4N3BA

Crystal structure of human o-glcnac transferase bound to a peptide from hcf-1 pro-repeat2(1-26)e10q and udp-5sglcnac
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
716
structure length
697
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title HCF-1 is cleaved in the active site of O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/substrate
total genus 275
structure length 697
sequence length 716
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3bA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3bA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4n3bA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4n3bA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n3bA03
2IV7A 2X0DA 2IF4A 4M60A 2QN1A 1NZNA 1YA6A 1L7XA 2QRMA 1L5SA 1YGPA 3QWPA 3RKVA 5CCLA 5KJLA 1WV1A 2ACWA 4AIFA 1OUVA 1QQEA 3FP3A 1H5UA 2PRIA 2R66A 1IHGA 2XCUA 3RO2A 4WNEA 1B4DA 3DDSA 3TAXA 2LNIA 3PE3A 4CGWA 5FZSA 5JJTA 4BWRA 3RT1A 3ZPJA 2MHKA 3PDNA 1Z6PA 5JTUA 4HOSA 2O6LA 3ULQA 2F9FA 3U3WA 3T3HA 4GCOA 4N39A 4JL0A 1NZDA 3TOVA 3T5TA 3ZCUA 2XA2A 4X7PA 1QKJA 1NA3A 1PSWA 4UQZA 3MTBA 2JZCA 1FTYA 1EM6A 3CEJA 5TMDA 2F3SA 3ASHA 3MV3B 4JA9A 3GPBA 3T7DA 3NC4A 1ZBPA 5BT1A 2ASVA 3RU0A 4MI6A 3GZ2A 2SKDA 3CVPA 2BGTA 3LY8A 3UYKA 1RRVA 3QWVA 4CGVA 4ME2A 3WADA 4APOA 2Y4UA 3TG4A 4XIFA 1L5RA 3NCHA 5G05J 2H1FA 3S2UA 1E4OA 4YVQC 3LY9A 6GPBA 3SYRA 2QN9A 5LCWC 3ZCTA 3NAZA 1FC0A 3UYLA 1Z8DA 1XKXA 4U0SA 1NOJA 5KJMA 1GZ5A 1L5VA 2XGOA 3S0JA 5C1DA 2AMVA 5IKOA 3ZCVA 3MBOA 3KS2A 3Q3HA 2QFCA 2VGXA 1ABBA 4RIEA 3RIBA 3L7DA 1W3BA 3MV2B 4N2SA 2G9VA 5ARGA 3VDMA 1QZ2A 4KXKB 3TGOA 2XMPA 1XC7A 1K06A 3RSZA 4RBNA 3KD7A 4NQ0A 1A8IA 2OOEA 2JJMA 5D0QD 2YHCA 4AMGA 3KAEA 3AMVA 2KCLA 1P4HA 4GA2A 3CV3A 3ASGA 4BQFA 5KJNA 1P4GA 2PYIA 1IXYA 3GZ1A 2R5SA 2XCCA 1UZUA 4NC9A 4Z5XA 1KTIA 3ZCSA 3QOUA 3GUHA 3MSCA 4U0UA 3L7CA 4MHOA 1GPBA 1AHPA 2V5FA 2VGXB 4KBQA 1JIVA 1P2GA 3CUTA 4W9RA 5D0OD 5DLDA 3TG5A 2FFRA 3UUXA 2VSNA 4O6FA 2BISA 2IYAA 7GPBA 3OY7A 4BT9A 3OTHA 2Y4TA 3O48A 1PC2A 3CUUA 3VUFA 4HOQA 4RG9A 2VGYA 2QLLA 1EXVA 5G05C 3MT7A 4WACA 4J8DA 2UY1A 1Y6GA 1Y8ZA 3D0RA 1NOIA 4GPKA 2GPBA 5DU2A 3CK7A 2GJ4A 1XV5A 4N3CA 3GW4A 1A17A 3H4IA 3RHZA 4XI9A 4U0ZA 4RIGA 4F9FA 3SF4A 3MT9A 5IKPA 4I9EA 4AN4A 5D01A 2P58C 3VTXA 2AZDA 4JHRA 2QZSA 2GW1A 3S7JA 2KATA 3SYMA 1Z62A 5GPBA 3CUVA 3SZ7A 4YI3A 4N2QA 1J39A 4J8FA 2XGMA 4CDRA 3HBMA 5HI7A 3ZN3A 3S7FA 5DIZA 3E3LA 3K9IA 2UY1B 1IYGA 1Z6QA 1L6IA 3G2JA 3BCUA 3L7BA 1HXIA 2JLBA 2GPAA 4BQIA 4IN3B 4YI5A 2FEZA 3S28A 4BTBA 4N5CA 5JJ7A 3MRXA 3L01A 4B94A 3WAGA 3S7DA 1WW2A 4KQ2A 2ECPA 2SKEA 3Q4AB 3CK8A 2GPNA 2ZB2A 3OTIA 4L22A 4NESA 3CKBA 1WUTA 3OTGA 4WNDA 4G24A 1LWNA 4FKZA 4EL0A 3ASDA 2XPIA 1ELWA 4HOTA 2R60A 3RSCA 1XOIA 5HXAA 5TMBA 3NPAA 2R4TA 1SXQA 4X6LA 2QLNA 1L5QA 4HOUA 1FU7A 3FFLA 2GT1A 3BD8A 3WC4A 1E96B 2DBAA 3MA5A 2SKCA 1XL1A 3ZCQA 2VG8A 4QLBA 2C0LA 2HR2A 3LCAA 4UQYA 3BCSA 4GZ3A 5FZQA 2AV6A 3QKYA 2XCIA 2IEIA 2XA9A 3Q47B 3O3CA 1YA0A 4REMA 2WQHA 4G2TA 4GA0A 3BD7A 4AMBA 2X0EA 3G2LA 4PQGA 2KCKA 3D1JA 4CTNA 2IW1A 3N71A 4UI9J 3HBJA 4LDPA 4RELA 3BDAA 4I2ZA 4I9CA 3U4TA 4GYYA 4W6QA 1L5WA 5ENZA 4EJ2A 5FZRA 4WADA 2QRQA 5EKQD 2IV3A 3L79A 4U07A 3Q3EA 3FROA 4G23A 5G04J 2F3PA 3E4BA 3S7BA 3T3GA 2KCVA 4I17A 4MI3A 3OKPA 3OY2A 5ARFA 3FWVA 3BD6A 3WXXA 1ELRA 4J0UA 2C1XA 3CK9A 3DZCA 2G9RA 3CEQA 1SXPA 4J8EA 1GPAA 2F3UA 2QN8A 5BNWA 2QRHA 4EQFA 3E3OA 1TJCA 5DBKA 4WUYA 4HWGA 2BGUA 4HORA 2BUGA 2X6QA 1F6DA 3ZGQA 2XGSA 2C0MA 1QM5A 3MQFA 4FZRA 3LYAA 3OT5A 4EKEA 3JYSA 4AY6A 3RJVA 3VDNB 1FA9A 4LEUA 4BFCA 1F0KA 1P2BA 4EKYA 5CCMA 2PYDA 1C50A 4AY5A 2ATIA 3Q5MA 2QNBA 5EX0A 2NC9A 3URZA 2Q7FA 1V4VA 2R4UA 3EBPA 2LSUA 3CV0A 3UQ3A 2E2EA 1ZU2A 2WPVA 3LPZA 2KS6A 2X6RA 5BW8C 4A1SA 3MRVA 1NLMA 3PE4A 4WNGA 4JA7A 3MKRA 1FU4A 3DD1A 5DXFA 2X0FA 2I6HA 1NVKA 3C48A 3C4VA 3VUEA 4UI9C 2YQ8A 5CHEE 2VCHA 4I1AA 2BFWA 2FETA 4HLNA 1XL0A 3D0QA 4LEIA 1RZVA 2PZIA 1HH8A 3CEMA 4MI9A 2QN2A 2VYIA 3G2HA 3CUYA 3GYZA 1UQTA 3ZFWA 3ZHEA 1LWOA 1WW3A 2PL2A 2Q6VA 3QHPA 4KQMA 4RIHA 5G04C 1C8LA 1NOKA 4RIFA 4CTMA 2OFFA 4M7PA 2L6JA 1K08A 5KJKA 2AW3A 2J9QA 1KT1A 5M72A 1GPYA 4YNDA 5A7DB 2PRJA 1P4JA 4RIIA 4H7XA 2LSVA 1WM5A 1KT0A 1C3JA 2YJNA 3CUWA 5I45A 1B89A 3ZCRA 5JJ6A 3MS4A 3LY7A 2XEVA 2R68A 5A6CA 4G26A 4MHSA 1FTWA 1JIXA 4AM9A 1GG8A 4WHMA 1Y6FA 1M5RA 4GPBA 3VTYA 1PN3A 3HBFA 5FTPA 3MTAA 5FJYA 4M83A 3ZHEB 3OXLA 2PQNA 4YUAA 2GEJA 3BEOA 3CEHA 1UQUA 2ONDA 4YVOA 1JG6A 2WTXA 2G9QA 4BTAA 3C4QA 3AS4A 3CVLA 2QRGA 1Y8MA 1AXRA 3MT8A 3BCRA 3T3IA 4WNFA 2XA1A 3IEGA 1WUYA 2ACVA 4Y6WA 3HYMB 3QKWA 4BT8A 2QLMA 2GEKA 2VCEA 3CX4A 3ZCPA 1XNFA 3MTDA 3CVNA 2PQRA 4MRAA 3MS2A 4XI0A 4H7YA 4F97A 1BX3A 1NZFA 1JIUA 2HY7A 1FU8A 2IYFA 3NP7A 3Q49B 3CKCA 5AYWD 4G25A 3T3DA 1KLXA 1JEJA 2G9UA 4G1TA 1WV0A 4ABNA 3UPVA 3OKAA 4N3BA 5LQDA 3E3NA 1IIRA 1VGVA 1GGNA 8GPBA 2QN7A 4UI9K 3ESKA 3G2NA 4N3AA 3NF1A 4GYOA 4X7RA 9GPBA 1NA0A 2XCBA 2H1HA 3HBNA 3NP9A 1PNVA 1FS4A 3IAAA 3TSAA 4U04A 1E1YA 4Y6CA 3S29A 3OXFA 4KQ1A 5JTTA 3CVQA 4NRHB 3EBOA 4GCNA 2UWJG 3OKCA 5EX3A 4GYWA 1O6CA 2C9ZA 3LKUA 4F3VA 2IEGA 1FCHA 3T3EA 3EDTB 3RO3A 4MICA 1JG7A 2QN3A 2C4MA 2FF5A 1WAO1 4I2WA 5FT9A 2GM9A 2KC7A 2VQ2A 2IFUA 3G2IA 4F96A 3R9AB 3QDNA 4UQXA 1HZ4A 1FTQA 4EL5A 4CTOA 2FBNA 3MEKA 4GA1A 3IA7A 3QWWA 3H4TA 3COPA 3G2KA 3Q15A 3S27A 4RENA 4GZ5A 5HQ8A 1P2DA 2IUYA 3AS8A 3MS7A 2HYZA 3MRTA 4G2VA 4X7MA 2PQ6A 2FO7A 1P5QA 5D00A 2HO1A 3OXGA 4BQEA 2P6PA 2VSYA 1PYGA 3DDWA 3AS5A 2C1ZA 4N9WA 2F3QA 3L7AA 4NEQA 1C8KA 2AVPA 3NB0A 5TVGA 4GZ6A 2FF4A 2FI7A 3ASFA 4KYOB 2QRPA 3BEEA 1GFZA 1RZUA 1HLFA 4RG6A 3Q3IA 5LCWJ 5TMEA 2C2LA 1P29A
