4N3BA

Crystal structure of human o-glcnac transferase bound to a peptide from hcf-1 pro-repeat2(1-26)e10q and udp-5sglcnac
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
716
structure length
697
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title HCF-1 is cleaved in the active site of O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/substrate
total genus 275
structure length 697
sequence length 716
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3bA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3bA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4n3bA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4n3bA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n3bA03
4JA7A 4NEQA 3PE4A 3QOUA 2Q6VA 2GEJA 5ARGA 2IEGA 2G9RA 6GPBA 1V4VA 2ZB2A 1PYGA 2LNIA 4UI9J 3MTDA 4IN3B 2SKCA 2XA1A 4CTOA 1QQEA 2AZDA 4I2WA 3CUUA 2XCUA 2R66A 5CCMA 2ECPA 2GPBA 3MKRA 3CUVA 5ENZA 2WQHA 4MHSA 4AY5A 4H7YA 2QNBA 3L7AA 1TJCA 3CK8A 3MEKA 3RKVA 2GEKA 1NA3A 2OOEA 1ZBPA 2GJ4A 4N9WA 4U0SA 2E2EA 3ZGQA 2ACVA 4RENA 5DBKA 4N3BA 1P4GA 4EKEA 1JIVA 3BD8A 3OY7A 2QFCA 3MV2B 5TVGA 2VG8A 5D0QD 3MBOA 4NQ0A 1WAO1 1ABBA 3OT5A 3O3CA 2VGXA 3G2HA 5G04C 1VGVA 3MQFA 3S28A 1LWNA 3BCRA 4MRAA 2AW3A 3RSCA 3CV0A 3H4TA 1J39A 4HOQA 4N2SA 1Z6QA 4RELA 2BISA 4HWGA 3DD1A 3G2KA 1C8LA 4MI3A 4J8DA 3S7JA 2R4UA 3S7BA 1K08A 4WADA 5BW8C 3GZ1A 3UPVA 3MA5A 3C4QA 3DZCA 4GZ3A 3IA7A 1RRVA 1OUVA 2PZIA 3ZHEB 4XI9A 1IIRA 2HYZA 5G05J 3R9AB 5CHEE 1Z62A 3ZCQA 5HQ8A 1UZUA 2XCBA 5GPBA 4GYWA 5JTTA 3VUEA 1PSWA 4KQ2A 3N71A 2BFWA 3OKCA 2ATIA 4U07A 1C50A 3QHPA 4JHRA 2KC7A 2GPNA 2GT1A 5EX3A 4F9FA 3T7DA 4CGVA 1FTWA 3UUXA 3QKWA 4RBNA 3COPA 3ZCPA 4EJ2A 3G2NA 2QLMA 3MRVA 2PYIA 3OTGA 2FF5A 3VUFA 1XL1A 3ASHA 4HOSA 3BD6A 3NP7A 4KQMA 3WADA 3RIBA 3CKBA 2F3UA 5HI7A 3SF4A 3UQ3A 1Y6GA 2C9ZA 4GA1A 2C0MA 2FFRA 1KT0A 2XGSA 1K06A 1NOJA 1M5RA 2Y4UA 1WM5A 4EL0A 4ABNA 4CDRA 1ELRA 4N3AA 3CX4A 4WNEA 3RO3A 1C8KA 1WW3A 4REMA 2IF4A 4RIEA 4CGWA 4EQFA 3T3EA 2IEIA 3L7BA 1P4JA 2QRGA 3GW4A 3FFLA 5AYWD 4PQGA 3T5TA 4YUAA 3ESKA 1FC0A 1AXRA 2QN3A 3E3NA 2LSVA 4HOUA 3LY9A 3Q3EA 1Y8MA 3VTYA 4GYYA 2KCLA 1A8IA 2QRMA 3S7DA 2NC9A 3WXXA 2IYFA 4WNGA 3SYMA 4WNFA 4NC9A 4EKYA 2GPAA 3CVQA 4NRHB 1GZ5A 4WUYA 1P2GA 4RIFA 5D00A 5D01A 1IXYA 3GPBA 4F97A 3TAXA 3CVLA 5HXAA 3CUWA 2UY1B 3CK7A 2PL2A 4N39A 5DIZA 5JTUA 3MSCA 5KJKA 2VSYA 4GZ6A 1UQTA 3ZCRA 3OXFA 1SXPA 4YNDA 2FO7A 3JYSA 1H5UA 1P5QA 2AV6A 3HBFA 1RZVA 4XI0A 3OKAA 4RG6A 5FZQA 1NZNA 3BD7A 5FZRA 1YGPA 3K9IA 2OFFA 3UYLA 3PDNA 4GYOA 4UI9C 2KCKA 1IHGA 2G9VA 1L7XA 2AMVA 3S29A 4GCOA 5EKQD 4BTBA 1L5QA 3FWVA 3ZFWA 2QN7A 1YA0A 2XCCA 3NB0A 1WW2A 3NPAA 5D0OD 1P4HA 3CEJA 3TGOA 5FZSA 2X0DA 1AHPA 5TMEA 3NP9A 4GPBA 3MT8A 4HLNA 5LCWJ 3VDMA 4BT9A 1NVKA 4HOTA 5KJMA 1E96B 3D0RA 2I6HA 3MV3B 3G2JA 5I45A 2C1XA 3HYMB 2SKEA 2JLBA 3G2IA 1FA9A 2R4TA 3QWPA 4G2TA 5BNWA 5JJ6A 3L79A 4F96A 3NAZA 4FZRA 4UQXA 2QLLA 4I2ZA 1XKXA 3U3WA 2GW1A 3LCAA 3CEMA 3ZCVA 1NA0A 4L22A 3CVPA 4MI6A 4KQ1A 1JG6A 2QZSA 2C1ZA 3MT7A 3AS4A 1PN3A 4GA0A 3SYRA 2QN9A 3Q4AB 4F3VA 4G26A 3EBPA 2FEZA 4CTMA 1WUYA 4G1TA 3U4TA 2Q7FA 5M72A 3QWVA 2BUGA 2IW1A 3ASGA 3ZCSA 5G05C 3E3OA 2KS6A 8GPBA 3Q15A 2XPIA 5ARFA 1FU7A 1P29A 2H1FA 3EBOA 3FROA 3Q3HA 3CK9A 4LEUA 5BT1A 1P2DA 1JEJA 2VCHA 3AMVA 1HLFA 4AN4A 2XA9A 2XEVA 1F6DA 4EL5A 2G9QA 3RHZA 1JIUA 3WC4A 4G23A 4N3CA 3Q3IA 4UQYA 3CUYA 3UYKA 3PE3A 4KBQA 3CV3A 1O6CA 2PQNA 2QRHA 5KJLA 2QRPA 3MRTA 1FU4A 2ONDA 2XGOA 5IKOA 2WTXA 2JJMA 2GM9A 2F3PA 1GG8A 3VDNB 3G2LA 4JL0A 2FETA 3CVNA 2PQRA 2IV3A 1L5SA 4FKZA 1Z8DA 4J8EA 2F3QA 2C2LA 2J9QA 3KAEA 4BQFA 1QZ2A 4W6QA 4J8FA 3T3GA 4CTNA 3CKCA 3L7CA 1FS4A 2ACWA 2R60A 1GPBA 4RIIA 4MI9A 2BGTA 1Z6PA 3GYZA 1KLXA 2X0EA 3LY7A 4B94A 2VYIA 2XGMA 2QN8A 4ME2A 2IV7A 4G24A 2V5FA 2F9FA 1GPAA 2X0FA 4M60A 1HZ4A 3RT1A 4AY6A 4U04A 3OKPA 3ZCUA 1HH8A 1KT1A 3C4VA 2P58C 3LPZA 2G9UA 3S27A 3BDAA 3RO2A 3S7FA 5CCLA 4X7PA 4QLBA 4N5CA 4GCNA 4YI5A 1QM5A 1FU8A 3EDTB 3MT9A 2WPVA 1E1YA 4M7PA 2SKDA 4A1SA 1F0KA 1GFZA 2C0LA 1FTQA 4Y6CA 1GPYA 1ZU2A 1E4OA 2QN1A 3IAAA 3KS2A 2H1HA 3MS7A 1LWOA 4AM9A 4J0UA 1JG7A 1WUTA 4LDPA 4G2VA 3ASDA 9GPBA 4RG9A 3L7DA 3E3LA 3C48A 3ZPJA 4G25A 3BCUA 1P2BA 3TSAA 4BWRA 1FTYA 1B4DA 1QKJA 2QLNA 3IEGA 3DDWA 5FJYA 2AVPA 3MS2A 2HY7A 3QWWA 3T3HA 2UWJG 1L5VA 2ASVA 4XIFA 1XV5A 1Y6FA 4KYOB 3D1JA 4W9RA 3NC4A 3URZA 3T3IA 2PRIA 5IKPA 1NOKA 4WNDA 3DDSA 4I17A 1PNVA 5A7DB 3ZHEA 4I9EA 2X6RA 5TMBA 4UQZA 5LCWC 2IFUA 2YQ8A 2O6LA 4NESA 1EXVA 1XNFA 3CUTA 1Y8ZA 2X6QA 1NLMA 2P6PA 4YVQC 3MTAA 4I9CA 1JIXA 3QKYA 3S0JA 5G04J 5JJTA 3FP3A 3NCHA 3NF1A 2MHKA 1GGNA 1ELWA 1A17A 1L5WA 2QRQA 2XCIA 1XL0A 4Z5XA 4BTAA 1WV1A 3E4BA 1W3BA 4RIGA 1SXQA 1IYGA 1NZFA 2VSNA 3QDNA 4YVOA 2HO1A 3S2UA 3O48A 5FT9A 2DBAA 4UI9K 3RSZA 3OY2A 1KTIA 1WV0A 5DLDA 5A6CA 2L6JA 4LEIA 3Q5MA 3LYAA 1FCHA 2YHCA 2KATA 2PQ6A 3ZCTA 2VGXB 3ULQA 3CEHA 3BEOA 7GPBA 3OXLA 1NOIA 4AIFA 4U0UA 4WHMA 3TG4A 4WACA 1B89A 3Q47B 4GZ5A 4GPKA 2JZCA 4AMGA 3AS8A 2Y4TA 3LY8A 3BCSA 3MS4A 3MRXA 2FF4A 5DXFA 2C4MA 3RJVA 2HR2A 4YI3A 3RU0A 3BEEA 1RZUA 4AMBA 2IUYA 5TMDA 2XMPA 2R68A 1HXIA 2PYDA 2FBNA 5LQDA 3ZN3A 4APOA 4BT8A 5EX0A 1BX3A 2UY1A 3TG5A 4X7MA 3WAGA 3HBJA 3GZ2A 3Q49B 4O6FA 3ASFA 4RIHA 3OXGA 5C1DA 2PRJA 4KXKB 1EM6A 4X6LA 1UQUA 3LKUA 2IYAA 3L01A 5DU2A 2VGYA 3HBMA 3SZ7A 3HBNA 4M83A 1YA6A 4X7RA 1XOIA 4N2QA 5KJNA 2FI7A 4MICA 2KCVA 2QN2A 5FTPA 3H4IA 3TOVA 3KD7A 4GA2A 5JJ7A 1PC2A 4JA9A 3OTHA 4I1AA 3D0QA 3T3DA 3VTXA 1L6IA 3OTIA 1XC7A 2VCEA 4BQIA 4H7XA 3AS5A 2VQ2A 3MTBA 4Y6WA 1NZDA 3GUHA 4BQEA 2LSUA 2XA2A 3CEQA 4BFCA 1C3JA 2F3SA 4HORA 4U0ZA 2R5SA 2BGUA 4MHOA 1L5RA 2YJNA
