4N39A

Crystal structure of human o-glcnac transferase bound to a peptide from hcf-1 pro-repeat 2 (11-26)
Total Genus 283
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
283
sequence length
716
structure length
697
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HCF-1 is cleaved in the active site of O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/substrate
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 283
structure length 697
sequence length 716
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n39A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n39A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4n39A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4n39A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n39A03
4LEUA 5TVGA 3T7DA 4X7RA 3MRTA 3T3EA 4RELA 4N2SA 3TOVA 3ZGQA 3CEJA 5CCMA 1L5QA 1NOIA 1XV5A 1A8IA 3S7FA 3WXXA 5LCWC 2SKEA 2BGUA 3RSZA 3RO3A 5G04C 1L6IA 2C2LA 3Q49B 4I9CA 3RO2A 1PYGA 5DBKA 3RJVA 3CUVA 4Z5XA 3T3IA 3MTAA 4PQGA 5FZQA 2QNBA 2YHCA 5JJTA 1KT0A 2AVPA 5D01A 4BFCA 4BQFA 3UUXA 1FA9A 3TG4A 1UQUA 1XL1A 3CUUA 3S29A 3KS2A 4GCOA 2QFCA 4APOA 2KCKA 4YI3A 2GPBA 3ESKA 3G2HA 1KLXA 4BTAA 4BQIA 1XC7A 4M60A 1P2DA 3MBOA 1Z6QA 3G2IA 1ABBA 3O3CA 2ACWA 4EL5A 1NOJA 2XCBA 4M7PA 3SF4A 3E3OA 2GW1A 2GEKA 3BD7A 1FC0A 2ASVA 7GPBA 3CK8A 4KQMA 2X0FA 3NPAA 3Q3IA 2FFRA 1W3BA 1GGNA 3U3WA 1PSWA 3L7BA 5TMEA 4U0SA 2NC9A 4F97A 3BCRA 1P2GA 4YVQC 2YJNA 3OKCA 3OTIA 4CTMA 3S27A 2HYZA 5ARFA 3LKUA 1B89A 3MSCA 2PRIA 2IV3A 2BUGA 4YNDA 5G05C 2PQ6A 2QLLA 1Y6GA 2C0LA 3AS5A 3BEEA 3MS4A 4I2ZA 4GYOA 3BDAA 1KTIA 1EXVA 5DU2A 2Q7FA 5D0QD 1C50A 3IAAA 2KC7A 3LY8A 2VSYA 2KS6A 5GPBA 3D0RA 4AMBA 1GPBA 2VSNA 4MHOA 1ELWA 2R4TA 2QRPA 3MT9A 4MI3A 4WADA 4CGVA 3EBPA 1GZ5A 1V4VA 1C8KA 3DZCA 3PDNA 4RIGA 1NZNA 4RIIA 4RENA 4EL0A 1JIXA 5D00A 2F9FA 5FZSA 1VGVA 2DBAA 