chains in the Genus database with same CATH superfamily
4JEIA 4KJXA 2FSVA 1MJ0A 3KB8A 1HDRA 1V16B 1W5BA 4DPRA 3MTEA 4J0EA 3D3MA 2VNJA 2ZBDA 4NTZA 2PMKA 4RMHA 1XXHB 1P62B 3UCEA 4RKQA 5DCUA 2OCKA 3GRUA 2F9FA 3HBAA 5IDXA 1W581 1EJ0A 1J8DA 2H7XA 3BB1A 1G18A 4RK0A 2IXGA 3EMKA 3WJAA 1SUSA 3CVWA 4QGAA 2C2XA 3OF2A 3VISA 1ZJYA 1U1DA 1TM5E 3KOUA 5LFAA 1L7VC 3FJYA 1LBTA 4BO3A 2ZSIA 3AFIA 1MG0A 1VECA 3JWIA 4ZEXA 1E1MA 2XE7A 1JB1A 1UBJS 3QX9A 3GVIA 5IT0A 4E1VA 1L8LA 3L41A 2QSYA 3KFXA 1NBWB 3FTYA 4ZKDA 3A1FA 2DVWA 5LXTA 3CUTA 5DLDA 1ODKA 4DIEA 5FQ6A 1LSUA 1P9WA 1PE0A 4ZI7F 5TE9A 5BPPA 1Y8CA 1WF6A 1E9DA 3TVYA 4PZAA 4DX5D 5G0WA 3W3AD 3ZYLA 4V0NA 3DJYA 4FC8A 1J8YF 3TTYA 4UEOA 5L3VA 1OX4B 1A8PA 3WV4A 2DYKA 3B1JA 3ND8A 4LY9A 3OH8A 2HDOA 1XT6A 5EIBC 4IN3B 1NATA 1MX2A 1JNRB 1AMNA 1OZGA 1WCIB 2P27A 3QZUA 1YTUA 3KJNA 4AG5A 1AKMA 3BWEA 4FFRA 1Y6RA 4PYKA 5H83A 4J94A 3LC0A 3Q7TA 3INTA 1U8ZA 2C0LA 4KZCA 3TLBA 3MHTA 2XZTG 2G71A 3PZRA 1Q0PA 2L0XA 3X1MA 3RTGA 1L1EA 2V6FA 4LCBA 4CTNA 1JSZA 4AXXA 2RG8A 5AW4A 3VHXB 2FWMX 4OO3A 2HW8A 1BGXT 5BYJA 3M3HA 1FXWA 1ZH8A 2C5LA 4PTLA 3W06A 5GJWC 4DR4B 1KYYA 4YJ2B 5F21A 1UDAA 1FJHA 5ANRB 1P7YA 4E12A 4IO0A 3PXGA 1NRXA 3DDNA 2NTJA 5EINA 4HH0A 3ORSA 4D8XA 2C9OA 4QQ8A 4DC0A 2OSVA 3AONB 4ZTBA 3V7FA 1U8AA 1E6EA 2IDJA 1RYZA 1MU0A 1ZM9A 3FUKA 3JYQA 1YASA 3CEAA 3TIIA 2I80A 3JZIA 1WZ2A 2HRRA 3SGHA 3REQB 2CLLB 3U56A 4C9BA 2MWMA 1U8TA 2AG5A 3FPBA 3G2HA 1TFRA 2YX1A 1T25A 3C3DA 3SHTA 1YL6A 2BFBB 3IE0A 5DI3B 1ZLYA 3S5JA 1YL7A 1ZVJA 4CE6A 2JDIA 5KS2A 4JFRA 1P4JA 5TNXA 2GRQB 4QYIB 5HIKA 1JWFA 3VI4B 5D3MA 4JIMA 5KDDA 3W6PA 5C7IO 3D1LA 1KIAA 3JQFC 2BUAA 2ZPUA 3E7WA 4N0QA 3TPZA 3D54D 1O6BA 3ZEAA 5DLPA 2PV7A 2GASA 4KXNA 1Y1RA 4MZXA 2I2OA 4AKIA 4IP0A 2GZDA 2QR3A 3EGDA 3PZDA 3TWQA 2HY7A 3CGWA 4PZPA 4P7BA 1NUAA 4LOAA 2F59A 2FPKA 5JMWA 1N2ZA 4B45A 4AP9A 4IGKA 2K2QB 3ZY4A 5B6PA 4M7RA 3F71A 4YJGA 5GVSA 1O6CA 1TECE 2X5KO 3NHYA 1SHJA 1U7ZA 3I92A 5L6LB 3IOYA 4JLOA 2OAGA 4AMZA 3HYTA 3J7AC 4N12A 5CEFA 4X8QA 1ZA2A 5A9TA 1KFBB 4EECA 1DXOA 8OHMA 1RAEA 3TQSA 3VLFA 3GGDA 4QOSA 2XDQA 3IDAA 3WNVA 1P73A 3HADA 3HP4A 1BFKA 1KQ3A 3AVWA 4A82A 3BN3A 2ZKLA 2XMCA 1KR5A 1YL5A 4G1BA 4FMPA 2ZBGA 2P9ZA 1EZZA 4DDVA 4DUYB 1R12A 4P29A 2EX1A 4E22A 5T7BA 2X1VA 2JLSA 2V4LA 1TK2A 1QV6A 3QWIA 1PL8A 3CTPA 2F8TA 5CH8A 3X43A 2GN4A 3KEQA 3NAZA 3H8SA 4WT7A 4ZKEA 3CS3A 4A8TA 1PNTA 4IEEA 1DJOA 2PLWA 4OK5A 2W71A 1WY5A 1ZK1A 3ASGA 4RLYA 3DBHA 4LMRA 1NQ5A 3AJAA 1AQLA 3E22B 2E85A 5GINE 1Q21A 1F17A 3ICPA 2V45A 2JFPA 3K9BA 4TS9A 3TD6A 2W6MA 2FK8A 1I32A 3EDRA 1PO7A 3RS4A 3UCXA 2Q1XA 2W9XA 1GGHA 3PDIA 4RZXA 1PLLA 5J9FA 4D74A 5C0OE 1ECFA 5EXSA 3IXQA 1XJWA 4U8GA 2R05A 5GPBA 3NH6A 1H0RA 1J0AA 4I3GA 3B13B 3ODGA 3ROQA 1RNLA 2ECPA 5TDHA 4DV3B 4M9ZA 4ZOBA 3F6YA 2CD9A 3HJAA 2IH4A 1BXRA 3ZXPA 1NQOA 1CE8A 4FKBA 3EXHA 2ISSD 3PJFA 4JHJA 3Q5GA 2VPIA 4COOA 2KM4A 2QMZA 4WA7A 4D9IA 1AV7A 3G85A 4XIYA 3BL5A 3G2LA 2OLEA 2CFTA 3HBJA 3KHUA 2PBLA 1UJ2A 4BZPA 4EVQA 3UN1A 5EUCA 3PJRA 4BX9A 3FUDA 2ZYRA 2NMVA 4D92A 2ZYGA 1OV6A 2CYBA 1DJPA 2P2LA 3Q9NC 1M1NB 4W4TA 3VSDA 5JNTA 2EKPA 4EY6A 3TWOA 1A5EA 1QFXA 5DN6A 5LP0A 3ETJA 4I3FA 3ITKA 3GIDA 2JGAA 4RLHA 3VO9A 4XUGB 4ZXFA 2HT6A 1RAHA 5AW8A 2WE7A 3HCEA 4ER6A 1F2DA 2X40A 2AXVA 2FW7A 4BVBA 2X4DA 1UK8A 5BQ5A 7REQB 4L2LA 3CINA 4M55A 2O2SA 1GCIA 5C8VA 4L8GA 5IJ0B 3OLWA 2N1MA 2D1SA 1DMRA 3N0RA 3T41A 1QH1A 5FEUA 4RMNA 3U7GA 2EZ8A 3OCCA 2JATA 4P33A 5IH7A 5T4YA 4UUPA 4N3GA 4DLQA 4US2R 2GHRA 5EQFA 2O6HA 2QB5A 4WGGA 5JLAA 3CLRC 4AG3A 3UF0A 5C52B 4K5CA 2A7XA 1RIFA 1XTPA 2AEMA 4Y9RA 3ZHYA 1Y8MA 4ZYXA 1GFWA 4ZZ3A 4JT2A 5AP9A 5BW8A 1LI5A 2UU9B 3UT5B 2PL3A 3JQAD 5FI3A 4PQRA 1N32B 2FI1A 3NTVA 2RJ3A 3BMQB 1I5EA 4EJSC 3Q7AA 5BT8A 3DULA 1A9SA 1OXBB 3DF7A 3OU6A 5KU7A 1G59A 2IBTA 1HL7A 2NU7B 2F2TA 1KZGB 2G4VA 3FKSA 2FW6A 2QAGC 4FCCA 3IP5A 1TAUA 5KNLA 1JPLA 3LOUA 3NEYA 4I6GA 1ACLA 5CLHA 5A02A 4MQEA 4NDZA 3OXGA 1L7AA 2GJ8A 1DQYA 3WMFA 4MPDA 4G0QA 2QK4A 3BGVA 1G5QA 3JD4A 3T1VA 4ER7A 3SEFA 5JAHA 3IAUA 1M66A 2CMFA 3Q3CA 2C03A 3VNRA 2X0DA 1WXQA 4FE4A 1YGPA 5CW1A 3BUSA 3X0DA 3DFMA 1E3IA 2WWWA 3O8OA 3V42A 2GBGA 2A9FA 1RZ4A 1LVUA 2JKZA 2C84A 3E9EA 2Q3EA 2IE8A 1DIRA 2YWBA 4FOSA 2I6GA 3GPBA 4PSCA 3QOXA 1S0PA 2BH9A 2PM6A 3K72B 3BHIA 1B41A 2CV0A 4CV3A 3CF4A 3V5NA 1DC7A 1HY3A 3SBDA 4TQ9A 2Q45A 2I03A 3G9XA 3I6YA 1YJQA 3D5EA 1GCGA 3H5LA 4HQ0A 4QXMA 2QLTA 1ZN2A 5JO9A 5B6IA 4GTTA 4TZ0A 3F6BX 2RBEA 4AEZC 3LCVB 4Z9AA 1OGYA 3UPDA 1JFRA 4U2CA 3P2MA 5ES3A 1P7WA 1SQFA 2IDMA 4YLGA 1PQPA 3MUFA 1K1BA 3VOAA 2GRMA 1RI3A 1LSJA 1IZ7A 1AN0A 4FCTA 4L6IA 