chains in the Genus database with same CATH superfamily
4ZOBA 3N2LA 2ZB2A 2XCRB 3MTDA 1W48A 2G04A 3HYCA 5JNUA 1CYEA 2R66A 1VYHA 4BNNA 1RLOA 2N3ZA 1B6TA 3MYYA 5DP1A 1Z75A 4CR6A 2CJWB 2CD7A 3EXFA 3LHDA 2VKQA 1XRNA 4TYYA 1UAGA 1X1AA 3TI9A 5C8YF 4M89A 4RA6A 3RSCA 3ADCA 2QHXA 1I3NA 5KWJA 3SBOA 1QHHA 2IK8A 1SKMA 3WGNA 1X87A 5COBA 5HSGA 1N75A 3FD8A 4MQFB 3EXIB 3ZHEB 5AVKA 4O4HA 1P0CA 3WLHA 1ABFA 2P30A 3EOAI 3GV0A 4MGYR 3R7SA 1VG1A 4TQ9A 2FPIB 1WD7A 2YN4A 1TM5E 1TADA 2F3UA 3CTPA 4GNKA 2V7PA 3BB1A 2EILE 3SLRA 5A5EA 5THQA 1OCEA 1WM1A 3AUJB 4GLBA 4Z2AA 4LXUA 4YNBA 1U3VA 2VHTA 4IH1A 5A4FS 2ZLBA 3HZZA 2B92A 3MWEA 2PFGA 1YQUA 4UMDA 1TM4E 1RKVA 1E7YA 1UN8A 1TYCA 3FTEA 3EZ6A 4IL5A 1XJ5A 3G0IA 1E1MA 3R5JA 2PX8A 4E5DA 1GG2A 5I9IA 1GV1A 4BKRA 3JR3A 1YA0A 4Q9AA 4ID9A 4DDKA 5FUMA 3N6XA 3IKOB 3CLKA 3MT8A 4Q34A 3D6UA 4UXJA 4V02A 4I1MA 1X1SA 4NMHA 4YCLA 4PONA 3TGPA 3IQWA 3I3SR 3PWKA 4M9RA 5FKJA 4IJ5A 3RAFC 1OILA 1KVTA 5H7XA 2FJDB 1JPLA 4WY5A 1PD0A 4B4UA 4PZUA 1S2OA 3FSJX 1A8QA 4O5AA 4KLNA 4UBMA 1YD7A 3I01M 4NECA 1C3OB 1TGVA 2OV8A 3CHPA 3I5YA 1CZHA 1O95A 4IJUA 2X6JA 2L42A 2HQRA 3IUYA 2JHGA 1F12A 2AZTA 3OE4A 2XADA 4H3HB 3DUFA 3B7RL 1OHHA 4EA7A 4YYZA 1YCDA 2G70A 4H0CA 3UMVA 3P2BA 1W19A 4BFTA 4C7OB 1SG6A 3C4VA 1QK5A 2G9UA 3Q7TA 4JJKA 2PUDA 2V5AA 2ORWA 4DVJA 1BN7A 4H6VA 3O8RA 2D2FA 1Z4LA 3I2IA 3DMHA 1G6HA 5G2OA 3DYVA 4Y6CA 3B1KA 3HG7A 1TKCA 3WGMA 4X61A 3B36A 4A03A 1JKXA 2Q9BA 5FWXA 4BVJA 2A58A 4IILA 1Q91A 2ZIVB 2JEOA 1DC3A 5C32A 1YRWA 4BTLA 5HUQA 5I7EA 1KYYA 4J90A 2PVSA 2I6XA 3IAEA 3A28A 2CL6X 3COVA 1QRDA 1ZGAA 1NTRA 5HEKA 4TV9B 5EIBE 4XARA 4H4CA 5K3BA 3UAGA 3GFSA 5IC4A 5LVAA 4LVCA 5H8WA 3HXBA 2BYTA 2CT8A 5CIQA 1VYTA 2VJOA 1U28A 1Z6TA 5LQMA 3QDNA 1GNLA 1XEFA 5H02A 3Q1KA 2PANA 2VEDA 2DPMA 4V0OA 1E0DA 4IIDA 3A1FA 2G80A 5FWYB 4AV7A 6YASA 2HRDA 2JKYA 2ODNA 4PZEA 4URUR 3E9YA 2YWBA 5DJ5A 3A6DA 2GN1A 1JSCA 4GZMA 2V0GA 2A1UA 4INPA 5FQ7A 5DTQA 3O7WA 5CLQA 2DJIA 2WAAA 1MH9A 2GILA 3PQ2A 1NNSA 5JH7A 4E13A 4PYJA 1LPMA 4S35A 4HQDA 2FI7A 2CLCX 4GR4A 1GU1A 4PBSA 3RWOA 4ZODA 3VTXA 3RVBA 2A0XA 1XC7A 4D43A 1ZOPA 1EBUA 2Z2IA 4EPRA 5JAOA 1FUEA 3WY9A 4JD5A 1R50A 3G7UA 1G3NB 2NYUA 3FSGD 4OVKA 1D1SA 1T8UA 2VLBA 4MRVA 3Q7QA 1QH9A 1PJ4A 4BFWA 4Z99A 3HEMA 5FUVA 1BRMA 1E0SA 4YCCA 2VJLA 5KOYA 4WBNB 1KO4A 4YXWD 1DRJA 2NO5A 4PV7A 2PR7A 5I01A 1TN7A 4QUJA 4BRSA 2WUGA 4R1MA 1GGEA 1FF9A 3L8HA 2C7PA 4RENA 1DDGA 1YJCA 1RMYA 3QBTA 4RVCA 1RJ9A 4DV7B 1ZGBA 2YJTD 1AP7A 2VDPB 1TVKB 1HTTA 2H0QA 4DKJA 4LHXA 2CL5A 1J7KA 3LPCA 3OQ6A 3MQ2A 1UMBB 3QI2A 5EWMB 1RQGA 1V3VA 1E8ZA 3DC7A 2ZT6A 1WP9A 1SQ5A 1G2QA 2XYGA 1H6DA 1VHQA 3QEKA 2DUMA 2WM3A 1EM8A 3LKZA 1L4UA 3EIEA 3Q5EA 3RS8A 3WGGA 2BLNA 2P6RA 3M4NA 3RS5A 1VCNA 3U1BA 2YV5A 4WESA 3FGPA 3L9XA 1FQOA 1U8ZA 2Z2ZA 2M6KA 4D9CA 2OCAA 3SY2A 1YCGA 1UFKA 3P5BA 4DL9A 2EX0A 2BKLA 2HMYB 1SOUA 3HLTA 4EPZA 3CZ9A 5IEBA 1G3UA 3CLVA 4I9FA 4B7UA 1L3CA 5IJAA 4X84A 2ZROA 2R17C 5DM1A 2HWKA 4FJ1A 4L4SA 2POQX 3RV3A 1IHGA 4QM7A 2HQBA 2P0AA 5FA8A 4EGCB 4C08A 4FXOA 2Z1DA 3LQRA 4EA9A 5CUQA 5KJMA 3V4ZA 5I9NA 4HXYA 3RRUA 4G1EB 4N1AA 1GLNA 4LSWA 3O26A 4L4ZA 4GA0A 5FQ6A 3A26A 5LYJA 3TXAA 5IKXA 2PIAA 1Y5LA 1G16A 3C97A 1RCFA 3AB7A 4HZGA 5KNDA 3JD1A 3IA2A 3F6CA 1S2NA 2LBPA 3PNKA 5CFPA 1Y5NA 1DWUA 1GGJA 1UM8A 3BXPA 4Y8VA 4W5QA 4OQMA 4BLRA 1Z3IX 5IFLA 3L7CA 1B14A 1TZKA 2QN8A 1DB3A 2F1KA 3KTFA 3AW8A 3NNDA 2F90A 4MS1B 2ZU0C 3Q10A 3T4UA 3GIDA 4CFYA 3EZXA 1X5BA 4ADSG 3IPYA 3FFTA 3VNAA 1OXUA 4RPCA 3UANA 4J4BA 1OYWA 4LNAA 2C5BA 1G21A 3ES9A 1TZ2A 4DJJA 5CDFE 3WLEA 2DM6A 4MVYA 1MP0A 2I6QA 1U0OC 2YWGA 2NZVG 4CJXA 3WAKA 4NH0A 4WZ6A 2NO0A 3HBAA 4GBED 3GLFE 4EZEA 4HAOA 1Y8QA 3G5LA 1T13A 1X74A 3OQHA 4GH5A 1ODLA 4NESA 1XHLA 2DSTA 5FUQA 4F7AA 5JCZA 2PLWA 3KTAB 4DDUA 3BMXA 4E0BA 2H63A 5CA1F 2FZLA 4DMUB 3FGOA 1A97A 4FADA 3MYVA 3FHCB 3LXMA 2FK7A 1X8KA 1P45A 3WLFA 4BBPA 3IKVA 2ZSJA 4TVBA 4FYJA 7GPBA 1LF8A 4HGNA 1N3YA 2EGHA 1KJ9A 4HQOA 1JNZB 2GI4A 2WSLA 2PGXA 4YPOA 1PL7A 3V2HA 1CUHA 3KUCA 1KE2A 2CHXA 3PX7A 2Q0HA 4GOKA 4IP0A 4B48A 3CONA 2XEEA 1MA3A 1QFSA 2HSDA 2HHAA 4OAQA 1QDEA 3IT1A 2Z58A 3NDJA 3TMYA 5KYNA 3GYGA 1KE1A 2P5UA 2Q49A 3D6MA 2ZRIA 3IKTA 1PWEA 1H0RA 3D0QA 2X2EA 4YRFA 1ZH4A 2KLHA 1MJNA 4Z9AA 2P5SA 1EHIA 2P9NG 4DR5B 4MHOA 1DQNA 3AR3A 4QODA 3MN1A 2JJQA 4XB2A 3D9OA 2ZXWE 1I32A 2DF8A 5B7PA 3KJXA 3CR7A 1NM5A 4KX5A 4H7YA 3AFIA 1PX0A 1K88A 1XAHA 4AF7A 1IPFA 1PEDA 3SX0A 3WRXC 3ZU6A 3DHYA 1GTSA 3AEUA 3AWIA 1GR0A 5JNTA 3JRWA 1Q3KA 3JD2A 3K0BA 3ASNE 5ISMA 3VYWA 2R4UA 3BFKA 3ESLA 2AEJA 3IO5A 3STUA 1C3XA 3UICA 3LGAA 1BI8B 1V9LA 4RTPA 4QBTA 