4MA 2D0OB 4KO4S 4UM9B 2F6RA 5I7EA 5HTKA 4H7PA 2IYNA 2J3HA 4MI6A 2NU6B 5JT1A 3D3JA 1RWNA 1O97C 1HNNA 4L0MA 4G11A 5K3DA 3PHCA 2C0CA 3WG7E 2WKRA 2VATA 4ZIRB 4DAOA 4MITA 2OHXA 5BNFA 3SU8A 3G2UA 1K2WA 2M32A 2YXBA 5G2NA 3AVPA 3OECA 3KV3O 5CT9A 4UYKA 4TV8B 5INTA 1U5AA 2GEBA 4C05A 3O8OA 4QGFA 2MYTA 2OPBA 2EZUA 4UNNA 1G5TA 5AQBA 1SXJC 3RJZA 2A0WA 4F2HA 5CD9A 2IEGA 5EJ2A 2BFNA 5H4HA 5B3JA 1N4QA 1KKUA 2V7GA 4U39A 3K20A 1K97A 3RREA 5K0BA 3C3XA 1JUDA 2PZBA 1PEAA 4YJGA 3MEQA 2EQBA 1A1VA 3L0CA 2RSLA 1ADYA 4GTMA 5DLPA 1GSIA 2X2EA 5LD2C 4TTTS 4ID3A 1RPJA 2EL9A 1QK4A 3VKUA 1OCRE 2PQ6A 3F5SA 3TG8A 4G56A 2RG1A 1R0WA 2O14A 3MB8A 5D86A 1QORA 2ZETA 1M2GA 1PYDA 1ZM3A 3CYFA 3VGPA 5IKEA 1JBQA 2JFFA 2YOFA 2LTAA 2WIBA 3VPGA 1I3NA 1WHSA 3SBTB 1Z2DA 2X23A 2QY6A 2PO5A 3AL3A 2XPZA 4TKMA 1YQDA 4H7FA 4R9UC 2IBSA 3DO6A 2KATA 2EVWX 1A27A 1IULA 2ZRJA 3M3DA 1HDGO 4ARZA 1OU0A 3TJPA 1JDPA 2O2IA 4BP1A 4A2CA 1OFVA 3RQSA 3EVEA 1QLHA 1EFPB 3HRHA 3G7SA 4J16C 3AHDA 1R8JA 4B48A 5I3ZA 3A0RB 3GLFE 3JW8A 1R6AA 3Q5EA 2XD4A 3DRAA 3EJNA 3ELUA 4TT8A 1ABEA 3GU3A 4J16A 1ZW1A 5LBUA 3ZGLA 1MZPA 1DC3A 4JP5A 5DX8A 3TKYA 4BPRA 1CYDA 4B89A 4U7PB 2GRMA 2ZIUB 3IKMB 2OORC 3MGGA 3PEUA 2PWBA 5F5LA 3HN2A 4ZGBA 4Z5XA 2QEQA 3JSAA 1X9HA 5D2MC 3FYCA 1KFEB 4GTPA 3IDFA 2CEKA 2C5SA 3RHFA 4D56A 1DBRA 4MYSA 4HAUA 4Y6WA 4AO8A 5LMUB 4A1GA 4MVJG 2A57A 2D3TA 4QOJA 2EW2A 4IDBA 2Z04A 4RZQA 3H5LA 4PC3A 4DB4A 1JS1X 4LSGA 4OHYA 3CJRA 3MIIA 3BDAA 1PZXA 3TW0A 1G8AA 2A5LA 3JR3A 1L1RA 3QE3A 4DM3A 2C8VA 2ATEA 4WFQA 1Y9EA 2XOKA 3PLAE 3F9IA 2I6XA 4LVOA 2KCVA 1TRKA 5DB4A 3KV1A 4O2RA 4HRLA 3OJOA 4I50F 3AT1A 3TWVA 4F9FA 1KTIA 1XU4A 1RFLA 3V4PB 5TEWA 1J2RA 4ND4A 5EQFA 4WBNA 1Q19A 3F0TA 1E96A 2I78A 4X8HA 4BFVA 3T7RA 2W93A 4PQRA 3U3KA 3FKSA 4X1KB 1C1YA 4C0LA 1NDQA 1TJFA 5ER9A 3KQOA 1D4OA 2H1SA 2C83A 2J6CA 5CYOA 5JCJA 2IRWA 3LLVA 3SNHA 2HHAA 1N6PA 1P1RA 1XEAA 1U2PA 1MX2A 4X6UA 1TC1A 1BRTA 3L0IB 3R74A 4KREA 2PS1A 2H2HA 1OLUA 2AX3A 4XVHA 1OH7A 1MJNA 1EFLA 2HA4A 2X0KA 2ZFUA 3ESZA 2GPWA 5CT6A 4AKSA 4F1WA 5I7HA 4KIFA 3AJDA 4S1VA 1E3JA 1I2CA 1JXMA 3RHSA 3LSTA 2EAUA 4J8PA 3N2NA 5I9IA 4OQZA 1OSNA 1V25A 3WQRA 1SQ0A 3LPDA 4R2IA 3TB4A 2V6JA 1PDVA 4J0IA 2ZTUA 2B36A 4FC6A 4YMHA 1RRVA 3PH0C 4DJFC 4PG7A 1Z5VA 3QUCA 2AQKA 1H8ED 4ZQCB 5B53A 2YMQA 5BOSB 3AVXA 1GZDA 5EJGA 4M1WA 2H31A 3PGVA 3PT9A 5HQ3A 4X3OA 5KQSA 3UWOA 1ZU2A 2GNAA 2V3WA 3PB3A 3PHBE 3ZCQA 1RQPA 5LQJA 4FYWA 1BGWA 1K68A 3WICA 3GGGA 4DIEA 3H8VA 3JASB 1GNRA 4UCQA 4DLPA 4B7CA 4PY2A 1S7CA 4Y2YA 1KE2A 3DZBA 1OREA 4XM2A 1RRGA 1OXJA 3LC7O 2Z1NA 4F93B 5KYUA 1XU9A 2LKDA 2XEDA 3BWBA 3PA8A 3LAWA 1DSSG 5A9TA 2FRXA 1EGMB 2ZXUA 2YMMA 5DCLA 2XD9A 3L93A 4YONB 1TT7A 1A7JA 2WD8A 4U95D 4RXTA 4H1UA 5CFNA 4YRBA 1R9NA 2V4UA 2WTBA 3EULA 3N8DA 4WESB 2RHOA 3LKZA 4P4TA 4I14A 3ND6A 5FBHA 2O0JA 2OCIA 