2FI7A 1WV1A 4N3CA 1P5QA 4NC9A 9GPBA 1NA3A 3CKCA 4U0UA 4I2WA 4WACA 3CEHA 4F3VA 4I9EA 4X6LA 3E3LA 2VQ2A 4BT9A 1FU8A 3ZCVA 2HR2A 3ZPJA 2IW1A 4G1TA 1C8LA 3C4QA 5IKOA 4J8EA 2SKCA 1SXQA 4W6QA 1NVKA 5JTUA 2VYIA 5D0OD 3QWVA 2C9ZA 1ELRA 3PE4A 4XI0A 3S7DA 1Z6PA 1Y6FA 3VUFA 3LPZA 2PQRA 4L22A 4CGWA 4CTOA 2ATIA 4WNEA 4GA2A 3GUHA 5JTTA 3EDTB 2R4UA 3Q3HA 2FBNA 2H1FA 3C4VA 3DDWA 5DXFA 3NCHA 3VTXA 3CVPA 4IN3B 3OXLA 3BEOA 4UI9K 1PC2A 3CVNA 5G05J 4EKYA 1NLMA 3E3NA 2QRMA 5TMBA 1P4JA 2PYDA 1RRVA 4Y6CA 1QZ2A 3HBNA 2WQHA 2ECPA 5ENZA 1AHPA 2QN8A 1ZU2A 2PYIA 4UI9J 3JYSA 3TGOA 1WW3A 3RHZA 3O48A 3CV0A 2MHKA 1A17A 1XNFA 3GZ1A 5A7DB 1FU7A 4AY6A 3ASHA 3KD7A 2JLBA 4WUYA 4HWGA 1ZBPA 2GJ4A 3MT7A 4O6FA 2WTXA 2F3QA 3WADA 3SZ7A 1XKXA 3AMVA 4UI9C 4NESA 4X7PA 1PNVA 3GW4A 4N39A 3H4IA 1FTYA 1Y8ZA 1FTWA 2KATA 1HXIA 3HYMB 1EM6A 2BISA 3GZ2A 3QOUA 3MRVA 3D0QA 5KJNA 1L7XA 4HLNA 3Q3EA 5BNWA 3QHPA 3RU0A 3UYKA 2AZDA 3CV3A 5LCWJ 2LSVA 2P6PA 3Q15A 2VCEA 2QRGA 3MA5A 2F3PA 2QN7A 4JA7A 2IV7A 1L5RA 5LQDA 4GZ3A 4GPKA 3UYLA 2GEJA 4N2QA 3L79A 2FF4A 3CKBA 3TSAA 3T3HA 4AIFA 1XOIA 3CK9A 3L7AA 2GPAA 1NA0A 2VGXB 1XL0A 4X7MA 2XGOA 3MTBA 6GPBA 3BCSA 1OUVA 4JL0A 2Y4TA 3MV2B 2X6QA 4NEQA 1SXPA 5JJ6A 4J8DA 2Y4UA 5KJMA 1FU4A 3MEKA 4YI5A 1WAO1 2FF5A 3RSCA 4J8FA 2UY1A 4JHRA 1F0KA 4H7XA 4WHMA 2AMVA 2G9UA 2F3SA 3C48A 3T5TA 3S7BA 3VTYA 3BD8A 3G2KA 1UZUA 3GPBA 1TJCA 2OOEA 5JJ7A 1P29A 3OTGA 4RBNA 4M83A 3RT1A 1Y8MA 2R68A 3ZCQA 4GPBA 3NF1A 4U04A 3NAZA 1Z8DA 5IKPA 4BT8A 2UWJG 5I45A 2WPVA 3FP3A 5G04J 2R5SA 3L01A 2F3UA 4F96A 5FJYA 3LY9A 2IYFA 1JEJA 3FWVA 5A6CA 2OFFA 4XIFA 3TAXA 1LWNA 2AW3A 4GA1A 4GZ5A 5BT1A 5AYWD 4J0UA 1P4GA 4ME2A 3G2JA 3T3GA 1JIVA 1LWOA 2IEGA 4CDRA 4EQFA 1NOKA 2C1ZA 1IYGA 3ZFWA 3Q4AB 4AY5A 2JJMA 3H4TA 4LEIA 5DLDA 4AN4A 2C1XA 3QKYA 1YA6A 3AS4A 2LSUA 3TG5A 3CEMA 2PRJA 1IXYA 3Q5MA 2IUYA 3MS2A 4B94A 1GPAA 2XGSA 4XI9A 1RZUA 