4N39A

Crystal structure of human o-glcnac transferase bound to a peptide from hcf-1 pro-repeat 2 (11-26)
Total Genus 283
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
283
sequence length
716
structure length
697
Chain Sequence
b'CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title HCF-1 is cleaved in the active site of O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/substrate
total genus 283
structure length 697
sequence length 716
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n39A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n39A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4n39A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4n39A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n39A03
2IV7A 5G05C 4U0UA 1WM5A 3ZHEA 3QKWA 1Y6FA 5IKPA 1UQUA 3FROA 3Q3EA 3S27A 4CTNA 3L7CA 3EDTB 1C50A 2G9RA 3TSAA 2LNIA 4UI9C 3VTYA 1JG6A 3U3WA 4U07A 2NC9A 4CGVA 3Q4AB 3CUWA 3MBOA 3OTGA 1FU4A 3ZCRA 2ACWA 4N9WA 3K9IA 3D0RA 3FP3A 3JYSA 3DDSA 4HWGA 5KJNA 4UQXA 2Q6VA 1P4GA 3S28A 3NC4A 4BT8A 3CUTA 1P2BA 4PQGA 1P5QA 3NF1A 2PRJA 3BEOA 4KXKB 3MRTA 1NVKA 3OXLA 3IA7A 3G2IA 3MEKA 4N3AA 1K06A 1Z62A 1C8KA 4WNGA 3ZHEB 1PC2A 3O3CA 4M7PA 3CVQA 2QFCA 4RELA 2KC7A 4HORA 1OUVA 2XCBA 3BDAA 2UWJG 6GPBA 3G2NA 1WV0A 2QLMA 3MTAA 2JZCA 5G04C 1FTYA 4APOA 4HOUA 1FCHA 1FTQA 2XMPA 1F0KA 2QRMA 3AS8A 4XI9A 4U04A 3WXXA 4RIFA 4N3CA 3UUXA 3RJVA 2XCIA 4BFCA 5CCLA 3TG5A 4BQEA 3BD8A 1KT1A 5EX0A 3GYZA 2X6RA 2QRHA 3OKPA 4RENA 4G26A 3MSCA 4RBNA 4MHOA 5CCMA 2F3PA 4H7XA 4BQFA 2QRGA 3C4QA 4RG9A 3BD6A 2BFWA 5EKQD 2SKDA 3C48A 3NAZA 3OT5A 3KAEA 4WNEA 5KJMA 4WACA 1NLMA 1KLXA 3QKYA 1FA9A 1PN3A 2BGTA 3Q3HA 1WW2A 3BCRA 4LEUA 5DLDA 2E2EA 1WV1A 2KCLA 1ZU2A 2X0EA 3WAGA 2QRQA 3PE3A 3ZPJA 4GPBA 4F9FA 1EXVA 1L7XA 4NESA 1C3JA 5A6CA 1PSWA 3U4TA 3Q5MA 1QM5A 4WNFA 2LSUA 1JIXA 2WTXA 4MI9A 3ZCSA 3MTDA 3N71A 3ZCPA 3S7FA 3LYAA 1VGVA 3SYMA 1NA3A 2PQRA 1UZUA 3QHPA 4M83A 3RO3A 3HBNA 2GM9A 5FZQA 2IW1A 1Y6GA 3CVNA 4WNDA 3ZCQA 4GCNA 3TGOA 1L5WA 2IYFA 4Y6CA 2R5SA 2AV6A 2GEJA 4U0SA 4KQMA 4QLBA 3LY9A 4WADA 3NCHA 2HY7A 3VDNB 1W3BA 4YVQC 3OXFA 2H1HA 3T3HA 3QWVA 7GPBA 2I6HA 2PYIA 1ELRA 1YGPA 1L5SA 3ULQA 3FWVA 4AN4A 1C8LA 4X7RA 4AY5A 2F9FA 3GPBA 3Q47B 3RIBA 3CV3A 3ZCTA 4BT9A 4HOSA 2QN8A 1K08A 4HOQA 1NOJA 3ZN3A 1NOIA 3HYMB 3R9AB 3RKVA 4RIGA 2C2LA 1Z6QA 1SXQA 2VCEA 3ZFWA 1FU7A 5JTUA 5TVGA 5JJTA 1RZVA 5IKOA 3ASHA 5JJ6A 4N39A 1BX3A 1RRVA 2PYDA 3CVLA 2XA9A 3RT1A 2BISA 3CVPA 4X7PA 1XV5A 4G2TA 2O6LA 2YHCA 2AVPA 4A1SA 5EX3A 1IYGA 2LSVA 1H5UA 3Q3IA 3ASGA 2KCKA 3O48A 2R68A 3S29A 3GUHA 2J9QA 4Y6WA 3MT8A 4UQZA 2VQ2A 3URZA 1WUTA 2ONDA 2HR2A 4GA2A 4JL0A 4NC9A 1NOKA 1PYGA 3LCAA 2R66A 8GPBA 1GPAA 2QN7A 2PZIA 1L5RA 1HLFA 1LWOA 3PDNA 3VTXA 2F3SA 4BTAA 4UI9K 1EM6A 1FC0A 2KATA 3IAAA 2P58C 2GJ4A 2XA2A 1GZ5A 3CKCA 1QZ2A 4N3BA 2Y4TA 3QWPA 4GZ3A 3UYKA 2VSYA 3NP9A 3NB0A 2P6PA 3Q15A 3ZCVA 3T3EA 3RO2A 1P2DA 3BD7A 4CTMA 3SZ7A 2R4TA 1A17A 1YA6A 1B89A 4Z5XA 2ACVA 4N2QA 2ASVA 1P4JA 3T3IA 3S2UA 1ABBA 3UQ3A 2R4UA 5BNWA 4I2ZA 1QQEA 1GFZA 4YNDA 1Y8ZA 4BTBA 3MRVA 3MKRA 3FFLA 3CUUA 1FU8A 5BW8C 4RIEA 1XL1A 3E3OA 3SF4A 1IXYA 3TG4A 2GW1A 1ZBPA 3G2LA 5CHEE 4NQ0A 2FF5A 5M72A 2ZB2A 3MV3B 4GA1A 4W6QA 3CUVA 4YUAA 4AIFA 3MT9A 5JTTA 3CV0A 4EJ2A 2ATIA 3MA5A 1XKXA 2QN1A 1XOIA 2OFFA 2HYZA 1KTIA 3S7DA 3GW4A 4F96A 3G2JA 3RHZA 2XCCA 4XIFA 1GPBA 5ENZA 3COPA 4REMA 2SKCA 3CEQA 4I1AA 3HBMA 5A7DB 2VG8A 4NEQA 3S7JA 3L79A 4O6FA 4YI3A 3NPAA 3OTIA 3RSCA 2XGSA 2G9UA 4XI0A 3OTHA 2XCUA 4MI6A 5DXFA 4I9CA 4FZRA 2X0DA 3E3LA 2X0FA 4I17A 2FETA 1A8IA 4RIIA 4JA7A 2WPVA 5FTPA 2XGOA 4GZ5A 4MI3A 4GYOA 5D01A 2KS6A 2UY1A 5D0OD 3UPVA 1WAO1 1NA0A 5HQ8A 2IEIA 3TAXA 3MQFA 4N2SA 2IYAA 1XL0A 1XNFA 3AMVA 2AW3A 3CX4A 4AMGA 2IFUA 5FZRA 2DBAA 4F97A 1KT0A 4MHSA 3CEHA 4LEIA 4WUYA 2QLLA 9GPBA 3VUFA 1P2GA 3CEJA 1NZDA 2YJNA 3GZ2A 4RG6A 1HH8A 1NZFA 4F3VA 2GT1A 2XA1A 4GPKA 2UY1B 3CK8A 4J8FA 2PQ6A 1IIRA 2X6QA 2PL2A 2VSNA 2AMVA 3OY7A 2HO1A 4WHMA 1J39A 3Q49B 2MHKA 1E4OA 4M60A 4GYWA 2JLBA 4IN3B 1P29A 4G23A 3KS2A 2V5FA 3C4VA 3HBJA 3T5TA 3L7DA 1F6DA 4MRAA 1HXIA 2C9ZA 2GPAA 4JA9A 4N5CA 5KJLA 2IV3A 2FF4A 3OKAA 2KCVA 2ECPA 4BWRA 3OY2A 2C0LA 4NRHB 5FJYA 5HI7A 3AS4A 1GG8A 4J8EA 4I2WA 4EKEA 1NZNA 1L5VA 5TMBA 1LWNA 1FS4A 3QWWA 2PRIA 2QLNA 3MS7A 3E3NA 1FTWA 1Z8DA 3ESKA 4AM9A 4KQ1A 3UYLA 2F3UA 3ASFA 2C4MA 3GZ1A 1QKJA 3E4BA 5C1DA 3S0JA 2IEGA 4G25A 2QRPA 2G9VA 3NP7A 4EKYA 3TOVA 5G04J 1P4HA 3MTBA 3OKCA 5FZSA 3CKBA 3RU0A 4L22A 2QN9A 4GCOA 3WC4A 1PNVA 2FO7A 4RIHA 4G1TA 4HOTA 4AMBA 1AHPA 2XGMA 1SXPA 1WW3A 2OOEA 2QZSA 1ELWA 4CGWA 1V4VA 5LCWJ 1B4DA 5BT1A 5TMEA 5DU2A 3BEEA 3ZCUA 1AXRA 3BCSA 2BGUA 5HXAA 3L7BA 4EL5A 3LPZA 5DBKA 2H1FA 2PQNA 3DDWA 3L01A 1Y8MA 5LCWC 2YQ8A 1GGNA 3VUEA 4HLNA 4ABNA 4EL0A 3CEMA 3QDNA 2C0MA 4KBQA 4ME2A 3DZCA 3PE4A 3CK9A 4CDRA 2F3QA 5JJ7A 3CUYA 1O6CA 1Z6PA 2SKEA 1TJCA 1L6IA 1RZUA 3LY8A 3HBFA 4X7MA 2QN3A 1YA0A 5KJKA 3H4IA 4U0ZA 4BQIA 3AS5A 1E96B 3OXGA 1JEJA 1E1YA 4GA0A 4FKZA 2Q7FA 3L7AA 4J8DA 4YVOA 3EBPA 4W9RA 4AY6A 2XEVA 1IHGA 3IEGA 2GPBA 2Y4UA 2IF4A 2C1XA 3VDMA 5D00A 4KQ2A 3RSZA 2QN2A 4KYOB 2QNBA 1WUYA 2GEKA 2FBNA 2AZDA 5ARGA 3LKUA 3T3GA 2XPIA 4B94A 4LDPA 4EQFA 1M5RA 3MRXA 4G24A 2FI7A 5ARFA 2VGYA 3ASDA 2L6JA 2GPNA 2FFRA 2WQHA 1JIUA 2FEZA 4GYYA 2G9QA 3MT7A 2VCHA 3ZGQA 2VGXA 5DIZA 4I9EA 4UQYA 3SYRA 1GPYA 4CTOA 3WADA 5I45A 5LQDA 2IUYA 1JG7A 3MS4A 3KD7A 5D0QD 2JJMA 1L5QA 3MV2B 2C1ZA 4MICA 3T3DA 4J0UA 4G2VA 3QOUA 3CK7A 5AYWD 1UQTA 5FT9A 3G2KA 4JHRA 5G05J 2R60A 3LY7A 4YI5A 5GPBA 3H4TA 3G2HA 4GZ6A 2BUGA 3S7BA 5TMDA 3BCUA 4H7YA 3D0QA 1XC7A 3D1JA 3MS2A 4UI9J 3EBOA 2VYIA 1JIVA 2VGXB 4X6LA 3DD1A 3T7DA 1HZ4A