2OV8A 3A1SA 1V7PC 1PGPA 1TB4A 3UJPA 2BEUA 3T9EA 1VSVA 1IBLB 2J0QA 3WBKA 4OAOA 1TE2A 1EUDA 2XB2A 2W2KB 3OIFA 1ZJWA 3C5RA 4DMCA 3ZN3A 2ORWA 2OGSA 5EEGA 3FH5A 4F7DA 3NKFA 1RXSA 3J7TA 5DWVA 3MRXA 3VH2A 3N28A 3FYDA 4OP2A 1Z16A 3X1XA 3Q75A 1TTQB 3A7EA 5DEOA 3TFQA 1YFLA 1XMOB 4YT8A 5B1IA 2FPMA 4NR0A 3N2IA 4URWR 3R5KA 5JLJA 1MFPA 4W99A 2JGIA 1I4TD 1ORHA 1RM4A 1VIYA 3TLXA 3GNTA 4Z9FA 2X0EA 4IKEA 4X6UA 4B6OA 5FULA 3QFCA 3HB7A 3L06A 4DLTA 2BWJA 1Q17A 5JJLA 1CQXA 4MI3A 4BP9A 3EOZA 3PHJA 5ALKA 3WFZA 3FMPB 3ASVA 1D2GA 3ZRHA 1E8ZA 1SKUA 1RT9A 2IZ5A 5IKXA 3OWOA 1N2SA 2AZMA 2FSSA 2JK1A 2VJYA 4TKUA 4AJLA 1SCUA 3VLEA 5CVUA 2Y4NA 2AYXA 2VWGA 1K7SN 4IFEA 2Y68A 2AX3A 4L57A 4XARA 5LIPA 4XWAA 3IUPA 5C51B 1JALA 2YIDA 1DFIA 2P4EA 3LF1A 4CFYA 2JW5A 3C4VA 3I2YX 5G40A 3REGA 2WEKA 1U28A 4XR4A 3FUMA 1OBHA 5EIDA 5J47A 4J6IA 3LGXA 1BS2A 3DE5X 5DNUA 4HH4A 1HE8A 4E6EA 4M49A 1UMBB 1B43A 3S6JA 2OHVA 3Q9LA 1U02A 5JMND 2Z0MA 3HMQA 3UXMA 3AOGA 2W42A 1F51E 3JCKC 2VH2A 4YECA 2CYAA 2K4NA 1DRWA 1H1LA 3VGPA 3DZFA 4CMCA 1UQUA 4P36A 2PSEA 2GTIA 2G09A 2QYUA 3CH7A 2I4TA 5SYMA 4PZEA 3ASUA 3DV0B 5K8LA 2IYFA 2CHWA 1SOVA 3T12A 5HF9A 2XPYA 3VKVA 2C7VA 4RXTA 1YNOA 3TFWA 2PPVA 4ME6A 1QC5B 3HB1A 1FS4A 3NHBA 3WQBA 4XDGA 3REFA 3K0FB 3VR0A 4EY5A 4B3IA 4G67A 5AI0A 5FT9A 3D6FA 1WEKA 3AJEA 4EO4A 3HXLA 4EDFA 4X7BA 1BFUA 3RVMA 2NSHA 4DT1A 2OKCA 3C72A 1QDLB 3OTWA 1EE2A 2ZRFA 5EIFA 1ML3A 3BEEA 2O3TA 4GTVA 2VRNA 4XPZA 3UPUA 2C4WA 3ZDFA 3A4LA 3GZNA 4YR9A 1VOTA 3W5HA 1JZTA 4I1SA 5K0EA 4JP2A 1A95A 1L8OA 3KTAB 3G7NA 4LTDA 1OXSC 3JRWA 3C15C 2FDRA 4FTWA 5LLTA 4ZC8A 1EGQA 1RWVA 3AUXA 1B00A 3KJHA 4CLRB 1DL5A 4Q34A 4M7CA 4X62B 3HGTA 1R16A 4KJZA 1KE2A 1A5SB 3WA6A 4YIKA 2Q6LA 1GG9A 3GEGA 2XW6A 3QWVA 4RQTA 4YRCA 3T95A 4ID9A 4IZIA 2QN9A 3D4PA 3ZWVA 2GN1A 4XM2A 3MBOA 3WHKA 4H2DA 1F4PA 3B9RA 1IY9A 1S89A 2IEYA 5IANA 4DA8A 3AMVA 3ZZ0A 3HB0A 1PIWA 4TTPA 4UXIA 3CF0A 2XTMA 2VDJA 4XDZA 1A9PA 2KSQA 4FW8A 1QHXA 4F1PA 3A06A 3L5OA 1PZNA 1XUOA 1DELA 2H1IA 3CLHA 4L9RA 4URHA 4C01A 5SY6A 2R59A 2P4SA 3BBLA 2JZOA 2GHIA 5I3ZA 2OTCA 2OCBA 2GETA 4G8BA 2GVNA 3KR0A 2VS1A 1XMPA 1AQNA 3M6AA 1TJNA 1E6LA 3JAKB 5B3SE 1SG0A 3JASA 3F4KA 4XFKA 5K0LA 2ZB2A 1EP1B 3MMSA 3OPMA 1WULS 2R1TB 3VMFA 2R60A 1W1UA 3EAGA 5HXAA 5H82A 4YEDA 1QE5A 4G0MA 4DAOA 3FHCB 4YAJA 2BLNA 4WGFA 1NWHA 3STXA 1L7QA 3UA3A 4FI3C 1Q57A 5I7AA 1W2HA 3N8GA 1B2RA 2BJWA 2J5RA 2W4QA 4OJYA 4UU7A 2V1XA 2QRQA 3TAHA 4W5HA 1GN8A 4L8VA 1X7XA 3H4MA 2IYNA 2QR5A 3TFOA 4C4OA 2CLFB 5EE1A 4DGQA 2N9UA 3TNDA 2V74B 3DUWA 3MUEA 2WW8A 1U5BA 1I2MA 4AY6A 3K70D 4FJ2A 4D6YA 1PQYA 3DQQA 1ZD3A 3MK31 2OMEA 2RONA 1NQTA 7AT1A 2I67A 5HNKA 3UK1A 2C2WA 1YUMA 4Q4JB 1JZQA 5DK6A 1H6PA 2QRUA 1Z33A 4HEJA 1J09A 1I3CA 3RRMA 4YRSA 5C5DA 2PO7A 4EX7A 4CM5A 4CLDA 3WRXC 1PR5A 3G7SA 1SBHA 4RXMA 5EJFA 1LJ8A 5AK0A 4BASA 3R5HA 4LWOA 2H5IA 5E6SA 1GGEA 3ZLJA 3OQOA 2HRDA 4F2GA 4LHVA 1QANA 3R0XA 4L9SA 4MW9A 5JHBA 1KEVA 1H9CA 2R87A 1V1RB 1W36C 4FGKA 3CVLA 3VC1A 1GUFA 2O23A 1KP9A 4J3FA 5IC5A 2O20A 6ABPA 1GPKA 3DCYA 2JAOA 1B15A 1D9ZA 4HGQA 2HIGA 2IE0A 4YQEA 1UJ5A 1BMTA 3ESKA 1EQ2A 2EX4A 3IAAA 5HQ3B 3ZNNA 2XNKA 4GI2A 5LUBA 2P3SA 3A8TA 1Z5UA 2J49A 5TC4A 3NATA 4UTNA 1X7WA 1OZ0A 4GA1A 2BFMA 4GKBA 2ADFA 2RHDA 4GZ5A 2NLOA 5ALZA 1YCHA 2PQ6A 2QUAA 3HNOA 3TO5A 4AYWA 3AUSA 1Y9AA 4BUCA 3QA9A 4BYGA 2VPQA 3L7AA 4G65A 4NEQA 3MB5A 1D2RA 3TL2A 5IVPA 3DMFA 2PGAA 2O8EA 4TL6A 3IV0A 2H4YA 2E89A 1CUIA 5GWXA 1X86B 2XE4A 5AK5A 4LDRA 5DIFA 4HVLA 4Q4CA 4Q5IA 1N78A 2I1KA 3IAEA 3Q5EA 3CWZA 2BMJA 1UOOA 2HMWA 1FK8A 5ELXA 4LRUA 3OZTA 2UZ0A 4PWZA 4D8VA 4J3JA 1J70A 1X7ZB 4K28A 1LV8A 4NENA 4K6KA 3W6OA 3TEFA 1K0UA 3ZOKA 4I4LA 3C24A 4Q39A 3T7AA 4PF1A 1U7WA 4GXQA 3P0IA 2PX8A 2XWSA 4NNJA 2IELA 5LX8A 2Q5CA 3FTZA 3HP7A 1PFYA 3L7NA 3KSDO 1H2VC 3ZDCA 2JLCA 1KDOA 3J5QB 1XMXA 1AMOA 4IV0A 2WIJA 5E6RB 4E15A 3P52A 2CJYA 4PIVA 4FBLA 3NEAA 3L7CA 1D0SA 2XVYA 4A0GA 1TN7A 3VC7A 3ENEA 4U7JA 2AA3A 1TEZA 1Z5OA 1J9GA 3PVSA 4UDNA 2IBSA 2Y4TA 3AB7A 1DQRA 1AHIA 3QPAA 4BX2A 3KT8A 3F6SA 3F67A 1IY8A 4TTVA 1XPOA 4R40A 1JFTA 3DZBA 2BD0A 3O4ZA 5KQMA 4MGYR 1OCZE 3NBQA 1ZMOA 4IIJB 4BEVA 4EUSA 2JLBA 4IX1A 1A71A 4O08A 1SA0B 2JVKA 4JJIA 1G8HA 3K6JA 5FX2A 3V1TC 3IXEA 3N6RA 2ATXA 3LQ4A 4NI5A 1PCXA 2GBLA 2R4TA 1F8FA 4GZMA 1QGZA 3EIJA 5FB3A 1XNJA 5IEBA 3SMVA 2EQ5A 4UVHA 2PUVA 4ABYA 5T67A 3TGLA 1B2LA 1OAKA 3N2KA 3QBJA 1I7QB 1BDIA 5GP1A 2OBYA 2ZB3A 3CXRA 2DGDA 1IEQA 1T26A 4LSMA 3ZWWA 4RWZA 1ESNA 4QJBA 5FV4A 4F93B 3OX4A 3JATB 4XRGA 1HDYA 4X1KA 2HU7A 1WG0A 3ZIDA 1BMFD 1XYYA 4WKPA 2H29A 1DDIA 1FRQA 4M1TA 4CMJA 3URZA 3W90A 2WM8A 2E5FA 2HYDA 1NMQA 3Q40A 1Z36A 4K2HA 1E6UA 4XB2A 5LQSA 2FUEA 4GP9A 5FIOA 2HEIA 3WK9A 1D4AA 4YCAA 2ZUEA 1GLGA 4H4EA 4H0FA 2O8FA 5COQA 3IRUA 1Q14A 1PK7A 3Q8XB 2Q1UA 1A9OA 4L76A 3FUNA 4GTOA 3GG2A 2VJMB 1A2OA 1KZ1A 1Z07A 2H2DA 4KIFA 1NUPA 1AD2A 2P5SA 2VQ6A 2IP2A 5M72A 1KMIY 3FCXA 1Z08A 1NJSA 2VJ8A 4WN3A 2C9YA 1R64A 2V9PA 2WXPA 1JIKA 2WSSD 4LF7B 2F7SA 5GONA 3MEQA 4B3RB 4K2AA 3VVMA 3VVLA 1TTHA 2R17C 1KERA 2J9RA 1ZNYA 3TXXA 1TAGA 1WUYA 1NI3A 3LBYA 2VXOA 3HPRA 1GP2A 4ZAXA 5DHFA 5AWFC 1KEKA 2OCLA 