4UUAA 4CKWB 2P8SA 1DJOA 3VTZA 1V1RA 2J9FA 3WMXA 4RQTA 3RK1A 3HA2A 4XR4A 4K81B 1Z6YA 3SOPA 4RG9A 4FD3A 4FYMA 4DLUA 2BUCA 4ID9A 5EESA 1X1EA 3GP5A 4BQNA 2FXIA 2D8MA 4EG1A 3FN4A 4XW2A 3SI7A 2H5EA 1E1KA 2ZATA 2XOKD 4S0ZA 3KQUA 3ZVLA 4F0JA 1QB8A 3LUGA 9MHTA 3RF6A 2H52A 3OEEA 5DU2A 5FWXB 2WF6A 4R1SA 5CHYA 3QELB 5DM1A 1RYBA 2YW9A 4PHCA 2IPNA 1RRKA 5EYPF 4REMA 4MWTA 5SZJA 1Y8MA 4A1OA 1VYTA 3GRYA 5HOEA 1EEXB 3OQHA 1O7JA 4XI9A 4L23A 1UJ5A 2AJCA 2BCJQ 3A1TA 3I5XA 1JDTA 4N03A 1P0MA 4TVOA 4RZ3A 2A9OA 5SYAA 2IHNA 3ES9A 3EMVA 2CJYA 3ICVA 2ZB4A 2O2DA 3B6ZA 3H2BA 3PYXA 3RTAA 2FKAA 4X9XA 3TGWA 1VG8A 1XKXA 3EAQA 4JC4A 4G1EB 4IIUA 1RMQA 1WVIA 2B8TA 3SHVA 3VI3B 4KVGA 2AW6A 4M7OA 1TCBA 1YUMA 4M8IA 3WYDA 2VA8A 1YS6A 3DHYA 5DTQA 3TF5A 3V80A 3DAOA 4N0EA 1RWWA 3LVBA 3RLIA 4BX2A 4UBJA 5H82A 2Q7DA 3ESCA 1I7SB 4QREA 1J49A 2BR3A 3UKJA 4YCSA 4OB8A 4H1WA 5A3QA 3SQVA 1UBOS 2AMYA 1I1OA 1JR3D 4WDQA 1ECFA 1OVMA 3L18A 5KCMA 3PT5A 3T5PA 1M1YB 2VGYA 2FUKA 4CRWA 1IY9A 1D2GA 1I3MA 1VA5A 4O5OA 3QVJA 2PGDA 4BO4A 1RM0A 4J76A 4WN9B 3U0VA 2IHUA 1UXOA 2J6HA 3AIIA 4GP7A 1D6SA 1E89A 4MR7B 5E9AA 2OBMA 1UKBA 2O2JA 3L3BA 4ZVTA 4DTIA 1IMJA 1IXZA 3Q87B 3NBMA 2R2LA 3WL8A 2JRCA 2NPOA 2PL9A 4P7KA 4LFAB 4H7HA 5FNZA 1TCVA 4FYJA 1FRNA 4Q3OA 1FA9A 2V9PA 3D3MA 3RSFA 1JNRB 1UBUS 4PZZA 1OU4A 2VHTA 4YAWA 3S3TA 5J4VA 3OKAA 2X13A 3L4BA 2QY9A 3V00A 5CTJA 2E2EA 2JGFA 2W4MA 3O9MA 1TK2A 2GN4A 3K8QA 3MMZA 4ANVA 3W2FA 3TMAA 2O8VA 3ANXA 2HI0A 4L2LA 3MUEA 1NJGA 3ONWA 4GKVA 1KS9A 3RUIA 4KPYA 3F78A 3GP3A 1OIXA 2LKCA 1UXHA 5EUBA 4G09A 5BNTA 4YMTA 3OT4A 3HVIA 4AN0A 5KTPA 3TECE 4LYHA 3W78A 4X90A 5CVVA 2Z1DA 1GTSA 2O54A 2NU7B 3BHIA 3OAAD 1FNNA 5IYZF 3U1VA 2IP1A 3BCHA 3HCPA 4KGVA 4LCJA 4UREA 5B57C 3DAGA 4FONA 3C6KA 5K0TA 5KSZA 5A5FA 5L3SA 3CGHA 2HY7A 3FNBA 1FCHA 5EIOA 3S2AA 3FD8A 1KQGA 1XPJA 3F49S 4YAFA 4DCSA 4QG3A 1FX1A 3PWSA 3UGJA 2WF9A 4RD1A 3VHXB 1EM8B 3UT7A 2ESRA 3C1AA 2CY0A 4FYPA 3EQZA 4LOHA 4CMBA 2H92A 5E0OA 2R1TA 3WR5A 1KBZA 2A9KA 4CM3A 4U9IS 4N8SA 1OBFO 3DBHA 5BURA 5ISMA 4YDOA 4X24A 1FTYA 4ZYWA 3SM9A 3EGCA 4LY3A 4C6HA 3T7DA 2QZ4A 3WLNA 3DFMA 4GYJA 4YREA 1JFRA 1U8UA 1NAIA 1UFOA 2PMWB 4C29A 4QXRA 5LLTA 5A06A 1OBHA 3GZ1A 3R0XA 3PGKA 4DEVA 4S05A 3DNPA 1KR2A 5CA0A 3QEOA 3SK1A 4PR0A 1LSSA 3NASA 1BLXB 1G6OA 5ESWA 3F6EX 1AGNA 1P2SA 4JP1A 2I7DA 2ZGGA 3QG1A 3GLVA 3GGJA 4R51A 1EPUA 3EB9A 3A9RA 3HRKA 2HK6A 2O4UX 4MGHA 1E8DA 1YFZA 2VNIA 2GGSA 1A4RA 3PDCA 1NP3A 1JH9A 2G25A 4DG8A 3L7KA 2BEWB 4ZYLA 1ULTA 1S3FA 2PG3A 1SVMA 4X44A 5C1BA 1P6UA 2JGEA 2GAAA 1FYWA 2OKGA 3J5PA 1E2UA 1MAUA 2PS9A 2QTZA 3DR3A 3ED1A 3HJAA 3MMSA 3NTUA 1T4MA 4HK4A 5A6SA 2PJDA 4KIJA 4MV6A 4OF4A 1ULZA 3TN7A 4AY2A 2GBLC 4ETWA 4QPJC 1NA5A 2G09A 4BLOA 4CT4B 3TQQA 4DMHA 5B7GA 3DLCA 1MX9A 4HN9A 4E6HA 3LIPA 3NTQA 2PVSA 4GOJA 4RACA 3MBOA 1IYGA 4WAFA 