4N3BA

Crystal structure of human o-glcnac transferase bound to a peptide from hcf-1 pro-repeat2(1-26)e10q and udp-5sglcnac
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
716
structure length
697
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/substrate
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title HCF-1 is cleaved in the active site of O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 275
structure length 697
sequence length 716
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3bA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3bA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4n3bA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4n3bA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n3bA03
4WHMA 1FA9A 1WV1A 2F9FA 4KQ2A 4W6QA 4F3VA 5D01A 3AS5A 2NC9A 3Q49B 2QN3A 9GPBA 1AHPA 1TJCA 2GJ4A 4F97A 4KQ1A 4G2TA 1JG6A 1P4HA 3E3OA 3T3IA 1PN3A 4M83A 3OTIA 2LSUA 4ABNA 4F96A 4CGVA 4CTOA 2Y4TA 5EKQD 5DLDA 5I45A 5BT1A 2X6QA 3IEGA 5TVGA 3CVLA 1FTQA 2VCHA 2IV3A 1FS4A 4XI9A 4GA2A 2IF4A 1Z62A 3MRXA 4FZRA 3QKYA 2AW3A 3CUVA 2X0DA 5ARFA 4RG9A 2J9QA 1WW3A 4BQEA 1F0KA 5LCWC 2SKEA 3T3HA 4IN3B 4L22A 4JL0A 1PSWA 1UQTA 2BGUA 3OXFA 2BUGA 3OKPA 3VDNB 5EX3A 3NAZA 3AS8A 3UYKA 4GCNA 4QLBA 3DD1A 2WQHA 4WNGA 4ME2A 2PQRA 1C8LA 3FFLA 4J0UA 3CEJA 4M7PA 2Q6VA 5BW8C 3MS2A 3ZCSA 4KBQA 4G26A 3TOVA 4WADA 1L6IA 2R4TA 1IHGA 2QRPA 4GA0A 1B4DA 4GPBA 2C0LA 3GZ2A 4BT9A 1NOJA 1V4VA 1LWOA 1P5QA 5GPBA 2FEZA 3ZHEA 4F9FA 3LPZA 2XMPA 3LY8A 1GGNA 4M60A 3IA7A 3VTXA 1GZ5A 2QZSA 1XKXA 2FF4A 4GYYA 4AY6A 1XL0A 3CV3A 4KYOB 2GEKA 3NC4A 3G2NA 3NPAA 2ECPA 3QDNA 3G2KA 3OTHA 3T5TA 3WXXA 3MV2B 3TAXA 2QRQA 3G2HA 3DDSA 3EBOA 3FROA 4UQXA 2HYZA 5HXAA 2ACVA 2GPAA 5A7DB 4EKYA 1XNFA 3G2JA 4N3BA 4NEQA 3RHZA 2IYAA 5LQDA 1NZNA 4G25A 1QZ2A 3G2LA 3T3DA 2FETA 3ASHA 3PE4A 2KC7A 2FF5A 3CEMA 3QWPA 4BTAA 3CKCA 3Q3HA 4RIIA 1HXIA 5DXFA 2SKDA 3T3EA 4BWRA 1KTIA 1NA3A 3KAEA 1ZU2A 3GW4A 5D0OD 1HLFA 2L6JA 4MI9A 4AM9A 7GPBA 3LKUA 2UY1A 3LY7A 3S28A 3RSZA 4HLNA 3L7CA 2R68A 2GT1A 4O6FA 2KATA 3MTBA 5KJKA 4I17A 2VGYA 3NP9A 1RZVA 3WC4A 4NC9A 4HWGA 2PZIA 5FZQA 5IKOA 4I9CA 1WW2A 3ASDA 3Q4AB 3ZFWA 3HBJA 5HQ8A 4RIEA 2O6LA 3COPA 3VUEA 3ZCRA 4AN4A 5TMDA 3ASFA 3CV0A 2XCUA 4J8DA 3JYSA 1FCHA 4RENA 1HZ4A 4EL5A 1PC2A 3DDWA 3WAGA 2HY7A 1P2BA 4UI9J 3NP7A 3RU0A 4RIFA 3MT7A 1JG7A 3URZA 4J8FA 4MRAA 4KXKB 2C9ZA 3C4QA 2F3SA 2ACWA 3C48A 2ATIA 2IEIA 2XA1A 4GYOA 1WAO1 2C2LA 3ZGQA 5KJMA 2WPVA 3BD6A 2PL2A 4CTMA 4FKZA 3GYZA 5FZRA 2R66A 1YA6A 4G23A 3MKRA 1Z6PA 4WACA 2IW1A 2PRJA 3S27A 5JJTA 2R4UA 5C1DA 2VGXA 4GPKA 2AV6A 3MRVA 3HBFA 4EKEA 2Y4UA 4U0SA 5DBKA 2QN9A 2XCCA 1WUYA 4N2QA 3RIBA 5FZSA 3EBPA 1FU4A 4AY5A 1Z6QA 1NOIA 3MA5A 1Y6FA 2BISA 4BT8A 1YGPA 3ZCPA 1SXQA 3IAAA 1GPYA 6GPBA 3CUUA 2Q7FA 1LWNA 3CUYA 1P4JA 3OKCA 1VGVA 2XPIA 4XIFA 2KCKA 4B94A 4G2VA 3VTYA 4N9WA 1QM5A 2JZCA 1KLXA 3S29A 2YHCA 5G04J 2C1ZA 5G05J 1JIUA 5CHEE 2ASVA 4RELA 1FC0A 3QKWA 1L5WA 3H4TA 4I2ZA 1P2GA 2G9VA 5DIZA 2H1FA 3SF4A 3ASGA 3CVPA 3UQ3A 1L5SA 5HI7A 1H5UA 3GPBA 8GPBA 2UY1B 3CKBA 3QOUA 4N39A 2ZB2A 3LY9A 4HOTA 1Y6GA 2MHKA 2F3UA 2IYFA 4YUAA 1QQEA 3Q5MA 3L01A 3ZCUA 5M72A 4Z5XA 5G05C 1KT1A 4RG6A 2QNBA 3L7AA 2QLMA 3G2IA 1NZDA 3NCHA 2GEJA 2FFRA 3CK8A 2DBAA 1Z8DA 3VDMA 3E3LA 2P58C 2YJNA 3CVNA 3S7JA 3RO3A 1NVKA 2QRMA 3E4BA 3OY7A 4BFCA 3ESKA 2XCIA 3BD7A 3ULQA 2GM9A 3BCSA 3N71A 1RRVA 2R5SA 1EXVA 4JHRA 4LEUA 1OUVA 3CUTA 1GPBA 4KQMA 1UQUA 4I1AA 5D0QD 1C8KA 2JLBA 3L7DA 5FJYA 2VSYA 2G9RA 1XOIA 2FBNA 3BCRA 1FU8A 2VCEA 1WM5A 3CX4A 3MSCA 4A1SA 4I9EA 3AS4A 3ZN3A 5KJLA 4CDRA 3ZPJA 1FTYA 2GPBA 1JIVA 4N3AA 3S2UA 2KS6A 3TG4A 5A6CA 3K9IA 4NESA 4GZ3A 4RIGA 2VGXB 1W3BA 4GYWA 2OOEA 4MI3A 1ZBPA 1NOKA 4WNFA 3CEHA 1UZUA 3CK9A 1FTWA 2C1XA 4NRHB 3MS7A 2AMVA 5EX0A 2HO1A 2GW1A 3MBOA 4BQIA 1NA0A 1GPAA 3LYAA 3MTAA 3QWWA 1PNVA 3S7FA 4EL0A 4EJ2A 4APOA 2FO7A 2P6PA 4X7MA 4HOQA 2BFWA 4JA9A 3D0QA 4CTNA 4CGWA 3D0RA 1E1YA 1L5VA 1PYGA 4U04A 3QHPA 4YVOA 3D1JA 3Q3EA 3AMVA 3WADA 4UI9C 1AXRA 5JJ6A 4N2SA 3Q47B 2XGMA 2IV7A 2FI7A 2QN2A 4LEIA 2QLLA 3CK7A 3NB0A 3RT1A 1GFZA 4H7XA 3MT8A 3HBMA 1P29A 3S0JA 5TMEA 3ZHEB 3Q15A 1C3JA 3FWVA 3ZCTA 5JTUA 3EDTB 2X6RA 3OKAA 4N3CA 2QN1A 3RJVA 3H4IA 5LCWJ 2X0FA 3RSCA 1KT0A 3OY2A 4YI5A 1FU7A 4RIHA 4RBNA 3R9AB 1JIXA 4H7YA 3LCAA 1A8IA 4MHOA 2QRGA 4MI6A 1EM6A 5IKPA 3UPVA 4JA7A 1O6CA 1BX3A 3MS4A 4HOUA 5CCLA 2PQ6A 4Y6CA 2PYDA 3O48A 3U3WA 2G9UA 1K08A 4WUYA 4U07A 5ARGA 4YVQC 3MRTA 4GCOA 4YI3A 1WUTA 1IYGA 2XCBA 3S7DA 3CUWA 3OXLA 2X0EA 2SKCA 4UI9K 1IIRA 2IUYA 4Y6WA 2HR2A 4AMBA 4I2WA 1F6DA 2OFFA 3GZ1A 2KCLA 3PE3A 4GZ6A 3OXGA 1L5RA 2QLNA 3TG5A 1QKJA 2XGOA 4MICA 4GA1A 1XL1A 3GUHA 1NZFA 5AYWD 1C50A 3O3CA 1NLMA 3BCUA 1P4GA 2PRIA 3BD8A 4HOSA 2E2EA 5G04C 4UQZA 1E96B 3CVQA 3BEOA 4EQFA 2QFCA 4MHSA 3UYLA 4G24A 2KCVA 2H1HA 5CCMA 2XGSA 2PQNA 4XI0A 3U4TA 1L7XA 2F3QA 4AMGA 3ZCQA 1HH8A 3BDAA 1YA0A 4BTBA 5JJ7A 1ABBA 4X7RA 4W9RA 3E3NA 4GZ5A 4LDPA 1K06A 1P2DA 2JJMA 1Y8MA 3TGOA 1L5QA 2UWJG 3MT9A 2YQ8A 2QN7A 3C4VA 3MQFA 5TMBA 4PQGA 4UQYA 1A17A 1ELRA 1SXPA 3CEQA 3FP3A 3NF1A 3SYRA 1B89A 3RO2A 3TSAA 3KS2A 5ENZA 3MV3B 5FT9A 5FTPA 4WNDA 2IFUA 2XEVA 3S7BA 5DU2A 4X7PA 4REMA 1Y8ZA 2QN8A 3VUFA 1RZUA 2VYIA 2LSVA 2VG8A 2I6HA 3L7BA 5JTTA 4J8EA 2VSNA 1ELWA 2ONDA 4X6LA 3ZCVA 2PYIA 1XV5A 1J39A 2F3PA 1E4OA 2XA2A 3UUXA 2G9QA 4YNDA 2XA9A 4NQ0A 2QRHA 4G1TA 1XC7A 4BQFA 3T3GA 1GG8A 2V5FA 1IXYA 5BNWA 2WTXA 3QWVA 4WNEA 4N5CA 2IEGA 2BGTA 3SZ7A 4U0ZA 1JEJA 2R60A 3BEEA 2LNIA 3HYMB 5KJNA 2AZDA 3L79A 3HBNA 4AIFA 3SYMA 3MEKA 3Q3IA 4U0UA 5D00A 3OTGA 3T7DA 2VQ2A 2AVPA 2C0MA 3PDNA 1WV0A 3MTDA 4HORA 1M5RA 3RKVA 2GPNA 3KD7A 3OT5A 2C4MA 3DZCA