2KCVA 2X0EA 3ZN3A 2XA9A 4WNDA 4G23A 3OKAA 4G26A 5DIZA 4AMGA 3FFLA 1BX3A 4RIFA 1C3JA 2PZIA 5EX3A 3G2NA 3E4BA 3QWPA 2QN1A 2KCLA 3NB0A 4GYWA 1NZFA 1WUYA 2ACVA 4FKZA 2BGTA 4BQEA 3CEQA 2UY1B 3OXFA 4RIEA 4G2VA 2XCCA 5EKQD 4UQXA 3NP9A 4HOTA 2QN2A 3QKWA 4GZ6A 5TMDA 2XPIA 4HOQA 1HH8A 3RKVA 1KT1A 4RG9A 3S7JA 3ZHEB 1GPYA 2QN3A 3ZCPA 1P4HA 3ZCSA 2ONDA 3HBMA 3RIBA 1M5RA 2YQ8A 2GPNA 8GPBA 2HY7A 1WM5A 3EBOA 1FCHA 3MQFA 1L5WA 3L7DA 3ZCUA 4HOSA 3ASDA 2X6RA 4LDPA 1E4OA 5BW8C 2VGXA 5CHEE 1WV0A 3BD6A 1P2BA 3U4TA 5FT9A 5C1DA 3URZA 3OXGA 1YA0A 2GT1A 4NQ0A 3LYAA 4H7YA 4N3AA 3ZHEA 3K9IA 2R66A 3CUWA 4AM9A 3OY2A 4KQ1A 1QM5A 2XCIA 3LY7A 3ZCRA 2C4MA 3OTHA 4RG6A 3AS8A 2FETA 2QN9A 5KJKA 3IA7A 2G9VA 2GM9A 2VCHA 5ARGA 2HO1A 3CX4A 4GA0A 4BWRA 2VG8A 1PN3A 2FO7A 3HBJA 4WNGA 3LCAA 4Y6WA 3IEGA 1IHGA 4KYOB 2AV6A 2SKDA 4N9WA 2QLMA 1K08A 4EJ2A 3SYRA 5FZRA 1AXRA 2G9RA 2LNIA 1JG6A 4KQ2A 5FTPA 4UQYA 3ZCTA 1E1YA 4G24A 4N5CA 4HORA 3R9AB 4MI6A 1QQEA 3BCUA 2QRHA 3T3DA 1FS4A 3ULQA 4I1AA 2P58C 2H1HA 2R60A 3CUTA 3VDNB 2XMPA 3ASFA 4GCNA 4MI9A 1JG7A 3GYZA 3SYMA 4CTNA 3OKPA 3L7CA 4JA9A 3ASGA 4REMA 3Q47B 3KAEA 3QWWA 3QDNA 3DDSA 3WAGA 4G2TA 2QZSA 2BFWA 1GG8A 4HOUA 1QKJA 4WNFA 3VDMA 2PQNA 2PL2A 4KBQA 4U07A 3D1JA 4W9RA 4ABNA 2IEIA 3MS7A 3MT8A 4MICA 1E96B 5M72A 3COPA 1HLFA 3NC4A 2QRQA 5CCLA 3OT5A 2IF4A 3S2UA 2C0MA 4QLBA 1HZ4A 4MRAA 4F9FA 4GYYA 5KJLA 3S28A 3MV3B 3MRXA 3MTDA 2X0DA 1K06A 2O6LA 2I6HA 2G9QA 5EX0A 2E2EA 3N71A 2IFUA 3MKRA 3NP7A 3WC4A 2XEVA 2FEZA 2XA2A 3UQ3A 4A1SA 1L5VA 2QLNA 3OY7A 2VGYA 3PE3A 1JIUA 1NZDA 4EKEA 3HBFA 1F6DA 1L5SA 4U0ZA 1O6CA 1J39A 4G25A 4KXKB 1Z62A 3DD1A 3S0JA 3FROA 4YUAA 1WUTA 1IIRA 1WW2A 2V5FA 3CVQA 1YGPA 5HI7A 3G2LA 2J9QA 2XCUA 4YVOA 4FZRA 3CK7A 1GFZA 1B4DA 5HQ8A 1UQTA 4BTBA 2XGMA 2XA1A 2IYAA 2L6JA 5HXAA 1RZVA 3UPVA 2Q6VA 3CVLA 3VUEA 4I17A 4MHSA 4UQZA 4RIHA 3CUYA 4N3BA 2ZB2A 1H5UA 1FTQA 2JZCA 4NRHB