1JKMA 1UZUA 2E48A 1SU8A 4HZUA 4CEIB 3OLCX 1EE2A 3EVBA 1HDCA 4DGSA 1OFHA 3E18A 2CHGA 1VDMA 2FJUA 4MB2A 4ZPJA 3RFXA 3NP7A 3TB6A 4IUYA 3IBEA 5BW4A 2BELA 5HRAA 2HO5A 1TT7A 4K2AA 4MV0A 3GNSA 1W0KD 2BEJA 4R51A 3TQTA 3TQQA 1AQNA 5AXBA 3IIEA 4E33A 3RFUA 5ITZA 1YJ5A 5KYWA 4WNGA 5KC8A 3N8NA 1PL6A 3CVQA 2PX3A 1E4VA 4AECA 4YO7A 5J23A 3OUZA 2P9ZA 3HL4A 2TECE 2FFJA 4ZV9A 9ATCA 5FZQA 4HX2A 4PYMA 3WYCA 5JPDA 5BUCA 3D8UA 3S40A 4BFSA 5A23A 2Q8NA 3FULA 2BUBA 2NMVA 1FJXA 3TLZA 2GAJA 3D9QX 4LF6B 3JVEA 2OKCA 4ZJZA 1SKQA 3EY9A 3UTMA 3OPYI 4AJ2A 5AVXA 2R4TA 1B2LA 3DW1X 2QLLA 2FK8A 5IVPA 1M54A 4R3WA 1E9BA 1VB3A 3K20A 3R8CA 2AFIB 4AMYA 4M86A 5JZVA 1X1EA 2ZYAA 2LNDA 2OILA 1KBQA 4HPJB 3NOCD 1E8OA 4MV4A 4KXWA 4Q3KA 3W77A 2WYUA 2ZJ7A 1T9GS 3T7JA 2O3UA 5H4HA 2IH4A 2OOSA 2ZKIA 3ECCA 2VHUA 2II6A 2XGMA 2WD8A 5I5EA 1AKQA 1P2TA 4YMSA 4Y2SA 2P4HX 1H8HD 4PHGA 4QFBA 2DCUA 3TSAA 2XWPA 3FB1A 4HDRA 5EVJA 4YR9A 5EIDA 3MTGA 4ZCSA 1CF2O 5CFNA 4L3VA 4F9GA 3VMFA 3HYSA 1BE0A 5ADHA 3K16A 2QTGA 2ZW9A 1H9AA 4WZBE 2AN1A 1W36D 3HUDA 3ZX5A 1AY0A 3EZ7A 3PSAA 4I1SA 1N5OX 2PUCA 4YECA 5LP6A 3ZVKA 3SMQA 1T9KA 3D59A 2WQZA 2FUCA 3D02A 2GXAA 2VGXB 4DWWA 2OSVA 4KCGA 4F85A 1D1QA 3A1SA 4Q7MB 1G21E 2ECFA 3O8DA 1P17A 3CR3C 3BMQA 4YJDA 1TCUA 3OX3A 5IJ9B 3KOMA 2QMHA 3UB2A 4KVGA 3BRSA 3D54D 2WF9A 2I3DA 1UXIA 4DMMA 2FUG1 3TPZA 4FPXA 2VUIB 3BXEA 2GFHA 1J9GA 5KTSA 3KD3A 4UQLA 3C85A 3DUWA 4GYJA 4G56A 1M72A 3BX1A 4X1YB 2YZ7A 1O2DA 5TEVA 3PNLB 2VXBA 1DX4A 3TR5A 1PGJA 1INLA 1U0TA 2SICE 3PEUB 2PXXA 1PK8A 2KE5A 4WH0A 3OF3A 2DQSA 1X77A 3UMFA 1AKRA 3HZOA 5JMND 1SKYB 5CPFA 3OIGA 1R6UA 3IP6A 4DXAA 4L57A 4MVJI 3R3JA 4HGRA 5C52B 4LOAA 1L8OA 2ZBPA 3QVUA 5ADVA 4BKOA 1WQ3A 2G25A 2PV0A 4OKSA 1IY2A 1V2HE 1XNJA 2AWOA 1KF0A 2ZSFA 2H7CA 4C7BA 2TMKA 3VU8A 5DHRA 4B71A 1ZSNA 4EVRA 1U5BB 3E53A 4IIXA 1BKYA 1BD8A 4AC9A 1B1CA 5A02A 1XQ1A 2K7ZA 5IUJC 2O2EA 2FOLA 3IO3A 1YK1A 2Z9BA 1G4UR 2CEKA 4X44A 3WS7A 3M6FA 3VR6H 1IQ0A 1GZ5A 3BGSA 2Z4TA 2D06A 5EUCA 1KQPA 3H2SA 5H16A 2BR3A 3K1YA 2FO7A 3QAQA 3TECE 2W2VA 4QNRA 3QKUA 2K6GA 3RANA 1SK9A 3MOGA 4XRGA 3GLVA 4D4JA 4MQ6A 3TGOA 1TPYA 4OFZA 4X1KB 1SCUA 1GKUB 5F5XA 13PKA 4W1PA 4TKVA 4JJ4A 5BYAA 2YS6A 1H3EA 4DK5A 1Y42X 1TVEA 3BGDA 5KTMA 2DPXA 4CRWA 4J7WA 3GZNA 4G1VA 3R3UA 4ARBA 1AS2A 3GCDA 2VT6A 1IN1A 4LF4B 2HXSA 5B3LA 4Z9FA 1KI2A 1RJFA 4F0JA 1Y6IA 2ZDGA 3B9BA 2ZBFA 4A82A 4DUYB 1HYEA 3W5IA 1V9SA 3HKCA 5KOJB 3IDAA 4H7IA 4PO9A 2MIIA 3G9ZA 5KNDD 4B1FA 4WI1A 3R75A 3LLCA 3BQNB 1HG2A 1I7PA 2IHZA 3G2MA 2O0KA 2OP1A 1PD1A 3ZNPA 2QORA 2J30A 4U7JA 1IHPA 4QNNA 1O87A 2I1QA 2AHRA 4FDTA 2HN9A 4DV0B 3RO2A 3S7FA 1NMSA 4HGZA 3I9V6 1ADYA 5DYTA 4ZYVA 3M4ZA 1ZN8A 1FFAA 1OTHA 2X4LA 1MX6A 1DADA 3HU5A 3QA3E 3CNOA 1AU9A 1T36B 3WGLA 2QL7A 5K0LA 3VR2A 2H2WA 4TKMA 3PR1A 1J1ZA 4M1KA 5LPNA 1F7UA 2A5UA 2HXGA 2C5HA 4FGSA 1JBQA 5AT1A 5DBEX 3I0NA 3E9RA 4XKCA 4XVHA 2X0IA 1ZD3A 2QQGA 4F3KA 2DFNA 1JCSA 2RD0A 4ZYZA 1CUXA 3AHJA 3BL5A 3RO7A 1ISHA 3J80A 5C46F 3AU9A 1NPYA 1KFCB 2X23A 3LZDA 2CXSA 3GDOA 2E5FA 5AKEA 1SUSA 2W5UA 3QXSA 4X41A 2EKLA 2X3UA 4Q3DA 1M1XB 2V45A 2CHZA 4LY9A 4MRMB 3OEHD 3OPMA 4B33A 2WOJA 4BXOA 1J2UA 3NLLA 4FKBA 4UTRA 3V6LA 1XDDA 3FCUB 2O8DA 4P3OA 3TWQA 1V1MB 3U1TA 2IIQA 3SK1A 1NVUQ 3QMPA 5KCMA 3HI4A 4DQVA 1TEZA 1DQPA 5AW3A 1TU3A 3IUJA 1Z3YA 5HF6A 4DQ0A 3V1NA 1RWXA 4CN8A 1GL6A 4P4SB 2XITA 2ZWAA 2DKNA 4PLPA 3AF1A 3N0RA 4A0RA 4R41A 5J63A 2V4HC 4DNFA 2PSHA 4G0ZA 3RT7A 2ECPA 2QUKA 1WKCA 3KXPA 4J7AA 3SQDA 1RT9A 1WSAA 1RACA 3JS5A 5FUBA 2HA4A 4MV9A 2QNIA 2V5UA 4G5YA 3D1VA 1N0HA 3I1IA 4MCAA 5JNLA 1XNGA 2JH3A 1VKRA 5EHQA 4O1PA 4IG9A 3FDZB 3ECAA 4KPYA 2IL1A 3JWIA 2BF4A 4OQYA 1RPZA 2HA3A 4DCCA 5HGXA 1RRVA 2PZIA 4HRLA 2YFHA 4LGCA 3P7MA 4Y6LA 2EF0A 3PHGA 4G5RA 2RONA 4M0DA 3UWSA 1OZAA 2X41A 5EX3A 3SIRA 3MJSA 1C2TA 1GQYA 5AN8A 2Q1TA 2HPZA 4FFPA 3P9CA 2EBWA 4J7CA 4LTDA 4UCWA 4BO5A 2RBKA 2YINA 5I48A 2P79A 1G42A 3IJEB 5DNEA 3RPEA 1B0ZA 4JP5A 2ILVA 1YTUA 1TAUA 4S3MA 3EC1A 1R9MA 2REXB 5JAPA 3K31A 2MWMA 1YMVA 1CUFA 5K3SA 3AOEC 5D01A 4HS4A 2B6CA 1YOVB 4LY3A 5A04A 2ZAMA 4EF4A 2FX2A 2RAUA 3MJHA 1WBJB 1RZVA 4XD7A 4DV3B 1N11A 3KDAA 1WKBA 5AESA 5CXSA 3A6ZA 1KEEB 5DNVA 2AHOA 3EW7A 2ZQYA 1RM4A 2CSUA 1JT9A 2AQHA 4BMNA 4CIBA 1M5UA 5GZ6A 3ZDZB 3NAQA 4BQPA 1H4SA 3KU1A 1COWA 3UJAA 5BSVA 3DTVD 2IHBA 5TGTA 1GR1A 3MJDA 5ANRB 3C70A 1PR9A 1BHJA 1IXKA 5F1OA 3ZS9A 3VDXA 1UT5A 1GVNB 2Q41A 3H6HA 2E82A 1ZR2A 1HKUA 1TQ2A 2HXYA 3ASGA 1DC4A 1R27A 2X8LA 3UCEA 3BU8A 5FWQA 2WMOB 3FVTA 2VTVA 4KJXA 4F3RA 1JRLA 1N2IA 1PQPA 3ED1A 5KJLA 1E6CA 3NIDB 4Y0NA 1N0VC 4AX8A 2VYND 3A1VA 9ABPA 1Z4IA 2GAOA 2ZB8A 1HSOA 4GOOD 4Q96A 2X0KA 4MH0R 4OVVA 3FTUA 3B51X 4RORA 3ROKA 1W29A 2AOTB 3S5UA 3IEVA 5CHEA 2YFKA 5JQGF 3KXLA 2VF4X 4EYEA 1NT2A 1NW9B 1IBKB 2GHIA 1N4SA 1GQSA 4MMXB 3W5UA 1QLJA 2QU7A 2HI0A 3SIWA 3CWCA 1RM5A 1UODA 4X1OA 5EJAA 1O1YA 2C3PA 4IX9A 3ZXPA 4X63A 2ZR0A 4ZCPA 2AX3A 3T3IA 4QDJA 3A4YA 2X5TA 4XSHA 3O1IC 2WPDD 1UEJA 3OZGA 5FQOA 2J3JA 2YVQA 4LXYA 4KXQA 1YUNA 4EY8A 4HV4A 4MJ3A 3R0VA 3QBVA 1NE2A 1W88A 3TXXA 4JB2A 3FOBA 5EIEA 1RJDA 1L5WA 4C0BA 4I8XA 3QFRA 2OORA 4P4GA 4FDUA 3AQ4A 