3ZU7B 1JEJA 1OFGA 5H5JA 2P30A 4JJ4A 5F5XA 2ROQA 4B8AA 1TD1A 1NR7A 1OKKD 4C04A 2C20A 4WOPA 1WAMA 4NCHA 2J3JA 1GRVA 4GEGA 5EX3A 1JG7A 2IBMA 2O7RA 1YHNA 2XMQA 4PYQA 1QZZA 3MEKA 3CVJA 4YUXA 4E1AA 3IMGA 1K8YB 1ZNXA 1N7GA 3ISJA 4DSUA 3V4OA 2HO1A 3C97A 1VJRA 5F77A 3GUYA 4X6XA 2ZYIA 4A2QA 4BNXA 1I1HA 1W4ZA 4FIDA 4GZ6A 3RVRA 3V2GA 3LHSA 5J08A 4N40A 4HOYA 2WJVA 4F8EA 1YC2A 4MA5A 1WABA 4WW0A 3FN4A 4D9MA 5EYPF 4I1RA 2Q21A 4MQ4A 5DYIA 3Q15C 2WTEA 2CHGA 1TLFA 5ALPA 3TOVA 4ZZIA 3PG5A 3UIEA 2WWVD 3WB1A 2I91A 2WTMA 1ZBDA 3FOWA 5CT8A 4RQBA 4C88A 3R40A 3DMNA 1OYYA 4ZT3A 2Y4UA 1SBQA 4BESA 1VIMA 3JQ1A 2VP5A 5CT5A 1W30A 4OLHA 1Z8DA 3I3OA 2QTCA 3O3MB 5D3ZA 1SJ9A 5ARCA 2ZR8A 2ZS7A 2JLQA 4FGSA 1WHSA 1MR3F 1YQQA 4BQSA 3IQDB 4OSEA 5D0QD 2GILA 1XEWY 1Z4OA 3U60B 3W5IA 3IP3A 4FHKA 2OBLA 1E3QA 4JOSA 2DHQA 4DIUA 4YUYA 4UASA 4ZT7A 2JCGA 1U7HA 4KYIB 3VUFA 1PSZA 3FZGA 1EXVA 1RWXA 2AXZA 1G2PA 2IOQA 1KMQA 1HE4A 5YASA 5TPZD 3FLEA 4K86A 5FA5A 4N1AA 1A8QA 2BZGA 1VLMA 3IYLW 1V43A 1ENYA 4R83A 2VJKA 1XSEA 3E2MA 3QBDA 1SU8A 2QRVB 4AJPA 2GPAA 3K92A 1V9CA 5KWJA 3AM5A 3QPUA 3AL0C 4FYKA 2J3QA 3LKZA 3U49A 4YQZA 3MAAC 1IONA 2XCQA 3I9KA 3DXMG 1V48A 3R24A 3FVRA 1FUUA 3KIPA 5ILGA 2V0CA 4DHWA 3GLKA 4GDFA 3C3YA 2VWHA 1U31A 2HOQA 4NJMA 1R5OA 1V8DA 4F5DA 5EAIA 1Z5GA 1BW9A 3BAZA 3G2MA 1R6BX 4QUJA 3PT5A 3ESCA 3KJXA 5L4SA 4WE3A 1RXCA 2X6TA 4HB4A 4LDPA 4F72A 2LCIA 2X42A 2QV0A 4DLUA 2HF7A 3RK6A 3EVBA 4YRNA 1X38A 2W22A 3CHMA 1OU4A 3K0AA 5JS7A 2WM3A 3B78A 4LJYA 4C0LA 3DE0X 2GZMA 4QTUB 5KX5B 5AJHA 1K97A 4HRLA 1SHUX 4I55A 4F84A 2DPGA 3LYHA 3K5HA 1ML4A 2XTAA 4IDFA 3C3RA 2ZVDA 3QEKA 1RMYA 1K66A 1E9AA 3WGMA 2PXCA 1UBHS 2FK7A 3HABA 4PRKA 2X0JA 3RSHA 3CEMA 5FPQA 5CIQA 2WNSA 5BNFA 3EF3A 4JHKA 1U94A 3ZWQA 5J4KA 3O8LA 1QH8B 1T6NA 1T5SA 1XQYA 4QPZA 2WTBA 2AC2A 3CE9A 4FR0A 2ABWA 3SYNA 2YFYA 5JHGB 3SZLA 1K7XB 4BFSA 3ASYA 4RDCA 2R0QC 1QK3A 4PRLA 3B8HA 1U7XA 1C4KA 4TMFA 2M32A 1KO5A 3HK2A 3CFYA 4GX0A 4R2MA 2OWEA 3RGGA 3ELBA 1D4FA 3ZHCA 4Q1EA 2A1TR 4B74A 5DBIA 2PUBA 4H7YA 3UT7A 4JNKA 2G1JA 3FTNA 2EFYA 2NZJA 5DGXA 4KWEA 3QU7A 4XPIB 3SIPA 1TW3A 2WJPA 4D3ZA 4ABTA 3SDSA 3BSYA 1HQDA 1X8LA 1FB5A 4N41A 1IBCA 5LMZA 1JG3A 2J3KA 3D4NA 4KQ1A 5IY5E 4EUNA 2KBFA 1AS0A 4PICA 1D7AA 3A37A 3UNXA 2AH5A 4BJ6A 1ZSVA 4BSXA 5IJZA 1PFVA 4WK6A 1N2CE 5DO9A 3WLQA 1M33A 2A2ZA 5LOZA 4MR9A 3GLVA 3I30X 2OFPA 4Y6RA 1KSGA 4G8LA 3M5CA 4HDCA 1FSFA 3X1DA 1I7SB 2W11A 1COWA 3GN1A 4GMGA 2F3RA 1Y9ZA 3LBNA 2PHZA 4GS5A 3WJ7A 1KH2A 4UMFA 1Z75A 2GD6A 2OZLB 2QN1A 1CIVA 2Y2VA 1U0JA 3U4HA 3COZA 1UP7A 2XCUA 4HUJA 1RWPA 3F49S 3FYUB 1P7PA 1S9HA 5ILQA 1P2FA 2O8DB 2OPBA 3LC1O 4HOSA 4RJKA 3FCYA 1C8BA 4TXPA 3AU8A 3RTBA 2P11A 3UK0A 3CNNA 4WY2A 1P0MA 1GQYA 1ODFA 3R3WA 2VLBA 1DKNA 2LXMA 1D9XA 1PAQA 3GZ2A 4JQYA 1OD6A 4Y0AA 1Y1SA 3WGIA 4O2AA 4F06A 1FPMA 1T4MA 5IUJC 4IIEA 2Y27A 3SE0A 2OAP1 4FI3F 1ABBA 1XWWA 5CLQA 2J3EA 4Q3OA 4I7EA 1UPXA 1SGWA 5AI6A 2FP4B 3T9KA 3VR2A 1AU9A 2QC9A 4MAAA 3IV7A 3E35A 1RKBA 1DQPA 3AIKA 3OQJA 2J32A 2HBYA 4D0RA 2PH1A 2O2IA 3MTJA 3S2SA 5LOVA 1JKXA 2NV0A 4O6FA 1H0HA 4JSYA 4TTSA 3DSWA 2QGZA 3R0IA 4KQIA 4Q3CA 3EIQC 4DTCA 2PUAA 2GRJA 3MJFA 4GXRA 3A9RA 2O2XA 3ETLA 3ICWA 2A8YA 1HQKA 5KNBA 5SYNA 2R751 5ALLA 3H6GA 4ZAVA 2NV2B 2VK2A 3LUDA 5LYJF 2WE8A 1HBJA 2XGMA 1D2EA 4XVQA 4ML3A 3W5DA 3WSWA 3KLMX 2Y93A 2YIVX 3K3PA 2IPNA 3GAAA 1DPFA 2VHUA 3INNA 1O5TA 1G38A 1J7KA 1WZNA 4Q9IA 3D8RA 4UAVA 1E3DA 2GSWA 2DOKA 3JQDA 1N57A 4C5AA 3OLZA 1Z38A 2XKAA 4TM7A 3L4BA 1G2IA 3U19A 2AOWA 1S2LA 1V5EA 2FPIB 1LW7A 1SXJD 1T3ZA 4DMLA 1YOVA 4CLEA 1SQSA 4Q6BA 5BOSB 1N11A 4EG0A 4RTMA 2H2FA 2AUNA 5C5EA 3CONA 1L4UA 3DS8A 5J4VA 1MV8A 1O08A 1EX1A 3PC8C 3JWEA 3OT5A 4XEUA 3U0BA 4J07A 2IYEA 2QUBA 5EIHA 4HDKB 2DPMA 4XWTA 4JELA 3KWMA 3QPDA 4JT9A 1IM5A 1OPXA 3GD5A 2FZLA 1V6CA 1NVKA 1RXWA 5C5IA 2EJCA 1I6WA 3NYQA 5EOVA 1J5PA 1S2IA 1GZDA 1ILEA 1U4SA 1K6EA 3GPCA 1TZMA 5L7YA 4GBGA 4Q05A 3WLIA 2CFUA 4XR9A 5EVCA 2CBGA 1XJ0A 3PGLA 2IOSA 3WIBA 1C3OB 4HVAA 1LS1A 1OH8A 5T8KA 1UBEA 1W4BA 3WYDA 1R4ZA 1Y4SA 1DXYA 4AJKA 1Z2EA 2NVWA 3YASA 5LC1A 3CHQA 3UJDA 1ID8A 3NFRA 3DTVD 4A6EA 4MKGA 4X3CA 2QTHA 3CX4A 4KAAA 4JB2A 4PFKA 1D8EA 3OHMA 4IICA 2H8KA 3OUTA 4YP7A 5EFZA 2FMXA 4ABNA 2ZJ1A 3EOAI 1GGNA 4DA4A 2NP7A 1KI3A 1WPRA 1Y81A 2GRNB 3GQVA 5F64A 4X61A 2RH8A 4BVEA 2OO3A 4J0IA 3ABKE 5BXUA 1GN9A 3OCUA 1GQSA 1R4MB 2D2VA 2GD0A 2ZCJA 3ASOE 1H8ED 4WZBB 4EKNB 1SCQA 1CF9A 4WL0A 3M6WA 4HUTA 1J22A 2ES4A 2PS3A 4XLZA 4C43A 3CC8A 2GZSA 5CLLA 2F3QA 2UYQA 2YJ6A 1H23A 4C7JA 5HZMA 3JTMA 4LC1A 2XDYA 2KQUA 2YS7A 3CA8A 1FRZA 4QEDA 2EF1A 2A9VA 2JCBA 5EIAA 3OG9A 1G8GA 1JMKC 4AWAA 1XLTA 1P80A 4Z1MD 3HKEB 3TAXA 1U3WA 1RVDA 3CG4A 4IVNA 2CNWD 1WHTA 2CHFA 3CZMA 2IXAA 3DV2A 1U6IA 2BKGA 3SSNA 2OORA 4CEJB 3T5DA 5FDFA 1UMCA 2WM9B 1SKAA 5HJ5A 5JDIA 1N2CA 1HGXA 1UBNA 5AI5A 2OAEA 4G9EA 2FWRA 4JJAA 4HAOA 3PTLA 4WLNA 1JSCA 3WMRA 4DCCA 1NYTA 3RV3A 3LLSA 5BR8B 2HA6A 3E9ZA 4DNXA 2NPFA 4DMKA 1J2RA 2C3YA 1KO8A 3HJTA 5BR1A 3GHHA 3VKUA 4WBNA 4EFMA 2KZTA 3EGIA 3FB1A 4F45A 5AJWA 4X9XA 4DE5A 2PFSA 3V6MA 3SBTB 5L7TA 3IMEA 3LG2A 4W9RA 4YIHA 2QD3A 3PCTA 1LPPA 2QRJA 