chains in the Genus database with same CATH superfamily
3ZQ4A 1Y8CA 1X7ZB 5HRAA 2O05A 4EVQA 2HHLA 3SBSA 3FTDA 5AP9A 3MBOA 4HY3A 4C7JA 3FEXA 4L5IA 3ZDRA 3PNQA 1Z4IA 4GR9A 3MRTA 3RYFA 4JJEA 2HA2A 4EFLA 1A8PA 4QOSA 3V3KA 1A69A 2ZWVA 2GPTA 4MJXA 3V2OA 3NTOA 4GR5A 3NNDA 2GXAA 2KHZA 4CF5A 1FNDA 1P5FA 4UAJA 4UKDA 3KZKA 1RMYA 2I2CA 2E48A 2ZATA 4NCXA 4C05A 2CLOB 2IVFA 1T8PA 3TQTA 1XNGA 1PNTA 5F2NA 3KKZA 3HWSA 4QHTA 3V1MA 2HA3A 3SE7A 3TPZA 2VDMB 3GI1A 3QUSA 4YC7A 2O0KA 2E85A 2WJAA 1EX6A 1MA0A 4DAEA 3BXXA 1N5OX 1Q0SA 1VE9A 1WB9A 3AZQA 4OB7A 5EDSA 3QITA 1NA3A 4EAQA 2ZBDA 1K7XB 3B36A 1RBQA 1FW6A 1ZZEA 3KHUA 2W2QA 4TTVA 1SCQA 2ATXA 1JHPA 3LY9A 2JLZA 1P1HA 4EZIA 3AHJA 1K8QA 3B85A 1JVNA 1MB2A 2NV6A 4TVSA 1KKLA 5HG0A 5ANRA 3R9AB 1XQXA 5JO9A 4WCFC 4LY0A 3TLEA 4HJXA 3QXCA 1ZAYA 4AJ1A 4CL8A 1XV5A 3DPUA 3P5SA 5GVRA 1BXGB 3M83A 2MYNA 4UPVA 2NWQA 3KQTA 2HRZA 2AL7A 2VXYA 1TK2A 2PGIA 5IMSA 1WUTA 5KTOA 1XYVA 2I6SA 3AWIA 2APJA 4KMOA 5IUNC 2GXUA 1INLA 2PBFA 2J48A 3FHJA 1IXVA 5JMOA 1SQ0A 1Z7EA 3DL2A 5E4TA 4QVIA 2HZBA 2Y68A 3PL1A 3S2GA 4KIWA 2O2CA 1Y48E 1RLJA 3ZH9B 3WGOA 3CF4A 4RF3A 3IV6A 1L7AA 4M8IA 1ZOSA 4Q4HA 2Q7OE 2PKWA 2W5UA 4YRAA 3ICOA 4LOIA 1HH4A 3VDQA 3I9V6 2E6UX 2ZUFA 1P1FA 1Y42X 3KL2A 1LVHA 1T6NA 1K3FA 2GPSA 3SBOA 3NT2A 1M34B 4JHXA 4DUPA 3UKOA 3NV9A 3B5JA 3DE0X 1PL0A 4J0FA 2QM3A 4QUGA 2CLHB 5JHHB 1NR5A 2HWWA 5K1ZA 1ABFA 1XEAA 3M6WA 4BUJA 3K1AB 4YRFA 1AQNA 4OLHA 4DEYA 1A50B 5JY6A 3C8HA 3NBYC 1RXIA 1AQJA 5K0NA 1USKA 4G01B 1PTJC 3OZTA 4FE4A 4S04A 2QVGA 1ZESA 1C41A 3B6MA 4PNZA 3CVVA 1GTSA 4JBIA 4AN0A 4QUHA 3LBHA 3EEBA 2ZRLA 1NDQA 1G8JA 3DO5A 4N40A 5KX5F 5I7WA 3MJSA 4C3ZA 4ND8B 4RNDB 3BS4A 4FB4A 4JYCA 3OLCX 1KGSA 3WYDA 3H86A 4LYFA 4LK3A 2VCYA 1XZBA 2VK2A 2ACKA 4MW1A 3CLJA 2V97A 3I6YA 4UWGA 3KJFA 3GRVA 2MTBA 2O8NA 1K66A 2PQNA 3K6KA 1YQUA 3FPJA 4KUGA 2C5LA 1XKTA 4OHYA 3ZE6A 4DQVA 4DX2A 4EW2A 3PGJA 4F06A 3U3DA 1JKIA 2DIWA 4LK2A 1R9NA 4B73A 3FNGA 4CKBB 3SY2A 4PLFA 4RCYA 2NYRA 2BJHA 3GMSA 3L84A 5EILA 1SJ9A 4RTRA 4HPXB 3WMEA 4RXMA 4ITUA 5CVEA 5CECB 1E5XA 5I4BA 3OIWA 2XV1A 4RVNA 1KOLA 4CKEB 3MPOA 1C9YA 1YKSA 2HHCA 2WB4A 2C61A 5C5IA 5SZKB 2WZQA 9LDTA 3ISTA 2C2WA 1L8XA 1QG6A 3LNTA 1J33A 4DDKA 1LPAB 3TOXA 2A14A 2JAOA 3I0ZA 1K2VN 1CX9B 1N5IA 2YY7A 3DEKA 1U2QA 3GG2A 5KJNA 2IXGA 4WPGA 3OT1B 4C0BA 3O0DA 3PQ7A 1ZH4A 5K3BA 4ZVRA 2Z8YM 4YGYA 1GNQA 1VCOA 5CFZA 6GPBA 3VR6A 2FZCA 3GA7A 3TBHA 5G3YA 3KPVA 2PUBA 3P9NA 3ONKA 3A3PA 2MINB 4ZZ0A 3EGXA 4UVGA 3B3FA 1PRYA 3A1FA 1AGYA 1L5YA 4WKCA 1GYPA 3G7NA 4CEIB 1EFVB 3SYNA 4JUDX 1LBQA 4WNEA 3TQFA 4ISCA 4LEUA 3A1VA 5F51A 1BGXT 4WX2B 3VOBA 2ZJAA 1T26A 5HUQA 4DUZB 3FOWA 3F4KA 3WLIA 4NSNA 3I34X 3F9RA 2YWRA 2ARKA 2QX7A 5LB2A 2BKXA 3F5FA 1Y8RB 5KYKA 1FJXA 4J4BA 2HRBA 4N5DA 4AWXA 1W3BA 2XNKA 2JH8A 5L95A 3Q7IA 2AXNA 2WHPA 1ZMBA 3TZQA 3R7WA 4D3SA 1NVDA 1M2NA 4Q01A 3U60B 2FNAA 3STXA 1NUAA 3KTAA 5G4LA 4BNDB 4N5QA 1GZVA 2FDXA 4RHCA 3GX1A 2QRJA 1K3TA 4LHWA 1IYZA 1PDOA 4TUMA 1X7GA 2CG3A 3C3PA 3ZJ4A 3AFIA 1K0FA 4UAGA 4MINA 5CA1B 3NG1A 3CU5A 2XUGA 3NX4A 3W77A 4WL0A 5CFOA 2KSQA 4R3WA 2HCJB 5GINE 3PI6A 4EEZA 4LZWA 3T3EA 4RKWA 1CJTC 2R4TA 3HK2A 4H2DA 4OU5A 1JEQA 5DVZA 2ZCVA 4Y6PA 4JW1A 4BKOA 4AV7A 4PINA 5DRTA 1H85A 4K40A 1PEYA 2Q2WA 4B3XA 1QKKA 3QV2A 3F1KA 4E2WA 1MJ5A 2H8KA 5LNK1 2W8ZA 1W9MA 1F14A 4JLPA 3PVLA 4MW2A 4GMDA 2VH1A 1H2BA 4IS2A 4Q7KA 1DG1G 4LXGA 5JMWA 2JGRA 4D6PA 5C1PA 5JAZA 2ZQ5A 1T5LA 3B7WA 2RBGA 2QP9X 3WV5A 1D1SA 5I9IA 4DR7B 5DTQA 3LRXA 3IUJA 2X6QA 2FRDA 1LI7A 3OHSX 1PAQA 4CL2A 1V3UA 2Z8XA 2OYSA 2PRZA 3U09A 5ADUS 3RRYA 3FPAA 2WXFA 4BBAA 2QYTA 4IH4A 2ZTLA 3L40A 1UJMA 1TCUA 5B6IA 2I6TA 3E9CA 4Q19A 1TEVA 4GW3A 1PR4A 1TAQA 3VOAA 4OAPA 3ZDBA 2ZUDA 5EUMA 1CUHA 4R5MA 4RVBA 2AHOA 3OMXA 4YXWA 4DTIA 4TUYF 3TOVA 5G04J 5IT5A 1U2GA 4WXEA 3UBMA 1CUEA 4EG7A 3AR4A 2OZLA 1HE8B 5IJ9B 2A1TS 3Q1KA 4FYWA 5AKGA 3SS9X 4CPDA 4D25A 1AQUA 2PCJA 4QUEA 2ETVA 5DI3A 4DQKA 3RRMB 3I2JA 2I87A 2OP0A 3FWNA 1P9OA 2N46A 5KJKA 3B8EA 1WBDA 1TVCA 4GP7A 1SUFA 2E82A 2PS0A 4KGXA 4RDXA 3GD5A 4CYMA 4E3ZA 3FLEA 1U4SA 2VJPA 1MB4A 2JHCA 3K30A 1WBBA 5HKOA 2NXEA 4IHJF 4HN9A 2PGOA 1VPDA 4DR6B 4ISBA 4QOEA 1YH3A 1DC7A 1KHTA 4TM8A 4WINA 1X9IA 1I6MA 1QB8A 5ERXA 1E0KA 4URYR 3IX7A 3OWOA 4MXDA 4WASA 5GGXA 1Y7IA 4EY6A 1AN9A 5CDTA 1BU8A 2H07A 3SE0A 3TRJA 1J7KA 5AN8A 1KJJA 1Y3IA 3UINC 2GDZA 5DYIA 3V6MA 3U4GA 1KPHA 3G0IA 3FTZA 1TM2A 1KI6A 4HWRA 1MABA 4FDTA 4YCBA 2GCEA 1JGTA 4Q3BA 2VK4A 2P9TA 2GK3A 5FNZA 5K3DA 1OILA 2WSSD 4HAWA 4H3HB 2JGMA 3THXA 3BD8A 3BF7A 3VBEA 4K8RB 3DSTA 4RJKA 1YQGA 2J5QA 