2CVPA 3O48A 2HT6A 1V16A 1NC3A 3BICA 4BFLA 4MWSA 1JIKA 3FJOA 1NLZA 4ENQA 5CMWA 4CKCA 3HDGA 2Y4TA 2WIGA 4NVRA 5BSMA 4WWHA 3AFNA 3ZWVA 1TC2A 2R8XA 4K0KB 5GVSA 4YP5A 3RVJA 3IV0A 4I14A 1VIAA 3PGVA 2OR3A 3OHMA 4TXMA 2ENWA 1P1IA 1LVUA 3UH1A 3DNFA 3HBNA 4OREX 4F45A 3H9EO 4R6XA 3IKMB 1D4OA 2O8CB 2XVAA 3DWGA 1Z5ZA 4CM5A 4XPIA 3GUHA 4HO1X 4F1KA 3DLIA 3DTTA 2KW5A 4KQIA 3KM0A 5JMOA 3I5AA 2P9UG 4CLXA 1TK9A 1A77A 4E7PA 2X3MA 1JFFB 1MOZA 4Q1VA 4GRAA 1E9SA 4KC0A 4FMBB 1GXSA 2PGOA 2PO5A 4C29A 3V8VA 1FP4A 4U9HS 3MKQA 1KMCA 3N7UA 2P2CA 3W5JA 5JCOA 2PG3A 2X19A 3HA2A 3HYTA 3KJFA 2Z09A 2H2AA 3VR4H 3MQFA 2DY0A 3T5XA 1M76A 1UBEA 1NL4A 4J49A 2WVGA 3U6KA 3FH0A 1R3DA 1NDHA 4MQLA 4FOOA 4UCQA 5LZ2A 1UOPA 4R98A 2VF7A 5SYNA 1GDHA 1T3HA 1AQIA 1CUWA 4Q4HA 3NI2A 5FNVF 1F2TB 2WK1A 2VJMA 4M37A 3CZMA 3TEFA 1VPVA 5LOVB 4UWLA 4MAFA 1N2EA 1QGUA 2VAWA 4AJ1A 4GTSA 1EQ2A 1DBWA 3TCXB 2G1KA 5ILOA 2P67A 1Z36A 1JR4A 5EOVA 1N1GA 1NQVA 5JZMA 2UVPB 1VE3A 3D8SA 4HOUA 4JBYA 5KWDA 2Q5EA 4I43A 1RXEA 4EQ6B 4OH7A 1Y9AA 4FXPA 3JCZA 2WINI 2I4IA 3QWHA 1GG9A 4D8UA 1R5OA 4CKEA 3EVNA 4RHXA 3RT9A 1JYFA 3W2FA 3ZD8A 3ILYA 3RIYA 3QUAA 5BV8A 1E1RA 4GL4A 2OV2A 1JIIA 4BVFA 4KPUA 3GRFA 4DC1A 2DUUA 5LQAA 4LPSA 5IBCA 1DDIA 2HQSA 2NSJA 4FZRA 4FMDF 5AKXA 3WL3A 4PQFA 1JIJA 4I66A 3PLNA 1YULA 1H8EA 1Z0KA 3H83A 3FZNA 1DFHA 3HY3A 1M2HA 3U3DA 3D8NA 2I3AA 2OMEA 2LXNA 1OGJA 3MELA 3OFNA 2V65A 2X15A 4PHTA 3VR5H 1IBCA 1KWGA 1I3MA 4Q69A 2V7TA 2F3PA 3R4VA 4F2WA 4F6RB 3DEOA 3ACCA 5A4DA 5FWAA 3KYCB 3U80A 3EMVA 2OUKA 1TN6A 4OLBA 3DE3X 2BM1A 5LZ7A 1UJKA 1REQA 3DSXA 2P58C 1E1CA 3FYUA 5ENSD 1QP8A 3FOZA 4U3JB 1VMDA 1ZI6A 1XEAA 4KI7A 2EYQA 1UDRA 4NZYA 2VJKA 4CQMB 2MT9A 2VQ3A 4GO1A 1JR3A 2GEUA 2JIOA 5BN1A 4S1NA 2WMYA 3ASDA 4XYBA 5TPZA 4TS4A 4U00A 1JHOA 4EG4A 2R6R1 4ZXPA 5JMPA 5CURA 5HRCA 2VP3A 4HEHA 3MHTA 2H31A 3MINA 2X58A 2PRIA 4BPRA 3SC4A 4XLTA 4HNGA 5IKMA 1XGWA 3R74A 4BX9A 4YT5A 1N6RA 3Q0EA 3TL5A 3E3AA 3GLHE 2KWIA 4OHKA 1E79D 4EG1A 4BVGA 1U0BB 2EKQA 4R2IA 1D5WA 4WLFA 3K0FB 4AROA 2V3CC 1EMDA 1IOLA 3PUHA 1EUDA 4JLWA 3RSZA 3GNLA 1J22A 1L7DA 2IP4A 4RCVA 1YKFA 3CIFA 1ZN9A 3FI9A 5BVGA 2V4LA 4JBWA 4BVLA 3C7DB 3GQBA 4CEHA 2A86A 3QUQA 2OFXA 1N2BA 4D9HA 3H8JA 1ZMBA 5DXFA 4B82A 1ETHA 4PUCA 1U9JA 1JDSA 3KSLA 1QHSA 1BIFA 5JAUA 1RFGE 3ZE9A 1J8QA 4M1QA 2XE6A 4IDEA 5J4YA 1XQVA 2PMFA 3LS2A 2MR6A 2PXAA 2IS4A 1VTKA 1CLUA 1FL9A 2AIRA 1GYQA 4MR9B 3SLGA 3T1VA 4HEQA 3IERA 1S1MA 1SA4A 4DGQA 3K9WA 3NM4A 2VOEA 2GK6A 4GMHA 4E31A 3ISTA 4U0ZA 2WSSA 3NT2A 3TG8A 1SN7A 1CF4A 4LFAB 1N7GA 5SY6A 2L6BA 5AW6A 1ZXBA 5EZYB 3NATA 3DZKA 3OCWA 4ZCLA 3L1IA 4CG1A 4NG4A 5DIFA 3MMXA 3LTNC 2ACVA 1DBIA 4BO0A 4DLUA 3R7BA 1KWKA 4PZAA 3H16A 1TZCA 2GD2A 1EFHA 4OUDB 2AOWA 3ZKAA 1AB6A 2ZPAA 3BGOS 3V4OA 5G0SA 1DARA 5AW2A 5JC1A 1K0UA 5HIJA 4B35A 2OP0A 1FK8A 2QL5A 1JEYB 4W1RA 1G3QA 4BIMA 5F7XA 1MO5A 3WHLA 4U0KA 2OZPA 2VNSA 2G08A 2ETVA 621PA 5JBIA 2XEDA 4GRIA 1T43A 4GL2A 1ZL0A 2TMYA 5JVDA 1LV7A 3T1OA 1J8VA 3M70A 3A1CA 1E3TA 4ITUA 3T3EA 1UW4B 1HDYA 5A6SA 3D5TA 1GQOA 3KR9A 2P7IA 4MA4A 1JG1A 1HYHA 4MRPA 4C6TB 4UCFA 2JK1A 4TZKA 2J9ZB 1VKHA 4OX9Y 3D6NB 3WMEA 1AD2A 1M0EA 5HS0A 4JXZA 2JIMA 2E7ZA 1TF2A 1YONA 4XD7D 1EXMA 2QN7A 3CB2A 4O2AF 1L5NA 3QE4A 3E05A 3FDHA 3FBTA 3VH3A 4LWZA 3FYSA 2Q6TA 2X77A 4Y2UA 2FI1A 3HXPA 2DERA 1Z74A 1SZAA 1UM9A 4DLLA 1S2IA 2FN9A 3K09C 4JKIA 3RVRA 2VJYA 3TM5A 5B3AA 3DWFA 4UDOA 3DTVB 3QJYA 2O5EA 4FSHA 1ZCAA 2I4RA 2QD1A 4JY7A 4MTLA 3EFBA 1UPXA 1Z39A 3T4PA 3C8DA 5U4QA 4BNLA 1TQDA 1WNTA 1E4EB 3NJRA 1OFTA 3B2NA 2BFFA 3U5ZB 4EEKA 4HNQA 1XJCA 1O6CA 4QEZA 1XAJA 2V54A 5DZSA 3TLKA 5AM4A 3H11B 4DNQA 2J3IA 3H18A 2DWPA 4NS4A 1I30A 3CX6A 4BVKA 3MK31 1WB4A 5EEHA 3N6RA 3DV2A 1MHPA 1QHNA 1EGHA 3INNA 2M2IA 4QLBA 1Y4SA 3HXOA 4L02A 2F6RA 8ABPA 2YCBA 3PUVA 1RPTA 3E0QA 1LRLA 1KMNA 2J8SD 4UNPA 2UZ3A 2W2PA 2NU8A 2Q3FA 3OE7D 2C7OA 4YDSA 3KOZA 5T8KA 4PXYA 3D1JA 3IT3A 1QE3A 3RDPA 1U5CA 3H19A 4TV8F 1SBIA 1FB5A 4WW0A 2OGUA 4FZ5A 1Z88A 1ZCZA 1HMPA 2EBUA 3D1LA 4OOFA 2O6LA 1X15A 3RS2A 2X6QA 1PFWA 3JQGB 1R66A 4ZTBA 1BXGB 3KL4A 4FOTA 3EZYA 1NN0A 1B00A 4LQCA 5AMXA 3TWSA 4COOA 3EJWA 4B6OA 5FJIA 3B9QA 1KQOA 1CQIA 3V2OA 1MD9A 3F97A 3WOHA 3ASOE 4Q9LA 1S3GA 2ZQ5A 4CMIB 3W9FA 3EVFA 2JZCA 3COYA 5B1DA 3VR6A 1FMFA 3CJRA 4P7JA 2Z5LA 1LLCA 5B37A 1JR3E 3CZRA 2Q3MA 1A88A 4DG8A 1DJMA 1RBMA 1Z35A 3DYIA 4N2QA 1EFPA 4NDNE 3K0SA 3EHRA 4ER3A 2VTEA 3L7LA 1GTZA 3L8FA 2GBGA 3IELA 5G02A 4YAUA 4AWBA 4RMIA 2GVZC 5DDIP 2AI3A 3C3CA 3LT5A 1WX1A 2A9VA 4BEBA 1WUJS 1XN1A 4LJ7A 3B6EA 5LR6A 1C1DA 3ZY3A 3I45A 5D84A 4KEAA 3NBNB 3U62A 3ZUVB 3AERA 5KPJA 4P08A 2RHMA 5CDFA 2YV3A 4MEBA 2CBZA 5B3SE 3IP5A 1QG6A 1IBSA 4Y9RA 5AI5A 2YMPA 4HNRA 4D9IA 1QSGA 4B84A 5KSZA 1M2VB 3HJTA 1KI9A 3UCXA 5JTTA 2VA9A 3GLFA 1O1SA 4ZPXA 5FL7A 1I2BA 1E5VA 3ABME 1HQCA 3MWFA 1SBQA 5BNIA 4EJ2A 1KQ3A 3K6RA 5KHOC 3P0RA 4H27A 5EYPB 3DDOA 2ZYRA 1MXHA 3TINA 2FQWA 1EFVA 3RO3A 4JELA 2ILTA 1FDIA 3F9RA 1NUAA 3UHJA 3CT6A 4IIJF 1G8YA 2MINB 1UF9A 3DBLB 3JRNA 3SYMA 5H1YA 5AVZA 1KOJA 1QJCA 1R8JA 2VSYA 4UTZA 1TUBA 3U4QA 1XKLA 2VXOA 4GAEA 1KMMA 1DEOA 3BMOB 4Y2VA 2B3DA 5I9LA 2WAXA 