chains in the Genus database with same CATH superfamily
4Y6RA 3KXKA 3I05A 1J0AA 4A3VA 2BFEB 4OYHA 1JMKC 1BS9A 1PWYE 4G5FA 1B42A 5EKQD 1O6FA 4JLUA 4CQLB 4ZAVA 1FT2A 1MJFA 4BO4A 3LF1A 5DDIP 3D2AA 2JLZA 1LC3A 4MKHA 3OMSA 3L3BA 4RZSA 4UUBA 4UMDA 4HMPA 3ECCA 2IHTA 3GZNB 5IX8A 3QW2A 4PH4B 5DYGA 1P5QA 2DVWA 4HO1X 1E6WA 4IGIA 3KKKA 4JXKA 1VHTA 3ZDXB 2GF2A 3PH0C 1IHUA 4F4DA 2AJ8A 2XUKA 3AEKB 4LTDA 3ITDA 4HH0A 1XDGA 2IV2X 2QI9F 1FXWF 1FMJA 1O1SA 3KD3A 1RWOA 3K1JA 1M8KA 4QPPA 3IUBA 4Q9NA 3AEQB 3IAHA 4CLDA 4L7VA 1OJLA 1OYWA 1ZD9A 4HATA 1ZD5A 1JDZA 2FFHA 5CU7A 1IM2A 4F4JA 2AMJA 3MRSA 3M2PA 3K71B 4HEA6 2HJGA 2NQ2C 1YHZA 1G1AA 1XAGA 3WQBA 1TJPB 2EX1A 1KYZA 5CDYA 4ABTA 2XUJA 4MS4A 4ZARA 1Y3DE 4AY5A 2A8YA 2NZYA 4UTPA 1V11A 4R4JA 1JJAA 3A4VA 5EEGA 3K15A 1LK0A 3INYA 1NIPA 4B6RA 2GGFA 4ROTA 2EIXA 3ASGA 3KVRA 4BB5A 3CJRA 3MFYA 3TSYA 2OWDA 4LRTB 3PSAA 3LWZA 3R5FA 3NIDB 2DVMA 4E15A 3RC3A 4L8YA 3ODPA 3PJGA 4W7HA 1UP4A 3AIMA 1CY7A 3UK2A 5BUZA 3BGDA 2NOAA 4EHDA 3WIEA 4HNTA 1LFDB 1VP3A 4N40A 4YDOA 2BSXA 3CISA 2RKKA 5KJLA 1W47A 5AXAA 3PEUB 1Z0SA 4N0EA 2FMKA 1Z3IX 1Y8RA 1UAYA 1UK6A 1CUUA 1KBZA 3FUUA 3W4IA 1NU8A 3FLMA 1U2EA 2L2QA 3MBOA 7REQA 1H5NA 1OCEA 2VXOA 2LTAA 3LM8A 3A9CA 1MQAA 1UJBA 5F3RA 4A6DA 3AMVA 2AQIA 4B87A 3QXHA 3DLAA 1ZM9A 2V7BA 3CX6A 3HXQA 4E31A 4CLEA 4TQ9A 4EGSA 2JCVA 2GCIA 3CKYA 1QGYA 2YNMC 3V1UA 5B1IA 3ITEA 3QQPA 5CYFA 1HMYA 2WSIA 3NGXA 3LWDA 5JD4A 2JC3A 5EUBA 3EFBA 2PZEA 3G5AA 1MABB 5LB2A 3H1TA 4NJMB 1U0GA 2K7FA 4ISBA 1RWQA 4DZRA 4B7UA 1OX5A 4DPRA 3DS8A 4DLUA 3UYLA 1RWWA 3C85A 5T8KA 2CNWD 1RI3A 1SU7A 3EEYA 4B3JA 3GLHA 4C0HA 2GXSA 4K9NA 3U7IA 3UXHA 4Q7JB 2WM9A 3Q73A 5ALHA 3MOGA 3PYLA 3U6KA 5A3SA 1JQKA 3OA2A 2EQ5A 3UMGA 1U04A 1M1NB 4KO3S 3NB2A 4REMA 1VDYA 2VSXE 1PG2A 1I9GA 4OIMA 4DLNA 3KHSA 1DMRA 3GAZA 4ZXFA 3OBBA 2LRHA 5JJ5A 4BQFA 2IODA 3R8FA 1T9DA 3QFCA 2IYZA 2ZB4A 2ZIXB 3HBNA 3DG9A 4ZOQI 2ZWMA 4G2NA 1M6YA 2TS1A 4MARA 3R8XA 2H1SA 3KPYA 3ONWA 3SC3A 2XSZA 3IA2A 4K6MA 1TJCA 5F7XA 3EW7A 5GTDA 4F96A 3ZEFA 1LF0A 1ZAKA 3CWCA 5LCXA 5FNVF 5F2EA 4BO5A 4QLOA 1P1CA 5JO9A 4ERXA 3IURA 4GI1A 1VLHA 4HGYA 5CURA 4B9EA 3BWBA 1QHYA 1XA4A 4HNAD 2UUCB 1V5WA 4NBWA 1OXVA 4N5MA 1OTHA 3LVRE 3KSUA 5AUNB 5HF6A 4JT9A 3TAXA 3G8DA 3EAFA 4MI1A 3PX2A 4LXIA 4RKEA 1H2WA 3L8YA 4DYDA 3MTGA 1DDGA 4BPBA 4FJ2A 2HLDD 4N0PA 2FZ5A 1G59A 2PZIA 4HRNA 3FUMA 2VTBB 4QJIA 3EY4A 3ASFA 4U6QA 3C3DA 3EGEA 4YAIA 2WB4A 4A0FA 3JQGA 3M70A 4LGYA 2L9BA 2RC6A 2C4HA 3SQLA 4BRUA 1IONA 4RPGA 2HSDA 3SIRA 3GCDA 3DXFA 1D2CA 2H0AA 1RWXA 3LRXA 2FE1A 1PGQA 1VBNA 1AOXA 1TUIA 2HUNA 2NO1A 1TA0A 3W7VA 4M38A 3WZ2A 1S3FA 4RV5A 1XROA 1MCZA 3IXQA 3R9KA 4JSYA 5DK4A 1YUMA 2X9NA 2OFWA 1F20A 1ZOIA 3K09A 2I67A 4MWCA 2X8WA 4B80A 5KYWB 4LG6A 2GK6A 3UANA 1R5NA 1UL1X 4KHZA 3BMOB 3HV0A 4QO7A 2PUVA 2Q3MA 5DF1A 5B6IA 4H2DA 4OFWA 3LNCA 3ESYA 3LC7O 3EPJA 5BVHA 2ZRFA 4HLDA 2RK6A 3E3LA 1ADJA 1LPSA 1V4NA 1G8JA 2QRMA 3DBVO 2YRWA 4EDFA 1JSCA 4UNRA 1THMA 4DUZB 2ZTHA 2PXCA 1JBQA 1P7ZA 2YMLA 5IC5A 4EKIA 4F8YA 4DJ5X 1RJDA 1KR5A 2VCYA 1OU0A 2QL6A 1M75A 4FT2A 5C7IO 2RHWA 4GD3Q 4EABA 3FN4A 3RYTC 4GYWA 3QVJA 3GCZA 4X54A 4JZYA 3M1AA 2C54A 2O3TA 1NUSA 1D5WA 2WBLC 4LI0A 1YQDA 1DAPA 1DWPA 3GEPA 1YDGA 3FCAA 4UNNA 3LUFA 3QB2A 3GA5A 1F12A 4BESA 2FO7A 4U9UA 1EYZA 3GLRA 3W5UA 3AQIA 2JI6A 4JI7B 2JEOA 2XGMA 4MTCA 4FD2A 2HREA 2WE8A 3FWVA 4XDYA 1HFAA 3QUSA 4FE3A 1P0IA 3A36A 5FORA 3ZUPA 1UN8A 3G7NA 4NG5A 3C3MA 2WSYB 1FSZA 1IU9A 1KSFX 5IAJA 3T0IA 3O3OB 4M49A 3RIEA 3B53X 3NANA 1GU1A 3WWCA 3NWJA 4ND2A 4I1OB 3D3EA 1UJKA 1P0QA 4B8AA 1RKXA 3ZG6A 3DUFA 3NDRA 3B5EA 1SEVA 5B4TA 4DNXA 4EATA 3EGWA 2F64A 3D64A 2AD5A 4LVOA 3Q7TA 1F3LA 3CMCO 5AO9A 2VAVA 4J8YA 3PITA 3ZE0B 4BTBA 2GO1A 4Y3UA 1PT5A 4DPKA 4PFKA 3TH5A 1I24A 1R4NA 4P84A 5EZYF 1N8KA 3IIMA 1VI5A 4G0MA 3VNRA 5I7AA 2D1FA 4ZO8A 2B4QA 4P5PA 5AVTA 3TZQA 1WCWA 4UFNA 2W11A 3UZUA 4OHXA 2X6HA 4YASA 3USZA 5HTOA 1FRVA 1MO3A 5ALFA 3T5PA 4N3GA 3G5MA 3OG9A 1IXYA 4PQYA 4NJEA 4QPNA 4QQFA 3MXOA 2K6GA 2B5VA 3TQFA 1PZFA 2P6NA 1R3DA 2QORA 4LMAA 3CWQA 1U8TA 1UKCA 1D1QA 1A04A 4Y1RB 3VZPA 2RIRA 4X94A 5DN9A 3RBXA 4ZYLA 4RXTA 4OJQA 2BKAA 3QPBA 1CJSA 2R8RA 2ZATA 5LP6F 4MPRA 2JGEA 4G8DA 3IX7A 1Z37A 1MO4A 2DY0A 4WUTA 2GN2A 3WI7A 3IUQA 5AJHA 4Z3OA 3C7DB 2IU1A 4XJSA 3O2NA 3ICCA 2A0KA 2CL6X 2JLWA 4IP0A 4GRIA 2K87A 1DXHA 5ERXA 2XQVA 1S02A 4DR4B 4TQAA 1E1QA 1ZRMA 3P2OA 3HJRA 3T9DA 3MV2B 4FYJA 3AI1A 3EUWA 5AI5A 3DF9A 1ZESA 4O4IF 4TL9A 1IY1A 3Q0IA 4C0AC 1YJAA 3ULEG 2FZEA 1XTIA 5U1PA 2G17A 4AZ3A 3DAGA 2HZBA 2AW5A 1BRTA 3GQVA 3HBJA 2HPVA 