3C43A 2RBEA 4YR7A 2OBLA 2BFWA 1ZUHA 3BCRA 2MOKA 1WV1A 1T8UA 4Z4FA 5HMMA 5K3FA 3RC2A 4K5QA 1QM5A 3VC7A 1X3LA 4I2VA 2XZDA 4LHZA 4AQ7A 4D82A 3G0DA 2HIAA 3ZCQA 2IYFA 4YCAA 4JLBA 1XR3A 1A97A 1ZVVA 3FNFA 2AW5A 3G2WA 2J5BA 4BTVA 3N5KA 2J3DA 4G0PA 3UK6A 3F7OA 3QTTA 3EMBA 1AKUA 2WF8A 2AEMA 2OCIA 1RRFA 1QVRA 3ZIUA 5K09A 4EFDA 1N7HA 2ZBQA 1VJ1A 1MAVA 3ASGA 1C7RA 4BX9A 2DZDA 3S7ZA 4PAGA 1QKIA 3W3AA 3HR8A 3VHXA 3IAAA 1JB9A 1C4KA 3K32A 3ZBQA 3H17A 3FFAA 5AT1A 3RD5A 3GGDA 1K7CA 3ZPXA 2UZ0A 3UM2A 4ZMRA 1O1YA 1DEKA 4JC0A 3KU4A 4BNYA 1N5MA 5LIPA 1EF1C 4EY7A 4F21A 4QUDA 2WNIA 4INJA 1XCGB 2BFBA 1VMKA 4G0OA 3Q7RA 2A4ZA 1NW8A 4DCVA 4RDHA 3K8QA 3MF4A 3LFUA 1KY3A 4RD1A 3TL6A 4L27A 3LOPA 4I17A 1DV1A 1PHPA 1TQ4A 1A4RA 3R9KA 4N8DA 4L5CA 1QAOA 2B7BA 4L2YA 3FUHA 1O54A 2OCGA 3WIBA 4EA6A 4RWEA 5FL3A 1UT5A 4RG6A 2TECE 4NYJR 4EYQA 1XHLA 2CDBA 2MHKA 4X84A 2RI1A 5AVZA 2V0PA 4EHHA 2J67A 1E0AA 3I9OA 5T3YA 2IH2A 4BP1A 5AVRA 2PFSA 1HL3A 1QS0A 3UXEA 3L8FA 2X58A 1KY5A 5FUMA 1WDKA 2QY7A 1FNCA 2FI1A 4BXOB 1FFDA 1FLAA 3QU9A 4TXNA 4OYSA 4QXMA 3VR1A 5JMTA 1TLTA 3APDA 3RABA 4XEUA 3KXIA 4NBKA 3BDVA 3WDSA 1JTFA 1YJ5A 2F00A 1U80A 4ZJUA 3N8NA 1XK6A 1HA3A 1M0SA 3D43A 3WLEA 2AW6A 4BZZA 4B6OA 3DKKA 3F5QA 4JBNA 1JG2A 1IPHA 1H6PA 4DV4B 2VJYA 5SZHB 1WUYA 3ET5A 4AJEA 1ZNQO 3LIPA 3WTCA 1YL5A 4BRZA 3MRXA 1QQ7A 1MO6A 2VGYA 5CM9C 5DZSA 2OZKA 1TM5E 3CPSA 3O26A 3ELWA 3LGAA 1YJCA 2VP6A 1O96A 2IU3A 3EGVA 1LD8A 4ZV4A 4N18A 2AMJA 1UFVA 2W22A 1K4YA 3EDMA 2E5WA 1T5SA 2R97A 3KEAA 4X8QA 2RC6A 4YK7A 4IX1A 3UAZA 2C2XA 1Q0QA 1PK8A 4D9HA 2HO4A 4Q4DA 7ABPA 3JQ0A 3UHAA 3ZHBA 1UG3A 4M7OA 4RELA 3RUIA 4WNAA 4R2KA 5FPTA 1YZKA 3V33A 3FOFC 4HI8A 3LSTA 5A3QA 3J81k 1U5BA 2W9XA 2OD9A 1KAHA 2Q1YA 1TKCA 3U16A 2Z2KA 4H4DA 4JLVA 3P71T 2AF3C 4NCHA 4C7BA 4ZT6A 2XQKA 2EYUA 2ORED 3AFHA 3V7YA 3ZHXA 3KS9A 5KJMA 1BH2A 2ZYIA 4GQIA 3WQSB 1U2GC 2FSIA 2I4NA 1R00A 2AR9A 3PUKA 1OE0A 1MZCA 2QAIA 2AZXA 4IHQA 3KP1A 4XSVA 1KFKB 2FPMA 3GP8A 4RD2A 2HLDA 2AV6A 4I9NA 3CMCO 4ILHB 4KO3S 2HY7A 3O38A 2C4NA 5AVWA 4TMXA 3KJXA 2CHZA 4B4DA 3O8LA 1M7BA 3WB2A 4EMSA 1OXBB 2HMAA 4P80A 1Y37A 1NOJA 3DPIA 1SCUA 5EP3A 4INZA 3FDIA 3I3NA 3NRBA 1UBHS 3KR2A 3A14A 4M1SA 2IP2A 4EGQA 4R5HA 1OKKD 4XX1A 3U44A 3L6DA 3JYLA 1I9GA 4V0SA 5IHXA 4CM9A 4NK4A 5T8IA 3OQNA 4LMBA 3IDSA 2QRUA 5CYOA 4DX7D 4DB2A 2B78A 4CXMA 2RD0A 2XEXA 1RWPA 2RHJA 3WKCA 1V7QA 3UQ3A 3G6KA 1QGUB 4R41A 1FU8A 2A6PA 3QF4A 1XL1A 1SOUA 5CX1B 4NZ9A 2QTAA 5JAQA 4ZHBA 4C2UA 3EN0A 2H00A 5H68A 2ATIA 1Q21A 2PDAA 3MWDA 3SC2A 2IWRA 2E4YA 3O9VA 4G9GA 4ER7A 1OA0A 3RM3A 2XGSA 2G9UA 4M9UA 4MH0R 4QJBA 2H85A 2ZUTA 1JDPA 4Q9NA 3N2LA 4JA7A 3OSUA 2ISQA 1E2IA 2PA0A 1U7HA 1YRYE 2I5PO 5I4IA 2B8NA 3GJTA 4GECA 5IXJA 1E5LA 4FLFA 4GZDA 1WQ4A 1K5HA 2R48A 2EL7A 1U6KA 4R7GA 5DM60 1RRKA 3QEAZ 3QXGA 5NLLA 3FMFA 1BW9B 3ICPA 2CUZA 1C3OA 4WIAA 4Q9IA 5DXJA 2Y2VA 2QVZX 1F48A 5L53A 4LHVA 5K8JB 2GPAA 2ZBUA 2R8PA 1K7YA 3SR3A 1GTL1 2F64A 2HXYA 1J0BA 1U0SY 2OD2A 3KQUA 3NTLA 4YMGA 1XZDA 4G0WA 1MTOA 4PYKA 3RS4A 1GPDG 2GZ3A 3KSMA 3V3LA 2ORYA 4ZPJA 1W0KD 4OK5A 1YI1A 3QPUA 2CMFA 4QQFA 2R6JA 4MITA 4RIHA 4N5MA 1TEXA 1TK9A 4EK9A 4YQEA 2A58A 4D74A 3NHYA 3I9KA 4KLZA 5BRAA 1KOGA 1NUPA 4IJKA 2BI7A 4OY3A 1KTVA 3HCBA 4E4TA 3CC8A 2X4IA 3IC5A 2H7YA 4L4UA 1GADO 4CF6A 1Z0IA 1R5BA 2Z83A 3R9XB 4NMWA 1PSDA 2PLNA 4E2ZA 2O2DA 3H4IA 4KGZA 3K72B 1A72A 1GTJ1 4RESA 1PYDA 1ZJ5A 2CMDA 4DJ5X 2JAXA 4AOFA 3WBJA 3TQHA 3VDMA 3QXSA 2GZSA 4PX2A 1G21A 3B6KA 4TMYA 2IZ1A 3T1YB 5IJWA 3EAFA 2X1MA 4BEJA 4QBFA 2CCJA 3VR4A 4B3FX 1Z4KA 2ZFUA 4B1FA 3RJMA 1QHIA 2G6TA 4F5ZA 1GOTA 3SXJA 4GZ6A 3ZHQA 3IT3A 5JYCA 1WCXA 3QE9Y 3LQFA 4HWSA 3PNLA 4YJKA 4E0BA 3W5BA 4I6GA 1A82A 1G2OA 2WG2A 6PFKA 4PPYA 3H8VA 3KXPA 1L5HB 1QVZA 4B6EA 5LMUB 2Z9DA 4RFSB 5LCXA 1KPIA 1ORRA 5GJCA 3DP9A 3Q7QA 2G8NA 3B13A 4X90A 3TVTA 4G5XA 4IIBA 3RS8A 3SU8A 3C39A 4TRNA 1U2RA 5FYQA 4XI9A 2GFIA 3O1LA 2FJDB 4H3SA 1DQNA 2A7QA 4BQEA 4H35A 1GLGA 3BIJA 3ESYA 3GLGE 1UM9B 5SZIA 2EW1A 2BUAA 3ZY2A 4TZ0A 2VT6A 2V3WA 3LPCA 3PEYA 2JLAA 4Z53A 3SC4A 4N7JA 3SJZA 1WX1A 1JLSA 3M0EA 1BHQ1 1LFDB 3QXXA 4U6QA 4AXBA 1B8UA 2YDYA 1I1NA 2Z5FA 2P2CP 3QHPA 1L4NA 3NOGD 3DSRA 1ZM9A 4QYWA 2P4EA 4BFVA 4X7BA 3OKFA 1C29B 4NHEA 5ALLA 2QZAA 3QWVA 1ISIA 4X93A 1UPBA 2P5SA 3OPYB 1TO2E 3V32A 1KDVA 2GA8A 3L08A 5ERGB 4BO9A 1LF5A 1JMYA 5GWXA 3PZRA 4ZT2A 5CA0F 5GONA 2DTXA 1DAIA 5FPYA 3GDGA 1I4TD 3HIZA 1EFRD 1CQIB 5BV8A 2WD8A 1X7HA 2VP0A 3F9CA 1MLDA 4UEKA 4DKXA 2QN7A 2HIGA 4J16A 2I3DA 2Q3FA 3HCFA 4C03A 2NU8B 1F5NA 2P9LG 1MOQA 1IULA 2D13A 5JXWA 1FFWA 4I5GA 4M37A 4US0R 1ABBA 4F1KA 4AJ2A 4GKAA 2CXQA 4LJ8A 5M2QA 4FC6A 3ORSA 4R1OA 1GKLA 4OLJA 5E1OA 2FF5A 1Y4UA 5J23A 1JILA 4FMPA 4RHTA 1G3IA 3G2JA 3RHZA 1G17A 3UHPA 4A92A 4YJGB 3GRPA 4TYYA 5DTMA 4KR3A 5BUSA 3RJ9A 4MMXB 3JD0A 4X1YA 3W5JA 5CVDA 4EPZA 4C2TA 3QZUA 2QT9A 4XD7D 3W05A 1FMJA 1OF1A 3O8QA 2OOSA 1MJ0A 1O0CA 3A1EA 1RLOA 3PLAE 1FTSA 3PC8A 1P17A 1YASA 1KYYA 4QICA 1JEYA 4UTVA 1A9QA 4GQBA 3BG1B 2ZIGA 5TT0A 4V3BA 2C59A 2GAOA 2G82A 5ECDA 1CUJA 4J8PA 3U66A 2XNDA 1QHHA 4V0NA 4HL6A 4QUJA 5A5GA 1MR3F 4Z54A 4PPQA 5FRDA 4WVFA 3AU4A 3I5XA 4D3FA 