4BLQA 3M1YA 1GA1A 3NPAA 4MQEA 2PUAA 5C37A 3FBWA 5I7AA 3EXAA 5I45A 4EI2A 3K8QA 3STWA 5BXYA 3HVUA 4PO8A 2AXEA 3CNNA 1E1RD 2CE2X 1H4QA 1ZG3A 4EITA 2CK3A 3E5NA 4HD8A 4A4DA 3Q4AB 1YQTA 3ZEFA 4EKDA 4F3TA 3EGIA 4KR3A 3AVTA 2RARA 1ICEA 4RTMA 1UKVY 3GLIE 5ARFA 3LIIA 1HQDA 2HV8A 3UB4A 3K5WA 4ND4A 1N1EA 3ZXXA 3G49A 3EDOA 1V48A 5IXJA 3PNOA 2XGJA 1G9TA 5GM1A 4CTNA 3HKBA 1WCIB 2F8LA 4MI9A 2EGGA 2WJ6A 3HGMA 1N5JA 2ZI5A 3JQAD 2HIMA 5T7BA 1OB2A 1ZUIA 1XO1A 2WT8A 4EHHA 3ILSA 3S27A 3HO1A 3BN3A 4BVHA 5CCLA 2VL7A 3WYGA 3AETB 2XVXA 4IDQA 4HN4B 1N3LA 2BEVB 1RJEA 3RYCA 1OYVA 1WXIA 1SUFA 4WXMA 4CM9A 1CZUA 3GLGE 1SHTX 2C3UA 3RODA 2DFVA 3M9LA 3LL4A 3ZV4A 3QXGA 2YYAA 4L3WA 1Y34E 2HY7A 5TPZD 2VSXE 5GZ3A 4NCBA 4UVGA 1K92A 1NOKA 1SQ6A 5CGZA 2I5PO 3DDSA 2JI4A 1BPOA 4TUYF 1BDIA 1QMGA 4GTMA 1N34B 2YQ8A 1E1QA 1ZYUA 3EUEA 2R2LA 3KWFA 2I2FA 5G04J 5L4LA 4OU4A 1UK6A 5H81A 5BV0A 2A5JA 3KUKA 2F9LA 4XW2A 3WNQA 1AKTA 3S2UA 1VSBA 5LZ5A 3SYKA 4YLGA 4BNMA 2B94A 2VXCA 3KYJB 4Q1CA 3EU9A 3UJ9A 1FRFS 3ONWA 3FPLA 1YR7A 4ZI7A 1JEAA 1NN3A 1HXIA 2R2GA 1UBMS 3JQ8B 3KLOA 6REQA 1X2EA 5ALSA 4YRMA 3SKVA 4BJ5A 2C2XA 4O4JA 1AIPA 1ZVQA 3B1XA 2X9LA 3V46A 4FMCB 1EFAA 1MJHA 2PL1A 5HJ5A 2GYVA 3ESAA 1Z2OX 5FB3A 4Q3AA 2JLZA 2OBXA 3O3NB 2HAEA 5D5HA 1Y7LA 4NARA 4NAVA 2IEGA 2G9RA 4HTAA 4F1PA 3SFTA 4IN3B 4JUIA 1L4LA 1TKBA 4JXKA 3OJCA 1HFEL 5HFNA 3M6LA 3OQIB 3WI7A 4TL6A 1TJCA 3I6ZA 2C7BA 1CV2A 2ODQA 1PX2A 4OK6A 4X1IB 1ZIYA 4CMGA 4F86A 4J9VA 3TM4A 2ZSBA 4G0YA 1WAO1 1ABBA 1OLUB 3PGMA 1BLXB 2X40A 1H4TA 2CJYA 4D41A 2JH8A 1FJ2A 4GRDA 2JA2A 2CFOA 2XQIA 1YVRA 3MB8A 5BT9A 2WXPA 2RH4A 2W6OA 5GPBA 3F1KA 1U1GA 1VZ3A 3NGMA 1U8CB 3SHWA 4GOLD 4C5BA 4CI0B 4WZBA 2JAPA 3MRVA 3DVQX 4MVJP 4Y1FA 1I7DA 2OHOA 1TO1E 2DBZA 1YJ8A 2ZYWX 3L0SA 2IEIA 3QKRA 2HPAA 3ZKWA 2OBYA 3E9EA 4BV3A 2AVNA 3FNRA 5CW1A 5BQFA 2GSWA 2ZBQA 4A23A 1A5BB 4C4XA 3KJHA 4QFVA 4I1OA 2G82A 3RI3A 1N9KA 3ZVVA 2PEZA 5EESA 2QBYA 2XUAA 4TLAA 4EPYA 5LCWJ 3FTDA 5EAIA 1IQPA 1S8NA 2P9BA 4L4YA 1N77A 4Q3BA 4OU5A 1BKSB 1NNEA 1CRLA 1E9DA 4DZTA 3LWZA 4XUEA 4MB0A 1R4MB 4EI8A 5MFPA 1U63A 3NHZA 1K89A 2C5SA 3IUSA 2XUKA 2ID8A 4BWGA 1R8YA 4MJ7A 3ZRHA 2XEXA 1I4LD 3VLFA 1NMYA 2WYVA 3SE7A 2QENA 3F3MA 4ANWA 2PQNA 1E3EA 1LBSA 4DLRA 2GH1A 3ZWYA 2WUWE 4LXQA 4MCJA 1D07A 3AL2A 4QOJA 4JP3A 2WM9B 1PTJC 2P9EA 4YRRA 2GD0A 4PFKA 1J23A 3V42A 3PK0A 4G65A 3LUHA 1XVVA 1W4AA 2VDLB 4LMBA 3I83A 2XD9A 4QQNA 3ZHOA 1EVJA 3BG0B 4MYDA 4KQCA 5CLLA 4BV8A 5HBGA 1RI3A 2N1BA 1E59A 4CKBB 2CDCA 3M1LA 2PS9A 3K72B 4CCYA 4YDWA 3VR4A 2R25B 2V8SE 4RVDA 1WHSB 5AFSA 3OEWA 4CVNA 3DB2A 4I9HA 4C21A 1SZPA 2OVBA 3G2UA 1UMDA 4ZEXA 4I1YA 4GPTA 3WA7A 1FTGA 1NXXA 4L6AA 2W2KA 1IRXA 2KLBA 3OZ7A 2HMUA 1HPLA 3VNVA 3FHOA 5DF1A 3O9ZA 4IQFA 2VZEA 1AHNA 3PZ1A 3EZGA 1SCJA 4B2IA 5KVAA 1T0HB 3O94A 4NNJA 2TSYB 3G0HA 1CY1A 3ZS8A 1Z4MA 4V0QA 2FG7C 2XZTA 3ANNA 1P18A 5IWCA 2XT0A 4EX7A 4HLUC 1JWBB 4GX1A 5H80A 4IXWA 2LCQA 3U7QA 5IASA 2YVUA 4BAUA 1CP2A 3TTUA 3DMDA 2AXNA 1Z29A 1YQ9A 5EJ7A 2JNWA 1D2HA 1C30B 4Y9UA 1Q0TA 3LT1A 5A3RA 3NXKA 1QMPA 1PR4A 1P44A 2X8JB 1SQFA 1YVDA 2X1MA 1K63A 3L4KA 5K3FA 1S1CA 2EX1A 4GPZA 1WPXA 1N7JA 4WCDA 2O9JA 3W6UA 2PPVA 2FSUA 3CM0A 1DG9A 1FDWA 3NNNA 2Q5IA 2AOUA 3DEIA 5JD5A 5M2QA 2QQ5A 3GGJA 2BFCB 3ODPA 3KHSA 2ST1A 2JHPA 2QJOA 1IUNA 1WU8A 5BWLA 4C0LA 2AL7A 1SMKA 1DRVA 3GBSA 1KSFX 3JASA 3VR5A 4IKOA 5JLJA 4MVJG 3UNXA 1ILWA 2XDAA 2JAWA 4P84A 1SVSA 2MJLA 5KI6A 5LNK6 5A71A 4BLWA 2R00A 4JI1B 4FQ8A 4HB5A 5IANA 2GSDA 3QLEA 2F64A 1JDUA 4AG5A 5C8DA 1CUCA 5E1OA 1MVLA 1NQTA 3CX8A 2E4ZA 3G1UA 1E8DA 3LMKA 3GP5A 1HEUA 4L73A 3VUFA 3AG4E 3RIBA 2G9NA 3P20A 4GMDA 3I3OA 1VKNA 1UFOA 4AJNA 1O95D 4E09A 3W9GA 1Z82A 1S4MA 3A6FA 4NH4A 1S89A 3L7BA 3VPHA 1NXOA 5M34A 1LVHA 3W5SA 3KKPA 5DWDA 3JQFC 2ZRCA 1PJAA 2XAAA 1OHHD 1Z2EA 4NAHA 3LKDA 1ZKDA 4PY2A 5HKBA 4KAFA 4CWAA 1J06A 5JYBA 4M38A 5JD6A 2BEUA 4ZXFA 5FZRA 3K96A 3NGLA 4ZYTA 1F38A 3MF4A 1WUHS 4G5HA 4GKAA 3JV7A 1P2VA 2XYPA 4HF7A 3TL6A 4I6EA 5DBHX 2GXSA 4QQRA 3VZRA 2QZZA 1XDWA 1OZ0A 3BF8A 3QARA 1U2SA 4M0LA 1JDJA 1GZ6A 3CF4A 4DUPA 4KVMA 3BB4A 4UZFA 3AY3A 3GNQA 4E4YA 2R5FA 4B2LA 1OGYA 1EJ2A 2PZ8A 1QVWA 3J7TA 3KP1A 3ER6A 3ORSA 3QEBZ 1W5FA 4TQGA 3TD9A 3QPVA 2YJ3A 4HATA 1TAQA 2G09A 2VDMB 2BLLA 1T5OA 3JWHA 5A7HA 5ICEA 2PMCA 1A96A 1SCQA 3TYXA 1ZK1A 3VDNB 3S1SA 4L07A 3X3HA 1GD1O 1IN6A 3AG2E 4GXNA 1WUKS 4MW0A 1TE2A 2JJYA 1TJYA 3FDJA 3ME5A 3KU4A 4ME2A 4WZAB 3RRFA 2X0FA 4BBJA 3UKUG 1HBJA 2JGLA 1M0WA 2CFIA 3RB8A 5AM0A 4AWXA 2E1PA 4JYAB 1BS2A 3TFWA 3FWHA 3VNRA 3O9MA 3TKYA 5E0KB 4Y2RA 4KXYA 2HJRA 4MW2A 1W85B 1B26A 2DBQA 4W63A 2CY0A 1Y48E 4LCBA 4QIHA 2XB2A 1KARA 4HDSA 9MHTA 2CFZA 1LDMA 3AVUA 4IHQA 1ZN2A 5AKLA 4CM9D 4MULA 1QV9A 1SIBE 3WLAA 3E35A 2CHUA 2FEXA 1F8YA 4I17A 1XRMA 4Z7JA 5CIYA 5AKGA 2AR9A 2G1UA 1Z7WA 4BIIA 2C2MA 2PT6A 2O8EB 4Q9DA 2P1DA 2BTEA 4HYQA 4IUCS 1M8GA 3KWMA 2DPYA 3LK6A 4D4HA 3W34A 1PF7E 1H93A 4Q7KA 1G3RA 4GU5A 2QPOA 4ZFNA 2X4IA 1DDOA 1NZFA 5I7VA 3DOCA 2EJCA 2JLAA 1ISJA 2ANCA 2QP9X 3REOA 1H6KA 3L06A 4HQFA 1M3SA 3GG2A 2ZIWB 2REBA 2BHNA 3B8EA 2WHEA 1RIIA 3LU1A 4D3DA 4FE3A 2NUAB 2ZDQA 2ZVPX 4O29A 4GQAA 