3AC0A 5JISA 4H7EA 1YZLA 3CF6R 4DBZA 3QTBA 4E6HA 4B3XA 1NW9B 2II6A 4J8FA 5AJWA 1WOMA 1D4FA 4CLOA 1CUFA 1VPEA 3F7NA 1R64A 1ZSVA 5AI8A 5B58C 5REQB 5I7RA 5IEBA 1USKA 3M3PA 2EINE 3VOSA 4JBYA 3E81A 2HMUA 3PZ1A 1QGED 4M36A 2Q0QA 5AW9A 3JSAA 5I3CA 2BGNA 1G3NB 1M6NA 4A16A 3L9XA 4F72A 1I3CA 1DPFA 2ZI6A 2V1UA 3B60A 3BA6A 4K9PA 4EYSA 4N9QA 5GONA 3HCFA 4EYGA 2UUBB 1RYBA 2VDQB 5AQEA 2EZUA 3JWJA 2AG6A 2GI4A 2OCLA 2YY6A 4RC9A 1V25A 4D79A 3WDKA 4C7XA 3MCTA 5FR1A 3Q2OA 3C3WA 1MC8A 3H2IA 3N2KB 4JBGA 4F2GA 2WT9A 3HYLA 4IJUA 3V3LA 2NT3A 3L41A 1U3VA 3M4XA 4MV0A 4C4TA 4D45A 5IKEA 1QCZA 4WVFA 1NMYA 4MI3A 1R7RA 1SA5A 3LY5A 1R66A 4PWYA 2NXCA 2H1OA 1WMDA 2WJAA 3D5TA 3AL0C 4YRBA 3SX2A 1COZA 4ZI3A 2HGZA 2V0NA 1PDWA 1G64A 4FN5A 5FNVB 3H5NA 3QEJA 3DNFA 2R05A 3KV1A 2P3SA 3VNQA 2ZI7A 3R9AB 4L1KA 1O5OA 3VR4H 1F1JA 5D6NA 1QORA 3B20A 1KRHA 4K40A 1RRGA 1IJFA 4OKNA 3UJCA 2G9UA 4DC9A 3GLHE 4G1UC 1H4VB 2J3MA 1H2UA 3VO9A 2V65A 3THYA 1CUSA 2YVKA 3RT9A 3EAGA 5AOAA 2V54A 3FNIA 7MDHA 1NLMA 5AHWA 4NI5A 2AB0A 5FAKA 1K7CA 1KY4A 4UTZA 5BV2P 1DLJA 2Q45A 5J4LA 3F96A 4D3FA 3WMRA 2WTBA 1PWHA 3R76A 4EYQA 3MUOA 1EUDB 2C3PA 3Q0TA 1FYVA 3ZBUA 3V2OA 1N75A 3VI3B 3EEOA 2VQ3A 1XXHB 1EU1A 1Q3HA 5EXXA 5LJIA 4DSNA 3IAS1 1W2HA 5A0VA 3OFND 1M1UA 1PLKA 8AT1A 4QPCA 1IHYA 5EG5A 1J1UA 1KEKA 2N75A 2QSUA 3PC4A 4X6LA 5BV7A 3RU9A 4TWIA 2RHMA 4N8DA 4YDYA 3PGVA 1WIWA 3I34X 2GD2A 1JG3A 2ZI9A 2ECFA 1A8QA 4R1TA 2QUKA 1IHPA 3DP9A 2W2PA 2OCAA 3LFTA 1NN5A 4MUMA 3CM0A 3BMCB 2EFYA 3C3XA 4FUTA 2Q7DA 4Y2PA 3GDFA 1MMFB 2LSUA 3LQFA 5MN4A 3K1TA 4F6LA 5KYYA 3IEGA 2YNMD 4OXNA 2IV3A 4X93A 3B2QA 3VJKA 3E7PA 2J9QA 1UPXA 3Q3VA 1ZVVA 4BKOA 2R44A 3GAAA 4MUHA 3R7DA 2CVQA 4CT4A 4UTRA 4KMMA 3OKPA 2DU8A 2J6CA 2FW9A 2WQHA 3FGNA 3SF8B 2CXOA 3ZEAA 5LDDC 2ZROA 4TS1A 2ZXFA 4S1PA 3QUBA 4LY9A 2DK6A 1J8DA 1CUCA 1ZY2A 4MVJF 5AKKA 2JFHA 3RK1A 2VSQA 3UA3A 3L4BA 1G5TA 4S2EA 4HCJA 4TV9A 4BJ1A 2WINI 2CL0X 1Z0JA 3QP9A 1S89A 1WKCA 4CGZA 3COVA 1WMAA 2IS1A 1NJFA 4FFNA 4ZGWA 1NUAA 4XQGA 4EQ6A 3K6KA 4GSLA 2WDZA 4ZO4A 2AZ4A 4DCVA 3PVSA 5EY5B 2NUTA 4U8HA 3L92A 2RAFA 2EAUA 2DBQA 1XD2A 4XDGA 3IKMB 4CFYA 4RZIA 4KXKB 4HMOA 4XEHA 1PVDA 5L8VA 1Y3CE 2SHKA 4CCYA 2RHJA 4NZMA 3S70A 1IPEA 2G36A 4LOAA 5JJCA 3FVTA 3RG8A 5CBPB 2Y4UA 1DKNA 3L1HA 4ANXA 1E7YA 5ALZA 2UXCB 4FGSA 4F9TA 3OZFA 3CT4A 3VA7A 4E33A 1JIIA 2OFOA 4K9QA 4EKDA 5A4IS 3VZDA 3GF4A 5ECDA 1C1HA 4IBOA 1DP4A 1L4NA 1CCWA 4IIXA 2AYZA 3G1UA 5K05A 5EE1A 2DHDA 3EZ7A 3UUGA 1O9HA 4UW9A 5GY7A 5CW2A 4JH0A 1WHTB 3JQAB 2WWWA 1X80A 3ZDZB 2R8PA 2JZOA 4QGSA 4D4JA 4ATZD 3LBHA 3NTRA 3AFIA 3V1YA 1RZ3A 3HWX1 3EGXA 1S3GA 4NE9A 1Z5PA 2R97A 1TT7A 4UEQA 1N6KA 3UK7A 3IQDB 3NYIA 4BMSA 1NWHA 2CV0A 5FWYB 4A8JC 3SBTB 3QI2A 5HZKA 5BR1A 3K4HA 5DMXA 2AFIA 3TG2A 4QWWA 1XNRB 4J16C 2VATA 2W0MA 2PX6A 5JH7B 1MIHA 4D0GA 2Z4RA 4CL3A 5F76A 3S55A 3JXEA 2WF5A 4OB7A 4ZTUB 1TZBA 1CQJB 5KX5B 1R0ZA 2CJFA 2IEDA 4M1TA 5LP6B 5F51A 1UBKS 5HOEA 2GXUA 1UH5A 1S7CA 1UXIA 2QT9A 4MGIR 2H8KA 4RJTA 5KZMB 4IJWA 3SEZA 4HY3A 2E6UX 1I2CA 3VMFA 5DB4A 1YIAA 3PE3A 4S24A 5AW4A 4ZV9A 1S8OA 5EYPB 2AK3A 4D5GA 1ZB1A 4NF2A 4O4IB 4GTTA 2H1HA 2HCJB 2IXDA 5HFJA 1QQ6A 3K6SA 1ZWKA 1GY8A 1R27A 4LCEA 2Q5LA 1SBIA 1DIGA 3BG5A 4RFSB 3HQ4O 4YXWD 5C3UA 2WWVD 2D0PB 1UBGA 3RARA 3BFJA 2HQ1A 3A6LA 2PGIA 4BZWA 1WDMA 1G5QA 1G42A 2LSVA 3LK7A 3KT6A 4DHWA 3NIWA 1YK1A 1E79D 5KYVA 1QGUA 3SDBA 2QGZA 4RHXA 4F1SA 4UWFA 3HR7A 3C2QA 1A9QA 4KEAA 3KSZO 1IC6A 5IN5A 5EJ7A 1V2GA 4D74A 1SW6A 5JAQA 3EXIB 1NUPA 2A86A 3EEIA 2H1IA 2CYAA 4FMCB 4NOKA 2GEFA 1LVUA 2H65A 3SQOA 4TV8F 1YR3A 1GG5A 3E2IA 3GLGE 2ZS7A 1XCPA 5JYEA 4HVCA 1Z2DA 1L0BA 2P4SA 1EM8B 4DDWA 1UODA 2N1BA 3VR2D 2GBFA 3SXUB 4P4SB 3DMYA 4DY6A 3VNAA 3DDZX 2YN4A 4BLOA 3W2TA 4RVOA 4F7WA 1X81A 4KIFA 1PZXA 3MX3A 4GQBA 3D8SA 3E9CA 4QELA 5C81A 4JHJA 3L17A 4M1SA 3ZJ5A 4H4DA 4RUKA 2GZRA 3OCXA 3JZDA 2Z58A 5JCJD 3S1AB 2ZYAA 4OGLA 4NNOA 4MKIA 4D26A 1XNFA 4XASA 3WJ7A 5K8JB 3ZV3A 2G8NA 1OFGA 3T6KA 1PLLA 3UHAA 4ESVA 2HU7A 3T3EA 2ZBVA 1L7AA 4HF7A 5ITZF 1CEXA 3OOWA 3JPWA 4DLAA 4QGHA 5JI3E 2BBTA 2RG1A 3AG4E 1KOGA 3X1YA 1UN9A 2B20A 4J76A 3A3KA 3B36A 1C8VB 3ZFWA 2NUPA 1KQ3A 4DX6D 1C9YA 4LZAA 4G5QA 3I53A 2RONA 4KH1A 4QBGB 4MVJP 3A1SA 4BX3A 4MSUA 2G4VA 5G0TA 2IOHA 4XJXA 1WAO1 3PNLA 2GILA 2PMBA 2PVCA 2ON6A 2PKWA 4YRCA 3UAVA 5JJIA 3ZWNA 1JHPA 3HBFA 1NP6A 5T67A 3MPUA 4WI1A 2YIDA 2JG3A 1N6RA 5A1TA 1P5ZB 1ETHA 2CNNA 4D6YA 4H7IA 2IEYA 3JRXA 1W34A 4EZKA 1HFKA 4KN9S 3KQQA 1HOTA 4BGEA 4CZ2D 3QW4B 2YKGA 3MERA 3PJEA 2D2XA 1SC4A 3ABOB 2DPXA 1EDBA 2IUEA 3V4LA 2QL5A 3TGPA 3R09A 4EB8A 2YWDA 4B46A 4EBAG 3RJZA 3W06A 3AF5A 2BMJA 1VRWA 1D0VA 721PA 3DKVA 2WHEA 4V24A 4N3AA 2JLAA 1A76A 1A27A 1Z74A 1PJSA 5TGDA 4RK4A 2JAPA 4V38A 2VNJA 4TL6A 4CEMA 3MS7A 4UAVA 3JQ0A 4C0SA 1F8UA 3OICA 3UKUG 4BBJA 4F5EA 4F60A 4W5TA 2X14A 1S63A 4AQ7A 2WJPA 1J21A 2RGNA 4E0BA 4L6CA 3KU1A 3W04A 2R6R1 2NVBA 5LQSA 3I2YX 5IFKA 4Q47A 3DJFA 4F06A 2FHSA 3VBEA 4G4SO 3K32A 3TXNA 4HI9A 1K8XB 1LZLA 1BN6A 3SPXA 3BE4A 1C5KA 4TSFD 3GJ3A 2WEKA 5KPJA 1OBOA 3FYUC 5C51B 4P29A 3TLAA 3ASZA 3N2YA 1UC5B 3W5IA 4ETWA 4E1BA 1OGJA 1R0RE 1Y9JA 2I2FA 3VZCA 