1IU9A 4FFSA 3TZCA 3JQRA 1LF5A 1W94A 1EBFA 1EZ1A 4EX7A 5M29A 2PH1A 4BCCA 2Z8ZA 4XEIG 1V11A 3CX3A 5KJLA 3VOAA 4CTNA 4NZMA 5HP4A 3ZZ0A 4D41A 4WXMA 1TZJA 3IT3A 3BMQB 5HKLA 1PAUA 3Q15A 2NV2B 4I55B 5ALEA 5J1SB 3QKUA 1Y8RA 3NBZC 3ZJVA 1E32A 3GAFA 4QM7A 2OCKA 3KTAB 2KBEA 4KIGA 1RJFA 1YI8A 1WMEA 3ZKAA 1AKYA 3PC7A 2I1JA 1HI9A 4GZ3A 1EQUA 1GR1A 2QVCA 2J07A 3DSXA 3I4LA 3KU1A 2I62A 2YVKA 2PT9A 3LC0A 4II2A 3QA9A 4XSVA 4R3WA 3QVUA 1XBTA 1Y63A 5AKHA 4US1R 1EE2A 3GIDA 3IRVA 4ZQFA 1N1DA 5EIBC 4BU1A 1JIJA 3BQMB 4TXMA 3O4ZA 3EPHA 1RMYA 3HDVA 4NH0A 3DBVO 5BW5A 3MWEA 4H2DA 4TTRA 1RLOA 2VHEA 3C43A 2DG2A 2ZJOA 3W9FA 3Q0EA 3NWJA 4AY6A 1WBDA 3OOSA 2Y4UA 2E7ZA 4V1CI 3I2IA 1Z15A 1UOOA 4PPGA 1EU1A 3D64A 1O4VA 4UBIA 2Z6AA 4KQ6A 5H70A 3U16A 3AF2A 2VYIA 3EUEA 4DMKA 4N7MA 2IFTA 4KXFB 4P22A 4G9EA 3K5WA 4XGQA 4AJNA 3WQHA 4OCZA 1O8BA 3D0RA 5DOZA 1Z8HA 2FUEA 3D0OA 5HF6A 4XX0B 5JMPA 2X0JA 4B35A 2EFHB 4BEPA 1AO3A 1C7QA 1OX4A 1T43A 4GOND 1UPFA 1OAOC 4GR4A 3OZGA 4R0NA 5JQGF 1YQGA 4LVNA 5AI8A 3IJPA 2OBNA 4C6RA 2PWYA 2OV4A 2XYVA 4HXIA 2F2TA 3I2HA 4JGBA 2MRIA 4P92A 4B75A 4YX9A 1UCFA 2E55A 4GB9A 4R2LA 3WV4A 3CN9A 1OIVA 1OZ0A 3A4LA 4FT4A 3CZCA 3V1LA 5GTDA 4DQUA 5K8JB 3LFTA 1KS2A 4NNPA 4RLYA 4DREA 3ZCRA 4CL0A 2DSTA 1RM4A 1DC6A 4N82A 5LCXA 1GP2A 4JGGA 2NOAA 3MYYA 3K0EA 3RO7A 5D1NA 2I6GA 3K2EA 3R6WA 2ETAA 4IW3B 4NZOA 1C1DA 4OU4A 4RH0A 3QFTA 4WFIA 2RBGA 4F4UA 2Q9AA 4Z3KA 2B7LA 4LF7B 4JXZA 1QX4A 1OFHA 1TL7C 4FMCB 2C2WA 1L4NA 2ONKA 5ENQD 3W8NA 1XLVA 2ZRGA 1JALA 3DOUA 4RHUA 2VWPA 2QTWB 4LSZA 4DR3B 2XMZA 1L9KA 1YB1A 3QNMA 2DKFA 3V9PA 1YR3A 4BMSA 1WF3A 2CHEA 4GUAA 2QY7A 5T6MA 1KFJB 4FFBB 3SVLA 1E1LA 3E58A 3BUAA 3IV7A 4OBEA 3SSMA 4BKPA 1BE6A 4FM9A 4LDAA 2I2BA 5FPHA 5BOVA 1R0KA 3KEOA 1OV4A 1ZHFA 1YD7A 3FPKA 1OZHA 3B36A 3UM2A 4LY0A 4MW6A 2XT6A 4EG4A 2WYHA 2G9RA 5A4KA 2DPHA 4R7LA 1KTVA 1N6IA 3KYBA 1J99A 1Z4LA 4MS6A 5DX1A 2C2HA 5HJ5A 4BVGA 1SK9A 3RDPA 2G67A 4ILIA 3UK6A 2V1XA 5FKJA 4RA9A 5FDFA 1OBCA 5C7YA 1ELOA 2RI0A 2W2NA 4OJNA 3CLUC 3SGLA 3L7YA 2BFOA 2IQ5A 3RM3A 1NYLA 4FUTA 1BS1A 3NTVA 3U4IA 1MGOA 4GVPA 5DYYA 2LV8A 2IYSA 2R6ZA 3W5VA 1QIFA 5EUQB 1XZBA 2XITA 2O3SA 4IOMA 1CJTC 2ILVA 1WBJB 3QVWA 5IZCA 2DR2A 4MHTA 4OA5A 2H85A 1ECGA 3ZHRA 1UMCB 2GN0A 1T1SA 2WMYA 3VO2A 4N4AA 3S27A 1K7SN 1MJFA 4JWKA 3TTXA 3OC0A 4BTBA 4YRCA 4JOSA 1OKKA 3ND8A 3ZS9A 4EF6A 1N2OA 1SQSA 2UVPB 4PGFA 1YI0A 5LP1A 2CUKA 1KSHA 3WDMA 2ZIWB 2YWXA 3EVFA 3H1BA 2MHKA 5F77A 2YVQA 5C0OE 4JU9A 3R5FA 4ND7A 3IP6A 2Z8XA 3HADA 3ZIAA 1J23A 4ENWA 2Y9MB 4DG5A 4IJ5A 4FLEA 3DVAA 3M2TA 1DQRA 1NU6A 2FZGA 2H6EA 3G5LA 5AOAA 1KZHA 2F55A 4B82A 2AOUB 1OWMA 4KX5A 4KWTA 2QRZA 3CBQA 1HQKA 1NR7A 5KSOA 2Q1YA 1N4DA 2FEPA 3ISJA 3N6VA 4ODIA 2RK4A 3BGOS 4KQHA 4EGFA 4FLMA 2I7XA 2E5FA 1HQYE 2IUSA 4HGRA 2GN6A 5TPWB 3T94A 2FMTA 1PV4A 4B17A 5HGJA 2JKZA 