4FONA 1DKPA 4HDMA 3H99A 1OLSB 2ZWMA 2IYAA 1Y4UA 1MEEA 5FPHA 2JLRA 2HWWA 3BM5A 3BIOA 4FGUA 1GYRA 3T12A 2NU7B 2BGGA 2RHDA 1JCRA 3SJ7A 3KAQA 3DWIA 1XR3A 1Y1KE 3CEQA 5F21A 2BGUA 1HDXA 4MKFA 4E21A 3H05A 5E9QA 3OOWA 3CA8A 1TNYA 1Y5MA 1Z38A 1TU0A 2W42A 2O1EA 5H59A 4OJNA 3QOWA 2R47A 2GF9A 2LIPA 1QFJA 3DH0A 3TQOA 2WQHA 2H1VA 4PC3A 1GDTA 3P9RA 4HUQA 1X13A 5EWLB 5FTKA 3VSEA 3Q2OA 3ANTA 1T4BA 1WY6A 4FYWA 2OKGA 5GIOE 1RQ2A 5LUAA 3SM9A 2BM9A 5DYNA 1QGAA 1G59A 3ORQA 3G2PA 1BMQA 3FNQA 4B47A 4ARAA 2VR1A 1L7AA 3FUCA 4BS9A 3SHOA 1ACJA 4MDHA 5DGTA 1VMKA 3CN7A 1FZTA 4RNDB 4R2LA 4D8VA 2B78A 3AUXA 2IHVA 4OQDA 4TV3A 3DEYX 2QJFA 1QONA 5AQ1A 2NZ8A 4MYTA 4HBZA 4UWHA 2EIKE 4J7XA 3USCS 3BJIC 4UUPA 5F3WB 3JZDA 2RGEA 5AI8A 3GL9A 5TQVA 2PWBA 2B1QA 3UIPC 2CNNA 4CGWA 1IUKA 4CN9A 3D9HA 3BHIA 3M6VA 4RCYA 1UC8A 2W6PA 3PT9A 1FFSA 1NKTA 5CJ2A 2PKEA 2H5JA 3V4LA 4QRIA 1X7YA 4Z4EA 4AOFA 4YMIA 4YDEA 4DLVA 3MJVA 3RYHB 3DCNA 4HDQB 1OFIA 4Q4AB 1T10A 3INYA 4BE9A 1NJGA 2WIFA 1X7XA 2G3YA 3QIAA 4HLNA 4R7ZA 3DONA 3EN0A 4MYHA 2I6HA 2CVZA 4ZJUA 2Y92A 4RMHA 5BR4A 1Q7TA 4MBGA 1U6KA 1V5IA 4PG4A 3EWAA 4G8BA 1QV6A 3CJQA 2DFPA 2GJ9A 1FDOA 4AY4A 1DXYA 2GWHA 4R81A 5NULA 3FOWA 2I78A 3RTBA 2BMDA 2BF0X 2MYUA 4MKZA 1PJSA 2VQEB 3IRVA 2V7UA 3ZWKA 1X1DA 2ZRAA 2ET6A 3EG5A 5AUOB 4FYHA 3LDAA 3L84A 3B7GA 2EF1A 3UT5B 4AAYA 1FUIA 2IQIA 2FSSA 1KYQA 2F8MA 3QRWA 1Q84A 1E6EA 4CFSA 1FS4A 1QU2A 4JBHA 1HRKA 1A4UA 4CM8A 3UZUA 2YY6A 4IZOA 1N32B 3G6WA 1DOAA 1C1XB 2D1SA 1JQLB 1XEXB 2BGKA 3HE3A 1FNNA 4QXPA 3N0TA 5FORA 2QP4A 1LPSA 4ZDIA 1MOPA 2OCDA 3FCYA 3CRNA 2B0OE 2P9LG 3NYIA 3CB4A 1JHAA 1U0HC 3EFOA 5HM8A 5K0TA 3DBHA 3AIOA 4CETA 3Q41A 3DE2X 2E4VA 3E2PA 4N5HX 2HIHA 2MCFA 1JB9A 3T95A 1V8FA 1EGQA 4IF4A 5IJ0B 5T4YA 1XV5A 2AKAB 3KSZO 2G9ZA 1MG0A 3JQ7A 3GAZA 3KYDA 3T41A 4DJEC 4AFNA 5AM5A 3RJ5A 5BOSB 4X60A 1L5HA 1QKIA 3H8SA 4KO1S 4XGKA 3AR9A 1X7HA 2FMFA 4MKTA 3HO8A 1ZD4A 3AHGA 1HT0A 4AY3A 5ALIA 2YX1A 2YZNA 2HFJA 2VSNA 3OD5A 3CHYA 4BTEA 1A9PA 1AF7A 4FYXA 3GJ7A 5F9MA 3KQHA 4D25A 2REOA 4P5DA 3SZRA 3KZMA 4ENVA 2L18A 2ZRDA 4OL0A 4RA6B 3HRHA 4JASB 1QHHB 4BKUA 1MC4A 3CJTA 2BKKB 3FTWA 4DCSA 5IABA 3ZYMA 4Q03A 4ZVOA 3UMCA 4RY0A 4PAQA 2FQQA 2A0YA 4O4HB 5REQA 3M5PA 2EFDB 4OKNA 3L4BC 1ZOSA 3T7KA 2HSZA 1NPDA 1IN5A 1RC8A 4MQ4A 1ZDMA 3ZGNA 2VUHB 2F1IA 1GJRA 3U31A 5KHLB 2CXXA 3ZIMA 1D04A 4G1MB 3A4MA 1X38A 1CJSA 4GPIB 4BFUA 5AWFC 3MWEB 4KQHA 2RKKA 1MZCA 3G2TA 3GJTA 5AVVA 1NVXQ 4OG2A 3UPUA 5G41A 2KXPC 2YW9A 3UAWA 4NPHA 4XVCA 3JZIA 4JYPA 4TYMA 1MX2A 3COSA 2ETBA 4CFZA 4CMAA 2V6IA 2P1ZA 2FSVA 3JD4A 3IB6A 5IVDA 1OX5A 4AN1A 4NMLA 2C4UA 1E3IA 2CB0A 4CW7A 4QDKA 5TT0A 5B5SA 2UVDA 3NRBA 1Q0LA 2H1WA 3WG9A 5GINE 3CHOA 3UKRG 5JYDA 2J48A 5WRFA 1RXSA 2J9FA 1BGVA 1K3ZD 3G13A 3LLMA 3GLHA 1GFWA 1H94A 1NYRA 4O4LB 1JI3A 4IX1A 2OPBA 4E5UA 4RHFA 4JYBA 5JYCA 5CH8A 2B37A 1QNFA 4MNTA 4C3OB 4UPDA 1TYZA 2OEPA 3W2HA 1X8XA 2IF4A 5JR3A 1B16A 4MVJM 4RLHA 4AJOA 1UKBA 2LRHA 2YZKA 3RFCA 1XQ9A 1HC7A 4GOJA 2OCPA 4GXTA 1UFVA 2GHQA 3E7FA 5JZBA 4W99A 3DUFB 1ACLA 4OI2A 1RRKA 4R01A 3ENKA 1W35A 4KBFA 2QPAA 2NZJA 1OBVA 1C3VA 3RIGA 2IYEA 3N8DA 3EBLA 1CY4A 3E33A 2PU7A 5HIIA 1V11A 2V0NA 5LQJA 2NO9A 3J81k 4FUTA 4ARZB 4DMKA 4XDYA 1W1IA 2Y1OA 2LXLA 2QX4A 3P9KA 4L6CA 1UPFA 5FWXB 3SMVA 3Q2IA 2A5DA 4AQDA 1S4QA 3ETGA 3ZK8A 4FCCA 1W36B 2J41A 3G9QA 1YVUA 1VL6A 3H4MA 3H9CA 3JQ9A 3UX4A 2QI9C 2VF8A 3W3AH 1RHJA 4IQ4A 3SFVA 1OASA 2R0QC 5IKOA 1MPXA 1KH3A 4PG6A 5AOXA 3BHNA 2H51A 3CLUD 1W4RA 4B8ZA 1E1NA 3QVMA 3M4JA 1Z6PA 4WAUA 2R87A 2QV0A 2PQ2A 5G4KA 3LW8A 4QWWA 2NUTA 3K9CA 2H4XA 1MDBA 2PT5A 2JLWA 4RTLA 3T8YA 2BZ1A 3KQLA 4CG3A 3OPNA 3O6VA 4E51A 3RSGA 2PNNA 2H4ZA 1NAHA 3T0IA 3Q3JB 3TWRA 3E3MA 1NI4A 1L7RA 2AGVA 1KJIA 4DLPA 1Z56C 3IULA 3L7NA 1XG5A 5JH7B 3OHPA 2BW0A 1FSFA 3D6AA 3F8TA 4JJEA 3DZFA 3T9DA 2Y1EA 1P2UA 1JHQA 1U1EA 1JDNA 5EP1A 4TN1A 2VH2A 1ZD5A 1CIJA 4AYXA 5K6TA 2IC5A 4E22A 2Q8QA 3DPIA 2I87A 3ETCA 4LA4A 4QOEA 2ONJA 5LD2C 3WK7A 4RFLA 3RYIA 4CLHA 4U0JA 3GGPA 3GJ4A 3NT5A 2IY9A 4E7OA 2QLFA 2I1WA 2XECA 2GDJA 4Y6QA 1KK2A 4EBAA 4CM4B 2H0AA 1U90A 2OXRA 1YRLA 2R02A 1C81A 2Q7DA 1RJ9B 4JGGA 2GJKA 2EG5A 2IHKA 4CEJA 1NQ5A 1UBLS 3KQKA 1O0SA 1C7QA 2AEMA 3LUKA 2FF4A 3NVMB 3BEEA 3DAOA 4NTZA 4M99A 2EVWX 4I5GA 1DC7A 1ZXXA 4KGZA 5DHSA 2FZCA 2PRJA 1PWXA 4HNHA 1Y80A 3RVSA 5JSYA 3DPSA 4MLDA 2UZIR 2PH7A 1EM8B 1NP3A 2QU8A 3QLJA 1CR0A 1VE9A 3KD7A 3LUAA 3RAJA 1Z6ZA 4PSAA 1YO6A 4Q3NA 5IT9A 3I12A 2ETAA 2XA2A 1D1TA 4H4EA 2AC2A 2P62A 3KIPA 3U60B 1DL5A 1YDFA 4WESB 4BWVA 3PDJA 3R24A 3WLOA 4AZ3A 1WF6A 2WD7A 3I1YA 3NJ4A 1EKXA 5ENZA 5IU6A 2RI1A 3VZCA 2XZOA 1PJQA 2VRCA 4DMCA 4C0SA 3EISA 4RV9A 3ZGQA 2IVFA 4HQ6A 5DYIA 5DNCA 2CG3A 2BM8A 3G9UA 3C74A 4M36A 3WK8A 4Z7NB 4D0NA 4X92A 3ENEA 4JB8P 2NP7A 3CVJA 1B8NA 4GZ3A 3WNCA 2BFOA 4KFCA 2V6MA 2HYZA 3G02A 3TO5A 3WDLA 4XASA 1UH5A 4B3MB 2G07A 2YIVX 3SM3A 1ORRA 2B8WA 2JIRA 3INRA 4LGYA 2RK6A 3QHPA 3ZG6A 4IRUA 3KEOA 1NXVA 3K4QA 5EZSA 4TQAA 2DMRA 1HYBA 1IPHA 1IONA 3HWSA 1P31A 4C7KA 4GA1A 3PI7A 4UJ5A 1KO5A 1YCHA 4FYKA 1NOJA 4DLWA 2FPXA 2PUBA 3G79A 1FCJA 1MB3A 2BWJA 3ZW7A 3D3NA 3EZ2A 4BCCA 1MJ5A 5B7GA 1G60A 