4MLDA 1DBPA 2X6FA 5HUHA 3ZEIA 5B3JC 2R97A 3VPSA 2P67A 2VHYA 3D0RA 4I50F 1R4NB 3M5WA 5KB3A 3CRNA 3BSWA 4C21A 1E59A 3EVDA 1DKOA 2JNWA 3U7IA 4I1IA 3NJ4A 1E8XA 4A1GA 3FPLA 1ORVA 4EENA 3FNHA 1TTPB 4X1IA 4RJLA 2F8YA 3FI9A 5HDBB 1N3YA 4KN8A 4QQNA 3ZE8A 1Z82A 2QD4A 3SLKA 2CDAA 2X13A 1XA4A 2CHEA 2WIFA 4ER3A 5HJ7A 3MJ4A 2A3RA 1ZQ1A 1WDMA 2D5AA 2JGKA 5I4CA 2HBQA 2HQRA 3SIWA 3HHMA 1O96A 1TM4E 4GB9A 1KGSA 1E7WA 2FMTA 2PTGA 1E8MA 1E0KA 2BC9A 1EESA 4JT8A 1NXVA 5ENZA 3SVZA 1D6MA 1TAQA 3NZEA 1REQA 1K2WA 5ENTD 3Q3EA 1PS8A 4JI0B 1KYXA 3DOFA 5H80A 3WXXA 3M6VA 4W5NA 4J0UA 2QR2A 4ARZB 3LLMA 4RK1A 2GJ9A 4EQFA 1N9GA 4KR9A 1TU4A 5D6NA 4HJRA 2QUJA 1XJCA 3FTDA 4OKSA 2XXAB 4V3CA 3FOFC 1I1NA 3OLXA 1ZR4A 1QDEA 1F4LA 3KSQA 3VUEA 3JXEA 1NC1A 3UWOA 3AF3A 4D4KA 2IUTA 3ONVA 5C31A 1V41E 1E89A 3B38A 1XCPA 4QHSA 1UFVA 5EHNA 4DXHA 4TLBA 4YNDA 3RUIA 4RKWA 2R5WA 5JC1A 3NOOA 1NW4A 3F78A 3V7WA 4E11A 2J7KA 1UAAA 4I46A 1JJFA 3HUDA 3OFJA 2XYPA 4DREA 4MMZB 4BTAA 1DIHA 3S2EA 3PRHA 3PPYA 1SVNA 4ZO8A 5AKLA 1M6YA 3MTDA 3FMGA 5C37A 2YN4A 5CBPB 2ETAA 2VAMA 1WP4A 2N1BA 4ZV4A 2UKDA 3QU4A 2ODAA 4WTOA 2KLBA 1Z2NX 2REOA 1EVEA 3N7UA 4RVGA 2RGDA 3QYFA 1K3TA 3BULA 5JALA 1VDMA 4U96D 3ZNPA 3OT1B 4RDXA 1T6ZA 1Q0QA 5EKUA 2VTDA 4GQAA 3QJYA 4Q3KA 4L8YA 4KDRA 3TDMA 4OFWA 4U7GA 3AEKA 3TIFA 5MN4A 3OZGA 2IO2C 1AGNA 2P6PA 4WNAB 1YJCA 3AEUB 1JG2A 2HA3A 2YV2A 4PHHA 1CUUA 3P45A 1L5OA 1GL6A 2TMKA 2VSOE 4WCFA 1YRLA 3BYZA 3NVDA 4F60A 4ZJPA 2HMVA 2WD9A 4LZZA 5GOTA 4BZQA 4RX1A 3MGKA 4KLAA 4Y1RA 1UJNA 1RAAA 3NHRA 1DKRA 2P2NA 2PKRA 1MV5A 3UJ6A 4CRWA 1I6KA 2P69A 2I62A 3VJRA 4WCDA 3THXA 4FPXA 4IRMA 4MI6A 3RU0A 2VUTA 4B44A 2DX7A 1OXTA 3W2TA 3GLHE 3B1XA 4DX7D 2XKBA 4CMEA 2L2QA 4GR9A 2O5EA 5LCWC 1R0WA 2MU1A 3ZCTA 4CZ2D 1AJEA 1USUA 3ZW3A 3PPWA 2VT7A 1E8OB 4U7PB 3QITA 1V47A 1XHEA 1E8DA 5GJVC 1OI3A 1VG1A 1GZ7A 1O94D 1EX6A 5K0NA 5LA6A 1ZRMA 2ZIAA 2JJMA 4CDGA 2R00C 4NAUA 5EZ5A 2ZRGA 3TRIA 4MK4A 1UXIA 1EXDA 1C7RA 3UUXA 5F7XA 1P9LA 5F5LA 4Q6WA 3COJA 4NYJQ 3EPHA 5I9LA 2G08A 3U09A 3O0TA 1HKUA 4V0SA 3SF0A 1YE8A 2EGUA 2WXJA 1PDWA 2IOFA 4OXXA 2FX3A 4JH0A 1UMDA 4RCZA 1Y5LA 4R3UC 1UOHA 3KM0A 2Z1NA 5IJAA 3QU2A 1G8KA 1M6EX 3BJIC 2PUHA 1T5BA 3OIWA 3W5UA 5FBKA 5KC9A 4FFNA 5DNYB 2G9ZA 1DEAA 4ZP1A 1DKMA 1P1JA 1OBOA 2QJOA 2YXLA 4F9GA 2A4ZA 1XTJA 4WFJA 4P3OA 2VKTA 3L4JA 3TIXB 3RRNB 1ZCJA 3THWB 2C3MA 3DQZA 4G97A 1ISRA 1HDEA 4RK5A 1CUEA 4Z3OA 4BN0A 1NFQA 4HOUA 4UNRA 5FQ4A 1H9AA 1KO4A 4QLBA 4GI5A 5KKNB 5TQ0A 5I7UA 2X8JA 4YV1A 3RWBA 3LDUA 1G6HA 1EFRA 2AZ4A 5LR6A 2A5FA 3AV3A 4N18A 3RU7A 4URYR 3UUGA 2WRZA 3BWXA 4EHLA 3U4GA 3UMRA 4F4JA 4ASUD 4AV7A 3M4XA 5F78A 4F9TA 4MUIA 3UINC 4FHEA 3L08A 3ETNA 5SZHB 1VP9A 3BRWA 4L2YA 2NXPA 5T4BA 2PGOA 2O0LA 4NAVA 1DIGA 2QTNA 2Z57A 1DEOA 3OURA 3AO0B 1YS2X 1V7QA 5KNDA 3KRTA 3RU3A 3CSTA 3ZHSA 2WYIA 1H3EA 4L3WA 1T5IA 3FXAA 1X5BA 3I42A 1DX6A 3ZPXA 3ZX4A 5EWLB 3SHFA 1L3IA 2G6BA 4KXMA 4ZU1X 3PF8A 1D09A 2DQ4A 1GRNA 2E7ZA 4AUMA 1X1EA 2W5UA 5E4TA 1G0OA 3NZUA 3EEQA 3FPAA 3AR5A 3EXAA 3D3QA 2IHBA 1LC0A 2FWAA 5EGNA 1JMVA 3RSGA 3OEWA 2IU6A 3TUZC 4G1VA 5BVGB 5G02A 4BT8A 2CSUA 4N7BA 4QUAA 4Q9DA 1GTZA 3OCYA 3QBTA 3AFHA 1SC6A 4TT3D 3QEMB 4OB8A 1FJXA 2D1FA 3DLCA 1IOLA 3R8FA 1PG2A 3E3NA 4KWHA 4BIIA 4CJXA 2R03A 1J5EB 1MAHA 1S0UA 2EL7A 4N8DA 4F6RB 5BN3B 1CBUA 3HU1A 4FGLA 4HC4A 3H5OA 3ZE9A 4DLLA 1E5LA 1H6AA 1JUDA 4KQXA 1ZISA 5J2TA 2Q9BA 5AM1A 4GR5A 1BFDA 4OHKA 2FI7A 4RG6A 5CVEA 2BI7A 5FUXA 4U8HA 3TZBA 1SXHA 1A4IA 2XNDA 2E48A 3SKXA 1KZ7B 1TM2A 1XPUA 4NBRA 3RO2A 3TSZA 1L1FA 3N2ZB 4I36A 1E3JA 3QYAA 5CX4A 4WJKB 1WDTA 2YV5A 1E96A 2I2WA 1ISPA 3CF6R 2HHHB 3WS7A 1LEHA 5KYXB 3IAM1 3C6XA 2XQGA 1LLUA 4PG7A 4PXSA 1PJZA 4I2NA 4FOLA 3C1TA 5L3SB 4EJSB 2IUFA 3LY8A 5EZ6B 1IEVA 1SCJA 4YRRA 3KOXA 3W5CA 2EFJA 1W4CA 3ZLVA 4J9VA 3HKDB 5HRCA 5DOVA 2G36A 2O57A 1VXRA 3LP6A 3ESDA 4ATNA 1KEPA 1EB8A 3OZDA 4QPNA 1TF5A 2QAGB 3R9MA 1EEHA 3WWCA 1R9MA 2VSOA 5KHLB 5IHPA 1K63A 5CXSA 4PO8A 5IN5A 2PJDA 4MUEA 5D84A 2FPGA 4KPGA 1ZD9A 2DUUA 3MWYW 3P9YA 2V6MA 5DTMA 1OHHA 4Z3DA 4DIDA 2DB3A 2WPNA 4NCKA 5HUQA 1GZVA 3B20A 4YRPA 1L7MA 5AW3A 1PR4A 2ZRMA 1TEXA 2GPJA 2B35A 4PEVA 4IIBA 4ZI2A 3GLHA 5THKA 1E6KA 3NYWA 3GA5A 2FPLA 4PLTA 1X9HA 2KATA 4R51A 5CCBA 3OJOA 3M5DA 1N6RA 1M67A 2IU4A 1EFPB 1B8UA 2XITA 3ZWKA 4ZQHA 1VKZA 4LYYA 1FMTA 4TMYA 2EGGA 5K8CA 4EBFA 3D0KA 2ZBUA 3L6CA 1E0JA 1HNZB 3QI2A 1TC2A 4M1WA 3B89A 1WB9A 2PZGA 3B53X 3DZIA 1NDHA 4LTNA 3AW9A 4XEIG 3CX7A 3IJPA 1NN1A 3P9XA 4HRXA 3UKUG 4BXOB 4GPTA 3AWIA 4IWNA 4W82A 4JBGA 1NHWA 3IXMA 5KTTA 1T2FA 3ZQKA 3B95A 3TCKA 1E2GA 1VZ2A 2LKCA 3NOXA 1J24A 1WDKA 2XZTA 2GPTA 2ATVA 5DNWA 3U4IA 2V96A 4Q12A 4EW1A 4MUKA 2GKSA 3N0TA 4MR7B 5F2EA 2R6R1 1FLDA 4M6WB 1IATA 3PD1A 1C50A 3ICCA 3PRJA 2XS8A 4CMIA 4K5BA 4Z68A 3I61A 4DJEC 1D1TA 1NXOA 2FETA 3ECSA 1N92A 2NTNA 1QHEA 1NRIA 2R44A 4P2BA 3EF1A 4ZQBA 4D6PA 1HE1C 2QW0X 1NM5A 1NY5A 3ABME 1ZY2A 4CKCA 3EEYA 1ULSA 1GGJA 4GPEA 2AVDA 2B37A 3MKQB 3SN6A 4Z0NA 4HQFA 4UMVA 5F5NA 2V0GA 3DHVA 3GJZA 4BB6A 3I58A 1O54A 3FM9A 3ZBTA 1WE2A 1A7AA 1RQ7A 4KDFA 2YHIA 4WBSA 2FW9A 1Z47A 2YYYA 3F4LA 3VJMA 1KAOA 2RGWA 2DETA 3GU3A 