3DZJA 4NBKA 3VKVA 4DLOA 4KMSA 3V30A 4G36A 2YC4C 4RY9A 1EGHA 3NNSA 4KE9A 4LE0A 5BSTA 4LMPA 4DCPA 1N8TA 3DNMA 2IPLA 1TW3A 4LQDA 1WCIB 3CH4B 3FYSA 1A5AB 3TR6A 1U4OA 3L7AA 1U7PA 3DEAA 2GNPA 3IURA 4RVFA 2VF7A 3W5DA 4Z4GA 1J5XA 3ROKA 1QVAA 2VYQA 2J4CA 3K9WA 3O8QB 3ZY5A 1CZNA 2YUIA 3PX3A 4GR5A 5LP0A 3I83A 4XJVA 4BNXA 3U66A 2XWPA 1ML3A 4OOEA 3ZPXA 3ICQB 3W77A 1PR0A 3N2LA 3APCA 4R5MA 1BFDA 3IVCA 3NM4A 2PY6A 5ADVA 5JRDS 3L17A 4I9FA 5IVKA 3EUAA 1JPVA 5EZYA 1X8XA 3VPFA 3WV5A 1KJYA 2J3LA 1LLCA 2NZWA 4KSYA 3VYUB 4DMMA 1P4SA 2JHCA 1D2EA 2NV0A 1BCRA 4R81A 2WIGA 1RLTA 1FFHA 4JDUA 1MHPA 4B87A 4EW6A 1JHDA 2RDMA 2FPGA 2CXPA 2GXSA 3HPRA 5T8KC 2AEFA 5IC4A 4I1MA 2C4HA 2JCSA 2PJZA 2Q6VA 4O6VA 3X43A 3AHHA 2YHIA 1USIA 2P9YA 1S2LA 4LYEA 3X2EA 2BUBA 2C07A 5JIBA 3I1FA 6Q21A 2TMGA 3WIVA 2X5JO 1EJ6A 3GFRA 3L54A 3RO2A 1X94A 2Q6LA 3AHCA 3HBJA 3LBYA 4DJ5X 2XKKA 4KDCA 3UT4A 2O8NA 2FUNB 3P1JA 4ZI2A 3S6JA 3MJWA 3M2PA 3C74A 3V97A 1EVKA 1N2BA 3O6VA 2VK8A 3IE0A 3NEYA 5AQEA 4YVFA 3RS2A 1T5TA 1ZC3A 4CR8A 4Z7QB 4GPBA 2R85A 3ZYLA 4BNDA 1FBTA 2W83A 2DBAA 3R9IA 2RGRA 4Y0NA 5DM4A 1OJLA 4PIPA 2VKQA 2MR6A 5JRZA 2DUNA 3RIYA 2ZS9A 2CWDA 1XD8A 3H97A 4Y9TA 3ABKE 4PTZA 2ZSIA 1TQ2A 3HHEA 5AVKA 4AJOA 1BROA 4DGSA 3DG9A 1H2RS 4R54A 4ZCIA 1KI2A 2C2GA 4Q16A 2BKAA 1KAGA 4ITRC 2CNKA 1G3RA 2H54A 1ZH2A 2FQXA 3ML1A 4OQDA 4QDZA 3H3XA 4V3IA 2RGAA 4LTDA 4M98A 1ZL2A 2W6JD 3FCCA 5A6VA 3K9CA 2H7CA 1IY2A 1HBJA 1HKHA 3MTBA 4G97A 1TM7E 1R4ZA 3O91A 3OD5A 4TWJA 4ALKA 4F3RA 2KC7A 3CEHA 1NUQA 2X4GA 3QMPA 4GM0A 4P4LA 5ALYA 5E6SA 4JEUA 3JQFC 5FR1A 4R7ZA 3ZWMA 5DXJA 4DW8A 3VKFA 3FUDA 4HX9A 3PDJA 2B4TO 3OZTA 3CHSA 4RD0A 4YHBA 3VJMA 5A5DA 2J4FA 4R9NA 4DUGA 1I6MA 1Y1KE 4OIMA 4ZAYA 4OSOA 1NXWA 1DBIA 5FUVA 5CFQA 2B6CA 4ZQGA 2XGOA 1KYIA 1JR4A 3GPIA 4JYZA 1PQUA 1ZISA 1L4HA 3MFYA 2UV8A 3WK9A 2LXNA 3NI2A 4KITB 5F78A 3TPCA 4GCNA 3OPYB 3UTMA 1TW2A 2QT1A 3WG9A 1S5PA 2P5SA 1A8IA 1XTBA 1YCFA 4R2WA 3WHIA 1QHEA 1TO6A 1QYXA 2BY4A 1A98A 3VOSA 2ZTSA 5EJ6A 3UNXA 3GLGE 3B1YA 4R8KA 2H3HA 4CUZA 4BNYA 4EMBA 1Z22A 5CH8A 3QKSA 2EJWA 3ESDA 1XKQA 3OLWA 1RWOA 1MX1A 1BD8A 1BHQ1 2F3QA 2R84A 3IA2A 4I2VA 2O19A 2QNRA 1RXEA 3INTA 4BZWA 2WYUA 4LTMA 5LP6B 2CYAA 4PZDA 4K3UA 3PC8C 4NCXA 3CSFA 2JHGA 2V8BA 2BN4A 1Y42X 3EIQC 1CUVA 1XFAA 4BGIA 4CM8A 2FCAA 1ORDA 2K6GA 5ALLA 1BJRE 4B7UA 3ILVA 1B3BA 2CLKB 4WINA 3GEPA 2AIRA 4PO3X 4ML3A 3QUQA 2Z4RA 4R0MA 2COUA 5ALIA 4PNZA 2WAMA 4JBNA 3OCXA 1H3NA 1Q44A 3H0KA 3H2HA 4PGMA 4CI9A 2H5JA 4DJDC 1QQAA 2XOXA 3KKZA 3HN7A 1YZNA 2DUUA 5FLKA 3E03A 3R7BA 4ZHQF 3UB3A 5JOQA 4Q4AA 1BEZA 2GD0A 2FO1E 3STUA 5KNCH 4PAOA 3ZBQA 4I2ZA 4W1QA 1B26A 1LLDA 2H18A 4I7EA 3ZBTA 1C4XA 5AICA 1K6XA 5EWMB 1IM8A 2EP8A 5F3DA 3SYRA 1N2CB 4C9BA 1N11A 4ZDIA 7MDHA 1N2XA 2Y0DA 3R41A 4QRIA 3KXPA 5BUQA 2ZRIA 4LJ4A 4MRAA 4D3FA 1T4CA 2PX0A 3HMKA 