3T1HB 2AOWA 5KUTA 4DANA 4QU0A 1BOOA 2PRIA 4BV9A 5ENOD 2MU1A 4XEIG 1WM1A 1CV2A 3QELA 3ML1A 3S0JA 4MPDA 3NP7A 2FPKA 4PGMA 3G0GA 4MRMB 3N74A 1BAPA 2F8LA 4CGWA 2Z2JA 3IPRA 1NMZA 1T6YA 3IIIA 3ZWXA 4DXAA 1CEQA 1V37A 3P9RA 4B82A 2SBTA 1G20E 2LW7A 1Z18A 2H1OA 2EZ4A 1CUYA 2FX5A 4J0HA 1RW2A 1NXXA 3GFPA 1SO8A 4QM6A 5M7EA 2CUKA 2GHQA 4YLGA 4DLXA 2WJ4A 3JRNA 5FH9A 5J1SB 2DFLA 3H13A 3ROEA 2F8SA 3ONLA 1GLVA 4KV9A 4PNEA 5CA1F 1KWKA 1E0SA 3R44A 4G0YA 1GPYA 4WUVA 5CIQA 5DH9A 3PNSA 1D2NA 1JHYA 4MW0A 4YTEA 3MS2A 3EBOA 3UB2A 4B6SA 4CMBA 3K0AA 4BATA 2J4DA 1UQUA 1FX0A 3TTVA 2GSWA 4PYJA 1LU9A 3CUWA 1EFKA 3ZCRA 3AI7A 2FUNB 2JZOA 4WMLA 1UDBA 3U7RA 5BYKA 1Z0ZA 1HF8A 2XUKA 1V4BA 2ZUSA 2WA2A 1AF7A 1UZLA 3BF8A 2RSLA 2ZYAA 2WJZB 4W82A 1CP2A 1PR6A 1L4FA 3QRWA 2M32A 2WD7A 4HOUA 5AOCA 4L6IA 1RHMA 2FKAA 4FR2A 3RWOA 3B82A 1U8UA 4CTJA 3K5WA 4D9CA 3FZEA 4OQLA 4Y3UA 3ANSA 4UWKA 2XSZD 1XKQA 1E2HA 3WWOA 3OWXA 3Q3JB 5JJ5A 3RSHA 3RYIA 2HLPA 5B7PA 4RPHA 1YFJA 2WFAA 4Y9DA 5A6CA 4U2DA 2NO5A 4GZCA 1NVAA 2H4HA 1YRWA 2PWYA 5FINA 3ESZA 3NZEA 4X8MA 1H2ZA 2ZBFA 4YAFA 1JFFB 2LKCA 5DB4A 1ODJA 1G42A 1SKAA 4L0DA 5CERB 4CI9A 2AK3A 2FP3A 2FPIB 5EWJA 2IZ5A 4G37A 4B6JA 3TOZA 4U9IS 1X7WB 1M7GA 4MUJA 5AVKA 3DKVA 1ZA2A 5HK9A 4RVUA 1KH3A 1LBTA 2AXVA 2BTDA 3DTNA 1YUMA 3IXQA 3JQGB 3BA1A 5EWMA 3DFZA 3D9JA 1Y9EA 4C2BA 1ADCA 5LLDA 3S2YA 5JMPA 3LQ2A 2PSSA 3CUUA 5L3QB 5LLSA 3T9KA 1UZMA 4ZYTA 2OV6A 4EGSA 3GBPA 4JQYA 1JALA 3N7TA 4GWLA 3COJA 1LC3A 2ZJ3A 4TV9B 5K0LA 1UXIA 3WLSA 4A26A 5CDFE 5DW0A 3ZDEA 2O8CB 3NBQA 4L02A 3GH1A 2ANBA 3ER8A 4X1OA 2XOKD 3FOZA 5JD6A 5I47A 2CWDA 1GUZA 4C30A 5DNUA 5J2TA 5H7PA 4REQB 4PC7A 1T0JB 3KE8A 4OXNA 4M1TA 2FW6A 1NQTA 3KQHA 4U6SA 4RA6B 3GROA 2NPOA 3IILA 1SXJD 5CDUA 3DAFA 1JDBC 4A8JB 3E7FA 2VAXA 3VSCA 4A0QA 4WJLA 3C3AA 4FHFA 2Z56A 2PZLA 4TQAA 3U5TA 1TYEB 4PU0A 4HD8A 4RH1A 4F3RA 4FQ8A 4GTQA 4ILGA 2R2LA 3ICEA 4G8CA 5LP6C 4PHTA 3Q7FA 2OTCA 5KTKA 4RV9A 5JISA 1V16A 3UWSA 1C9KA 4H60A 4QC2A 3BICA 2I2FA 4MVXA 1WW3A 1VJCA 5TMEA 1HMPA 1PLLA 5HCUA 1C1YA 3FRHA 2UUOA 2JGNA 3H8WA 4Q18A 4XVQA 1EE2A 3D6FA 4KNWA 4EOGA 3HKBB 1HXHA 1DIRA 3E18A 2JI6A 4M9RA 4EG6A 4JI0B 1L5KA 1T9BA 1OCCE 4CWAA 3IEIA 1XVLA 4AG6A 1KF0A 1OIWA 2ZSAA 2UXCB 3K31A 4EDHA 2YL2A 1S02A 1V1MA 2ZXFA 1W73A 3B1KA 3OE7D 4AUMA 3BT7A 1JDSA 1P33A 5DCWA 4PHHA 2PXCA 4QBTA 4IJ5A 3JCZA 1IWOA 1K8ZB 6NULA 2VDPB 3HZZA 2OA0A 3E37A 4J0UA 1MQ9A 1F38A 4J29A 2PX2A 4PDXA 3QVXA 3FGOA 3E48A 3FTFA 2WVIA 5CUQA 4KV7A 3L06A 1CZLA 5ES3A 4QTTB 1OW3B 1TM7E 4D02A 3B1YA 1Z4OA 4HRAA 4HWGA 2ZJ7A 3THRA 1Y33E 1DTEA 5EOVA 1CLUA 4L74A 1RVDA 2ID7A 1I4OA 2GKGA 1YB5A 1SA4A 4DA7A 5IABA 4RABA 3AJAA 4IV5A 2CXRA 4C4PA 3OUZA 1GHTA 4GOND 1A2OA 2Q99A 2P9PG 2WE7A 5KTMA 2XDQB 2CE7A 1ESCA 2W0MA 1QFZA 4RENA 1EAMA 1V95A 2DFPA 3DPDA 4LG1A 2FH5B 3LW7A 4ZHQB 1BMFA 2R4QA 1NLMA 2ZPUA 1SUCA 4I5IA 5HHTA 1S8OA 2QENA 2HT6A 4UWLA 1YS7A 1U0FA 2OGZA 5HR5A 3P9ZA 5E6SB 3F98A 4HR7A 3F6SA 1PJ8A 4F2PA 4MO2A 1O89A 1ZIDA 3U4QA 4M83A 4WGGA 4B48A 4G1VA 1I0IA 1YVRA 4XCVA 4MPJA 3OM8A 4BMSA 3CJQA 2FPPB 4AN4A 3VSAA 5B30A 3T5VA 3CXUA 2V0NA 2VSXA 3R0XA 4QOGA 2O8FA 1KPSB 1LPSA 5LWHA 3BTOA 1WO8A 4AF7A 4FJZA 3ZDZB 4KLNA 3R24A 1L4YA 3C6ZA 4O2AA 1Y3DE 3SWWA 3VKFA 2XCQA 4RYDA 4FEYA 4WTOA 3PJGA 2I4MA 4EEXA 3RU9A 1ZUD1 1P5HA 3O4RA 4S3MA 2JI7A 4ATZD 2YQ5A 3EIHA 3FAZA 4A7PA 3SKVA 1PW7A 4RORA 1J2TA 2Y4TA 3UYKA 1CCWA 4Z9BA 3UGJA 3E58A 4B76A 2V7WA 3BMOB 2FSSA 3DSUA 1NPTO 4JJ8A 2BEDA 1PNRA 2BLNA 2GW1A 4O2RA 2X3FA 1L7MA 1O95C 1PIWA 1N11A 1PS9A 1XOIA 1NXWA 3DMGA 5DK4A 3DNFA 1MV8A 1NI3A 5EE9A 5FNVB 4IJQA 1NVVR 1RM3A 1OYWA 2HV9A 2IHJA 2XVAA 3LVFO 3NNSA 1PZEA 4PIPA 4M1MA 1ZH0A 4BIMA 1A9RA 3IKLA 3V4VB 5DGCA 4J9UE 4YIKA 3Q5DA 4QQRA 1THTA 1QFMA 4Q69A 3D4IA 1NZFA 2DFKB 5EJ2A 4A63B 2YRWA 2D5CA 1N9KA 1AXGA 1LDMA 2OCLA 2ZIVB 3BFXA 5ITSA 5L8VA 5D1HA 3K4PA 1FQJA 5HA5A 4Q3DA 1YZVA 5CYGA 4NPCA 2QJOA 2I33A 3IR5A 4K9DA 3MCWA 3AL3A 4EKNB 2YWGA 2P35A 3U3RA 3GK3A 4KO8A 1JA1A 4Z4IA 2O8EB 1NMYA 1QFXA 4ZKEA 3NO4A 4M7CA 3NBKA 3RAEC 3ZLJA 5KTSA 4LCTA 3DCIA 4X54A 4Y1GA 5C8YA 8ADHA 2XZTG 1T1IA 1EVJA 3N3AC 4CMIB 2C7QA 1ZMRA 4LMRA 1VG0B 4BKRA 3FYDA 2ISCA 3SZGA 2WJHA 1ATIA 1ACJA 1KDYA 3AR9A 3D5QA 2C4TA 3AILA 4BCDA 3NTVA 1ORWA 1PG0A 3SQNA 4CDMA 1LBEA 5B58C 4ZAFA 3MPUA 4B3CA 2OV8A 2I22A 3D8UA 3ZI4A 2XEVA 3OC6A 3OZSA 2GYYA 2IHUA 5DYTA 3DPYA 3LFHA 3T5GA 3KWMA 3W8NA 3SN6A 2PT7A 2DB3A 4RDIA 4YQFA 5EFZA 1OBOA 2DHQA 3II6X 4N3NA 1R4NA 1RQGA 1OV4A 2POCA 3KBOA 4ZA2A 3CNQS 1XC7A 5EP2A 4MVJH 1ILEA 3TLMA 2I1JA 3S27A 4DCCA 4MLDA 2W6NA 3JY6A 3A6HA 4P3OA 4D9FA 3CVUA 3PX7A 1JT2A 2D7JA 2JFVA 2QSYA 2P6NA 5HJ5A 3KEGA 3N2KA 4EYKA 3P1UA 1V8ZA 1NBHA 5BORA 2P69A 1CQXA 1GRQA 1MHPA 1DPGA 4JJAA 2QLMA 1TUBB 2JZCA 1M54A 3F49S 3Q79A 4ZI7B 2JLUA 2DEUA 4IIHA 2QRMA 5L4LA 4AWBA 5KBYA 4U04A 2QK4A 3HNPA 3OKPA 2G8LA 1BS2A 4HB0A 3I9MA 4N9QA 2NPIA 4OMFG 2PO5A 1CYDA 2EWMA 1F2TB 5EGSA 3EHRA 1EP2B 2Y1CA 5LBUA 1C80A 4PG4A 4RLHA 3TEMA 4QREA 1E2GA 4HDKB 1PV2A 3QVGA 3AUJB 1YRLA 4X92A 3HVJA 1FMFA 4HS2A 3UEOA 4JJGA 3Q41A 3TK1A 4D9NA 1WDYA 5AHRA 3OZXA 2QL9A 3ETLA 2OHGA 2XB6A 2QYSA 2X5XA 2Q5JA 3VVCA 4L8VA 