3D7NA 3JWJA 1YZHA 3TBFA 1JHYA 1JJFA 4UTOA 3GJQA 4RG6A 1NZNA 1SOAA 5L7TA 1T5LA 4BP3A 1XUOA 5EGNA 4BEJA 2IPNA 5FTJA 3PBKA 4PR0A 3BEDA 5A7FA 2BMWA 2IYWA 3VR2D 5BQXA 1F5NA 4GP9A 3L1VA 3MWLA 3CPJB 1V5GA 2ID4A 1V8ZA 3GT0A 4Y1EA 3OD1A 3SYRA 1KDVA 4EX6A 3IVAA 1G2PA 1TNZA 4K1LA 2D5IA 5A6VA 3UT7A 3ESBA 2QP3A 3CLSC 4IQ0A 1XEWY 3UYKA 3CV3A 3ONVA 5HJ7A 1DGQA 2GJAA 3GEHA 4RWEA 1NRIA 2X5JO 3LCUA 4WN9A 4C2AA 5EN5D 1Z0ZA 3BC1A 3NX4A 5BSGA 3OC6A 3LY5A 2JFHA 2YWCA 4ZYWA 2NGRA 3CLJA 4ZIRB 2ZR8A 3UKOA 5E8JA 1EUCA 4NL4H 2C2GA 1N33B 3ZHUA 3PJGA 4EB0A 5CGQB 3I9KA 4XB6B 1SWWA 1LLUA 1Q11A 3VI3B 4JHXA 1Q0ZA 3ZDFA 3QMVA 1M75A 4IZIA 1UBOS 3HWX1 2F8XK 5FXMA 2IU6A 3AXTA 1UPBA 5ENPD 3SC6A 3HACA 3ML8A 2GYUA 4BWFB 1GQ2A 3CCBA 3G6KA 2P6PA 2GKOA 5H3CA 1SEVA 4ZO8A 2JCVA 3A7DA 3NAWA 3I05A 3GMIA 3K8OE 1F8XA 5ABPA 2KBXA 1OCZE 1F2UA 3PQDA 4AI6A 1OCRE 5ILGA 1NBHA 3AEUB 4BO4A 1ID8A 1ZK4A 3L54A 2X5OA 2RGDA 4UUQA 4MWTA 1Q1ZA 1K7FB 3DZ8A 2EOAA 1T3ZA 4MQBA 2ZYGA 1PR6A 3RUEA 3OM9A 3JYNA 4ACLA 1PNOA 5F33A 1JQKA 3ITWA 2J5KA 1U7PA 2HRCA 3SQXA 3SJZA 1JH8A 4FM9A 3GLIA 1XYVA 5C53B 1KYIA 1UL1X 3W7AA 4UNNA 1WDTA 1QGDA 5CRUA 4RDIA 3L0PA 2O2YA 3OQNA 4Y6WA 4KK4A 2L9BA 2H6IA 2CV1A 3NT4A 3WMGA 1Y7HA 3V1TC 2ZFUA 1L5KA 3KT3A 1CUGA 1L4YA 4JLSA 5FDFA 1SXHA 5THXA 1WWKA 3O03A 5ITZB 5KYWB 4RXUA 3BIJA 3T52A 2WM2A 1MQ9A 3GZTB 1JDBC 4KDRA 3CVXA 3BK1A 3IOBA 4MRRA 3GA5A 4F5ZA 4DR1B 3NHBA 4EGJA 2Z5GA 3JQ6A 3W0LB 4JI3B 3WKEA 3HL0A 2C4HA 3GLGA 1ZC3A 2WYOA 3K92A 4URXR 4N6GA 5EMHA 5KTRA 2R7KA 4YAFA 3O4JA 1COWD 5AVRA 2IHJA 3K53A 2VSXA 1IHXA 1PNRA 1RBYA 2QPTA 2ZE5A 3EPRA 5I7HA 2KC7A 2JVJA 4BFXA 2EEZA 4A2WA 5KTOA 5ALYA 1HE5A 1LSSA 1N7HA 1W5SA 4OB7A 4CIWA 3F5QA 4BLSA 4DCMA 4KR2A 4G07A 3KTDA 1ST2A 4B79A 1RWVA 4IDOA 4KYIB 1Y8RA 4GWGA 1E3SA 3EZNA 2J7KA 3LFTA 3BD9A 3WV5A 4JLUA 4WXPA 1OROA 1SHKA 4M0EA 2A3NA 4NBSA 4YMGA 2WXLA 5J58A 5EQJB 5EJIA 2WDPA 1EWRA 2VSQA 1TOAA 2PZMA 4CU2A 2GF2A 1E2MA 5ALQA 5B6JA 1OXVA 1ZAYA 3SYLA 4I4LA 4E85A 5FFMA 4XM1A 4Y0VA 1TEXA 1Q0PA 2X42A 5EMJA 5M3BA 4EO4A 1A9QA 3KZOA 1UOOA 3BWVA 3MT0A 4YAGA 3EHEA 1XKXA 4WNCA 1XMPA 4QU9A 5BV2P 1ZEJA 3I23A 4KUGA 3KK0A 2DX7A 5BMOA 1FFWA 3I9V1 1J6UA 1RR6A 2DHQA 5CDHA 1L7MA 2JAHA 3DA8A 3KV1A 3DXMG 4IGEA 2KSQA 1KZ1A 5DI3B 4OHPA 3Q15A 1NUUA 4RV5A 4C4ZA 3QU2A 2R97A 3FCAA 1O6FA 2H5EA 2BF7A 2NSZA 5AJHA 1KU0A 3K5HA 4V0LA 4UBKA 3HXMA 3ZZNA 2UDPA 2JJMA 5F1YA 3HJUA 2CUTA 3CVNA 1DJNA 7MHTA 4PNEA 1U0EA 5TF0A 4KO3S 1GPBA 2R1VB 2K7FA 2WIBA 3PRKE 3TFOA 4TUUA 1G8HA 4TTSA 4H31A 3ZWAA 2V9ZA 4Q4CA 4B6QA 4R05A 3ZY6A 2RCNA 1C41A 1IHDA 2J09A 3P94A 2FUEA 4PYIA 5EQFA 3ZD6A 2HMTA 1KR5A 3ORRA 1DEXA 1VLVA 3IR7A 3TW0A 2PM6A 5TS2A 1CJTC 3H97A 3STTA 4KIUA 3AIIA 4RG9A 3L7DA 3NVAA 3H4VA 4GTQA 1Z2CA 1CERA 1G8JA 6LDHA 2NU9A 1OVMA 2P3LA 2WXQA 3V7WA 3FH7A 4RHYA 3KFXA 3IOYA 3G5AA 5CCXA 2SECE 4MA5A 3IURA 1W1UA 1QHEA 2ZCVA 2N9UA 3UPTA 1LD3A 2Z9DA 4BNVA 4XEUA 4DHWA 2X0NA 1U94A 2EHDA 1XCOA 4LNHA 2Y1DA 1IXRC 3TZEA 4G0VA 5K8IA 4OVUA 3E8MA 4JUBA 4KNVA 1TLFA 2OY0A 3E8SA 3V2XA 2E4UA 5M5BA 4EZIA 2NACA 1JA1A 1L5MA 4QHSA 3EB9A 2CLKB 1Z12A 2CF5A 2HSEA 4J91A 4TYNA 2VJQA 1JXQA 4ACBA 4J6FA 3O8BA 3AV3A 5EMLA 4Z9XA 1KL7A 4IOJA 5D86A 1CETA 2KQUA 2WU1A 4IJMA 1R1DA 1QRRA 1V37A 3LQ1A 4MUHA 5FOUA 4R1UA 4C0HA 4XE0A 1M1UA 5D5QA 2OO5C 5HF8A 2RJNA 4YC7A 1TI7A 5J1SB 1HDRA 3ANYB 4FHEA 4X9XA 4YMHA 5KJ6A 3LQFA 3GLUA 1E8YA 4CI9A 1TJ4A 2WLTA 3NQPA 4R8MA 1LNSA 2VPIA 4PS7A 5LA6F 4BNKA 1Z0SA 4TX1A 4TZ6A 3C5VA 2PX6A 2X5HA 3ISVA 4UM5A 5U9CA 3DP7A 2QNRA 3JPYA 3OLZA 4BZWA 1L5JA 2VUSA 1GPWB 4L6IA 2FEOA 4KE6A 3UV7A 4IXTA 4WMLA 2ENUA 1FDRA 4O0MA 3HKDA 2GRJA 3QPCA 3KWJA 4U1RA 1T3GA 3ZUPA 2GN2A 4DT1B 4XWGA 4DBLC 2AS0A 1JHUA 1SCUB 4J1TC 5F5NA 5JY6A 3R9AB 4AICA 3K2BA 4QDUA 3GZNB 1TT5A 1H8ED 2IKQA 3JYHA 2O5CA 4GKJB 1DIGA 4DEXA 1GPH1 1KFEB 2O8BA 2FF5A 2FY8A 4F21A 2AXQA 4P7FA 4ZQFA 3IMFA 5H3LA 3CVUA 3OFND 4QARA 3UA4A 3CF2A 4EMTA 1X1BA 1M6VA 3JQ1A 1PKXA 1RMTA 3QVGA 4UBNA 2Y1GA 2WV9A 2ZJ5A 4FU0A 2BKEA 1EX7A 4RANA 3ICQB 4NFSA 1ZL2A 1Q1EA 3BWYA 2IEAA 3G8DA 5L51A 2J3MA 2D5BA 4CF5A 1N1DA 2CLEB 1Q16A 2CDNA 4X54A 5LM3A 3EF0A 1MO4A 4HX5A 1YRAA 5K0ZA 3UOGA 4WEQA 4GYOA 1W93A 1V3UA 1F0YA 1SC3A 5FCDA 3WK5A 5JJKA 3GK3A 5CW2A 1JR3D 2QYSA 5EGSA 1AHPA 1DAEA 2AYXA 1RYFA 2COKA 2NAPA 3GRPA 2C1XA 2WICA 1WG0A 4U7FA 1SXJE 4KBGA 4LOLA 3WLNA 3G5TA 5LQKA 5TQ2B 3MT7A 5DBGA 2QW0X 4HVBA 4DRXE 3TLEA 4ZCQA 1A9OA 1QXSA 4KMMA 4GP7A 4EB6A 3OSUA 2QTCA 4R9NA 2WC1A 3DCJA 1OFUX 5F5LA 1CHDA 1C7ZA 1G9SA 1JXAA 1T2UA 4CU5A 1PNTA 2ZSKA 4FZ3A 3LUDA 2QRKA 3FU3A 4JH0A 5ALPA 4EJ0A 4JJGA 2NWQA 1YH3A 4N5NA 2BMFA 3HVIA 4B4OA 2C8JA 5KTPA 3OMXA 3MWKA 1ODIA 1FJGB 4A16A 3EHNA 3LY7A 1OAAA 1CWUA 4D46A 4L4RA 3E30A 4HWPA 1R0YA 3UTDA 3DNMA 4BXOB 2Y0PA 2E9SA 1E2GA 4A1GA 5EC8A 1RRMA 4ZV7A 4CCSA 5CA0B 4D8WA 1M2GA 3S55A 3WGKA 3ZWOA 3HFSA 3LYUA 1XE3A 4DWVA 2X4GA 5EDSA 1P3Y1 2VA8A 3OA0A 5LXTF 2WSSD 4TKUA 1GZ4A 2P4UA 1H2FA 2P9TA 3Q3VA 5B12A 2HRBA 2PH3A 3RASA 3O90A 2QQEA 3ZQJA 4Q24A 3V8EA 1KGSA 4H17A 5ULLA 2A5GA 4ZFHA 3KT8A 3RUCA 3LM8A 4APFA 2WZCA 1RQXA 1TRHA 5F4BA 3W2GA 2R1ZA 3HBLA 4QT4A 2V7WA 3BK2A 1HV8A 2PA3A 