5CT8A 1DCTA 1P1IA 1UAAA 2D0PB 4R71A 2FEZA 4Y7DA 4ESOA 2HREA 2V5FA 3OMSA 4S0XA 1FLNA 2GJAA 4PFSA 1C7FA 2JAPA 2Y6UA 2Z3WA 3ELBA 2GO7A 3ZWBA 2YBEA 3RTGA 2GHIA 4ZCSA 4EO4A 3CKMA 5DNDA 2PGIA 3U64A 5D7BA 4Q7EA 2VQFB 3ZHCA 4RVHA 2REBA 1DQPA 4DYDA 1L5WA 3NWBA 1ELWA 4QZVA 1EEHA 3FTPA 4UD6A 3JQGA 1H2EA 2SICE 2SCUB 5FAXA 3ADCA 2V6GA 1R0SA 1IPHA 3MJFA 5CB6A 1QKIA 2Q7OE 2IZOA 3ZKWA 1NC3A 3FFTA 4TS1A 5EE3A 1QAMA 4MB6A 2XQGA 3AYXB 3CT4A 1M0TA 3FFAA 1CQPA 4CCSA 1CNFA 4EHJA 2COKA 4JY7A 3DOFA 3LJNA 1NKSA 3J7TA 3G2OA 3SYNA 2HYDA 4G0PA 3U62A 3H2SA 1F38A 4PU0A 3UH0A 1CYEA 4BEWA 2IYPA 4L5JA 3QE9Y 2FHPA 2OFFA 1E69A 3N3AC 2CXHA 3U9SA 4C7VA 4DA7A 2UUBB 1SUSA 1N2GA 3CKBA 2A88A 3GRAA 2WIAA 4HEA6 3LY8A 3CLRC 5EKUA 4CQLA 2QENA 3QMWA 4O25A 3G2QA 4HH0A 2ACEA 4JOQA 3V7UA 1WU7A 3U39A 3UIEA 2OCAA 2I87A 4D3SA 4X7BA 2VJKA 5IJXA 4L9WA 1ABBA 3VNVA 4URWR 2A0XA 4LCEA 2BHSA 2PZKA 5CFZA 1TYBE 1ZVJA 1P3Y1 4J7AA 1NFQA 2P78A 1G66A 4KHPB 2CXTA 3QMMA 2RG7A 2O8DB 1JA9A 2QZJA 2PWPA 1LDBA 1NATA 2H3EA 3DDOA 1T3LA 3NETA 1OI7A 4JENA 4UDXX 3R4VA 3W9GA 5FPQA 3RTBA 2F43A 2FXVA 4BWYA 2H6IA 1XEFA 4EHDA 4BQOA 4KH0A 2XBLA 5CFMA 1CBUA 4Q93A 5BMOA 1BOOA 2P2YA 2JL1A 1T35A 1S2MA 4Y98A 3KD2A 1H2ZA 3I2KA 4YAJA 4HDMB 3W9BA 4PR3A 4AURA 4AV7A 1G0NA 1NKVA 2XYPA 3L02A 3TNFA 3QSYA 3U4HA 2PAAA 4X1OA 3WSTA 4Q3EA 4ETIA 1IG3A 4LK3A 4DNQA 4UASA 3AERB 2XX3A 2X22A 4QU5A 4XAQA 3I52A 2XBUA 3ESYA 1ZLXA 3GK3A 3BB1A 4ZXPA 3DVSX 4IP0A 4CLRA 1BHJA 1UKAA 4ER5A 4PYNA 5KC8A 1BMDA 2ZTVA 2O3JA 4ZPXA 4E2ZA 4MLDA 1QIKA 3PI7A 1PY1A 3IELA 2PUDA 4U9UA 3T6KA 2AFIB 3SHTA 1RCTE 5F5NA 1KWGA 3U09A 3KPVA 3V6LA 1X86B 2RKWA 3GR6A 2PL1A 2W2KB 2B20A 4ZVRA 4J90A 3PJDA 6NULA 4UM8B 4B94A 3B7GA 2WMOB 4LFBB 1M75A 5KYXA 2BBTA 3HCRA 4LI3X 5DH9A 2VLIA 3L4EA 1JBKA 2DPYA 3D3WB 3K09A 4H6XA 2J87A 4H08A 1NQWA 4J8YA 4ZT4A 3ZXXA 2OAEA 1T2DA 1RP1A 1VKOA 3DB1A 2YHSA 4ED9A 1NXPA 4BQQA 3G2VA 1O0SA 1R15A 2CHVA 1R8SA 5DXAA 3FZYA 1ZM7A 1SVWA 3AB7A 3DL0A 4TYMA 1TGYA 1KZ9A 1MW9X 3NOCD 1AA9A 1B0UA 2GPTA 3SF8A 4EMSA 1V6CA 2OD7A 4L51A 5EYPB 3UFXA 1E2HA 1H3FA 4WWOA 3ZXIA 4K5QA 4IOJA 1W2GA 1E6CA 2JH9A 3IP9A 4MRRA 4OL9A 2CL6X 4FFNA 4YRRA 5ED0A 5IWAB 2P9IG 3WISA 1NDUA 1CY1A 5G02A 1DKRA 4G5OA 1K86A 3G2NA 4OQYA 3CRVA 4DV2B 2ZAMA 1VL0A 2NMVA 2ET6A 2A0FA 5J63A 2NUTB 5K8VA 2JIMA 3QV2A 2G5CA 5CYGA 4UQPA 4QYIA 1M6VA 1YVEI 4FGZA 2WSSA 3MQFA 4OEHA 1FSPA 2AA3A 5FPTA 2YNMD 1YRYE 1NWCA 1HLPA 3DKVA 2HJRA 3QHAA 2HGZA 3VOTA 4BVFA 4PEVA 4FCVA 4GCOA 1XK7A 3MCZA 4L3WA 3TZQA 3OTQA 4FTWA 3VDRA 4BKRA 1YZ3A 2JHAA 5FQ6A 5EUCA 2PU5A 4RDIA 3PZDA 5FWQA 1FFCA 5DHUA 3S2SA 4CQLB 3ZHOA 4BJ3A 1CKEA 4AC9A 1F06A 2HRQA 3PVLA 2PSJA 4J91A 4EUEA 2QZSA 5CFPA 1WDTA 3EFOA 4OUKX 4J8DA 1QGZA 5FXMA 3D9LA 3ROTA 3JQAD 3EPPA 3BIJA 3KT0A 4C20A 4BXOB 2ZR8A 4IMIB 2AI2A 4YP1A 1R0ZA 4B9EA 5B7NA 4OAQA 1MLDA 