3TDMA 3H99A 2YWXA 1IXKA 4NATA 3BTVA 2HDHA 1PU2A 3WRVA 3WAKA 4HOQA 1FDTA 1EDUA 1VPVA 2YOFA 4K03A 3HJRA 1BX3A 1GN8A 4B47A 1GJRA 5DNYB 4LGVA 2GF0A 4GBJA 1V2GA 3STHA 1W85B 3NHAA 2QSZA 3DONA 4BVGA 1ZLXA 2F0YA 1CHNA 3V8VA 4HK4A 3CRNA 4K9SA 3LVBA 1ZCAA 1RYMA 1W36B 2JIDA 4U8GA 3BIOA 3BD7A 1L1RA 3JAKB 3LGSA 4QBHA 2QIOA 4WDQA 2VJCA 5KOHB 2ZVJA 3W2TA 4F1WA 1Y8ZA 1Y6ZA 4Y30A 1JUDA 3C8UA 5CDHA 4URHA 1FJ2A 1TIKA 5CA0B 1U3WA 3EGOA 2XGGA 2A90A 3OE4A 2HJGA 1URPA 3JTMA 2DFNA 4GKVA 3QE2A 4KHPB 4WAFA 1O5TA 2HYZA 4JV5B 4BU0A 2PZBA 1SOVA 3GVHA 3MYYA 5CD1A 1E18A 3NTUA 4CM4B 3I92A 4M88A 2AWOA 3AHDA 4UCQA 4YHBA 3P2OA 1BYUA 3FLMA 2VRCD 5FPPA 1JXAA 2E0IA 2IYXA 3IHTA 5CJPA 3IVCA 3RVRA 1DC3A 3AG5A 4MGKR 4Q03A 3EASA 2A4MA 4RPJA 1EIZA 3SS8A 1M74A 4UDXX 5HF6A 3MWYW 5CB4B 5JDIC 1VSUA 2R05A 4RQIA 4FONA 1V41E 4PSKA 4DOMA 1TCCA 4DRXA 5ALSA 1E3DA 3K09C 3AZOA 1J25A 3QWWA 5AM4A 1OXUA 1ZDMA 4KEAA 2ERXA 5E75A 1EI9A 4LERA 3PA6A 4N48A 1NNI1 4HWTA 2BGLA 4PV7A 5HOEA 1N2OA 3FHLA 3ON5A 3QMVA 4Q1BA 1VFPA 1CNEA 4PYNA 3L22A 2FK7A 1WXFA 1PI3A 4ZCTA 4P86A 4B45A 3EQ8A 2QY6A 4J7UA 2AFVA 1ZK2A 4IJ6A 1RXYA 1QP0A 2HNKA 3R3VA 1XPUA 1QXSA 1C81A 4JGGA 5BVGA 3GCXA 1RP7A 4IRUA 1P5RA 2YJ3A 1F9EA 5EY5B 4ZXPA 4OQMA 3Q8WA 3WGUA 2FCAA 3REGA 4OIFA 1MVNA 5JARA 3U5ZB 4BC0A 5KBAA 2JRLA 2Q49A 2CXXA 1NATA 4L8FA 3BB4A 4I9EA 4ZVSA 4UBLA 2Q5HA 3NFRA 2FSUA 2V4LA 1QYRA 3N3BC 1SVWA 3RB8A 1JYSA 4QYIA 3RBZA 5GZ1A 2HDWA 3SHQA 3LCCA 1JE0A 5IKEA 3HDGA 5JRJA 1JLMA 2FZGA 4P34A 3KALA 2A78A 1LNSA 3UMVA 5T3UA 2PRJA 1CF4A 2B9VA 4WNGA 1Q22A 1TZ2A 1AOXA 5LKAA 3G0BA 5B7QA 5DTEA 8ABPA 4RK0A 3FTNA 1WCIB 4BMOB 4OO3A 1KVQA 2BKAA 3BJEA 2XLCA 4PBSA 3D6MA 4DPRA 3IRVA 3O4HA 2WKPA 1A88A 3TNFA 4DK5A 3T7SA 3MINA 5MHTA 2FJBB 2MSWA 1T9KA 2C98A 3ML9A 2EQBA 2BFEA 1RKBA 2PZJA 3RFUA 1PAUA 2QE6A 3PQDA 3NAGA 3AVPA 4LF6B 4B32A 1G8HA 3K0FB 5DM1A 5HKKA 5BSRA 1PSWA 5HRCA 3SBDA 1WBJB 3U9WA 2R6AA 2Y3IA 4JT2A 3D64A 2R65A 1KXZA 3ZHCA 4UU0A 4A6PA 4OLBA 3V31A 4C6HA 1YJ8A 1DCTA 3VDNB 1VMEA 3UENA 2F9FA 1UAYA 2Q9AA 4IY1A 1QVAA 4D42A 5JTUA 2K4NA 2XENA 4BJ1A 4RK4A 5HQ3B 3HN6A 1P0IA 2ZISA 2WOOA 2BH9A 2X5TA 4Q7MB 2OO7A 3C6XA 5A7HA 1MX6A 1O6BA 4B7CA 4FLHA 2QLTA 4O2LA 4HNTA 3H2HA 1I24A 4UI9K 1OYYA 4A8HA 3OURA 1SCIA 1IK4A 3VHRA 2QBYB 3IQEA 3QOWA 4RHFA 2HK9A 3NKLA 2NO0A 3CRRA 4Q4AA 2PM7A 1OXMA 3VU0A 3F6BX 2B82A 5CMLA 5LUBA 3C3CA 1USWA 1Y1KE 4WESB 4WLOA 2R5FA 3BZBA 4R2HA 4I9GA 1KORA 1PQYA 3O4VA 4NENA 5AI4A 1YS1X 3KYCA 1RYFA 2FUKA 4IXWA 4G65A 4WBNB 3ORHA 5CH3A 1JHOA 4Z8XA 1VC2A 2B4YA 3CKYA 4QO7A 1BJRE 2FSPA 1GL6A 4MYRA 1E1MA 4PN3A 2QZ4A 4GYOA 4GL4A 1WAO1 2RARA 2O2HA 3V1YA 4DABA 4LTNA 4AMGA 3MN1A 4I1UA 1XAIA 3E2MA 2LR0A 4ER5A 2O9JA 1XGKA 3MGKA 1MT3A 2NZXA 2YJNA 5CYPA 4JHJA 2O1XA 2O8DA 3X3HA 2PQ6A 5IK2D 4AVXA 1XYYA 2B21A 1XPOA 4ZDIA 3EPHA 2D7DA 3EJNA 2XE4A 4CIWA 2IV3A 3CHRA 3IP1A 4NJMA 5AJTA 1ZP6A 2YZMA 3DDCA 1KRXA 5F73A 2W2KA 4JSRA 4EI2A 1WB4A 4TOIA 1VDZA 2UYQA 2WJWA 4HUQB 2QM8A 3H2KA 1O94A 3WGMA 2YXPX 4J9VA 2VJKA 4KITB 3U61B 1PLKA 3IPAA 3QWBA 1KOJA 3K9WA 4A16A 1O77A 1Z4JA 5TJ9A 4FGSA 3NHFA 4PCUA 5J4YA 4KR9A 3D2LA 4KAJA 2C0CA 3ENEA 1E96A 1I33A 1IHUA 5BSHA 4I4TA 1WG8A 1Q91A 3T5DA 1RVV1 2P2CA 4HAIA 3W5DA 1VL0A 4L08A 3OO0A 5EIBE 4NNJA 5AICA 2AWNA 3QJZA 1C8VB 1CDZA 2X7JA 3KZXA 3DE4X 3N2NA 3EXG1 1PV1A 3UUFA 1WXIA 2ZIZA 2IX3A 4R9UC 1GPWB 3KWJA 2ET6A 1Q0LA 2EBWA 3PQ8A 3P0JA 3OMWA 4JUIA 4IDNA 3I1YA 1G55A 2DAPA 1LS6A 3D3KA 3ZTTA 3PXXA 2JJ1D 1GZ7A 4E88A 3PXGA 5LOVA 5HS6A 5EMHA 5D3QA 2X42A 1UR5A 4DMKA 1WKVA 3V5NA 4R8KA 3W5VA 1MO2A 4F71A 1B8VA 4KRGA 1YCDA 1J9ZA 4OQZA 2C2YA 3EZYA 1LPBB 1TO1E 3SM9A 1IN8A 4G9EA 1X1CA 3ZIDA 5KTPA 1AKVA 3W8DA 3PS9A 3EXEA 1KDRA 3B3AA 4XGQA 3AGQA 4C7XA 3R3ZA 1FXWF 2E3JA 3CQCB 4TV9F 5IAEA 2Y4NA 3T95A 4F4IA 3D4LA 6REQB 5AVUA 4M89A 4M1QA 1AGPA 5AVTA 2ZIFA 3IAHA 2O3TA 4UU7A 4U7HA 1PDVA 3FZNA 3TG5A 5C32A 5FQOA 1E69A 3SR0A 3DBIA 2FG7C 2PGLA 2FQQA 5GOTA 3OPVA 1WULS 4XXHA 1NC3A 4NYJQ 5C2JB 3WYAA 4CKWA 4CE6A 2JIPA 1DAHA 4X1KB 3W2EA 2QRQA 4R81A 4U2FA 2B1RA 4TKZA 2ZSJA 3E15A 3DP7A 3NBNB 1JV2B 3EPPA 3BL5A 3V4SA 4OVVA 1WLSA 1GL9B 1NR7A 2AFIA 2VL7A 2J9FA 2G5GX 3ELYA 1GQRA 2JEKA 4WCFB 4UASA 1YK0A 3OQOA 1DKQA 4UW9A 4O25A 5E0KB 1YZNA 4PRLA 4OJKA 3CX7A 4R3NA 5DNEA 2QUZA 3PNPA 2YFKA 1YS9A 2MR5A 4HOSA 4X6YA 2Q29A 2O54A 5MDHA 1QFSA 5JJTA 3REQA 3H9GA 4QAQA 2PO7A 3JUEA 1YL6A 1M3SA 1TJYA 2Q5OA 3DEFA 4LN1A 1KEEB 4KVZA 4M4SA 1GG2A 2NX2A 4Q3LA 1KQ3A 4Q1CA 1EFLA 5BT8A 4ARAA 2YZ2A 4LJYA 2XY4A 2GBPA 4U2KA 1H93A 1N2ZA 2H5IA 2XBLA 2WVHA 4OK3A 4LUNU 2RFAA 1YZLA 1QOPB 3IRUA 3GFFA 3BZUA 1DJMA 1LJ8A 1DVRA 4ZMSA 3AUYA 1SOWA 2DLDA 3CZMA 3KZNA 3P2KA 1AZSC 3I64A 3PS6A 4LYYA 1VJ0A 1ZSYA 3MV3B 1E9VA 2VDOB 4RA9A 1HYQA 1J5PA 5CW1A 2ZUBA 2CXUA 1WA5A 1LK0A 4LPKA 3C3BA 4HLEA 2VWGA 3ZGZA 2QRKA 3TQCA 5FWXB 1S9DA 4C3UA 4TS3A 3C15C 1PZMA 3RSEG 4U9HS 1C14A 1SIUA 4TQ9A 1YB1A 4IQGA 5FFFA 2AA3A 1W93A 4ITVA 3HVEB 3HLKA 2QM7A 4F92B 3EHMA 1TRKA 3CK8A 3D7RA 3HPQA 1Z0DA 3E9RA 2RH4A 3Q8XB 2VHUA 1DRKA 3PEWA 3OM0A 3GRYA 3KS2A 1V55E 1T3LA 4XPIA 2X6HA 5T8KA 4ZHQF 1A5AB 4RKYA 1NKVA 1E6WA 4I2WA 5JEDA 1FTWA 3RTAA 5BQ5A 1ZM7A 