3TM4A 4YCMA 2CLKB 1PR4A 3VHRA 3RD5A 1VFPA 1T5TA 1WCV1 2A0UA 3WLTA 3HK2A 3OO1A 3AWIA 5E7QA 3U4GA 1IMOA 1YQUA 1H9CA 2VDMB 4RZUA 5EL0A 3JYNA 5C2YA 2GUWA 1DVPA 5F1YA 3GWGA 4C7KA 2VYIA 1W4LA 4HEHA 4PZLA 3RNOA 5TJHA 4U2BA 4M1OA 3I3OA 3UMVA 3R5SA 5HQ3B 3UUXA 1IAVA 1MV8A 3LXUX 1E7WA 3BXHA 1NKVA 1CZRA 1MT3A 4PGFA 4Q9IA 1C3OA 3EIXA 3JQBA 3R75A 3U7GA 4ZZ1A 2C4NA 3F90A 1ZNZA 1GGKA 2PSEA 4LRWA 1P2FA 2PD6A 4J0DA 5D01A 5FNZA 1NNI1 9GPBA 2UZ1B 3DOFA 4QFDA 3OZCA 1IBSA 2XKJE 1OB2A 1G55A 2FW8A 5A5VA 5I9LA 4AURA 1NVGA 3RS4A 1T9AA 2P6RA 1MJGA 2V5UA 2PQRA 4G4JA 4D42A 4I1SA 2D2EA 2I7DA 4GGMX 4O4LA 3QX7A 3QKSA 3DT6A 4OFXA 1DQYA 1TJYA 3ZWBA 3QEMA 2IS4A 1AA9A 1KAOA 1Z0UA 3I2JA 4HAZA 4FC8A 3IESA 4YAFA 2CJPA 3GUZA 3QG1A 2RD2A 1W5EA 3QUCA 3HG0D 3DXKG 3M9WA 2EIME 1BEZA 2DPMA 3JRWA 3PS6A 3FCEA 4PCVA 4S1TA 3CZPA 2O0MA 1Y8AA 3ZVLA 4FM9A 1GRNA 1FCHA 1M5TA 3ZU3A 2HY7A 5DM4A 1PR2A 1XK7A 1SXGA 4D56A 4C6RA 3WL7A 2E7ZA 4PM4A 3IO5A 4RL6A 4UEOA 3ET4A 4F3TA 1TW2A 4UHBA 3SBEA 4TVSA 5K20A 2JCGA 2WYWA 3CX3A 5CNKA 3FETA 4LYDA 3UOAB 4X66B 4GPKA 1RIIA 4I4CA 3E70C 2NO5A 2BFPA 2AEEA 2AOWA 4IAOA 2BHRA 3SNHA 5C4IA 3VTKA 2DQZA 4HNAB 2O2GA 4INOA 2O8DB 2I6FA 3MF4A 4FCVA 4C6TA 4GRDA 4AKEA 1WVIA 4Q5IA 1IH8A 2WUGA 4TZ0A 3PQ2A 3PRYA 5LZ2A 5AKLA 2ASVA 3KG2A 2IU0A 1AKWA 4OH1A 1VE6A 3TWSA 3QKRA 3RAUA 1JLSA 3PFIA 4ALJA 1XBTA 3FMPB 3RC2A 5BSVA 4AF7A 4BCDA 1SHKA 3UIEA 1RD4A 1K9VF 1JHYA 2AFIE 3I4GA 2PLWA 3LHDA 1P3JA 3WYBA 2BFDA 4PINA 3EIHA 1UKEA 4DAEA 1IHOA 4OKIA 2OCKA 3SQWA 3KQPA 2VF5X 4A1SA 5DHPA 4ZC1A 1UBCA 5BT8A 3I2HA 2WP8J 1YDHA 1R8YA 4NMXB 2KZTB 2J3IA 2GARA 3P2BA 3KKEA 5FHRA 4R1PA 3W9BA 4F71A 1HYGA 3BWXA 4RKFA 1UW4B 3SO8A 3DZBA 4HQFA 3LVBA 2AUMA 2SCUA 1Z3YA 4PN3A 3NHRA 2O9JA 3ANXA 4KZPA 2JAWA 1VSQA 5ECYA 3GAMA 3ROMA 2A9JA 3WKEA 4N3CA 1AJEA 4PS0A 3OZTA 3C43A 1AF7A 4G9EA 4HNSA 4MGYR 5TQVA 1A5SB 2MU1A 2WQ6A 4CM9D 2GXAA 1MJHA 1JKIA 2VAMA 5H7XA 2Q9AA 5JBIA 3NEYA 3M8KA 1IDN1 4J91A 1FLNA 3APCA 3MCXA 2OWEA 5GWXA 3BS4A 3OJOA 4HB4A 2E4VA 4KQ6A 3WP1B 4LSGA 4IRUA 3E32A 1TC2A 5AW1A 4E5PA 1K3TA 1JR4A 2XDQA 4YRFA 1NHWA 4PLVA 1DINA 3V34A 1FSSA 2NZXA 3ZE6A 1M2OA 3TJRA 1TTHA 1Q44A 3TU3B 1XLUA 3DSXA 5BQXA 1HI9A 4GBGA 3MVEA 1KBQA 1KVTA 1E6CA 5ALEA 4MUAA 2MOWA 2B6CA 4C04A 5ANRA 4KLNA 3HKDA 2IU3A 4F4HA 2HBYA 2DX7A 3KKNA 4MMZB 3PCRB 3OKFA 2NV2B 2VG8A 5F5NA 3PA6A 4R1LA 1SC9A 3V9PA 1E2GA 4LQDA 3DOJA 4DABA 3NJ8A 3T7SA 4CM5A 1VG9B 3SK0A 3B1VA 2OCYC 1E2LA 4FTWA 1RFGE 5DCLA 4DLQA 4WJLA 3LHSA 4E09A 3WYFA 3HDHA 1MJ5A 2Z6UA 5DTJA 2EKPA 1PK9A 4ICIA 2PL5A 3R0QA 2IZZA 2QY7A 5IN4A 3EZGA 3PYMA 4Q3OA 4CGVA 4PO1A 2JLRA 4HFGA 3VJLA 4ZV4A 3H8WA 1I4OA 5AJZA 4EJ0A 1YA8A 5BUQA 1JQBA 1QG6A 1EP2B 4JL0A 2ICAA 3K9CA 3FIJA 4ILGA 2CJWB 5EX3A 3QPCA 1M34A 2HQRA 3BICA 2B4RO 2J4BA 2QRPA 4BX8A 1CRLA 4M1QA 3FYHA 2JI4A 3CF4G 1NP7A 1MNQA 4E14A 4TXHA 3P9YA 1N4DA 4PHHA 4PZPA 4ND8B 5IJAA 1MOSA 5AKYA 4TTVA 1M6HA 3VNBA 2X5GA 2GETA 1OWPA 2XS8A 1VB5A 4C6HA 2OHVA 2IX9A 5KINB 1RR6A 1YZQA 5J4KA 4US0R 1DC2A 2HIAA 3GRAA 3AU9A 3RIGA 1QZUA 3BILA 3IUEA 4JB8A 1ZU5A 1FLDA 3BSYA 3ZHOA 1NXXA 5F5LA 4EG0A 2IOFA 5GADl 3C3BA 4M8NE 1ODLA 4DMLA 5DBHX 1JG7A 1HK7A 2CVHA 4B48A 2YW2A 1E4EA 4NENA 3H1BA 3A2KA 1H6AA 5J2UB 1E59A 1I7PA 5TIIA 3O1LA 1ADFA 3L0BA 2CZGA 1Y1LA 1XCOA 2ZSHA 3EBPA 3VJRA 5EMNA 3W3ZB 1SXJA 1CFZA 2BEUA 1W46A 3ZVVA 1E2DA 2FX5A 2PZLA 4EJSA 4L6IA 2IHUA 4PC7A 3VVCA 1YIOA 3U26A 3H4TA 4JQSA 2WC1A 1BHJA 2J3KA 1E3QA 3CVUA 4M7OA 4BVEA 4YUAA 2BGGA 3B6MA 1EVIA 4RHCA 5GQSA 3ZX4A 3IUJA 3P2EA 4JI8B 5K5EA 1NASA 3CQCB 2I03A 3HCBA 3BT7A 2IOQA 3VR6H 3MWEB 1BD4A 3R7WB 4XE5A 1TA4A 1M2NA 3DZGA 4HQLA 3PDHA 4DAOA 3DAYA 1KNXA 2PZMA 2VGXB 4QVIA 1UBLS 5AVRA 3QLVC 1W0CA 4LX8A 2OSBA 4LWQA 4BGDA 3AUSA 1RXWA 1L5VA 1RJ9A 3HG7A 4I7EA 4ZT5A 3JXJA 2HLPA 5TS3A 1RQGA 3IOMA 2X1LA 1OH6A 1E2UA 5H02A 1N4PA 3EOBI 2AC7A 3TB4A 3KT3A 3W5AA 2G06A 1W5BA 3ROQA 4KHPB 3OPVA 4G0WA 3ZI7A 4II3A 4FQ8A 5AJYA 2GLTA 4WUYA 2O8EB 4PSDA 2VYVD 2OEPA 3A7EA 5IAKA 3TIXB 3NZUA 3P0FA 2HRCA 2H4JA 2CFRA 5FV4A 4W9NC 1EWVA 3LP5A 4E13A 4IS2A 1NFRA 3DWIA 3GMTA 1N1EA 2ZJ1A 3EPHA 2QFCA 4TUYB 4P4TA 4MR8A 5LDHA 3U3XA 1ZK1A 2PQNA 3O8LA 2ZU6B 2AQKA 3WGTA 1JIKA 3GFFA 1OKKD 3LXRA 4XFJA 3AVWA 2WTAA 3EEFA 4U8GA 3SYRA 3KS2A 2V4ZA 4YV7A 1MB0A 2AXNA 4QVKA 3RWOA 1CEQA 1FS6A 4NYIR 4GO1A 2D1TA 4R9VA 2QTVA 3ONEA 3GGJA 2PVPA 1XRSB 1KIAA 5JDCA 3QVTA 1F2TB 1ZD3A 5KJFA 1N5DA 2OK7A 5C1OA 4IV5A 3K7EA 2H3EA 4WT7A 1U2DC 3DMPA 3HKBB 3T15A 1LH0A 3REOA 4CIAA 2COEA 4LFCB 4ND1A 3I52A 2E48A 4E4TA 1TF7A 3EH1A 2LUHA 3UJ9A 5L3QB 1EE9A 4L0MA 5TY0A 1XMJA 4J3NA 2VP6A 1U2RA 3SGLA 3STVA 3H11A 1Y5NA 3WWDA 1LBIA 1D07A 1AS3A 4YCAA 3W6OA 4PCAA 3ZVRA 5J2TF 1O1YA 4EG4A 3U31A 4CF6A 1E9AA 1XZFA 4EA9A 1U9CA 2ECPA 3LTEA 1TOAA 4HL6A 2H06A 4FOPA 2I9CA 5LIRA 1QIGA 3HA2A 3BULA 3CEMA 5KAPA 3K9GA 2GPTA 1F4VA 3GJYA 4UQOA 1D7OA 2ZYDA 1U02A 3K0HA 4OXKA 4KJZA 1G16A 1NVTA 2R3SA 4BTEA 1MU0A 4UYJB 3L43A 5HJ7A 3PD1A 3C16C 2O8BA 1Y6JA 2GK7A 4PLHA 1GTRA 2LO6A 4H0CA 3T5AA 7YASA 4GPEA 2B34A 5DOZA 4GTVA 1WMBA 5FTLA 1ZUIA 1Q19A 2R8YA 4KH0A 4NAVA 2FQYA 2V7PA 3V7YA 2Q3EA 1OQAA 3SWWA 3RUFA 4MWBA 3G0BA 4BOYA 