3PWZA 1T9DA 5IJ9A 4X61A 4YROA 1OI3A 3R5KA 2SECE 4P3PA 3HEAA 2BW0A 1DAMA 2ZUSA 1IZ8A 4BECA 2G82A 1MAHA 1XN4A 2PPVA 2L0TB 4I3FA 5DNCA 3UMYA 2BL4A 1YHNA 2E85A 2H9YA 3QQ5A 4BVAA 1EK5A 1RI3A 2XCIA 2EIME 1WDWB 4NTZA 2G8LA 2VL7A 1LCIA 4GWLA 4NJMA 1HY3A 2XE8A 4BERA 3CRMA 1XTJA 3UV6A 5I9LA 2AS0A 1WW8A 2P5UA 1Z68A 1T2NA 3DZCA 3I4FA 4IFIA 5P8WA 1FSGA 4YP0A 3SLKA 5TQ0A 1QG6A 4W5QA 4BZZA 2V5AA 2V97A 1BDIA 2C5GA 1VBMA 4RJJA 5J4LA 4LWPA 1WVGA 1Z28A 2P4UA 2R6CA 4WCFB 4Y1FA 5D3QA 4MQFA 3NUQA 3CJQA 3DR5A 4HAYA 4IXNA 4QDTA 5G41A 4Z1MD 3WLHA 2EG9A 1HORA 4CGVA 3D3QA 4EPYA 2Q3JA 4YRLA 4U63A 2G76A 1IKND 4KO1S 3ZI4A 4B0OA 2WXOA 2NXPA 2CB9A 2LDXA 1F8FA 1KHHA 2Q1SA 2VNHA 1N2CA 1H5NA 3IOEA 4FOTA 3IX7A 1Y34E 4DE5A 1C9MA 1SUFA 2W4IA 3R7FA 4MW0A 1E18A 3LLSA 4P58A 2RGUA 4F4JA 2VAXA 5IX8A 2PLRA 3F1KA 5BSUA 1RLIA 4G6ZA 1GU0A 1IDN1 2XZDG 4WK2B 4LF4B 3AR6A 1WKBA 1TU3A 3VUFA 3ZGVA 4JI7B 2CK3D 4POOA 5JFGA 4B2IA 2VJYA 4LZPA 4LS3A 1MF7A 4P82A 1BG6A 1K1EA 2CXUA 1JR3A 3BMOB 3EFHA 1E4EB 3LT5A 4AJ2A 4O4HF 2PYZA 3EARA 3TRHA 2Q07A 4N5IX 2JLCA 1Z4NA 3D5TA 4CDMA 4ZQBA 1AHNA 1DZIA 1SZAA 4CM8B 2EKLA 1KMQA 2XPCA 2C4NA 2KZTA 3F9RA 2PUEA 5F51A 2OECA 4JNCA 2FN7A 1Q2ZA 4L5IA 4F3YA 3DP9A 3PXXA 5EXXA 4YCCA 4WECA 4HOSA 2P9BA 2DWCA 1A2OA 2I29A 3O1JC 4BB6A 3GLIA 5KTSA 3QKSB 4E5KA 4E5YA 2IHVA 2D4AA 2PE5A 4YRQA 1A7UA 4A5OA 2OP1A 3X1WA 4QGSA 2FJPA 1ZGZA 3EDOA 1NASA 4J0CA 5DSZA 2P65A 3ZHZA 2DIWA 3O3NB 3T15A 3ACBA 2YC2C 1TIPA 1WA5A 1EX7A 1AUPA 3Q10A 4MUNA 3OPYA 5IC6A 5KTNA 1I1QB 1EB8A 1QSGA 3GBSA 2PRZA 4ROSA 3R75A 5BWCA 3EGDA 1RKXA 5BYJA 2CFOA 2PV7A 3FYTA 3ZVNA 5E38A 1QC5A 1TZCA 2EZTA 3UMJA 2GM4A 4R6XA 2ZIRA 1E3WA 4NCHA 2F48A 1VPWA 3P2MA 2ZW9A 3D2BA 4L78A 4GR9A 4MKXA 3RBZA 1ZEMA 4F9TA 3BG5A 2DR3A 3E9DA 1UQRA 4JJ6A 2WQ6A 4L4YA 5UKDA 1N1MA 3U4CA 3UW1A 2WUDA 3KQQA 2MSNA 2OCXA 5HYVA 3VH4A 4UU8A 5IAEA 3LP5A 2VPPA 1KI1A 1CEQA 5AAOA 3ONKA 1BN7A 1U8AA 1JT2A 1MFZA 1YVDA 2P0EA 2NO0A 2W8BA 3AF1A 1I4DD 3K4HA 3EH2A 1A4XA 2JD1A 5LLDA 2BF4A 2PZFA 5HW0A 1GN8A 1IXSB 4IEEA 4O4IF 3THSA 2WYIA 4UMVA 2WTEA 4H4EA 4AOFA 3V1KA 1TUIA 1OOEA 1L6RA 1S1CA 3DKRA 5CPFA 3WYFA 4B5LA 2X7JA 2DU8A 3DEHA 4NEGA 5CYPA 4CM4A 1KK2A 2X3UA 3LUDA 4ILHB 4C0HA 2O0LA 3QNUA 1OTYA 1FSSA 2QTAA 4WKNA 1TM2A 2A9QA 4INAA 5JY6A 2QRLA 3B2EA 2WUGA 1QONA 3PRYA 4V0OA 5B4VA 1XQVA 1U3FA 1V47A 1EB9A 1SVOA 3SYMA 5DYTA 1EFCA 1TO2E 2R1VB 1HOXA 1U3WA 3E30A 3CSUA 2P9LG 1T9BA 1X14A 4KW7A 4LX8A 4ZCLA 2RBEA 3L8YA 3W1WA 4C48B 4JVLA 4D2IA 3GRFA 4C06A 4G1TA 3OCUA 3D1VA 1JR2A 3DXYA 1A8QA 3VVCA 1JZQA 1JWLA 1MH1A 4CM6A 5FTJA 5AVTA 1MW8X 1G38A 2YXPX 4AY5A 2TECE 4US2R 3D9KA 4OP2A 1JEEA 4NRDA 2DTEA 4KSCA 1H23A 4R1NA 4R16A 2X0DA 1F4PA 4Z9FA 1AQJA 3C3JA 3H7IA 4NG4A 4WVFA 1NNI1 4IYJA 4KO3S 2GN9A 3N7AA 3PDIA 3PXAA 2AW3A 1QC5B 1TXGA 3H6HA 3ONLA 4EG5A 4ZTZB 4Q00A 3UPVA 