1GUAA 1SIBE 1LK5A 1VGVA 2VNAA 4Z1OA 2FO1E 5JECA 1JYFA 4URXR 3T54A 2CC2A 5C80A 2RHWA 3IQIX 1U11A 1XTSA 4OK3A 3FUIA 4X91A 3T1TA 3G2KA 5EE9A 2ZT5A 4HAIA 3AB8A 2DH6A 1M0TA 1X1SA 1E66A 4PLYA 1PW7A 1GY8A 3KQNA 3G82C 2V55B 3ZU3A 1OGIA 3QG1A 4NFHA 1UXOA 1NVAA 3RK0A 2DECA 2I6SA 4ENRA 4M60A 5F1KA 1DRJA 3W79A 1U3FA 4AIFA 1SUAA 4KSYA 5JXIA 4BJ5A 1UW4B 2ACKA 2QRNA 1TZCA 4IIVA 4K05A 4BWRA 1IMJA 4UTRA 1BJRE 1ZNQO 4CI0B 3C3MA 3DVSX 4X7PA 4CL3A 3D8BA 2QX6A 1R50A 4A8JA 5JWRA 3ROGA 2IITA 3IVCA 1N4AA 3ZQUA 5A9SB 2NUPB 4X85A 1IUPA 4LJSA 2XR1A 1MABA 2BBSA 1P4RA 1IXVA 3VU9A 3TIVA 3TPCA 5IPFA 2VHTA 1P7VA 2H8GA 1ECGA 4M7WA 3LUJA 4XW2A 1TJFA 1SPXA 3VDMA 1R15A 1G98A 3HCRA 3TSYA 1BHQ1 1P77A 3NONA 3N8DA 1P1FA 4EF5A 1EFLA 2GB4A 3ONKA 2D3TA 3L0BA 5E3IA 4M98A 4NU8X 1SQMA 2I22A 3SC4A 3EARA 3OTHA 1GCOA 3AVVA 3TMYA 2H63A 5FWAA 2VXBA 1XALA 4FJYA 4LXTA 3G0OA 2G1PA 3DDCA 3D31A 3HXQA 4Q47A 1UC8A 4MUGA 1T6BY 2QX9A 3L5KA 3ESXA 2Q2VA 1C7JA 5IAEA 2YMQA 1X2EA 2DPXA 3ZWOA 3LZDA 3MJRA 1DC2A 1WXXA 4UJ5A 4DNQA 7YASA 2TMDA 5AXCA 4D8TA 4ZYYA 2JJ8A 3CK8A 4IM7A 1LDBA 1ZVMA 4NBNA 2EZ4A 4X24A 2QLNA 4TWBA 3KXKA 4XJTA 1E7MA 4J03A 1C4OA 1TF7A 3FLBA 3ROFA 3BQMB 3DQPA 5GMOA 1GZ4A 1YZTA 5A71A 3JUEA 4N5IX 4FU3A 5KWVA 1PBTA 3TLKA 1UDCA 5TQ2A 4U2DA 5T41A 4EVIA 3HVEA 4ALIA 1QFMA 4GO1A 3SNXA 2X1HA 4TXQA 4E31A 3KSMA 4B2LA 1AO0A 1Z3IX 4Z53A 2O19A 1W5TA 5IFLA 1DWQA 2H0QA 2F1JA 3JVIA 1B0UA 5BNWA 4O5OA 4URZR 1NU8A 3RYCA 4NNOA 4CETA 1MAWA 2OK7A 3E05A 3KKEA 3ZGQA 2FUG1 2J7PD 4XUEA 4AS3A 1KKUA 3VSCA 1RI1A 3E7FA 1UKCA 4S1OA 2PLNA 4U8VD 4MV6A 1S70B 2I1JA 3RUCA 3H6HA 1W5AA 4JA7A 3LIIA 5JO0A 3TZLA 3T5GA 4FWBA 2JAHA 3R1IA 2X7XA 1AUXA 2VYIA 1QVWA 3UAYA 2HREA 5FHQA 3Q8MA 1KAEA 3D7SA 1G55A 5EJAA 4MUMA 4FU0A 3ZI7A 4PNEA 4DI3A 2LSVA 4IHJA 4FX5A 1AHHA 2GHQA 5B1SA 1X3SA 3E7PA 5IW8A 2ZG6A 4PYMA 5IULC 3H05A 2ZKIA 2C83A 4GX5A 4CM8B 1C3XA 3KKMA 1QAOA 3KG2A 1WSWA 3KZNA 3EZLA 4HRYA 1IAQA 3CKLA 3T4EA 4GICA 4GL4A 1OY1A 4MEJA 4BVFA 2JS7A 4GNKA 3DUFB 1P0IA 2B8WA 1QP4A 4BBAA 7ADHA 5G2NA 4IUDS 2EDAA 3DOEA 3A6KA 4KXQA 3O3OB 1LY1A 3M83A 3QXXA 1SVSA 4ZYWA 4D43A 4DC9A 1BU9A 3RO3A 2QXUA 4ZOCA 2QX4A 3AVUA 1QTNA 5AESA 5CPFA 2V65A 2VF4X 3CPSA 1K89A 4F2PA 1RJDA 3OPNA 4UJ3A 3Q79A 4RENA 2EP8A 4ID3A 1BH2A 3LUCA 1EDDA 1PHPA 4HX9A 2ZXFA 3KE8A 4NWIA 4G11A 2V7VA 4KCGA 2GNAA 4EWLA 1QHYA 3N8NA 1Q7BA 1O8CA 1MC5A 2J87A 3MTGA 4GMKA 2IYQA 4L4RA 2ZRNA 5MF6A 2PVCA 3SPXA 1KORA 4IAOA 5DN9A 3DOJA 4WLVA 1W36B 3HDVA 2PV0A 2W2QA 5ALQA 1KFKB 2GNPA 3HNPA 4M9SA 3M1YA 4RVFA 2VHZA 3ZN2A 3HHEA 1TU3A 3O8QB 1ZM4A 2PWYA 4PYIA 1NVWQ 5I8WA 1TU0A 4XIGS 3O91A 2CDNA 5GZ3A 2YMPA 5DNDA 3C2QA 4QGSA 1Z3YA 4KTTE 2B34A 4MUJA 4TUYA 3B82A 1ZPDA 4MO9A 2Q07A 521PA 4UBIA 2H85A 1OH6A 3JQRA 4Z3KA 2PD3A 5BN4A 1DFHA 3ELDA 4HNGA 1KMHA 2VDKB 3H87A 4U0UA 4WH0A 2VGXB 3JALB 4CKXA 2Y0BG 4DPMA 3FTSA 2PLFA 4R8VA 1CUWA 1QBGA 1VKOA 4IHAA 1HYQA 1OLOA 3VYVA 4DNFA 4V0OA 4UTOA 2I7CA 4KMSA 3F97A 1Z0ZA 4OA8A 4C3UA 1DJLA 1Z4IA 2W0SA 1BMDA 1SBZA 2IS6A 3IBYA 5H1YA 4IV8A 1GVNB 5T64A 3EBLA 5F9HA 4HAVA 1WXIA 3OZUA 3WAGA 1K7YA 3F74A 4NURA 1F3LA 1D07A 2ZK7A 4I5GA 2I4OA 2B0CA 2GAOA 3VR5A 4EEKA 2CLEB 4LJ7A 2QW1A 1TYAE 3TWRA 1O9GA 2W2TA 5KYTA 8ADHA 2JARA 3P2KA 1E9RA 2OO5A 3FH7A 3ABIA 3BFXA 1Z68A 5LZ7A 1TW2A 3A3NA 4ZI7B 4FVTA 1RJWA 4INZA 3C4JA 1K1EA 3Q0IA 4NPHA 4TX1A 4U7DA 4MS1B 1UT5A 5FNVF 1DMSA 2X23A 5E38A 2EP5A 1TQDA 4TXHA 3VNBA 4HJXA 5G0UA 3AYZB 3L82B 1E1CB 1T9GR 4GAAA 1KK0A 3U1VA 4M9UA 1RQGA 5H16A 4MA4A 4AZ3A 5AJZA 4PTYA 4GI7A 4A23A 3G6WA 4BO0A 4B32A 4J0KA 1VPDA 2COUA 4Y6OA 3GZJA 4KI7A 2P5TB 1HRKA 2O06A 1ETUA 3V1YA 4FGUA 1GL7A 5G04C 1Y4UA 2ODPA 3M34A 1H2FA 3PFKA 3L7OA 3V97A 1KYWA 2VN8A 4P4TA 2HLDA 4P22A 2B5OA 3B7RL 4A03A 3CLUC 2BTQA 2E6KA 2AFHB 1VDZA 5A2QA 3ZS9A 4HVTA 4CIDA 3B6JA 4GPBA 4NBSA 5FJYA 5CA1A 3VA7A 1TYQG 1TRKA 2XOKD 4EG3A 4BB0A 4N3NA 1PFUA 3SIRA 3GJ7A 5BQXA 3FVTA 1IN7A 3R5FA 1QR2A 1YE3A 4HB0A 3PEVB 2P9GA 1CB0A 1ORTA 4L8WB 2UVPB 5LQUA 2SCUA 1OVGA 1PT7A 2AR0A 5F7OA 1SN7A 2O3JA 4PYRA 4D26A 4I50B 1Z34A 1NVXQ 1JVBA 4D44A 1HTTA 3OXFA 1VLVA 3SYTA 1ODIA 1FCHA 5DM70 1H4TA 2BGIA 3UMBA 5K09A 3SC3A 2J0SA 2SHKA 1PWHA 1MA0A 3S27A 3RYIB 2ZUWA 3K6SB 3HR4A 1M34E 4HS2A 4CKWA 2ZREA 3AJRA 4F2DA 1S2GA 3ECAA 2ODQA 1BHO1 4KV9A 2IWHA 4DCJA 4MR8B 5EJ9A 1FNDA 2LNDA 1AK1A 2ONZA 3LP8A 1KIMA 3PREA 4FBGA 3BMXA 4M3NA 2ZWPA 4FJZA 1JE0A 1HZJA 3T7IA 2I87A 3FD8A 2NSLA 1L5MA 1OXUA 2IUUA 3PDNA 2FZGA 3WMXA 1MO5A 4ANVA 2VFAA 3T0IA 4MDHA 3GZ4A 1DBIA 1TQ8A 4BCCA 4LA4A 3ZYMA 1NSFA 1C0KA 2Q0XA 3H5RA 4AI6A 1AV6A 1Q3KA 1EFUA 4RLFA 1P74A 5ISMA 4Q01A 3B2EA 3PIRA 5ESXA 4XCVA 1Y0BA 4IZOA 3T5CA 1QGYA 1NOJA 2AHOA 5DTRA 1VHLA 4G5FA 1ZC4A 4CKEA 2BH2A 1UC4B 5KJFA 3VR6H 3PUHA 3TVTA 3W5SA 1ZUNA 4MW4A 2GK6A 3JWGA 1SA5A 2NZYA 2YNMC 4L0DA 3N0WA 1YR6A 1ODTC 2I7VA 5G55A 1G7SA 3CLVA 2BR4A 3L54A 1YRQA 1KSFX 4QKQA 5CUQA 1L7NA 4N65A 4TV8F 4JC5A 4CFSA 4IBOA 1E2NA 4JC4A 5EHZA 1ORIA 4FDMA 2PNFA 3BGWA 3P0EA 1XU9A 9LDBA 1YVRA 1V4NA 2GPBA 4INAA 3R3HA 1D1SA 4DLVA 2YFQA 3FSGD 2ZIUB 4LWPA 4CT0A 2AN4A 2Y4OA 5F9FA 5FD8A 4OHMA 4JKYA 1BWPA 3NOVA 4KXWA 4WOCA 5AI8A 4WSOA 4M1KA 3I5YA 