1E6CA 5JNRA 1H2UA 1U2SA 4FE7A 4MWOA 4TSRA 3X1XA 2FRDC 2FOIA 4HAYA 4KFSA 1MC5A 4J0GA 1FP7A 5A06A 4U7FA 1Z75A 2UZ1B 4BRWA 2ZSFA 5D1NA 3LF1A 3ONFA 1II9A 4BUCA 2C0PA 3RDPA 2WNHA 2WB2A 5KWIA 3H9QA 3LQKA 3FTYA 2F3QA 3CUYA 5T3RA 1B1AA 4MWBA 2OWEA 3ZE7A 4JI1B 5IULC 1XDUA 3KYBA 2AFRA 4XUDA 4UOZA 4OKIA 1G0OA 1JEJA 3LUPA 3LDUA 1TI7A 4PLHA 2XCLA 3RSZA 3E27A 4MHTA 1DJLA 3FGZA 3NTXA 1UBEA 2GPYA 3GRZA 2FEZA 1FSFA 5IN4A 3BXOA 1YYHA 4IDCA 1T35A 3EIOA 2VBCA 1W2GA 3GLIA 4JT4A 4U7EB 5TQ2B 1NTRA 4BYGA 2QXYA 4ZOEA 1NBMD 1PT6A 3JYNA 1NN5A 4KJXA 4PZLA 5K3AA 2ZS7A 1ZK1A 2B9EA 1LD3A 4NOJA 1NQUA 1YNOA 5AK5A 5ALNA 1Y3FE 3HJAA 4BMDA 2J41A 4X85A 1W0JD 4C7KA 2FV8A 3AETA 2ACWA 4MDEA 4PLPA 1G21E 4J3FA 2Q4EA 1D6SA 3QARA 2J8ZA 5FNVF 3TRFA 1ZONA 5TQ0A 1T0IA 3CRQA 1LVGA 4JS0A 3TG2A 1UEJA 1EDBA 3IQXA 1I4LD 2DH6A 4OGFA 1E7YA 1FY2A 3L8CA 4DR2B 1L7QA 5TB5A 3HI6A 2NZJA 3FWZA 4AWAA 3MLBA 3LKBA 2QC9A 3P0IA 2FMTA 2IFTA 1UP6A 3UJ7A 3OU2A 3IHKA 3FEYA 2EQAA 3MUFA 4CV0A 2ETCA 3H1GA 1GZUA 4UUPA 1RU3A 1O94C 4IF4A 1D1QA 5F7OA 1I1HA 2NUPA 2DPLA 5CCXA 4JC8A 4BMZA 4G85A 2Y1XA 2P9IG 4FT4A 1E1QA 2ZRFA 3ASYA 5GADl 1EWTA 4UMFA 4C0MA 1SNYA 1UFKA 4AJIA 4M53A 5MN6A 2ZU6A 3RV4A 4ER3A 3HXTA 1E79D 3UWOA 1NOIA 4KDCA 4L51A 5JEEA 1FSSA 3CNNA 4P6VF 2GLXA 4CCSA 2WXHA 2W2NA 3MD9A 2VNKA 10MHA 2YHIB 2WWIA 2ATEA 4AICA 3DBRB 3WBKA 1PX2A 3UI2A 5AUOB 3AFGA 1U0BB 4AJ4A 5ICCA 2Y0BA 4P36A 4L9PA 1VPTA 1G9SA 2WSBA 2Y1EA 2P58C 1SULA 4OJMX 2EHDA 3Q9UA 3JD2A 4D3ZA 1E60A 2REQB 3U4HA 3GNTA 1AUPA 1RKQA 4CQMB 2SCUB 2NVBA 4JHLA 3HFRA 1VJRA 5EQJB 4DY6A 4YNDA 4U96D 2R79A 2IVZA 1F8FA 3AUAA 1L5FA 4JVOA 5ILOA 2PL1A 3FMPB 2OEPA 4XLLA 3L49A 5A6SB 3LQQA 4CM1A 4D80A 3HY6A 1MC8A 1UC8A 4MV1A 2WTUA 4EF4A 1P60A 3VAYA 3VC1A 4GTSA 3OQVA 4MGZR 1NN1A 2XT6A 4WY5A 2C2GA 4A2WA 1ZVJA 2DGDA 1RHRA 1YV9A 5I9NA 3F4BA 5ALQA 1KZ7B 2Y1WA 5AOXA 4Y7DA 3Q9SA 4CHTA 1XCMA 3MAAC 4EG1A 3TCKA 3GJYA 4Z2YA 1RQRA 3E9MA 2NIPA 3NIWA 2HU7A 3CX4A 4R6WA 4HQRA 5JROA 4ESHA 4ZI7F 5A7FA 3N2IA 4YDHB 5ALEA 4RKEA 4NBWA 1QPGA 2ZSBA 4O5AA 1DO2A 2GJ8A 3SLGA 3A36A 1JF8A 1DUVG 4LBZA 1PJAA 4I8DA 1TZBA 3MOSA 4MUXA 5FOXA 1E8OB 2Z57A 3LX8A 3HXQA 1SCKA 4Q6WA 3FBTA 3F6PA 2BBTA 4AO8A 4NYMR 1NFQA 1YQQA 3KLMX 2WYIA 1D03A 5HKAA 3GJ7A 4LUCA 3LQ1A 5ENTD 3RUEA 4IO0A 1Q1GA 1MCZA 3OBIA 4EL5A 4UHBA 1IAQA 3ITEA 2ZDGA 3DE7X 4POOA 2FP4A 3HXFA 1Z63A 5EIBC 2GN0A 1CY6A 2DBZA 3AIOA 3FKQA 2E7ZA 4A1GA 3L7NA 1X38A 1ST3A 4NECA 5E7IA 4HSGA 4DA6A 1WU8A 2PRSA 3IGFA 2O50A 2X1VA 4J76A 3NTQA 2AEFA 1THZA 1WPGA 3P9QA 3BRQA 4BYMA 2MSEB 1EFHA 4TS1A 2JIBA 4NFYA 3KUUA 3HCRA 3TNDA 3JYOA 2EFDB 2I6QA 1CEEA 1NI1A 1HDZA 3CHPA 2BSAA 5CXSA 2YCBA 4I4CA 1F2UB 5J5CA 4PYIA 2C4VA 1KO5A 1SIBE 1E6EA 3R20A 4GC5A 2AOXA 5EIFA 1P4GA 3DZDA 4RGVA 2FULA 1DT3A 3WDMA 5CVUA 4YRSA 3DMTA 1CUSA 2IP4A 4MDFA 1N33B 4HDSA 1IY1A 3IA2A 3WI7A 4A1OA 3GEGA 1HLDA 1JDZA 4JL8A 5B1DA 1O1RA 1WJGA 5ICSA 4A1FA 4C0SA 2Q6TA 1JQJC 4ETIA 5E7JA 4G67A 2WJJA 4YPVA 1G9XA 1YI0A 3OT5A 2B4KA 3VM6A 4UBJA 1O9HA 2VYVA 3SQWA 4LXHA 3PTLA 2VHVA 2Z09A 5CB4F 2A5FA 3VHQA 4LC0A 2ZKLA 1BKSB 1H9BA 3EGEA 1ACMA 4WNDA 2OAQ1 1XCPA 1DDGA 1JWFA 4OSOA 4G8DA 3AWDA 1UKVY 1SKYE 4L6AA 1GUFA 3L93A 3AB8A 4WJKB 2H4FA 1M1NA 1NUQA 2BTOA 1GKIA 1VE5A 4F3CA 1WY6A 1TM4E 2CNOA 4J8SA 3RFVA 3EOZA 5TVGA 4FYVA 4MRNA 2VTVA 3RJTA 3PNOA 3AG6A 1RWMA 4LFCB 3QENA 1G8GA 3DZGA 3ZDAA 4E5VA 4I6EA 4Y2YA 5BQ3A 4P5PA 4AKTA 4LZOA 3NBMA 4B83A 4EKGA 4EUHA 3L8DA 2PNFA 1LB1B 1YVDA 4WXPA 1GA6A 1OT5A 3AINA 4KG7A 1B89A 2IOFK 1CJMA 1NSYA 1QOZA 5J2UA 4H4CA 5DGHA 4ANVA 2CNDA 2QL7A 4GI7A 1K63A 1D4AA 5HIJA 2IGTA 1J24A 4YUAA 1Q0TA 2DYRE 2CSUA 3FTQA 1KBZA 5FI0B 4IH9A 2OILA 4GRIA 4F0JA 1GZSA 2A0FA 3RROA 4QLOA 4OP2A 2HLHA 3WXMA 2DUJA 5TRTA 3NHZA 2ZSUA 4Y2HA 4JKIA 1A1VA 3MFYA 3USES 1XN1A 2FW9A 1HK7A 1PGNA 3QVOA 4MP3A 3N8IA 2NP7A 5DSXA 3T34A 1HPLA 1ORDA 4HZIA 2EBHX 2J0UB 5DGTA 4RMGA 1F4PA 4D8UA 5EGNA 5BYJA 1D07A 4N5CA 2FF4A 1VHQA 2H4ZA 2PH1A 1KQFA 3HJFA 1C9DB 1DEXA 1QDLB 3DWFA 1SPXA 1B16A 2V5QC 5CX4A 3VSDA 1PBTA 5SYNA 4CT4A 3X2SA 2HWKA 3LO5A 3JQ8A 1TRHA 1BXRB 3ILSA 3QC1A 4F86A 2DUMA 4Y2SA 4Y8VA 2OZPA 3UT7A 2JDIA 3ZEIA 1Z0JA 5C1IA 1VCNA 3W5UA 4L2IB 1OLSA 2RG8A 4B79A 4MX8A 2QN3A 1JBKA 2NXWA 5JCXA 1ZCZA 2PU7A 3ED1A 2WTAA 3A04A 2Q46A 4YP9A 1Z8FA 1FXSA 3ESLA 5JD5A 1T2EA 1COWD 1I1QB 1NBIA 5JNLA 3WGZA 3I6QA 3KPUA 5IYZA 4RTKA 3OUTA 1HEIA 2HV8A 3I1IA 4EPYA 2GNAA 4XVRA 1PG2A 2DT8A 3IUEA 2P8JA 4Z2AA 5HCNA 3T7JA 1P8JA 2UYYA 3LY7A 5C4IA 4Z9AA 1AGRA 2B1QA 1VKOA 2Y6VA 1A4IA 4WBNF 1YXMA 2JAUA 3HLTA 4Q9KA 3UW1A 4XARA 3PUYA 4FR5A 2VPQA 3RG2A 1LQ2A 4WN3A 2O5EA 4RZHA 4IXTA 2XBMA 3PDIB 3E3MA 5ENNA 2W4IA 3WNDA 1MX3A 4HMPA 1NJ1A 9LDBA 4O4IB 5CBPB 4UMDA 4YIHA 4K6GA 1Z39A 4PCLA 1X81A 3TPCA 3K9QO 1U02A 1IWPB 2O7SA 3NW9A 3RRNA 5ALJA 3L8EA 3VYTB 1SCJA 3GNSA 3QSYA 5EA2A 3V7NA 1CVLA 4AIIA 1MFPA 5C53B 1IXRC 1E7RA 2PD3A 4MCJA 4JLNA 3EZ9A 3IJ5A 4PCAA 4UHCA 3GWGA 1QRDA 3N70A 5BNFA 3ILXA 4TRQA 5A0TA 2J59A 5C7YA 4GTOA 3V1UA 1KYZA 3BE5A 4K9RA 5FTLA 3LLMA 2G7ZA 5K51A 4LJKA 3UA4A 2V7XA 3I05A 1FU7A 4V24A 5LQNA 1R27A 2WEKA 4OXIA 3W2GA 3DTVA 3ES9A 1R1DA 1QHEA 1T2DA 2X6TA 5P21A 4DLKA 