2C9BA 5K0FA 1T3SA 2JIZD 3H5IA 2WM3A 3N0RA 2IWRA 4O1MA 3B8EA 1DFHA 2BFCA 2JZNA 4C4XA 1UFQA 2YIMA 4JUBA 1SXQA 1XQWA 4ACKA 1BNCA 4K9OA 4CMCA 3P9ZA 5B3LA 1ZAYA 3OZ7A 4KG7A 2JA2A 5DX8A 2BSQA 1SR8A 1T2FA 3V1MA 4RELA 3CN9A 3UEOA 3VO2A 4ARUA 3ZWMA 2PEYA 3PUIA 3VLEA 3OPQA 3RFTA 3WL3A 3EDYA 1X1TA 5FOQA 1QHXA 2EFHB 5AICA 5C31A 1AKQA 1T9GR 2UVPA 1B2RA 1W0KA 3ROEA 4FPXA 4EUNA 4P92A 4O63O 2C5AA 1LQ2A 4Q05A 3B2EA 2XCIA 4JKIA 3HCWA 4R40A 3QE0A 5HIJA 2Q2OA 3MSCA 1JEEA 4O0MA 1JL3A 3E15A 4X65B 4NE7A 3ZGZA 1PJRA 3ZVMA 2LKCA 2MSNA 2WHPA 5BT9A 3LWNA 3H2YA 1OLSA 5ALSA 1YUBA 1Z4IA 5LU8A 1C7IA 4CM8B 3G9QA 4KKVA 2IKSA 5EIOA 2V7VA 3DO5A 2FKAA 1P1JA 4REQA 4U2GA 2D74A 4CF7A 1ZGAA 4FGKA 1DQPA 3JYPA 3KSDO 3RJVA 3UPDA 2WDPA 1ZK2A 3ANYB 2V3WA 4M9XA 1ZBQA 3DDOA 1H2TC 1U8CB 5DNEA 4EJ6A 2ZE7A 3LOPA 4Y18A 3HSKA 2CNKA 1GDTA 1M9NA 4XAQA 2X9LA 5LX8A 3CQ9A 1ZH8A 5EWLB 5C1IA 1R8SA 3UAZA 4WCFA 2OZKA 1T0IA 4GZCA 3KV3O 3NETA 1ZO8A 1O5IA 1B0ZA 1IBCA 2XB8A 4JFRA 4RHYA 5BQ5A 5LFAA 1EK5A 4ENQA 3QXSA 4LMPA 4RA6B 2AXVA 2OCIA 2G5PA 2VWHA 1K6MA 3CHPA 3MPOA 3SC2A 2BN4A 5AKHA 3KYJB 4RKWA 2A5FA 5M7EA 2BH9A 4BFRA 1MC4A 1U8ZA 3PXGA 2DXIA 3V30A 3FNEA 3MV3B 3BFXA 2FA9A 2QAGC 1HMPA 3UC9A 1R0YA 4ZHQA 4DEYA 1XEAA 1K6IA 4GPD1 3PBKA 2O0HA 4ZD6A 2WW8A 4CG1A 1NRIA 2LNIA 2JGNA 3LUKA 4WFKA 2CFIA 1KYXA 5DLYA 1TRKA 2DKNA 1UZMA 1M76A 3EMBA 2QSYA 4NQZA 2ID7A 3V4PB 1NLFA 2QN3A 1LW7A 5BY2A 4G0XA 4MTLA 4ABNA 2A5UA 4CTOA 4QUAA 4MW0A 1PZEA 4BQNA 4DK5A 4F8EA 5EVCA 1N6OA 4Q02A 4A8HA 5C35A 4OLJA 3DBLB 3GCGA 1ZGBA 2O8VA 1H6CA 1I0LA 2V4MA 4K3VA 3T5MA 3CRQA 1TZMA 1HTWA 1CG6A 1U0JA 4UDOA 3WMGA 2YZNA 4MR7B 1LF8A 2PFSA 1GTSA 5SYAA 1BGXT 4TVKA 3OMWA 3OX2A 1FMFA 3UOGA 1Y82A 4KQ9A 1MLDA 4OXYA 3VR5H 5IMSA 2W4MA 5BSWA 1QP0A 2JHPA 3TQQA 1N0WA 1WSDA 5CW1A 2GT1A 2F37A 1A7UA 1H8HD 4LJSA 4HLCA 2FR8A 1JRLA 1R0KA 3COPA 3HXCA 2PSHA 4WNIA 1TT5B 4HB3A 5K8CA 1SXJE 1FDWA 3M1YA 3AJDA 3PG5A 1UZLA 1ZH0A 5MFPA 2CL5A 1CY8A 4B0PA 4UPDA 4IKOA 1PCXA 2OORA 2OAGA 4QO8A 5KOYA 1PJQA 4GI2A 4OLFA 3N5KA 3MILA 1NURA 3I39X 4FZ3A 1G7SA 1KVSA 3FYTA 4KRXA 1TTTA 5JJTA 5G40A 4RMJA 2AV6A 3DE2X 1BKSB 4WKCA 2Z6VA 3B9QA 3D2BA 4Y0NA 3P0IA 4OYYA 1KJWA 3O93A 3GCXA 4H7HA 5IHXA 3WAJA 4E2FA 4FBGA 1SUAA 4MA4A 3JQ1A 1WS6A 5K3BA 1QXSA 2MYOA 3KHKA 2AJBA 1P7PA 4EZIA 4IFEA 3ZHBA 4HLQB 3FFTA 4OH7A 4DPLA 1LBQA 4GM1A 4L72A 1ZC4A 2VR1A 5JSZA 3O9MA 3HVUA 5FOWA 5IJXA 5SV2A 4JJ4A 3EVNA 2QZZA 5AW7A 2QMQA 1G8PA 4KFTA 4ZYUA 2CC2A 4RJJA 4OQ4A 4G01B 5EKSA 3BRWA 3UXMA 2GJSA 3A0RB 3TOZA 3K5IA 1PY1A 3LGSA 1MDFA 1U9IA 5A4KA 4UUAA 3UHJA 2LBPA 4MGHA 4HNQA 2D62A 1F51E 4DR6B 1QNLA 4EELA 4F93B 5JZBA 3HEMA 1QH1B 3ZZUA 4WN3A 4ODIA 2O2JA 2J3QA 1UEJA 2GBIA 4NPCA 2D2VA 3DE4X 1P5HA 1XQVA 2QOEA 2A94A 4GC9A 1BFUA 4QEKA 3CHSA 4UWKA 5K3CA 4K87A 1GL6A 4HK4A 2A58A 4N7MA 2V8BA 3T7IA 3O91A 1T9HA 1X87A 2ID4A 4Y1FA 3RSEG 1VZ3A 5JECA 1E3EA 3MAJA 3ESLA 3JQ7A 3NHFA 4OOFA 2XNSA 3Q3CA 4AEZC 3U66A 5JH7F 13PKA 3BXFA 2X0FA 3K8YA 2BGWA 1RP1A 1VKOA 2GPYA 1OWMA 4GEKA 3DVAB 5BSRA 4CQMD 2Z08A 4E2ZA 3UJ8A 2GFHA 3HXLA 4GP9A 5KX5F 3L0PA 1WCIB 3RWBA 1LXCA 5J2TB 4EGAA 1WP4A 3FHCB 4RV9A 1INLA 1OFUX 4TRRA 1ILWA 4QDKA 1JWLA 4FE4A 5GOTA 2MINA 5DT9A 3SP1A 3OLWA 3CVJA 1DKLA 2IIQA 3R5KA 5AVZA 1B1CA 5EYPF 1ULUA 1QK4A 2C94A 2FGJA 4DG9A 3GWZA 4KGZA 1ELRA 4R0NA 2ZIUB 3TGLA 1GGHA 1PYDA 5I4BA 1C2TA 1O1TA 4M9QA 3DE6X 4PSKA 2H85A 4Q9AA 1IVSA 3EXG1 5IVPA 1XRPA 2JIPA 2RE8A 3DH0A 2XB9A 3T5GA 3D9PA 5CVVA 1F06A 5JANA 5EIEA 3BTUA 3R5JA 2OBMA 2EATA 4QT4A 5BNZA 2EP7A 4QBKA 4M3NA 5SYNA 2ZG6A 5CXUA 2IXBA 3ES9A 1M5RA 2X8JA 5AWFC 5I7WA 3TI7A 1KPSB 4OVKA 3BXZA 4F3VA 3JY6A 1JILA 1AG9A 3IUMA 2VUIB 2DG2A 2WILA 4G07A 1AVTA 3O21A 1EIWA 4FMCF 1GPLA 4RE6A 2E0IA 5LCWC 2PPVA 3KOOA 2I6SA 4BNWA 1U8XX 3AYZB 1G8SA 3IVRA 4EKGA 1E3WA 3U1VA 4ZAYA 4C2BA 1C80A 2CNOA 3EVCA 5LDGA 2O3RA 3GH1A 3QE2A 2XBLA 2Z4TA 2Q9BA 3FOFC 4N82A 2PV7A 3QJYA 2VRBA 2H2AA 3USCS 5A5EA 2BUAA 3WXXA 1N95A 2FRXA 2IF0A 4YV1A 1EHCA 4Q7KA 2FSVA 3IQXA 4CNQA 2FZKA 5EWJA 3Q6MA 3NHMA 3CG0A 5HKKD 3WWOA 1X9IA 1K8KG 3I62A 3JS5A 2WXGA 1NBOA 3WL8A 4NIMA 3RYHA 5ICMA 4FS3A 1N5RA 5CFRA 5K0ZA 1IZ0A 1IBRA 3WLAA 1CR6A 1WW2A 2WI8A 1UMDA 1E66A 2H2IA 3AH8A 4AZVA 4JL5A 1D2RA 2BL4A 1H94A 2RC5A 5KS2A 1GDHA 4DWVA 3AZPA 4OY3A 5KBAA 4PDXA 4B6QA 4KMSA 2BZGA 4ARVA 4O60A 2DFLA 1RQNA 1V9SA 4CMAA 4DNQA 4HB0A 3X1WA 2WXRA 3CYFA 2QM8A 1Q77A 2H4XA 1RWNA 1WAMA 1RRPA 1JUQA 1BCRB 1GPYA 3CURA 2OECA 2OGZA 3OQMA 2H6HA 1QOQB 4LZLA 2PT5A 2UUAB 1IXZA 1MHPA 2JFYA 4M54A 3UA4A 3T38A 1HTBA 4PZCA 2WFLB 2VWPA 1QQEA 1NQXA 4BMZA 4BE7B 3FFWA 4JHLA 2GEUA 3HM9A 4V0LA 2EHDA 2ACKA 4FQ7A 3VTAA 2PGXA 3FJ1A 4FX2A 2H5IA 3ZHCA 4CDNA 4OX9B 3UT6A 3RRZA 3AESB 4B3RB 3DSTA 1JBEA 1ID1A 1C9EA 1QTIA 1LNQA 5GVSA 4OBWA 2O2DA 4C2AA 4KQCA 3IP7A 4WEQA 2ZANA 3VR1A 3HJFA 3PWKA 4DLYA 4BB0A 3RIXA 5HP4A 1QYMA 4DJTA 5EILA 2ZQ5A 4W7SA 1D9ZA 1O87A 1SKAA 4L9WA 3AUKA 2BBSA 3WFIA 1WLSA 2JGJA 5EJ2A 3VDRA 4IEIA 1GEGA 3AEUA 4US2R 2WKSA 4LFAB 3BIFA 1NVDA 1U65A 5TR9A 2YZKA 4CT5A 4WOKA 4JJIA 2H16A 2A5LA 4Z9AA 5LCWJ 4YI5A 1FU7A 1UC8A 4L3OA 2BTQB 3DP7A 2I1KA 4TGLA 2YBDA 4ZMSA 1OYOA 2VLIA 3EG9B 4QFCA 