3ZDQA 3JQ9A 4HPWA 1UWVA 3R5SA 2Q5JA 5LP6F 1EA5A 4Z4GA 3OC6A 2VAVA 5SY4A 2FPOA 3MXOA 2P2DA 5HVNA 1IZZA 3ETEA 3IX7A 4U3JA 4BBZA 1JBKA 4TWAA 2OCCE 5LQAA 2QZZA 4DLNA 2ISCA 4G07A 4LQDA 3TOCA 4XM0A 2OOKA 2NZ8A 1QHFA 2X9NA 1P1CA 4YROA 3EA0A 2A57A 3EXEA 1PWYE 3UI2A 4W5RA 4Q1BA 5J2UA 3IAM6 4ILGA 1RC0A 2WYUA 5IM5A 1QU2A 3RC2A 3T9CA 5IASA 3LQRA 3P4UA 4GGPA 4RXUA 9LDTA 3GRAA 4HAWA 3KYJB 3MVEA 2PD4A 2C9CA 4FWIB 4QO7A 2PGNA 3A11A 1A7UA 4JASB 2N47A 2GEDA 4ZARA 2EINE 1C1HA 1SG6A 4R5MA 2RCNA 2RHLA 4B3HA 3MTQA 3F2IA 4IJMA 2B2XA 3DEIA 1MJGA 5DHRA 2DMRA 2PGIA 3ZFWA 3IEKA 1ETHA 1N0IA 3NAMA 2QTFA 4WY5A 4V1CI 1FF9A 5HEKA 1D3AA 5F2OA 3AH8A 1XLUA 1M0EA 4MCJA 4O1OA 3ZDEA 1GPUA 1ZGZA 3OZFA 4FC6A 1GQOA 3OQVA 4GZCA 1BVYF 4LV8B 4G86A 5KNHD 4AF6A 5AOXA 4TVBA 3GRZA 1JMYA 4W5TA 1L4KA 3JQBC 5DM4A 2MOKA 2JBAB 4D8UA 3L8DA 3ROZA 2BT4A 2HLHA 1HO8A 4PLGA 1E18A 4B40A 1PJLA 1NASA 4F97A 3BWMA 4J7AA 1ZJ4A 1KWGA 2DFKB 1M76A 4EDHA 4G1TA 1GO2A 2OFWA 3AZPA 2AXNA 4D3SA 4A6PA 1OBCA 4AURA 2NU8A 2AJDA 4FSHA 4BNIA 3R77A 2QPOA 4IG9A 1BSVA 3GG9A 3J5PA 3ZDBA 1TLTA 2WLTA 4I4TA 1SUDA 2WXIA 4QICA 2WZQA 2QTBA 1JHYA 4RPLA 4FE3A 1DO8A 1PQUA 2QDXA 2R86A 2AOXA 4PU0A 3KT6A 2R2AA 3G8YA 3GT7A 5L4LA 1DX9A 1OZAA 2X5JO 1YKGA 3TQHA 1JECA 4NQRA 4K9QA 3RRXA 3T3PB 4MRPA 4YK7A 5J4YA 4UDXX 5AM5A 1HT3A 1B42A 3NOCD 4UFNA 1N4RA 1HG1A 4N03A 3CSDA 3L13A 4BO2A 2ZUBA 3VR4A 3WE7A 3V1MA 1Y98A 1H8HA 1G6OA 2Y71A 2II6A 4GKVA 1P4AA 3LCCA 4W9NA 4RFLA 3HGMA 4N39A 3UJBA 3PQDA 1CDDA 4I1OB 4FOOA 2VKQA 1JEDA 2HK8A 4CXMA 3H2KA 2BMWA 5K7SA 4KBYA 1F5NA 1X7YB 3DXFA 1Z2OX 3RTAA 4PZ9A 1A9XB 2HGZA 3FFWA 3ZHZA 3NNNA 1E4OA 2CNLA 2PLAA 2B21A 1IJFA 1W2GA 5G4LA 4U0SA 2BGMA 3R3YA 3FVWA 1GU1A 3AFNA 2G4CA 4RIEA 5KNCA 4MLZA 5DHSA 3GJ0A 3TLGB 2X2PA 3JYHA 1E3TA 2ORVA 1D5CA 2MINB 5FXMA 3DWFA 1AC5A 2V7QD 4BTLA 2QE6A 1YIDA 1KNQA 1AM4D 2GFQA 5ALOA 4EQZA 2ZSDA 4NLLA 5ELMA 1O9HA 5F4ZA 5BO5A 3BWBA 1BD3A 2DLDA 3DGFC 3WHIA 4ILIA 2X77A 121PA 1J90A 4URKA 2QM3A 2Y1KA 1QHSA 4B7UA 2RGXA 2VYNA 4Q48A 1EYZA 4WWPA 1IJBA 3VSAA 4OI2A 2IS4A 1P75A 2AFIE 1RLIA 3OETA 2G8LA 4LHSA 4K0KB 3O47A 4OUDB 5KJEA 1ORRA 3TRHA 3ID6C 1XRNA 2OQ2A 3OE1A 3PUWA 2J3MA 2Y99A 3V6LA 4RH3A 3T7CA 2AOUB 4QSMA 3ICOA 3D6MA 1QCZA 2O8CB 1QTRA 2WB4A 2EZUA 3ASDA 1EVJA 2YRXA 4EI2A 4TVOA 2WAYA 3QNUA 1MN6A 2KI5A 1U0LA 1QORA 4QNMA 1Y4AE 3GYXB 5BN1A 4O4LF 2C5FA 5IWCA 2VF7A 1Y9JA 2ZJ6A 4BJ1A 1ESMA 5BXYA 3L79A 3I04M 3WB9A 4BGEA 2XRFA 2BM8A 1RJ9B 1J0BA 5AIAA 4Q1CA 2QJRA 3QE9Y 1RQ2A 3L4KA 4B6JA 1GILA 4HDNA 3GPLA 2FSIA 5CA0A 4ZO6A 3N2GA 2VP6A 3DVAA 3PE6A 2H4XA 3TL5A 3TWTA 1M1YE 2QM8A 3K7EA 2HWXA 1H5QA 3NPMA 4UWHA 3EAQA 2Z4RA 4X8OA 3EQ6A 4LG6A 4GP6A 1U9IA 5F2KA 5EHQA 3MYRA 1EPUA 5MHTA 1JTVA 4UNIA 5E3HA 3UJCA 4NBKA 1ADYA 1IWPB 1C3JA 4X95A 3BMOA 5B6JA 1HDCA 1PUIA 3KUXA 2VJLA 1MO6A 4Q3LA 3OXLA 5AJLA 4ZA2A 1QHIA 2LDBA 1OC4A 3NW9A 3OZWA 1BX1A 4A0RA 1SUCA 4OHXA 5EE5B 1KJ9A 3NAWA 3BTOA 3DONA 4UBOA 2DPHA 2BF4A 5A5DA 4PV7A 3NJRA 1DC8A 3C41J 1PV2A 4WLOA 4AC9A 5KJCA 2H1HA 5A05A 4JVSA 3SYKA 1KMCA 4UXJA 2XODA 3T5VA 1F6WA 5CIWA 1FOEB 2O4CA 2VQ2A 1KVRA 4HCJA 4R98A 3ZZNA 4JIGA 4U00A 4ZPJA 5B55A 1EGMB 2G80A 1W88A 2QEQA 4XZ4A 4ZMSA 1P2DA 1RJFA 2BKLA 4Z2AA 2GM3A 3GY0A 3ENQA 1YU6A 4B80A 4NF2A 1M5TA 2Q62A 4GLBA 1ESDA 3C7KA 5HKAA 2PVSA 1YDGA 3QH4A 3VO1A 1NG1A 5JCZA 2FMIA 2HSGA 4V0KA 2FUG6 2R48A 4MKIA 3S2YA 1MDBA 1V8PA 1Z56C 4OPMA 3U9TA 3SZGA 4XCXA 2YTZA 4KN6A 2YXBA 3CB4A 3SNHA 4C30A 3KFVA 4Y9TA 2WOJA 2CFOA 2FWJA 5EPEA 1G41A 3SCZA 4CQMA 3U7QA 4JLUA 1C9JA 2H2AA 4H7KA 4YBZA 4K6HA 5JDCA 3G0CA 4CGVA 4M8KA 2CDBA 3AHHA 3LKVA 2ZI4A 2WLSA 4MPTA 3ND9A 1NBHA 5IKOA 4NU6A 1O6FA 2N42A 2YRFA 1OZHA 3RFCA 2EOAA 4O3FA 1VPWA 3MQ2A 2KBXA 4DNPA 1HDGO 3EFOA 4HH3C 4BYMA 2IU0A 5HMLA 2YDXA 4L0CA 1Z22A 4Y67A 1DAMA 3F5MA 4F21A 4GWKA 1PGNA 3GMIA 2BE7A 4YDHB 4QOIA 4BE9A 1JDSA 5U4XA 1HPLA 5KJ1A 3HR7A 2GAFA 2GJ4A 1H6KA 1X7HA 1OOEA 4M8IA 4BC1A 2H2HA 1KZPA 1FDRA 1XP8A 2WUWE 1GPH1 2C5HA 3MUOA 1KZ4A 1BQ3A 3FVQA 2JEOA 3U4DA 4N6GA 3EXIA 1L7RA 1X9IA 1ULUA 4X00A 4R7TA 2ZEJA 4AFNA 3SF8A 2RKOA 3NGMA 1GV1A 1HOTA 4EL0A 5BYAA 3AUJB 4RF4A 3WYBA 1U63A 1HE3A 2P9JA 1MB2A 1XL1A 3T7SA 5FZQA 3HL4A 4PS0A 2XCIA 3R3SA 5JR3A 4JLWA 3PNLB 2HK6A 1MX1A 3O2SB 5JYCA 1SUFA 3QXGA 2HCJB 2XBLA 1HFAA 1O9BA 1A4RA 2DP4E 4MDFA 2AFIA 1JQDA 2JGDA 4DJ5X 4FX2A 2FNAA 4BSZB 2WWFA 5CH3A 3EZFA 2ORIA 1WOYA 1FLVA 3T9DA 3D9MA 4WUYA 1TM3E 1OT3A 3WRYA 1KJQA 3GJ8A 4IILA 4JT4A 3VDNB 3HKBA 4JOBA 3EVFA 5SZIA 2QL7A 1DIBA 1HLPA 4DDKA 3UQ3A 3Q72A 2ZRKA 1PG5A 2LP4Y 3OSZA 4RY2A 1B0ZA 4MGIR 2QORA 4AP2A 4J4TA 5CFRA 2Q6VA 1NG9A 3KFLA 2ID9A 1KU6A 1L4HA 4CLXA 3PFCA 3A32A 3LQKA 3RRUA 4HFMA 1JNZB 5EESA 1W94A 2ETVA 3EGXA 1CUYA 3AFMA 5C34B 3V8BA 2DFNA 2ZUVA 2R6JA 1WO8A 3E15A 3MCWA 5ER9A 2FWIA 3KSZO 4DX6D 1PYOA 1Y3HA 2OC9A 2Q4DA 1GEEA 4RZ3A 4GOOD 1HFEL 3P5SA 2G25A 4ZDJA 1M1YA 1XQWA 4QPDA 1H42A 4DCGA 4AMUA 2OBFA 1UXHA 4LRYA 1E1RD 3AKDA 5FPKA 1I4DD 4RVHA 5AVYA 4JGGA 2IX3A 2Q4RA 3R0VA 3PGMA 4QC2A 3AY6A 1RXEA 1HDXA 4EB0A 3IPLA 1RM5A 1GIAA 4HDSB 1S64A 3VNAA 2FF5A 2W4MA 2G5GX 3EISA 2IFUA 4B0ZA 5IVHA 1JLRA 1A04A 1EGVB 4OU5A 1FRNA 4GM4A 