1B76A 1YA8A 2BSAA 3R7DA 1I4LD 2EJTA 3DCIA 4HDSB 2GETA 4QGHA 2CMFA 2AUNA 1K3FA 1BCRB 1ZSVA 3AP2A 3I9KA 1DHTA 3HZOA 2O0MA 3NYRA 2R86A 4NMHA 4HRNA 4Y2SA 3ZD6A 4BQSA 4RPLA 1U9YA 2ZR9A 4DZTA 1HX7A 4TUYA 2A0KA 1TPYA 1HDXA 1DTSA 4FGUA 1OVGA 4OMCA 2ILRA 3HLTA 3WLMA 4EKEA 4FE4A 4W9NC 2OHVA 2F1RA 3OHMA 1UJ2A 4MP3A 4RM3A 4MAFA 3ABME 2A5UA 1CXZA 1ZNXA 1KP9A 2PL5A 3P9ZA 1X1SA 1W9MA 1BGXT 1WCIA 2AMFA 3VNRA 3IUSA 4U2CA 4DF3A 1D7AA 1XTPA 3MBKA 3PQFA 1U2VG 2P2CP 3RROA 2DQYA 1V4VA 1W1IA 4OHVA 4NCJA 3S1AB 3PZ2A 4JW1A 1U8CB 1GTZA 4PYMA 1WSBA 3CHYA 3K6RA 4TVKA 1CJUC 1GQFA 1ZO8A 1XZHA 2AN9A 2NXJA 2RHLA 1ZGJA 2WM2A 2PNFA 2B82A 3KKMA 2BFEB 4OAPA 1T5LA 1WE2A 4PX3A 4BZPA 5A4MS 1N5OX 1AD2A 2WJGA 1KOLA 3EAGA 5BSVA 3GA5A 1AKEA 1SBNE 1HT1E 1Z5PA 5JLJA 1N5LA 1TEVA 2ZSAA 5I8ZA 3KKPA 1JILA 4BWGA 1SELA 2WJ4A 4KMRA 2YIVX 3CW8X 3DVAB 4X71A 5J1TB 3L08A 1KMMA 4Q4HB 4U7JA 2A59A 2FQYA 3HLYA 2OL4A 1JE0A 2OG2A 3JAMA 4EX6A 2R8BA 2IITA 3TSOA 4QPCA 2ZWIA 4EDHA 1NJSA 1N0UA 3PFBA 5TE9A 4B3MB 3LUJA 5CCBA 2UVPA 2A84A 4JI3B 2JFPA 2Y6VA 3QKYA 3BGIA 2E18A 2O2CA 3JWIA 1N52A 3KBOA 3DBRA 2ZLBA 3AL2A 5JSQA 2VTVA 2WF5A 3PCTA 2DWUA 4CNBA 1UMCA 4EENA 2IS1A 4FDMA 1TJPB 4YRGA 3BJEA 3NO4A 2G1PA 2DFLA 2OYSA 2PAFA 4GM1A 4HL6A 2FWAA 4YR9A 4MUHA 4BFZA 3ILYA 5KREA 2AFHA 2JCYA 3Q7RA 3FGPA 2VPZA 4RVGA 2OWEA 4ZCPA 1T9HA 3BJRA 4J0GA 2VS1A 2PMDA 1ZOIA 3E8MA 1DAPA 1R4AA 4BDTA 1JIKA 2HLNA 3TZKA 5FINA 2BZGA 1BDHA 4FW9A 1NPDA 1YR7A 5JPIA 3HFSA 4KR7A 1P1BA 3O84A 5AK5A 2YQZA 3A1SA 1NQVA 1M8PA 4KIWA 3OH8A 3N0VA 1XNFA 4MIOA 3EK2A 4FFBA 4XRGA 5HDBB 3B6MA 3NGXA 2EEPA 3OJWA 5E6UB 2FWPA 2MOKA 2FR0A 1QV9A 1TNZA 1I7LA 4N2SA 1DKUA 1S9DA 2QP3A 3LHIA 1DOHA 3F98A 4PZ9A 1Z2OX 2WF8A 1SC3A 3ZS8A 1C1DB 2GS9A 4UMEA 3SIWA 2D7JA 4FU3A 2B3DA 2W6MA 5E9QA 3HK2A 2XUFA 4D9HA 4U0JA 1A7AA 1D09A 1PL7A 1U1GA 1V9CA 3AB8A 2OB1A 3EXIA 3CISA 2RH5A 4MRSA 3HQ4O 3JZIA 3BMNA 4ZYZA 2YV1A 1EDBA 4Q7QA 4P0TA 4PSAA 3T3MB 3ZI0A 4CGYA 2PVCA 2HO5A 1BJKA 1KAMA 2GHTA 2XOEA 3KHTA 1CVIA 2ZUEA 3UEOA 3FUJA 3DE5X 4W6QA 1XLTC 4YMSA 4QBKA 2XAAA 3EF0A 1CD5A 3M3HA 4MH0R 4D4JA 3AVQA 4K6HA 1I1HA 1P1FA 4HQOA 1UBNA 4NI5A 3UHPA 1T5HX 4KLRA 4EZBA 2QBYA 2W58A 2Z2YA 2GNOA 5JHAA 1J4AA 2ISSD 1OX4B 5IDYA 5DASA 5K4HA 1DIHA 4HLLA 1E5DA 1QZTA 1NW9B 3I8OA 4XX0A 5TEVA 721PA 2JLZA 4ZU3A 4N76A 3TRFA 4GSKA 2OEWA 2UY1A 3ASFA 1TT5A 2H17A 2QVYX 2ZXWE 4L0DA 2J09A 1MO4A 5DX0A 3S5JA 2Y66A 2QN6A 1X92A 4EYEA 3CSTA 3SKXA 4LGVA 1ECBA 3GEHA 1JJAA 2F90A 4HRMB 3D31A 1ZJZA 1IJBA 1FLVA 2AJDA 3P4XA 4XIFA 4MWZA 5HCNA 3PD0A 4PSDA 5KQGA 3L07A 2YXNA 2DEUA 4JB0A 1F7UA 2O7QA 1H4SA 3FH8A 3NHBA 3CCFA 4BRSA 2PR2A 1HSOA 2W2KA 5EEHA 2W42A 4MIEA 1QFJA 1NLMA 1Z0AA 2DBYA 2HLHA 3MZ0A 1XO1A 4P83A 4S1WA 1R66A 1P0PA 1ESDA 1UKYA 3CIFA 4DMRA 3WTBA 3T99A 1T15A 2FF4A 4Q69A 2VNJA 2R00C 1U2GA 4NSNA 3UTDA 3WOVA 