1E2EA 3K8QA 1N8SA 5DLPA 3BIOA 1JEOA 3IPYA 4RO0A 1QGZA 1X6VA 1WHSB 1RW2A 3MYVA 3FKJA 1RAIA 4QFVA 5EVJA 2QBYB 4R3UC 1I6LA 3LSTA 1IG3A 4J90A 3EDMA 1EFLA 1YCGA 1EFPA 3VISA 3E9MA 4R2IA 3O5AA 1ESNA 2EP8A 1R0XA 3QELB 5DZSA 1JHZA 4I99A 3U7JA 3TSAA 3OZGA 1L5GB 4KAAA 4A9AA 3OT4A 3SBXA 3COYA 5ERYA 4OEHA 5AIAA 1P19A 2I2AA 1TD1A 3R3VA 1QLJA 4FILA 4L16A 2HLNA 1L7OA 1HE8B 3I5MA 4NQ0A 3KJGA 4O2BB 5HG0A 3QWIA 2V8SE 3HGMA 1ACLA 4LYYA 4OHVA 5IXYA 2PGJA 3BRCA 1A7KA 3NIGB 2PBFA 4AF6A 2J3EA 2OQIA 4KAFA 4WHMA 3T5XA 4WZ6A 3DSSA 4ONEA 3O2JA 2DBYA 5HKPA 1FDUA 1ORDA 1XX6A 4KFRA 1U9JA 5EXSA 4HZUB 1A71A 4L50A 4IN3B 1V5FA 1EGHA 4BVAA 5EJIA 1U0NA 4B3TB 2Y0DA 3AHJA 1U5BA 3AFNA 2FW0A 2HYIC 5KNDH 3T7RA 1WLYA 1TRHA 5HIIA 4LZZA 3RLFA 3F6PA 3WR5A 2GN6A 4E94A 3UV6A 2ZJOA 3KUCA 1U0TA 1XZ8A 2A1TS 2R6FA 4M7WA 3G2KA 2B83A 5AOCA 2QPTA 3G2HA 3IQGX 3K0AB 1PFKA 1KSHA 4NE2A 1TK9A 1I2ZA 1L5YA 2VPIA 1H05A 3MUFA 3JATA 2P79A 2NZVG 1X70A 4NS1A 4JKOA 4KX3A 1DELA 4PX2A 1NRXA 1OYYA 4HAIA 4A8JB 3IHKA 1PVVA 4MVJH 2PX3A 3G89A 4RTOA 3A9WA 2BTDA 3EVTA 3AU4A 2AW6A 5CGZA 4NQRA 2HJSA 5KQSA 1SZAA 4TT3A 3RHSA 2I8LA 1FP1D 3C48A 3PQ5A 4Q4AB 4IXMA 2HBZA 3J5QB 1A9PA 1CUZA 1COWA 4CIXA 2DUWA 2DMRA 4Y2XA 5BSUA 5FZSA 1UBUS 1VIDA 2XUHA 2WMNA 3VU3A 1PR9A 4U5QA 5I7UA 1WKBA 3CUYA 2A90A 1IJEA 2HSWA 1K2WA 5ALXA 1TE2A 3LYLA 3W3AH 3T4EA 2H1FA 4GMRA 4MVJM 2V6GA 4DJAA 1NL4A 2J59A 4BNHA 4IIEA 1T3LA 3H2GA 2RKBA 1TZCA 3ASNE 1SQ6A 4ZAFA 4CDMA 1Z3XA 4Q6WA 4WDRA 2BSAA 3FB4A 3DAFA 1N11A 3RRYA 1SVSA 1L9XA 2KS6A 5A6CA 5E7JA 3RO7A 4M8IA 1BYIA 5KSZA 1ND5A 1JHXA 1DDIA 2CK3D 2JH3A 4RHUA 2V6FA 2ZBEA 1M1XB 2JJ1D 1NI1A 3IQZA 5FA6A 1EX9A 2AUNA 4BNLA 3LUCA 2QYJA 1N1MA 5JS2A 4TN1A 2PKRA 2ID8A 4YPVA 2ZDGA 1EJ6A 3FPJA 2BKVA 3H2BA 2HGSA 3ETEA 2ZR0A 4I8XA 4PYRA 2D54A 2X6TA 4UHJA 3KB2A 5AQ1A 1XRMA 1FQOA 4RL4A 1WY5A 2LW7A 3EASA 4AMVA 1MF7A 2XYRA 3WK5A 3TZLA 3FVQA 1R2QA 1OHHD 2JFXA 2WF8A 3WB9A 3Q8LA 5CPBA 1E64A 8OHMA 1S2DA 1H1LA 1H0KA 5BPPA 3FDHA 1E96B 1QU3A 4KQHA 1BDJA 1JLMA 3ZGLA 1M83A 2PBZA 3OPYA 4XLLA 2CL7X 2WXMA 1HDXA 1XVAA 3O9ZA 3RRBA 3IV6A 5TMBA 1QPBA 1M8FA 1TU3A 4F2PA 4WBNA 3GOQA 5A1JA 2Y2VA 3S5UA 1U0LA 5A3VA 1AQNA 1UDCA 4WNDA 2AVDA 2X15A 1NJSA 3WRYA 2HDWA 3N7AA 3P9XA 4HB5A 2OKCA 1PG0A 1UAGA 4LF6B 1AUQA 2MJLA 2BR3A 2QD5A 2NG1A 1NA5A 3ZCVA 4KJXA 1IDOA 1N7GA 1VHWA 2AR0A 4LE1A 3R7BA 1E5VA 4UZSA 3EF3A 4ACAA 1FNCA 1ZD2P 4L28A 2Q3FA 3CVOA 3CN7A 1ZRSA 4PZ0A 2ATCA 5COBA 4B6EA 2GOYA 1W85B 3U61B 4P4LA 3UWDA 3EJNA 3HYNA 1JQ3A 4I0WB 1KVRA 1DHTA 2A92A 1NUQA 4ALMA 5T8KC 1PD1A 2A3RA 2QE6A 3O31A 3THOA 1YJBA 5E1DA 2J09A 5AVJA 4QXQA 2GASA 3EOZA 4PC6A 4EA7A 3RRXA 3EIWA 4XR9A 3A27A 1Y3BE 4UQPA 1UFOA 4I5IA 1L5OA 4HAWA 1HRKA 3UFXB 4XX0B 3LPZA 1SA0A 3VKFA 3OQJA 1QIDA 1I2MA 2H08A 1L4EA 2WYUA 3C7AA 4TTSA 2Y8EA 3NPAA 3Q9UA 4JVSB 1JU9A 4NEQA 2YXNA 4OPMA 4WNYA 5JQGA 2HWUA 3QWPA 1V7PC 1MH1A 2JHGA 1NA3A 1I4TD 1C8BA 2ZRHA 1UJNA 1UPCA 4Z9XA 3AHHA 1OI3A 1AY0A 1IATA 1CQIB 3A1CA 4HBDA 3EVGA 1MQ8B 3G0DA 1KI9A 2A57A 1QRUA 1Q1BA 4J8DA 1Z06A 1P2SA 3CW2A 1KEZA 4CU2A 5EESA 1CJBA 2Q3CA 3AEYA 1KL7A 4KLZA 1XPRA 3WKAA 2HFJA 4JIGA 4UEJA 3L8MA 4NTZA 2HIGA 4UZEA 3OESA 1HTTA 2P7IA 3VAAA 1AKRA 1P74A 3FUJA 1E6KA 4RKQA 1WTAA 5CA1B 4IOLA 2QVZX 5J2UF 5DEOA 1NI3A 1DX9A 4CRWA 5HKAA 4AFNA 2HO5A 5G1NA 3HA3A 4ENPA 4DMUB 3PQ3A 2P62A 1G19A 2Y68A 3OM8A 3FYUB 2R59A 1YS1X 4I2ZA 1W1IA 3LQ1A 3WWEA 5HI7A 1QHNA 4YJGA 3SDSA 4YQYA 4R0MA 4ME6A 3A1NA 4NH0A 2B8EA 5L9AA 1DX4A 3ND6A 2ETBA 1V8BA 1II8B 3ZBTA 2OV1A 1YB4A 4MUXA 1QV9A 4GR5A 3JQDA 4UMFA 1IUOA 1JEQB 1G7RA 3NPMA 2A5JA 3AONB 2C9DA 1SCNE 2R02A 4K5AB 3BREA 2D5AA 3FE2A 1TNBA 1FPPA 5AW8A 4IF6A 3HYSA 3TGWA 2J0UB 2HSEA 2XWJI 5LZ8A 3UY4A 1YYHA 1WMEA 1KPHA 3NUQA 3ZS9A 1PTKA 5FTNA 5KOHB 1K0UA 1NX9A 5HE8A 3K09C 2YIVX 4Q0MA 1K89A 4RD3A 4G0NA 3RAGA 4ZOEA 3WGVA 3OU6A 3VSEA 5ALPA 3ERCA 3W4JA 4UTVA 1G5IA 2EYQA 5JMOA 4FC6A 1Z68A 2F00A 1R4MA 1XYGA 4GOKA 4H7YA 2P9LG 3QC1A 3TWOA 1GKIA 3LT5A 4ROSA 3OJXA 1JWFA 1JGTA 3QENA 2WD8A 5DTMA 4Q66C 2DZDA 1F6DA 1OXMA 3ZHUA 3GZ1A 2KCLA 1U0HC 1UJMA 5AJXA 1XZKA 3FUFA 1RW4A 4CTJA 4CKYA 3EXHB 4J7WA 3KXDA 3A1VA 4LUCA 1YT5A 2VN8A 5DJ5A 2ENWA 3A9TA 4DIUA 3GLTA 2XYQA 3MQ2A 3GFSA 1AGYA 3KSQA 5IC4A 2EJCA 3JQFC 4MYCA 4TUYF 3CC8A 4MP3A 4PIPA 1XA0A 4D4IA 2XADA 2X2PA 3B3GA 5D3MA 4R1OA 1WQ3A 1XV5A 1K3UB 5FWQA 3ZXUB 3T8KA 5F64A 1SQSA 4PEVA 2BHNA 5AVXA 1G1MA 2LR0A 4EOGA 1QQAA 4PGGA 4G0YA 3UVEA 3KSAC 4C7JA 1ISJA 4M0LA 1ODKA 2J5BA 1Q74A 1UUFA 3VX3A 4KLRA 3ZKWB 4DCGA 1WU7A 2B8NA 2X0RA 1U9ZA 2C5BA 1GOTA 3BWDD 5CP8A 1ZN7A 5DM2A 4LK2A 1MN6A 4KDRA 1SMKA 3PPIA 4D0LB 4BX2A 5KJEA 5LOVF 1D3AA 2ECQA 4B17A 1TYDE 4KV7A 2HJ9A 3HHEA 2WWYA 1UWCA 3L0IB 3OIUA 5GGXA 4BFYA 2VRCA 2Y3IA 3VAYA 4PONA 4U6SA 1Y7IA 2B4YA 2V6MA 1B6RA 1EFCA 4E32A 4XSHA 1KQOA 3LQ2A 3BF7A 3B3FA 1ZRNA 1ZHHA 3ER9A 4R9SA 5CAEB 3ISMC 3K9QO 1QR6A 1L3IA 4HWKA 4GLOA 1GZ7A 1R16A 4TKVB 1AKUA 3C74A 2ZWPA 4H7JA 1VJRA 4BJHB 2Y6UA 1MORA 4J2TA 2MSDB 2DWCA 2VK2A 5FTWA 4CM4B 4LZOA 5A04A 3F6RA 3FH5A 5JLJA 5H0IA 3PF9A 1CJVC 5LB4A 2E1RA 1JHUA 1R0CA 1JDUA 4HDMB 2IJGX 4YCNA 1Z5WA 1M54A 2ERCA 4GLFA 2G0TA 4S2UA 3KBBA 1U63A 3ADPA 