4TMVA 2K4MA 4MUKA 1TL7C 4ENTA 5DHSA 1QO9A 2FHPA 3H5TA 2VN8A 5SV2A 3EGWA 1ESMA 1P72A 1B2RA 1DJNA 3BQ9A 4CCYB 1RXUA 3PDNA 4EHFA 3DDOA 3OQIB 4EDFA 3SVLA 3EFBA 2DPHA 4GM0A 4F53A 1QQ5A 4HGRA 2VSXE 2OGTA 3W2FA 2A5JA 4Y98A 2QYJA 4FFPA 5KDDA 3O2QB 1SQ6A 2VJMB 1JIJA 2LIVA 1OZ0A 1N0WA 2KW5A 4GNRA 1KS9A 4F5YA 1Z8HA 2GCIA 2HU8A 4QULA 2FZ5A 5CFRA 3TM5A 4W6QA 1G8YA 3CLUC 4OP3A 2QM0A 3RS7A 1AD2A 1UPTA 2Y2UA 4J16C 1WB6A 1N7IA 1H2YA 2ORVA 4EJFA 4NXNB 1QMPA 2B6NA 1XTVA 3IBSA 4PS8A 3K8YA 4TWJA 4EP1A 2FLWA 1GAWA 3USZA 4JVSB 4OVKA 1Z2CA 3OIVA 2D5LA 4E6EA 2FWNA 1P1RA 3BXFA 3GZ2A 1Q19A 5I7VA 5I9LA 3FAKA 4KW7A 4LJ4A 1DFGA 3KB2A 3HZRA 1GZ3A 2CFUA 3RS2A 2F3TA 3DO8A 3F0TA 3PC8C 1TKRA 2FR1A 3F1LA 2QMEA 3KSUA 2B37A 3M2TA 4ZCIA 1X19A 2AFHA 2OQRA 2CMGA 1C7QA 4FDVA 2F6RA 4JX8A 2CEAA 1OVGA 3ONWA 4ERXA 2Z98A 3P0RA 4DN6A 4Q7LA 4GLOA 4Z68A 4CCAA 3MWEA 2YQ8A 4FFDA 1BI7B 2C0MA 3WHKA 2JGDB 3WGJA 2FWBA 1LBIA 3TOSA 3MMZA 4GHWA 3HKDB 2ZM5A 4DUGA 1A4UA 4MI1A 4NFLA 4PZCA 5EHZA 4KWEA 1VJ5A 4PLWA 3C3QA 2HBZA 5KSYA 1BIFA 4P81A 5FWDA 1JZTA 1XCLA 4TLCA 1WUJS 4EQFA 1M1XB 3EZ2A 3SJAA 3V8MA 4ALJA 1LGYA 4AN1A 2ESRA 3MHTA 1EKXA 4JPSA 3CK7A 2QAGB 3G2HA 5B58T 1T2UA 3FCYA 1Y98A 3T3OA 2J1LA 5AJUA 5IBCA 4E12A 5IZ4A 5B3KA 1M2OA 1HE2A 4K8OA 3B9BA 1L4BA 2GZ1A 1M2FA 5TGDA 2C7OA 3HXDA 5K0GA 1U7XA 2I2WA 5FP0A 1KP2A 5G2OA 3I6MA 3PGMA 2IIVA 4L9SA 1NVVQ 4W7IA 2D2VA 3LUBA 5FEUA 4ZVNA 4RCZA 1N6NA 5T6MA 3U4CA 2CYAA 4DCNA 3RADC 3ESXA 3ME5A 3O2NA 5DBEX 2FW7A 2WTNA 2ZJZA 5CCMA 1LLDA 4ZOQI 1QCDA 4TTRA 1F6BA 1IXZA 1NRXA 3A1CA 2B69A 4URWR 4P93A 1BCRB 4PWYA 3OZEA 3VA7A 4D97A 1KEPA 3K1JA 4ZQGA 1UMBB 1EVYA 4JBGA 2VXOA 2FKNA 2AMYA 1ZGHA 1M5TA 1A7KA 3WLFA 1OGJA 1FFHA 4RTMA 4BEBA 2DHEA 3DSSA 4WADA 1MVOA 1L4GA 1HO8A 3L4KA 4PR3A 4XW2A 3SQMA 3G2PA 1C8LA 1CUCA 3FWYA 3WL6A 1NI4B 1C7ZA 1IRXA 4IKOA 3UMJA 4KXMA 4CLDA 4D0NA 4QXPA 2ZJ2A 1NY5A 2VWHA 5JV5A 3WZ2A 5H70A 2LUHA 1TLLA 4OI0A 3FTSA 4CU5A 4EABA 3O4ZA 1O97D 3O03A 2PS1A 1I2CA 5J40A 1KXJA 3PX2A 1CERA 3AFMA 4KN6A 3X1KA 1VRWA 5DGDA 1OLUB 3CLHA 5CT6A 3VTKA 3LHDA 3M6AA 4XB2A 2WJPA 4LQDA 1KJ8A 4NBRA 5BMVA 1BE8A 1OFVA 2YTZA 4J6IA 4OFZA 5DM70 3EE6A 3R9IA 1KFCB 2DHCA 3JQAB 4DLOA 2CE2X 3KVNA 4YV0A 1USIA 4PLCA 5HZGA 3E3OA 4Q7QA 3NOOA 3LVQE 4ZEWA 1JHZA 3H87A 1Z74A 4D56A 1XWFA 3NYQA 3CUVA 3MT9A 2VP2A 1RAGA 4XLTA 4GT1A 2X8WA 1AUQA 1FUYB 2V65A 4OHPA 2DZNA 1JLLA 1HTWA 4BVFA 2JCSA 5FX2A 5K8CA 2YHEA 3WP1B 3GPLA 2IXBA 2INGX 2X22A 3NT4A 2FPXA 5BW6B 1D4FA 3H9UA 3OCUA 1TD1A 1NW5A 3NETA 3HKEB 3TTSA 1UOHA 5CVTA 4M9SA 4KAXA 3EDCA 3NPMA 3O94A 2P2GA 3TQRA 4Q6BA 1EBFA 1V5FA 3RU7A 1BDIA 3RAGA 3RYHB 1SQFA 1FYEA 3GPCA 5A4AA 1XZJA 1UOPA 1JAYA 3K6SB 3TGWA 3OCVA 3TXMA 1FK8A 3FH5A 2CXSA 1JE1A 4F2WA 3W1WA 4G81A 3CQ9A 2BKEA 3QSGA 3FGNA 4S0ZA 2GF9A 2RGGA 2A7XA 5E95A 1KR5A 4D3DA 1ZXBA 1EK5A 2PUDA 3N2ZB 3H11A 4KIGA 1AUVA 2PLAA 1CR2A 4IDQA 4DRXE 4X1IB 4F9EA 5KTYA 2LXNA 3B7PA 1XTQA 1GSOA 2AEJA 4QXRA 1QIFA 3GNLA 4BAZA 4Z8YA 1IN7A 4FJ2A 2GPBA 5G4KA 3GUUA 5KNDA 1I2AA 3OPYI 4R7LA 3D59A 3I2FA 1IJBA 4BFXA 3TBKA 4LGCA 3MLAA 4DLNA 4YCJA 3BMNA 1JLHA 4GTTA 2C4HA 1NIJA 4A0RA 4CN8A 1V7ZA 1U11A 4B4OA 1ZOPA 3BAFA 3NOXA 2GRUA 3IALA 5ALXA 1DWOA 4P83A 4PZZA 1OLOA 3CVXA 5B53A 2Q28A 4E5NA 4KPYA 1DZ3A 5EHIA 3SSOA 3D8NA 2RAFA 4L23A 4CTNA 2CJWB 3FMVA 1C0IA 3P7MA 1P3Y1 2V3CC 1N6KA 4RGYA 1S01A 2PMFA 3UT0A 1FDIA 4KWIA 5CXXA 1IONA 5DBGA 4QTYA 4CHGA 5KNBD 2GXSA 4G0VA 3NHJA 5JADA 2E4WA 3E4CA 3OQ6A 3QVMA 2IP1A 1H8ED 2QXTA 1AKYA 4R98A 3W1EA 1HTBA 4O1PA 4Z9XA 6Q21A 1EVLA 1UOQA 1WZUA 1RFLA 4O2BA 1XNHA 1QLHA 1XDWA 2BR5A 3GGCA 5BN1A 1ZI8A 5FWYA 4G5OA 3T5MA 3I04M 3DBHA 1S6YA 3GEIA 2GK6A 2XD9A 5FQNA 1T0BA 3H2BA 3FPFA 3CCCA 3GRUA 3L77A 3OXFA 3T3HA 5KJCA 4DSZA 4P4NA 3J7TA 2Q5EA 3KZVA 1RZRD 4YV2A 4MWZA 3N0WA 1P9LA 4FW9A 4B71A 1TD9A 4UUNA 4M8NE 2ODWA 2ZE7A 3DXMG 5L3SA 3GJXC 5JQGB 1RW4A 2MT9A 2GHTA 3RUPA 2ZR0A 2Y8EA 3O48A 3GJ0A 2BFFA 1OC4A 1RLMA 3R74A 1N36B 1KZ4A 2XHEA 2P9ZA 1OHHD 1TQ2A 1BDHA 2PUFA 4DA0A 3H8JA 3A9CA 2PANA 3SEQA 3QY9A 2BGIA 4BNHA 4MW4A 3GOQA 3NORA 5T4BA 4L5JA 1JKMA 3HRIA 1HWYA 4GM1A 4HH1A 4LJ7A 3HXMA 3UJBA 2XECA 2VTBA 1G63A 5CK4A 3B53X 1R66A 3HDTA 1LSJA 2CLSA 2C5GA 2IELA 2C5HA 1PZXA 5EMLA 2IPOA 1JYEA 5L3VA 3R3JA 3B3JA 1L5ZA 5DYWA 2HCRA 1XTKA 2DRIA 1COZA 1KI2A 3Q11A 4DV3B 1JDBB 3PNVA 4PC3A 3AHGA 1Q0UA 1GSHA 2LAHA 4QELA 3L0ZA 3HC7A 9GPBA 1YB6A 3O7MA 1VGQA 3TW0A 5BMOA 4KO1S 3THYA 3L1VA 1CIJA 2YC4C 3V46A 2HJRA 3EHDA 1UDCA 2BFDB 4ZAWA 3CA8A 1D2GA 3WP0A 1JHQA 4PANA 4B2PA 1WZEA 4ZVUA 4R8SA 2HGZA 4EZBA 4BMPB 3FUWA 2NZVG 2NMVA 4KC0A 3EU9A 2EKLA 1US8A 5AJWA 1ECGA 5KSOA 1KQGA 4EW3A 1RQLA 3OESA 5CBOA 3PX3A 2C2MA 3L02A 2C0QA 4G0NA 3TWRA 4KT6B 1JDUA 4BNFA 3LPDA 1IXSB 4UMVA 2V7QD 2G36A 3CF6R 4BDSA 1KO8A 3IODA 3M81A 3HACA 3EVBA 2VJNA 1AKRA 1T2NA 3S1AA 5EZ5A 4X24A 2HF9A 2Q5FA 2X1LA 3JPYA 1ZEJA 4TXPA 1T8RA 4ENPA 4D10C 4B35A 3HVHA 1IMJA 4DWWA 3QWAA 3BGSA 3PRZA 1KAGA 2OVFA 1E1YA 3A0RB 4YUZA 2PLWA 4OGKA 1JJBA 3HKCA 3QVWA 4X0EA 1DXOA 1HE5A 1IHGA 5I7UA 1KQPA 4WEOA 1TAHA 3R5SA 3KX2A 3CMMA 3K6JA 4H31A 4JJFA 4OP1A 1Y81A 3ZG6A 2NAPA 1TA0A 3Q6IA 1SC3A 3PG5A 3PVZA 3KFLA 