3M0EA 5DLQC 3ZH9B 3QVTA 3SI5A 1U5CA 4DK5A 2GYWA 1FB5A 2VBGA 3IVMA 4K86A 1GT91 2V6BA 3TBHA 5IN4A 3V1UA 1NF9A 1B7GO 1NV8A 4S1TA 2IPAB 3EH1A 4G67A 2CBGA 2PNJA 2KM1A 5EC8A 1S3SA 5KBYA 3PHGA 5BR1A 4PCUA 1TYAE 5DLEA 1KETA 5FNVA 1YK1A 4EGAA 2BRUC 4LHVA 3LRXA 2FX2A 5IS2A 4H7IA 3KSMA 1MJHA 1YOBA 3HXDA 1ZI6A 2B4QA 3ZGQA 3FPJA 3HZZA 3DH0A 3KLNA 4X0EA 2EP7A 3QOUA 2GHRA 3A14A 4J8FA 1CUFA 1HMPA 1CIPA 1VFPA 3D9NA 2AL7A 2F43B 3IA7A 4UEKA 3LUFA 4UCFA 5FFFA 3FPLA 4MDEA 4WERA 4GOLD 1ZIYA 4L57A 4ZEWA 4JP8A 3C15C 1EFKA 1U3VA 2FWMX 4BVKA 2X38A 4REQB 3WNBA 3D6AA 4B3JA 4G0WA 1NF8A 2WOJA 4L2IB 3LVRE 4X8OA 4DX7D 1A9OA 3KRTA 3I5UA 2VT6A 3SBXA 2EIKE 2C9YA 2ASVA 2PU7A 3L6UA 3TI7A 3I23A 3IHWA 4BVLA 1E92A 1MVLA 3L6OO 4MXDA 2HJVA 4DPLA 3VSCA 1XMSA 3WADA 3IEXA 4Y6CA 1N8KA 2KLHA 3MMXA 1QKJA 4OL0A 3SMVA 3HXEA 4A3SA 3C1TA 1U6JA 3WFJA 4TLDA 4EATA 4PN7A 1M2NA 3LLUA 2JVJA 1EP3B 4KODA 5CJJA 5DOVA 3K6SB 3AESB 1TPZA 3H83A 4B74A 3B12A 3K1TA 4XQ0A 5H0IA 4AD8A 1NJ5A 1MGPA 1ZGCA 1VLLA 2BZSA 2AQIA 3EZXA 4ZOEA 2OMEA 3STWA 1Z29A 4WJLA 1WD7A 5CM8B 1R27A 1SUBA 2B5OA 3NEJA 5CVEA 4YRJA 1QIMA 4DRZA 3W0LB 4FNAA 2PFGA 1QHHA 3JAWB 4BL5A 4NS4A 2Q8PA 5AKGA 3L4BC 1XE3A 2CLSA 3CGWA 4RLQA 1LH0A 3L43A 4WPGA 3JQGB 5G4KA 1CE8B 4FR0A 4XD2A 5AT1A 3THRA 4E21A 3HHMA 3IQWA 1TIBA 1914A 2UUCB 3AJAA 3HJGA 1MDBA 1VSUA 4XR9A 3G9ZA 3ABZA 5L3SB 2HHHB 2FDXA 2PN1A 4HXEB 3QOXA 3NPAA 2H0RA 4PXSA 4AW9A 1QO7A 4GXRA 2M6LA 1M0EA 2WWXA 1KJIA 4RV9A 2IK8A 3EJWA 1L7XA 4GI1A 4DJAA 4CF7A 1JZTA 1W0KD 3IR5A 3QU2A 4IX1A 1B3RA 4FW8A 5TJ9A 5FFNA 3TE6A 2HMSA 5ITSA 5G0WA 4ZN6A 4JN6B 4IHJF 1C1XB 1SULA 4NCKA 1HXIA 1XTQA 3K1JA 3F5DA 5EJ7A 1CUWA 1EZZA 2XUJA 3KDAA 4RKWA 4FP7A 1AKWA 3G02A 3K6KA 2FZEA 2C0LA 2ORIA 3Q7FA 2Q41A 3QXSA 4GI7A 3ZIUA 4D5EA 5KU7A 3MLBA 5ILOA 2QAIA 5TDHA 2C9DA 4G5SA 3I9LA 1JGTA 4O4LA 4ZRDA 1XN1A 2G1JA 3QUSA 4P3YA 2VJAA 4A15A 4OQ4A 2LUHA 2ZSJA 1L4FA 1AS0A 1NI4A 5A7GA 2XXJA 4G24A 5AHXA 2XUQA 2GSWA 4K1LA 1I80A 2Q9BA 1JHUA 3PUXA 4TX1A 2C31A 3RSQA 4D0SA 2JEKA 2G36A 1H0SA 4G5FA 5KCZA 4X62B 1H2WA 1M1YE 1MCZA 5U1PA 4HDKA 3WJ7A 4HFMA 1RRCA 4FNOA 3FDFA 2DJ5A 5HNKA 4B31A 1R4MA 4H7JA 5G3YA 1OA0A 1OLSA 5KVSA 4QXMA 3HJFA 1KF0A 1PBNA 1U1EA 1V54E 3B38A 3OZWA 4JB8A 4G23A 4OK6A 3LO8A 2VWHA 3SE0A 3UPTA 4JIGA 2Q6KA 4BWFB 1PKEA 3RSHA 2R97A 5K0SA 1TF2A 5E7IA 3FCSB 2X4IA 2GZRA 3L7MA 4DPRA 5LCWC 4M3OA 1DTEA 4FJ0A 4PC7A 2GZ3A 1SCNE 2C42A 3A9VA 3CJTA 2NU8B 1I5EA 3DD5A 4MRVA 5DBHX 1XZIA 2PGOA 2X8BA 1GZ3A 3AHEA 2WFMA 3OJ0A 3OQIA 1XEXA 1I94B 4KXUA 2B1IA 5DI9A 1P8JA 2FY8A 1WZUA 2IY7A 3RI3A 3SG0A 3DHEA 3JWHA 3IS3A 3AJEA 4CU5A 2ZEJA 3JYNA 2PQRA 1E59A 2R96A 3A31A 1LC3A 4JROA 2WWWA 4XDZA 1VE1A 2ZJ2A 4D9GA 4R2XA 3PFWO 3GEDA 4KXYA 1YC2A 2HN9A 4L15A 2VQ6A 2W2QA 3PGXA 1GXSA 4OQXA 5EI5A 4YT5A 4G9BA 2QPAA 4P3KA 1N5DA 3OXFA 2FFJA 3OLYA 1YQQA