1G66A 3UOWA 3WISA 5JJLA 3OKCA 3NWOA 3IIEA 3BKXA 2VYQA 4XIFA 3EA0A 3B95A 1GPUA 5ULLA 5FBVB 1D8EA 3VU9B 1XMQB 2CHZA 3PQ8A 1U8EA 3RC1A 4L8LA 1NYRA 2BEWA 3W6PA 4D5EA 1YGYA 3QOUA 4A0HA 4QBHA 4A27A 4PHTA 3M3DA 4XGIA 5CHYA 4QXAA 5CT4A 4FQ5A 4QDOA 1I1HA 3G68A 4JT2A 4XVHA 2VP2A 1JFRA 1VE3A 3RFCA 3ULQA 1WEHA 1IJKA 4KQMA 4TL8A 8ATCA 1OYVA 1NGSA 2VJLA 1XOIA 4NOJA 4L8VA 4KL8S 3NKLA 4FR2A 4P86A 3PE6A 2FQXA 2XJ9A 1EQ2A 3FAKA 1BW9A 2FV8A 2P6OA 1LEHA 4QJ3A 3AVXA 1HF8A 4Y0VA 5YASA 5KNCD 1JQEA 4HXYA 1DCQA 4EAAA 3CK9A 3KQMA 5GJCA 1ZKMA 5HRUA 4AO8A 1SCQA 2FKNA 1VSTA 2W6CX 3IT2A 5JNVA 1V1RA 2FN8A 4EHLA 2JK1A 3TCNA 4D25A 3RS2A 3I4FA 1XXLA 4ZVQA 1TGYA 1OCZE 5AK4A 4GTPA 4U8YD 1OROA 1WMFA 3O26A 2PSJA 3SEFA 3E22A 2C2WA 3T95A 2B6NA 3N07A 4Q9JA 4Q3EA 3UJBA 4LC9A 2C1EA 1OCRE 3PXBA 5K0LA 2GBLA 3IBGA 5GOZA 1E7MA 3OWOA 1LS6A 3OUUA 4MAAA 5HM8A 3MINA 3TK1A 2XZLA 3ICOA 4LFBB 4YCSA 4XARA 3W5CA 2W48A 3Q7FA 1U2GC 1KDOA 1G6Q1 5J3JA 3UT4A 3C3JA 3RUEA 4ALNA 3CNEA 4LHWA 2FX2A 4X3CA 1N7HA 3T5DA 2O50A 3AJAA 3V4OA 5JIBA 2GVZC 2QJRA 3VLFA 2AXQA 4ALIA 2BUCA 4TXMA 2QTHA 1HFWA 5IXJA 1EK1A 4DT1A 5A7HA 1F8YA 1XJQA 1EP9A 3BHJA 4YIKA 4ZQCB 2ZVDA 1KRXA 4H35A 4ZANA 1MB4A 4TXNA 3PA8A 4U5XA 3T3GA 4Y2GA 4DZZA 5JNUA 3VZQA 2FSHA 3GNQA 3I9OA 4ZQIA 1BHSA 1DI0A 2GA8A 1I2AA 1AQIA 1GWNA 2NAFA 1N8TA 4UYKA 1MZVA 1MB3A 1RHQA 1V16B 3ZPXA 1YL7A 1U0FA 4KQFA 4RHTA 3QVGB 2G76A 1NC1A 2D4AA 2VUTA 3DKIA 4XI9A 1FRNA 2P7HA 3CB4A 3GT7A 2DFNA 2GM5A 4RG9A 1P9LA 1GQQA 4G09A 1KJ9A 4BNMA 3ZWQA 1PQUA 4QLBA 1UOOA 4D46A 5ILGA 1UK8A 3WGUA 5HF8A 1DKPA 2MOKA 3WGLA 3GEBA 1YB1A 1V41E 2HK9A 3EYAA 3F4LA 5ES3A 2XMPA 2ZJ0A 1LBEA 4LMRA 1Y0BA 3PQEA 4UU0A 4ZDIA 3EDOA 4KPGA 2I7VA 1P8JA 4E12A 2VPYA 3R0JA 4XPIA 5FIUA 1CEYA 3GRUA 4DARA 4BY9E 2PRZA 5SYMA 1CEEA 2IYVA 3ZDYB 4MJLA 3L2OB 5I9IA 1X1DA 4ARBA 1KO8A 5ALMA 2OZLB 1SOWA 2PCJA 1V3VA 3IT0A 4CEHA 4WZZA 3PNOA 2O1WA 4M46A 3CV0A 4LOHA 4ZT6A 3ST7A 1SZPA 1KTVA 4OGGA 1URPA 2DPHA 4G56A 2ZRGA 2QIOA 3O94A 4JEUA 5DBIA 4II2A 2VPPA 2PL2A 2AOXA 3IPRA 3IEKA 4IMIB 3KWFA 3TWXA 1U3TA 3PPVA 3A7DA 3DLPX 4B7AA 4ZVMA 4EJMA 1LVGA 2ZYGA 2SICE 3LMKA 2ZRAA 1PU2A 1LWNA 3U3JA 4EY7A 5FPKA 2XMSA 4MRPA 4KDFA 2XMZA 1O96B 2Q5IA 3I01A 2P75A 5DKFA 1Y98A 4J0JA 3HCPA 1U7TA 4W6ZA 1R4ZA 3I23A 3KLNA 4OJMX 4F91B 3R9XA 3NCHA 5GM2A 3KSRA 5EIDA 5ES4B 4Q9DA 4DUYB 3E4BA 4U2DA 3BCSA 1UOHA 4I1AA 4Z4IA 5BO5A 1N32B 4H4CA 3JWEA 4KRYA 5KTPA 4BP9A 4UASA 4MKGA 3P9KA 1FDSA 5JNLA 3B85A 2WIKA 4RJKA 3NZSA 1B93A 1Y5LA 4I43A 1GUYA 4DQDA 2FSGA 4LGVA 4RNCA 1BYUA 5SICE 4RE5A 1NT2A 5F9MA 3KEFA 4X41A 4E5MA 2XQ0A 3F49S 2O3QA 1X7ZA 3HUFA 3EZ9A 3D1JA 4FHGA 1DO8A 1S3IA 1THTA 4FYKA 1QFMA 1AXRA 3WBBA 1BCSA 4WFIA 3ROGA 2XUGA 5T6MA 4MWTA 1YZNA 2BY4A 1S5PA 2WHRA 5JQWA 3CW8X 3HYCA 3WSTA 1R18A 4DVGA 2J9YB 3DEPA 1GSIA 2R9VA 1Q5PA 5LOVB 1OZHA 2TECE 1EUQA 2D1RA 2BTEA 4OHBA 2YX1A 2EG5A 3O84A 1IIRA 4BFSA 5CK4A 3C6BA 1LDYA 1MG5A 2QRKA 2B1JA 4DNPA 3LT2A 4U9HS 3W7AA 4D8UA 3BFPA 4C0KA 4RZ2A 3D8UA 2GK4A 4B2IA 3L08A 1YQ9A 5B2FA 4BE4A 2WAOA 3PQDA 5KSOA 2UWJG 2AA3A 3IP5A 4D9CA 1VL6A 3ZOZA 5L4SA 4UQYA 1WCXA 3ROTA 4P8RA 3NUZA 2O2XA 1FVHA 5FTPA 2QSJA 4JUFA 2ZBRA 1T1JA 3HJAA 1N94A 5DCYA 3AILA 1W4AA 5TSDA 1Y9DA 4TZTA 1Y7TA 5JROA 3U3DA 3MGAA 1LD3A 4X92A 1GP2A 3WGJA 2AJCA 2A30A 3TAUA 4H3VA 2APJA 2XF2A 4U0UA 3T7DA 3OJCA 2UXDB 1B16A 2MIIA 4DQLA 2XLCA 2HPHA 4LPSA 3FPLA 2WT4A 1FA9A 1HC7A 2EQAA 1JNYA 4JDUA 1ZGJA 4PG4A 3GPLA 4NEGA 4C6SA 4U02A 1RLMA 3OZSA 2HC9A 2FCRA 5TVGA 3D4OA 2C9YA 2KBFA 5JS7A 2Q2QA 4Z0NA 2FMHA 1PSWA 3RVRA 1YR7A 2C5EA 1L8XA 3N3BC 1X94A 2IVFA 1YV9A 5GZ6A 4OD0A 2B9EA 4ZHSA 4QTTB 4KN8A 4WESB 3TKYA 4DV3B 3V32A 2R4TA 3WLNA 1K1EA 3U7HB 2PFGA 3NDJA 3UFBA 5JXHA 2PIDA 2FAXA 2ADMA 3VO8A 1KMHA 5BSHA 2VHVA 1RRFA 1N2GA 5I7HA 3MTJA 1M6EX 5FOSA 4YT2A 4I5FA 1N33B 1FX0B 1W87A 1EG2A 4FFWA 2FULA 4JR2A 1SN7A 4BTAA 3DWGA 4Q4HB 4LECA 2BHTA 2OVFA 3PPWA 4CMKA 1EXMA 1TEZA 4R31A 1L3BA 3QEKA 1RWVA 1WB4A 1Y9EA 4X1OA 5H1YA 2WT8A 3BZBA 3RTAA 4C2TA 2CHWA 1F48A 4PNZA 1ZGZA 1G6HA 1U7OA 1YUNA 3K0CC 3R6LA 1I01A 3ACDA 2YV1A 4MLDA 1E9CA 2D6FA 2XT0A 5ENSD 2CLSA 3S27A 1V8DA 3JXIA 2PRJA 4JUAA 1NMEA 1U7ZA 4EKEA 2E3JA 3AOEA 4DANA 2XDYA 5KYNA 1PFQA 3VXKA 3KKMA 3FZEA 2PX2A 3IMCA 4BFVA 2QQGA 1Y81A 3H9JA 1WB5A 3DV2A 1QHHB 2B1RA 4GBJA 1KIMA 2RHRA 4CLHA 1QIFA 1RJGA 4ZALA 5CIYA 5KSYA 4WOCA 4FXPA 1CQXA 2X42A 2CMFA 3JZIA 1GPNA 1KI6B 2ZBUA 5D3KA 3DUWA 3M83A 2KBXA 1GL7A 4NURA 2HT6A 1PUXA 3RC7A 4OATA 3F6BX 4MUYA 2R6DA 4B33A 3MJTA 1OXUA 1GZ4A 2W98A 3HPRA 4ZRMA 4AVXA 1C7QA 3I37X 5KOJA 2LXMA 2C2KA 5AOVA 1KIFA 3FUNA 3OPYI 1N4AA 1JSLA 2DR0A 1YJ8A 4WXHA 2JA1A 1QRRA 4E4RA 4PRKA 1E77A 5LZ9A 3BB3A 2NN3C 4ENSA 3SQXA 2FFBA 4K0RA 3WRXA 3ZJYA 1HZZC 5TGZA 2BGMA 1A1VA 4W5HA 2VJCA 4IHJF 2BUBA 4FIDA 1Q0RA 1M34E 1C3JA 2I55A 4LK3A 1J06A 1J23A 3D6JA 5LMNB 4XWAA 4M1MA 4JASB 3KQHA 3QE3A 1ICIA 1L4KA 4N0MA 1JE0A 3R20A 1F2UB 1HR0B 2JFNA 5IJZA 4R5HA 3FTSA 3U4MA 5FIOA 3T5VA 3CR3C 4WFJA 2CBXA 5IK2D 2D0IA 4LQCA 1KHHA 4XX1A 1UBRS 1PWZA 1O5TA 3DPIA 2YUIA 3D54D 1QE3A 4APFA 1NR1A 3GT0A 3KYIB 1AKMA 2IWHA 1KFJB 4ER6A 4OFZA 4RMGA 1KEEB 2IC5A 4OXQA 1Z2OX 5D84A 