1OU4A 4G2VA 4GTPA 2Z8YA 3VJMA 1UQTA 2BKGA 4MS3A 1A96A 4OMCA 5GZ6A 5MFZA 1U0RA 3E81A 1QH9A 1SXGA 4QYXA 3DA8A 1B0ZA 3R0ZA 4ND6A 4OFXA 1W96A 3K9HA 2XNCA 3JVIA 1KP3A 2R1TA 3F8TA 2IJGX 2Q2VA 3GLGB 5ANLA 2JG3A 2H31A 3RU3A 4JEIA 4M1KA 3FFTA 2NT4A 3H7AA 2WFMA 3DGEC 1L1FA 2GCOB 4D57A 1QC5B 1VECA 1Z35A 2PUAA 3GZNA 4EJMA 1VBNA 3FCOA 1PS0A 4MTLA 3ROXA 1PQPA 3HSYA 5KU7A 1T29A 4BFUA 3EXG2 1E5DA 1KMHA 1UBTS 2WXLA 5AIBA 5A4KA 1RI1A 3QH4A 5A9SB 4XQGA 1EAYA 1J42A 3SP1A 4D98A 4LTDA 4BMYA 4JQOA 4CT0A 3QEBZ 3PFKA 1QR2A 4CEHA 4KQHA 2FJEB 2QY9A 4UZEA 1UKEA 3CX3A 3NRCA 4WH0A 2NZWA 2NN3C 3EVZA 4U8VD 4F45A 3P97A 4EI7A 6LDHA 2H2FA 1ZSVA 4C01A 5JYBA 4JJIA 2I6HA 4W5JA 4O4LA 4EQ6B 1T0HB 1XVVA 1MNAA 2QN8A 4CNQA 4HEJA 4KYIB 4PAWA 2WR8A 2QSJA 5CGZA 2P6RA 4IZOA 4ARCA 4L0CA 1RCFA 2VUHB 2OHIA 4TSFD 2JKZA 2O6LA 3N53A 4GKJB 2OQIA 1QQAA 1Z4LA 2CCGA 3H1FA 4YO8A 1BVUA 2R8YA 3AY7A 4GA2A 4JL0A 2G0TA 3C7KA 2AFIE 3HJUA 3JQQA 3I9NA 3JQFA 3L7JA 4KVAA 3G2TA 1XAJA 1NUSA 1DAFA 2XWJI 3NI2A 3CKCA 3VR0A 4D5EA 3ZX4A 2EJVA 5DP2A 3BG0B 1XA4A 2IYZA 4HTFB 2PR7A 2FQ1A 1LD7A 4BMCA 3NDRA 3RYCA 3QJGA 2CXPA 3S8EA 2XF8A 2PWAA 4MW7A 3ZD8A 1V5EA 3TG4A 1FNBA 5DTRA 2WTBA 1AKQA 2XJ4A 5M72A 1I2DA 2JCXA 4EYGA 3BXPA 1E8DA 1HT2E 4CIYA 2OESA 4LY3A 1S2DA 2H4WA 2FRVA 2CBZA 4AZWA 3RUCA 2CUNA 3ESCA 4EYSA 3TGPA 4A6XA 3L6OO 3PDWA 4K1LA 1JS1X 3U7FB 2HQOA 4KBFA 1OX6A 3ABSB 3R3HA 3AR2A 1WHSA 3PP8A 4G4JA 2CFOA 1XLUA 4N0DA 5E6UA 3ILYA 4FSXA 3DNMA 3DYVA 4OHXA 5LC1A 2M6SA 3OZGA 2DF8A 9ABPA 3DLHA 4PSDA 4C4SA 2RKBA 2ZTHA 1OUMA 1Y5RA 4O4IF 3OE1A 1RABA 1Y80A 2GEDA 2X40A 3DVLA 2XEHA 3AV0B 1TVKB 4DW8A 1VMIA 1CRPA 3DEAA 3E9ZA 1XNQB 3DYIA 1EZZA 3NVMB 4TMWA 5JHBA 2QT0A 2PHZA 2C5AA 2IO3C 1M1UA 2DQKA 2WY2D 1O1SA 2WIKA 4DTCA 2F1RA 4EPTA 1G20B 1HDRA 2EJTA 1G7RA 2EQXA 2VT3A 2PXHA 4II2A 3AVWA 4MYUA 5AJVB 4G97A 1V5IA 2G09A 3CNBA 4L8WB 3L7BA 3E03A 3I30X 3CPEA 3A6LA 4FFMA 3W9GA 4YJ3B 1FMLA 3QNUA 4YJDA 4R1PA 2XTMA 2Q5QA 3EUVA 1KI7A 1XDGA 2WTMA 5D00A 4MLZA 1CR6A 4B3GA 2QSUA 2DWPA 2JNWA 4DWVA 5IMBA 1TT5A 1JFLA 3KSDO 1K6XA 4LF9B 2F4NA 3AQ4A 4NU6A 4EHMA 5I45A 4EJSA 3HRAA 2IZZA 1K7FB 2C82A 3T0FA 4MV4A 2J9RA 2CHUA 1PK9A 4O6VA 5JT1A 3UY4A 3AF1A 2HNBA 4YMLA 3BWYA 4F9GA 3ZLTA 4EGFA 3QKWA 3JQDA 4ZZ2A 5C1OA 5B3LA 3DB2A 4YB8A 3M4JA 5CDYA 3AUTA 1SH7A 2R00A 4YWHA 1X70A 4BKQA 2ZRBA 4F1SA 4QX6A 1ODIA 1KE2A 1SHZA 1QO0A 3T7KA 3EJWA 1F60A 2NU7B 3Q4GA 2Q3LA 2C20A 2YMPA 1JPNA 2LVBA 5IVHA 3ZHUA 1YO6A 3S2ZA 4AMZA 3WDKA 3UO8B 5LYJB 3GLIE 5LYYA 3ROQA 1AXEA 5D66A 4FXOA 5KTRA 3HFJA 1QE0A 1DQPA 821PA 3L82A 2II6A 3FUKA 4G4GA 2BEWA 3C48A 4YAIA 1RBYA 4Z1OA 1X2BA 3EIUA 4GBMA 4J4TA 3WWDA 1QWOA 4ZT4A 4JUBA 5ENVA 1NAIA 1RSZA 2CF6A 4NH4A 4N41A 4FFVA 3I5YA 1YE5A 5AI8A 2X8JA 4N5LA 3DS8A 3V7UA 2DFVA 4GPTA 1DINA 3MCAA 1HV8A 2R17C 5A2GA 5JA4D 3EEYA 4EHLA 2G08A 2L6BA 2B7CA 3ULQA 2BGRA 1ECCA 4ACAA 1E2LA 5EXDA 5J08A 4O59O 1DS6A 4BVHA 2C8JA 1NVTA 1BFUA 4GKBA 3OZFA 3EPKA 4PBRA 2UZ4A 4MS1A 3DOJA 2C5SA 4HDAA 1NT2A 2ZROA 2WPDD 2JLSA 5WRFA 4BETA 3KG2A 3CYFA 1H2FA 1SCAA 4GZ3A 5K8LA 3Q15A 1H4QA 4HNAD 1P2DA 2AOVA 4LZJA 1T36B 5C8DA 4B8YA 4BMXA 3EAQA 4Q94A 3HN2A 3SYKA 5FV7A 2H06A 2J5XA 4ARVA 4BV8A 4AJHA 2BI8A 7MDHA 1NL3A 3GFTA 2LXMA 4L7QA 2H0RA 1HURA 1PJ3A 4I1IA 1N9AA 1LXCA 2AHRA 3IAEA 1WCYA 2QMOA 2R0QC 2X19A 1YRAA 4UXIA 3CR3A 3HYLA 4HCJA 1U8EA 2HA6A 1EA5A 4MTCA 2W6JA 2CHGA 3KV3O 1BZYA 5K3OA 3VV3A 3JQCA 3C1AA 3ZIAA 4WFJA 2AVNA 4Q12A 1Q7CA 2BGGA 3H2ZA 1LDNA 4P58A 4EB6A 4HSEA 4XX0A 2AMVA 5JFOA 3LT1A 2I7TA 3IDAA 4AFNA 2DPGA 1IBLB 4MV3A 3RSFA 1W5FA 5HM8A 4MRAA 1MAHA 1ZNXA 5LQCA 3OZDA 3EH2A 2IS2A 2CF5A 4FHJA 3IV9A 1P5ZB 2VEDA 1E63A 4XEHA 4UYKB 1R0CA 3VBCA 2I6FA 1YBVA 5MN5A 2ZIUB 2BGWA 5A2QA 2P9SG 2GN6A 4MWDA 3GGGA 5FLYA 1GU7A 3IUPA 3ZE8A 4BU1A 3CK9A 3STYA 1QYDA 5EG5A 2XB9A 4ESOA 4PLTA 3LD9A 3KSBC 1PK7A 2CLFB 1U0OC 2N0SA 1X3SA 3ZGXA 2EJUA 2FN7A 4DRYA 3H4MA 3FWKA 1U7PA 1J49A 1L3IA 2ZI9A 4NDAA 3R7FA 3NKFA 1Z7YA 2XVZA 4JY7A 3RGGA 4FDAA 2J3EA 2IPMA 4QGBA 1QNLA 5LWQA 3TJMA 3LT0A 4IM7A 5FUXA 4C1NA 5HWSA 1WZCA 5CXQA 4H7YA 3QX7A 3F6CA 3A4VA 4OQ4A 4FOLA 5G05C 5IVIA 4D45A 1EA7A 3DBLA 4ARZB 4B17A 1I7DA 1H42A 3ZKAA 5KNGA 3BH7A 3PEVA 3HU5A 5EPOA 4O08A 1MHTA 2C31A 3A70A 3S2SA 1C4XA 5DGXA 4BNXA 3WWPA 3C5WP 5YASA 1PZGA 1J2UA 4HNGA 3BHMA 1TPZA 5G2NA 2ZB8A 2ODNA 3RYFB 1NG1A 4OA8A 3JQPA 2O7NA 3L5KA 2JIRA 1SURA 2OCKA 2WUVA 3HXPA 3AL2A 3AKDA 1ECFA 5JSYA 1VSBA 3G59A 4KPUA 4UTXA 3TZEA 3BSWA 5FZQA 3DUFA 3D3WA 2QVXX 1DEHA 3D0KA 5AI5A 3AVQA 4FLEA 3VYWA 2P2DA 3A4TA 3D2CA 1DUSA 4NK5A 4DJEC 4NYMQ 2ZPAA 4QDJA 2AH5A 2C96A 1QTNA 3Q73A 2R6GA 1L7NA 3RIBA 3DM9B 3UJ6A 1K6MA 1IJKA 2FPLA 3GG9A 4OATA 1MAAA 1FYFA 2H1SA 1RI3A 1Z9BA 1U5CA 1Z6QA 4BO6A 3D3MA 3D5TA 2SICE 3PDUA 4N39A 3WG7E 1JQDA 2A0XA 3QIAA 3LUKA 1IIBA 2R5WA 1HOXA 5ANRB 4GMGA 3EB9A 3B70A 1IZ8A 5FF9A 3GUZA 1Q95A 2XVXA 3GCDA 1XZFA 2ILTA 2FE1A 3SC6A 3IULA 4ACBA 4IFTA 1W36D 3QEOA 3ZY5A 3R77A 4ZALA 4NMLA 5JQWA 1ORTA 3HJGA 1BXKA 4UVEA 3QPBA 3F3YA 3PGXA 4QRHA 3ZWPA 4RZUA 3B1XA 1W5EA 2CHEA 5HTOA 3L6BA 1X1AA 4QEKA 3F9IA 3ENQA 4ZO7A 4FHGA 5A02A 2PL9A 2P68A 3BYZA 3S44A 3GW4A 3Q5GA 3D5EA 3NEPX