3Q5MA 1WXXA 2MMGA 1AA9A 1SVIA 4OHVA 3UEOA 5DCUA 4DY6A 2B4KA 3CKLA 3LVFO 2JZOA 1DHTA 3T3OA 1DFIA 4R69A 5FNVA 1YRHA 2XUZA 3SBEA 5KSWB 2OC9A 3A6EA 4IIUA 4MYSA 1YL5A 3AF4A 5EIBD 3L1JA 3HBMA 1X9HA 1XOIA 2DFLA 1K7SN 3Q8KA 4NG5A 2WIJA 4PE5B 2BH2A 4FYIA 2XAUA 4F4UA 1GOTA 3LUCA 4D57A 1PL0A 2VIIA 2FV8A 3K0EA 4MUMA 2PWAA 1BX1A 2V4MA 1GZUA 1Z5VA 3CCFA 4A5SA 3Q8WA 2YH2A 2EBFX 4FC7A 2YZGA 3W3AA 2RJOA 1JIVA 4NCAA 2UKDA 2EIXA 4M8LA 4YDQA 2UYYA 3N2IA 3OJLA 4FOPA 3I62A 3UKJA 1K9VF 1OW3B 4OMFG 1I9GA 2I4LA 5ALWA 4NULA 2XT9A 1ZOIA 3URKA 3AFMA 1RBZA 4N54A 5AJYA 3QKWA 2J4FA 1KY2A 4RH3A 5FA5A 5HRYA 3IQZA 1K2VN 3ZE6A 2AN3A 4NV3A 1WDKA 4LDZA 4LNUA 3PEFA 3P0FA 1VJGA 1CZLA 3ENWA 4ABNA 1OIWA 2TYSB 4JI2B 4EW3A 3GW4A 1B6GA 5ESWA 4EG5A 4QECA 1T5IA 4W1SA 1MEOA 5HF9A 4I8DA 2GB4A 3AVPA 3QEMA 4R2JA 4EFLA 1GY8A 2YNMA 2VHZA 4GVLA 2EWWA 3S29A 3NB0A 4IEEA 3O31A 3ZGYA 1K1EA 2RKOA 4H3SA 4DMHA 3CG4A 2HQ1A 4J3NA 3MV3B 1JVNA 3T7SA 1ZICA 3U3WA 2XODA 4Z8YA 2J33A 5JDCA 4P2BA 1SG9A 4PSCA 2P6OA 1T2EA 4BJ6A 3BSYA 1JAYA 2ERYA 3F96A 4YRJA 2LKCA 5EWJA 3HVHA 3G8BA 5BT1A 2I1VB 5AKJA 3OE1A 2EDAA 1W88B 3ET4A 2I2XB 3UWPA 5L45A 3P4YA 5DX8A 2PGJA 4JUFA 3WJ1A 2I62A 2F4VB 4DLOA 2BV3A 3FA2A 1RYEA 4QTZA 3VR6D 3U7FB 4D0RA 4BMXA 2HR1A 3MGBA 4G0PA 4CKCB 1WVIA 3L1KA 1YMPA 1CS4C 3R3ZA 2A9KA 4R31A 1ZD2P 1U7IA 3TSWA 3R1IA 2ZI9A 1NA5A 2IH2A 2B5OA 5G55A 4Q47A 3I5MA 5IVHA 3SR4A 4Y7DA 3BVPA 3FBGA 4W9NA 2IJGX 3GN2A 3V7UA 1D6JA 3CLTC 2H6HA 3BKWA 3PQ3A 2O57A 2EYUA 1K68A 1FS5A 3HP4A 4EHDA 2O2JA 1BD3A 1ZXLA 3WQRA 4QXRA 3WFZA 4YYEA 4HAIA 4QAJA 2O2XA 5HKOA 5CFZA 1GXSB 1J2RA 3UMJA 3AESA 3PFIA 4LG6A 3DVAA 4CXMA 1FP4B 1JN0A 5CERB 3IE2A 1WMAA 3MW8A 5D66A 3ZLTA 4FEYA 3KQNA 4BFRA 4WWPA 1EXDA 1W25A 3CWQA 3ADDA 4ICIA 3ZD9A 4GZ5A 4AMGA 4FSDA 2PX5A 4G0MA 3RJVA 5CVCA 2BGRA 1I3CA 5FL7D 3ZEAA 2W0MA 4GKBA 2GZSA 5C5DA 3G8AA 4QSMA 5E9AA 4Q4HB 4V0SA 1NV9A 5JDIA 3IAXA 5I4IA 2VJMB 4V0KA 2ROQA 3SJAA 1QGUB 2CXPA 4L23A 2VUUA 4I1AA 3U3MA 2I7TA 2OPHA 1ISIA 1FMJA 1NGSA 2VGEA 1ZVJA 5DKFA 5D2MC 1TLLA 3PE4A 2IUEA 1KYWA 3NZSA 2ZREA 3HU2A 3CLRC 1YS4A 4UI9J 3HB4X 2GAIA 5T67A 2ZT8A 3UFXA 2XCUA 1FLDA 3R0JA 3MKRA 1QC5A 3Q1LA 3R3YA 3TBKA 1HDGO 5E6UA 1PW7A 4NOMA 3WYFA 1ZBPA 1MV8A 2WWXA 1Z4PX 3D3WA 2PZGA 4URZR 2LD4A 4CKEB 3GJRA 4O2AA 4GMLA 2XQGA 3FNBA 4LPKA 2XQJA 2FRDC 3IEUA 3RVOA 4IOMA 4KPUB 1OUVA 2CK3D 3QU9A 4B89A 3NV9A 2FPRA 4UOEA 5BVHA 5CB0A 4W7IA 3MWYW 3R3WA 3HJFA 2C9BA 3EXHA 4MKGA 1WLYA 1DAPA 3COPA 4BO8A 4FC8A 3C7KA 3N0XA 3CH4B 5DEIA 4OUKX 2O6HA 3IPXA 3BGWA 2XGSA 4LJYA 2IO3C 4QUIA 3ZW8A 3I2YX 1H65A 2ZEJA 2Q6KA 1WULS 3BMNA 4MYUA 4JT8A 2XXBA 2KYRA 1Y4AE 1XD2B 2CHQA 3JQAB 1P2GA 4H3VA 2BKVA 3GRKA 4PH4B 1MJ0A 1FQWA 2VQSA 3FTYA 3PWSA 4Z7QB 4Q3LA 4NXNB 3AM5A 1Z25A 1N2OA 3FYUB 4XE5A 2A5YB 3VI4B 3IR6A 1U2RA 3WYAA 1NXTA 3VU9A 4TWIA 3HSSA 1RFLA 4ZGWA 1XRJA 5E7QA 2P41A 3TOSA 3BAZA 1W6UA 3EX7C 3AONB 1ECCA 3EOZA 1F8GA 1HQKA 1M2NA 3BJMA 2Q7XA 5FO0A 1KERA 3AJRA 1SD2A 4ECAA 1TUEA 2HFKA 4D1YA 3SKXA 3UXGA 5MF6A 1Y37A 2QZSA 3MINB 1LLFA 1E1QD 2WW8A 4KSYA 1LA2A 3KXKA 5DT2A 1FP1D 3T5CA 3ZHYA 2PKWA 2D0OB 2H9YA 5BSUA 1UBNA 3UT8A 1MJGA 1XZMA 4JJ7A 2PAAA 5G05C 4G2NA 5C8YA 2CLHB 3H2JA 4WLNA 2HA6A 2EJTA 3M6IA 4KMRA 4YJ2F 1BO6A 5FADA 3GY0A 1FU4A 2F37A 5SZKB 4GI1A 4FYPA 1U02A 2C0PA 2FEMA 3PRJA 4MP6A 1EUDB 4AVXA 5ECGC 4UVEA 4LWOA 3CKCA 3CS3A 2BGTA 1Q7EA 3PGXA 3OTWA 5BVGB 3ROTA 4MQ5A 2WYIA 2WB4A 3RTAA 1KXZA 4CEHB 3A1NA 1P77A 4B6PA 2HK8A 5AK3A 5ES4B 1ZO8A 3I28A 3M3PA 1B76A 4GBMA 4RF4A 4EPWA 4RF3A 4I5FA 5J40A 3FUIA 1WUTA 2P5YA 1HORA 4RTQA 5L3QA 3HWRA 5FBLB 2GVNA 4TROA 4FZVA 4KLAA 3ZCXA 4GI3A 1OV4A 4BRWA 1OBCA 1PQWA 1P0MA 4RULA 3JYQA 3TEMA 2XV1A 3ZJUA 3V31A 3KXIA 4I4TF 3B12A 3LRXA 3CUTA 3HJHA 4YVQC 4B2PA 1VXRA 2Q8PA 3SHQA 4BNDA 2XHEA 2XH8A 4ESVA 1JT2A 1WV1A 3TUJC 4DG9A 1Y4ZA 4U5XA 1II0A 1D5CA 1XAGA 2XR1A 3T06B 4D80A 2F55A 5E2AA 3OZUA 4R9UC 5GONF 3L93A 1Z47A 3LO8A 1Q14A 2H7YA 1PZNA 1IVSA 3TG4A 4CIYA 4JVLA 3FOEC 3TI7A 2Z8ZA 2CN1A 3TIIA 2XTZA 3MRXA 4TXJA 1T25A 4EG6A 4D56A 4E1BA 4FD3A 4MX8A 4CT4A 4GWLA 4ER5A 3SGLA 3SDZA 4P8RA 4LN1A 1D2AA 4DIMA 1DX9A 3T7IA 4ZZIA 4FE7A 4QUEA 5ETJA 1ZVKA 4NK4A 1L6IA 2W4IA 2XRFA 2LSUA 2WF6A 5CMLA 4HORA 3FUFA 1ID1A 4RZXA 5DLEA 4BATA 3N7AA 3PD1A 4MR8B 4D4IA 1FDSA 5A6SB 4CTOA 3AJ8A 2WWHA 4II2A 4E5NA 5CG1A 5EP4A 3WDKA 3L7AA 3N2YA 2IYNA 3BWXA 1HETA 4I8IA 5EIXA 1E62A 1HRDA 4UAJA 2X2FA 1O77A 3TEJA 3V55A 4WKPA 2P2SA 2R86A 1GGFA 3X1WA 3W3AD 1R6AA 4AULA 4I1RA 2OGWA 4GTTA 1P1HA 1VKOA 1UM9B 1YJQA 3UG7A 2G1JA 4K46A 2ZIFA 4EGSA 4WINA 4F3NA 4JHRA 1KAQA 4BCBA 4DCNA 3U4AA 5LWQA 3UMYA 1O94A 3Q11A 1YJAA 3QTLA 1ML3A 4EY6A 4F2PA 3WIDA 3AR5A 2Z6QA 2HV9A 3KZNA 4REMA 2BFFB 3ANMA 4EQFA 4GMXA 4EW1A 3QSYA 2X7XA 5BW8A 1HDZA 1BHSA 3QA9A 2IO2C 3APFA 2DPLA 1F48A 3QV1A 3OH8A 4EKYA 2QJTA 4F4DA 2CWDA 4GZ6A 4YR7A 4GPEA 1LKZA 3V1YA 3GRUA 4F11A 5I9SA 5J90A 3FHLA 3JXEA 4M9ZA 3SNXA 1LTKA 2NW6A 4FHDA 3IV9A 5SICE 2I80A 1RRFA 4LGVA 1XXLA 3I4FA 4ANVA 2Q99A 5JSUA 3E1KA 3VR4D 4GPBA 3UXHA 2ZSIA 2CB9A 4UU1A 4AJIA 3FCXA 2J08A 3ULEG 1KI8A 3AUSA 3JYOA 5EJFA 1GA6A 3IAUA 5BRNA 3DEAA 1ULBA 1ORIA 2R7AA 1U80A</