4NVRA 5DU2A 3W8DA 1S2LA 2AE1A 3KKZA 2RGDA 4OL0A 3MYRA 1IQ0A 1CZNA 1G8YA 1JDJA 2KYRA 4HN2A 4ADSG 2F43B 3CSTA 2B99A 2FOIA 3BMNB 2PAAA 4O2BF 3OT5A 3QFTA 3OU2A 4JEHA 4PAGA 1DAEA 3HCAA 1AHPA 1EA7A 4G2TA 2IHNA 3NO4A 3VOBA 2WJVA 2ZKLA 3ZE7A 3TBFA 3ROZA 4DVJA 5DASA 5JZ9A 4PUCA 3OA0A 2EFEB 2BGUA 4H1HA 1OZAA 5G0UA 1G21A 3KQKA 3GL9A 5G4KA 2PT9A 3VYWA 5HUHA 4BKUA 2H2FA 2O07A 3FTFA 2VH2A 2GBPA 1U0SY 4MYDA 2OHXA 1Q15A 1OA1A 4ZI7A 5KTOA 1JPVA 2QZSA 3KXIA 4TXLA 3CV3A 3P0RA 3UWPA 1P31A 2A88A 4HQ0A 1RPNA 4AXBA 1N5KA 5K0EA 4A6EA 4DQVA 5IPFA 3E5NA 3G2JA 3B9BA 1CUIA 5KQRA 1Z7GA 3JX9A 1KAQA 4MWEA 3NTUA 2AG1A 4GPMA 2X5NA 4HDQB 2R86A 1OPXA 2JIBA 3VR3A 4WN9A 2PR2A 3EA5A 2BEVB 1EYHA 3VGPA 2OL4A 5T4FA 1W0JA 5E4FA 4QYSA 5TMDA 1IXRC 2ZYUX 4Z0PA 2I87A 3ZU2A 2D1QA 1RWPA 5ALWA 3A10A 4I14A 4GI5A 4GUDA 1FJHA 3JALB 2V7GA 1I13A 2XTMA 2GCOB 4FKZA 2WXFA 2WPDA 3ZHTA 4MV6A 2PM6A 1PJ8A 4RDXA 4UD2A 1OH7A 2WWIA 1UIMA 1UDAA 3SZGA 3T9CA 2X7XA 3HDYA 1YKSA 4BT8A 1XZGA 4LBVA 3ADDA 1TNZA 5JHGB 1PNTA 4GI7A 3AI3A 3RU2A 4GPTA 5EKUA 2YS7A 5G05J 1J2JA 1U3GA 4IFBA 1BA2A 5DMHA 4AKTA 4BE9A 5DIZA 3CGGA 1INZA 4ZT2A 5BR8B 1NUTA 3A6DA 2UY1B 5AARA 3Q75A 2PU5A 3GFBA 3FRJA 3L02A 2VYCA 2DWZA 4P3OA 1MENA 1GR0A 3CHRA 5G1OA 3RQIA 3S7JA 2GWHA 3FA2A 4K6OA 8LDHA 2R84A 4BO0A 5DBFA 4JCCA 4XDHA 2H2GA 1ULZA 2DUNA 4HLUA 2ZIGA 5LQRA 3NT5A 1GN8A 2EBFX 2GRRB 2QRLA 3OLVA 3OM0A 1QZZA 4DYVA 3A4TA 2LAIA 1S96A 4RM3A 4C4YA 5K3FB 4NFYA 1X3LA 3IC5A 2MR5A 1U7IA 3KOWA 1GPAA 3ZTTA 4V0NA 4BIMA 3U13A 2QAJA 2FUG6 4IJMA 4D82A 4UI9C 1KYQA 2FEMA 5KKNB 2EEZA 4NATA 1CUYA 4DG5A 3AUFA 3SKXA 3IIIA 1GL3A 1KY5A 1P5FA 2R25B 1AQ6A 1GTL1 3EFOB 4B0ZA 3MC1A 1WP9A 3Q98A 4I81A 1OV4A 4BLRA 5CLQA 3H5OA 4NBUA 3DPDA 1MNAA 1GT6A 1W88A 5IASA 3TR6A 4GYKA 4B0OA 4ZYTA 4CIBA 3OU7A 2E2EA 5CK5A 3PIIA 1QFZA 1YE3A 4NCAA 2N1MA 5MDHA 3RI3A 2Q5HA 2I34A 3R7LA 3V3KA 1SCDA 3X2QE 5B6PA 1N2CA 3AR5A 3RO2A 2VDWB 4WNAB 1E7RA 2QTZA 3FU5A 1RPJA 3TLGA 1P60A 3RIMA 2NYUA 3L49A 2NXEA 3KDPA 1NQUA 1K7SN 4AG6A 2VK8A 3BL6A 5CEJA 4Q4LA 2WJIA 1E4OA 3RV3A 4AUKA 4AZSA 4B3CA 5LLDA 3QKTA 2C98A 1WF6A 4S04A 2I3ZA 3RFFA 2ZUFA 1JWGA 4WK0B 1O7JA 4XGKA 2GPNA 3REQA 1XEWX 3OURA 1QLWA 4GOXA 2WD7B 3S44A 2RI0A 5BVGA 1RMQA 4WZBB 1NSTA 1YNOA 4F97A 1K6EA 4TLCA 4I55A 5JRJA 4Y98A 5J5VA 1FTQA 3GYGA 4I1VA 3IE0A 1JHDA 1SVWA 2JHAA 3S68A 4RDCA 4LBYA 3KO8A 1PGNA 2OBNA 3GJSA 2PMFA 1V26A 5KVCA 1XKQA 2PSSA 5P8WA 4EUFA 3ZH9B 4B2YA 1M10A 4MKXA 3AERA 5C4MA 5LZ7A 3TIVA 4YP5A 1ISGA 4DXHA 4DPMA 5UKDA 1J2UA 4UNQA 2ZRLA 2TMDA 4BFXA 1MA0A 1T4CA 1QIEA 2J4DA 4LNUA 5GJVC 2DLDA 1TYBE 2HCFA 5DGIA 1Q3KA 2X0KA 4NARA 3KJHA 3SBSA 3VJMA 3GW4A 1KZ4A 2BD0A 1HYEA 3BWCA 5BPHA 1HDOA 4XYLA 1TCAA 5EN5D 3FULA 3IB6A 3MKQB 4MP6A 2GJ9A 4O29A 2QRVA 1PFUA 5BSTA 2FZWA 3DONA 1CETA 3I9KA 4EL5A 5COQA 1GKKA 1UF9A 4UI9J 3GGDA 4P22A 2GAJA 4IHJB 2BZ1A 3NKVA 1U7UA 1D8TA 2G04A 1J7JA 4TLAA 3U4QA 2XQFA 4RZHA 1L1FA 5L7TA 3T4UA 4LS3A 5EJ8A 4WD3A 3Q41A 1PJAA 1IRIA 4K81B 1L6RA 3NXKA 1DXOA 3UMYA 3A37A 4GE0A 3WO0A 4L78A 2FX3A 4JX9A 1UMBA 1G8HA 4XWYA 3TZHA 3HA7A 1LGYA 2HNKA 5CA1F 4GWGA 1V55E 2Q1TA 1LLUA 1XN1A 3LPMA 2FG6C 5LNK6 1FDOA 4JUCA 2XYVA 4JOQA 1KI8A 4RF2A 4NECA 1KU6A 3IGFA 3FPHA 1NLYA 3JARA 3IAM6 1NW3A 2G5TA 3ESKA 4AMUA 4Y8VA 4PG5A 5C5EA 4GKKB 3BE6A 2MSLA 1NY5A 1J97A 4IVNA 2XPZA 4Y9UA 1RYYA 4LTMA 1AS2A 3T9KA 3MOSA 1RXIA 4JQYA 4JP1A 1H66A 3WK6A 1E58A 1OAOA 4J1TC 1KH1A 1ZX1A 4CV1A 4DTIA 2HBQA 1CR1A 2JVJA 3DSRA 3FEXA 1O9BA 3MTIA 1A4XA 1Q0QA 3UCEA 4L4SA 5C8YF 2GYVA 3DBSA 1JFLA 2DWOA 1TAHA 1YCSB 2QX6A 3H4IA 3H65A 5I51A 5A62A 1N9KA 5JHHB 4IILA 3DB2A 3IEMA 4RD2A 2IZ6A 5I9MA 4AJ9A 1Q20A 1PEAA 3OCZA 5CTAA 1QV6A 2M32A 4TX1A 3PX3A 3P2YA 3FWNA 2IIVA 1CVIA 2JDIA 3D3WB 2WK1A 2GCPA 2ORVA 4Y9SA 1DTWB 1Z25A 3IEUA 3L7LA 4QL3A 2MDTA 4I4NA 5IXSA 2XODA 1QHEA 3SIPA 2VJQA 5HQTA 4YAKA 2X6JA 5LQKA 1FSPA 1BD8A 1P2DA 2Y1LA 1K3FA 4FDVA 4G0VA 3CRNA 3NTLA 3WMFA 2E82A 3R7RA 1FP2A 5DWDA 5FUMA 3DEKA 2HA6A 2Q50A 5G02A 5CLLA 3PRZA 2QN8A 3G7SA 3VUFA 2CMDA 4DBLE 2UZ0A 4URKA 1ZEMA 2ES4A 3G7UA 1BO6A 4NDNE 1SHZA 2ZM6B 2PJDA 4OAQA 3HL4A 1N78A 4BVKA 1YOVB 2WWXA 5IT4A 3JD3A 1XJ5A 5AKZA 2Z09A 5KDOA 2VO1A 3V5NA 3FTVA 2CSUA 4WL0A 5EE0A 1ITZA 5D00A 3HY3A 4OQFA 3FCYA 3UCXA 4DXAA 3HO6A 2CUNA 2H9YA 1V8OA 2HR1A 1ESZA 4G0QA 2F1KA 4Y2UA 2A5EA 2GJ8A 4GSYA 4EVIA 5J5CA 3HY4A 1X7YA 2P40A 5LQJA 4MB6A 4HXIA 3CVLA 1JE1A 4BO7A 4FW9A 5F3DA 2C9CA 1RMYA 2NMVA 4RH1A 1YKGA 3E1KA 3RTDA 1KRWA 2BUGA 1ZIXA 4L08A 4H31A 1V4VA 1JR3A 3IMKA 5GIPE 4LVCA 2AUTA 3JUIA 1HDGO 3TB6A 4V0RA 1IOWA 1YOBA 4H77A 3RVDA 3I6IA 3PTZA 4YROA 4CF4A 3NHLA 2G1PA 4UHCA 4FMPA 5IP5A 3IJRA 4G4GA 4RKYA 2NUBA 4P08A 1JI3A 3IKTA 1UBJS 3WOVA 3HDGA 3OO0A 1OBHA 2CCKA 1V71A 4TTPA 2BFMA 3QVOA 5D0OD 3FB1A 4X00A 2IE8A 3PXCX 1ZOOA 3IH5A 2FQQA 1AXGA 3QPDA 4H3SA 4LJ8A 2M9MA 2Z30A 2ZTUA 3SHTA 1K9SA 2QE7D 3IBFA 4F5WA 3ZD7A 1NXWA 3FMFA 5DI9A 1K7FB 1PW7A 3O82A 2PZFA 1D2EA 2DC1A 1YL5A 3BVPA 4JA0A 4CQNA 2CUZA 1VG8A 1YA6A 4G23A 2IW1A 1EHIA 2JLUA 1K97A 3MRVA 4LI3X 1SU4A 2P9EA 1NXVA 2GA9A 5KI6A 2QTCA 2J6IA 4DUGD 2XT9A 1VJTA 1WSWA 1PV2A 1KDZA 4IYPA 2C1ZA 5A71A 1OH8A 2YVUA 3LA6