5CB4F 1ZAYA 4V02A 3ZU6A 4XE0A 5E7MA 5I4IA 2WT4A 2Y77A 3O95A 1O1YA 1S2OA 2BFCA 1Q22A 4ANUA 4ZCPA 1Z26A 4J0HA 4JMLA 1SKQA 1RYFA 3BSSA 2CL6X 3DLHA 1EAMA 8MHTA 3RKVA 4LJ9A 3ZU2A 3AU4A 4BNZA 3PNTB 3QVWA 4IXDA 2LE0A 1B4DA 3LBAA 1JWBB 4M3OA 1AZWA 4RM3A 4OIMA 4NBVA 4LRTB 2JANA 5BR7A 4AUEA 2YUTA 5M04A 4FC7A 4H3SA 3LNTA 5TGTA 16PKA 4HYYA 4RZ2A 3OPYB 1JSRA 2ZB8A 3RQIA 1J1IA 2E82A 2NT3A 5ITZA 1GNRA 1W4RA 5IWAB 3HB5X 2C9MA 1JHRA 4TKMA 3VJKA 1PV1A 5EJ4A 3BXPA 2NG1A 3T61A 1RYMA 2GEBA 5IBQA 1X15A 4X8HA 2CE2X 2QE7A 4JLDA 1DRKA 3DLTA 2VF2A 1RWKA 4YJHB 3U4QA 1DHTA 4TSFA 2QTVA 3QIVA 4PFQA 3ORRA 4UZFA 4QGHA 4A0HA 3UM1A 2VSNA 4YREA 4FSDA 3I3NA 3A2KA 3WV5A 4Q1DA 4D8WA 4LNBA 2NXCA 1ZJZA 2IO3C 3NU1A 5K3SA 1F2UA 5J43A 3NXKA 1A17A 4NYMR 4PW0A 1JJVA 2R7LA 3IUYA 2CW5A 2GW1A 2IH5A 2VTVA 2L42A 1BGVA 3I6IA 4WJLA 5AFSA 5HUJA 3FNRA 3PENA 1DTWB 3OOYA 4LHZA 3VZQA 4KE8A 1YCDA 4R2JA 2YL2A 1Z0IA 4NESA 3BD9A 2RHMA 1Q3TA 1OBFO 3I6MA 4L1BA 1SUBA 3M6XA 4EZBA 5C7LO 1JLLA 4RETA 3W3ZB 5CFLA 3PNVA 5FLEX 4RDIA 4MW2A 5BQOA 2AV6A 1THZA 2XA9A 2XB8A 4GEKA 4UUOA 3ZYCA 2EFEB 4TMVA 4B73A 1KFEB 3BXEA 3O5AA 4OVVA 1QB8A 4W6QA 2A9JA 3QXHA 3NTUA 3TI7A 3V4ZA 4I17A 3OTOB 3OJ0A 1G60A 3WLEA 4JUAA 4RA9A 1E2MA 3LU1A 5CCMA 1WTAA 4MV5A 4IJUA 1P1RA 1CQJB 1R6XA 2ZR9A 5BMVF 5FOXA 1KO7A 1A5AB 1II8B 2NO0A 5K0SA 2CWDA 1VIVA 2NTYC 4MAFA 2JI8A 2OFFA 4M7PA 1ESZA 3A4MA 1X80B 4HNUA 5K6AA 2GZRA 2RGAA 3KLPX 1P5JA 4OB7A 3DSVA 1FFGA 1BVHA 2Q5FA 4M36A 2EBUA 2Y69E 3IVXA 2HI0A 1VMEA 4XUDA 3DZDA 3QOWA 4YDRA 1FX0A 1I2DA 2QRGA 1ODCA 4YDEA 3I6QA 1J00A 3B52X 1XNFA 2YZ7A 3WLLA 3PNOA 3PPVA 2XQ0A 1QYMA 2RC6A 3EC7A 4B3SB 4TRJA 4B0OA 3P2OA 3RVSA 1YHZA 4QDXA 4D3DA 1HM5A 1KHHA 2BCJQ 3DLBA 2BEVB 3WB2A 2AL7A 3JQ7B 1KEEB 2QX7A 4WWNA 3NQ41 2VPYA 4OX9Y 1U0BB 4YRGA 5JCOA 3W2HA 3WLNA 3V4PB 1NBOA 1JAIA 1C9NA 2C9BA 3MS7A 4DTIA 4WESA 3UMMA 2A9QA 5B5SA 3MINB 4F6RD 1R1DA 2HU5A 4HI0E 3F73A 1Y7HA 4IJ5A 1U9CA 3VU1A 3NHPA 3G5AA 2P78A 3DAPA 2WKRA 3IRVA 5IZCC 2DHDA 3BQOA 5LB4A 1URPA 3RS9A 1OUVA 3WHPA 3E9NA 3SS7X 3GEIA 4L7VA 4ECEA 3WQQA 1L3BA 3VOSA 3CLRD 5FZSA 4B33A 1LSSA 2EFDB 3N74A 1NVGA 3CMCO 4J0GA 1QQBA 4BX0A 4OP3A 3OE5A 4DR3B 1I0ZA 3Q7RA 2R65A 1Z29A 4YACA 4INPA 4M0DA 4HZGA 4B8WA 5K0GA 2JZCA 2XT0A 1SPBS 2GERA 4NBWA 1LDGA 2QG6A 1GD1O 5CYFA 4DY4A 1FMCA 4Q4HA 3UJ3X 3QK7A 1QIDA 4YVQC 5ENQD 3EFHA 1GQQA 5HW0A 1VL6A 2BHLA 4KR6A 1C30B 1YMUA 3BIWA 1XRPA 4AW9A 3W3AA 2WY2D 1U2EA 4TTJA 1S2DA 4TWZA 2DIWA 4JZYA 1EFVB 1NMYA 4OREX 3QVSA 5AVRA 3HDQA 3IP8A 3ZCSA 1PHRA 4F5EA 1JIVA 3RS3A 3KKNA 2KWIA 2OCYC 2RKKA 3N87A 3P2IA 3B5JA 3H9CA 2YYAA 1MQAA 3QUCA 3RKUA 5EYPB 3PDJA 1Z2CA 4INOA 1XV5A 4CG3A 3GLFB 5FFNA 2CKDA 2ZITA 1N8SA 3KWJA 1C1XA 1CKEA 2H1VA 4RF5A 1B76A 4N2QA 5JWOA 3UENA 1IYGA 5LP6C 4EG1A 4O6VA 1SOMA 3DB2A 3FMVA 4J9UE 1SO8A 4XX0B 1A82A 4FULA 3PXAA 3QVJA 2I4LA 1SWWA 4PQFA 3AF2A 4ZYTA 4X6LA 3W8NA 1NNUA 2GT1A 3KYCB 1XDWA 2EGHA 2DBAA 2BFFB 1GA6A 2XADA 3QKYA 1VJTA 3AG4E 3ZK8A 1UH5A 5MN6A 1KY3A 2EKQA 3BH6A 3OTQA 2LAHA 2WIKA 1Z4JA 3G3EA 3N3BC 2WSIA 5T8IA 3UGJA 4LFAB 3NKLA 1MQSA 1LPBB 1VHWA 2OENG 2Z8YA 3GZTB 1PD1A 4F4HA 2PMCA 2YINC 3T8MA 2LDXA 2C2GA 4HB5A 1PEYA 1OLSA 1AXEA 1NI4B 5DISB 5M2QA 4OKNA 5GAJA 3OQIB 4LCEA 4C1NA 2MOWA 1MENA 3C3JA 4FNOA 3C8ZA 5G1PA 3BOSA 3WL3A 1C8LA 3OQMA 2NU6A 4L95C 4M38A 1GVHA 1INLA 1XMJA 1FVOA 1MX4A 2I9CA 4RIIA 5AVOA 3PKZA 1S9DA 1RMQA 3OVMA 4MO2A 3HXPA 1C9DB 4L51A 1FFHA 2G5PA 5LN1A 2IGBA 4UHDA 1NI5A 2XLBA 1XEXA 2QUZA 3VM6A 2RHJA 1EG2A 4GNRA 3KJEA 3H3FA 2Z6UA 3PXEA 3G2UA 3GR6A 1UZMA 2Y1EA 3Q73A 4B48A 4P9NA 4TV8B 4B3MB 2WIDA 3GMSA 5JATA 4F56A 1XHFA 1Z5VA 1HZZA 4H17A 1Z6TA 4XX5A 3HBNA 2JIZD 3OKCA 4GLJA 3FWKA 1JHPA 4HXYA 2GM9A 4LPKA 4IWXA 3GJXC 2QJTA 2DR0A 2GBFA 4EP1A 2CJWA 4WBXC 4JYPA 1G3IA 4Y6PA 5FP0A 4P53A 3UAZA 2Z2IA 3GLGB 2D4HA 2H08A 4LSZE 2DBYA 4W7SA 5KBYA 1RYDA 4JP3A 2WD7B 2C2LA 2X6IA 1EGHA 2C4HA 4A1OA 5A23A 5E2AA 3LQ2A 3HY3A 4MB2A 3DBLA 1AKUA 5F1PA 3VZBA 1G5HA 1O97C 2LNIA 4DPKA 3J80A 1VLHA 1P72A 1NV9A 2B20A 2YWEA 1Z37A 1ZI6A 4KYTA 1XAJA 1WCYA 1IJKA 4G6ZA 1QHNA 1EK5A 3I9MA 2Q49A 1GYPA 1XF1A 3KJGA 1F1JA 2KBEA 1WM1A 2L19A 3S2AA 3BJRA 3G2WA 4INJA 1A1SA 4P32A 5A7FA 1K3ZD 4ACKA 2Z3ZA 1VL8A 1PJ8A 2VUUA 2HIMA 1QS0A 4DMHA 4BY9E 3HRIA 4A73A 5ARGA 3K1AA 2XMPA 1W49A 4OMFG 2I3ZA 4LERA 4UCWA 4C22A 3P1JA 2OD9A 4A36A 4X3OA 1PTJA 2A1UB 4U9UA 4MYSA 2ZJFA 1S96A 1T8WA 2R1VB 4YGYA 1XCJA 2LBPA 1UK7A 1NVBA 4E3WA 3K8QA 2GK4A 1WPQA 1LU9A 1VGRA 4BUJA 2JJYA 1E5QA 2EZTA 1SIOA 1Y7PA 3RU2A 3TAUA 2RGRA 4MV7A 3GJSA 4NMMA 3DMTA 4P92A 1RXVA 4H4CA 4MBGA 3N6VA 1Z6GA 1GAJA 3EF0A 5HM8A 3GLIB 1EWYA 3M0EA 1TPYA 2R25B 4RV4A 5AVJA 4BTBA 3LY5A 1DSSG 3QU9A 4BQRA 3RDPA 2FYTA 3Q4AB 2A30A 5LZ9A 4ZHQF 1A7KA 5CFOA 4JEHA 3P0JA 4QTYA 1U4NA 3K94A 3OC0A 3QTTA 4WVLA 4Q24A 2C7OA 4HEA1 3N71A 3DAHA 1G66A 1JXAA 4DLWA 3JARB 3TLEA 3V8PA 5JT1A 4ANFA 4MEBA 1A5ZA 4MVJI 5FUVA 3SI5A 3R6GA 3SJAA 3OEHA 2IL1A 4L75A 1YI8A 3OM0A 3KT3A 3UK6A 5HP4A 5LYJB 2EAUA 3UT4A 3CNEA 4D9BA 1PSDA 2GAIA 1E4EA 3CHYA 4RY9A 5ENVA 5FAKA 3HWRA 4PCLA 1PFWA 4XWOA 5EMHA 4TV9F 3NTLA 5JAIA 4MWBA 2ZU0C 1DUVG 4OGLA 2FRVA 2HQ1A 1LRKA</