chains in the Genus database with same CATH superfamily
1T8TA 3JUIA 1DDOA 1MHQA 1M0TA 1QRAA 4G1MB 4YDYA 3V3LA 3GRYA 1Z3IX 3PD0A 4MQ6A 2PJDA 4D8UA 1SA4A 1ZRHA 3K9NA 1YB6A 4B2IA 1A8IA 2H9IA 4YJ3F 4AKXB 3F9RA 3OHSX 1MIOA 2WJ4A 1CG6A 3GGOA 3QVXA 1CUAA 4L75A 3QYFA 3WMRA 4ILHB 3D9MA 4HQDA 1QFMA 2YFYA 1QZ3A 3F5FA 3IBGA 3MC1A 4JOCA 3RJVA 3GLHB 3PNBA 4GVXA 4A03A 3WZLA 3HHMA 1YL7A 1N5OX 2G07A 3W04A 3WWOA 4C4YA 5KWJA 2AT1A 5CIQA 4YRCA 3N28A 2BFOA 4I08A 1B1CA 1T2FA 2AQHA 2WM2A 3HACA 2IHVA 1CNEA 3U4IA 4V0NA 3UUXA 4YJKA 5DGXA 3FX2A 4QFMA 3E4DA 3SMQA 4CMIB 3EDQA 3TG4A 3TAHA 1AUXA 4BEVA 1R66A 1WPGA 3AEKA 3WYDA 4GRIA 4KN5A 5G3ZA 1JS1X 3W4JA 5LIRA 3PVLA 2WYVA 1FYVA 3CT4A 2O3JA 3DLAA 5KU7A 1OYOA 1DAOA 1UF9A 2I2CA 1G7RA 1YCSB 2AR9A 4NV1A 4BBPA 5L51A 3WGOA 2EW8A 1CF2O 2A88A 2MHCA 4LWOA 1FUKA 2CNWD 4EITA 4AUNA 5HJ7A 3K0SA 3P26A 4CKBB 1YVUA 3LDGA 3NM5A 2J08A 1U94A 4UUAA 4W99A 4JB2A 4FK8A 1KGSA 4YA6A 4EL5A 3GDGA 3ZNOA 3RIMA 5K7SA 4PGFA 4M7PA 2XE7A 4G0YA 4JUBA 2PO5A 2VJ8A 2XMRA 2UZ4A 7GPBA 3I2JA 4RQUA 2PMBA 5A3SA 2PX5A 2X3YA 2AHRA 3KQLA 1R27A 3Q5EA 1B26A 1SXJC 2C8JA 5A4AA 3PEUA 4KO8A 2ZBQA 3AVOA 4GBED 5AHKA 3PQ5A 1BA2A 3TLJA 5FTLA 4HEQA 4R84A 2R7LA 3EJWA 4LFCB 1M8GA 2WXIA 4LYHA 1ZMXA 1P74A 3UK0A 4C3VA 5K20A 2YXDA 3IQXA 1KEEA 5BWCA 3L1IA 2AS0A 4CTMA 1E98A 3V4RA 2GFQA 3E37A 4L4YA 4U7DA 2OXFA 1ULTA 4EFNA 1DC5A 2CSXA 1Q0HA 2EJUA 4NBVA 2H7VA 2D74A 2FTKE 1KTIA 3UXHA 1D8DA 2Q7FA 5DU2A 2X5XA 1NM5C 3EF1A 1KOFA 2PNJA 3G23A 4B32A 1EFUA 2VK2A 3K9BA 4GTSA 1OZGA 1ZVVA 3GHHA 2WFZA 4S1NA 5A5FA 3OJOA 2WJHA 1UG3A 1X39A 2ODQA 4BQRA 4DMHA 2JABA 4LCTA 4KWTA 3T54A 2WMNB 3R5KA 3OI7A 4LRUA 3GA5A 3W5IA 4C4PA 4TRQA 3IDQA 2F8MA 3V2IA 1PZXA 4Q9HA 1ZQ1A 2IELA 3PDNA 1N94A 4OREX 4QYIA 4RY2A 3EFOB 4D4KA 2WD7A 2W2XA 3TH5A 3OTNA 1FUUA 2CYCA 3M9WA 3NDRA 3P9YA 4CEJB 5FPQA 2GBFA 5B6PA 4MQEB 4PG7A 2GNAA 1C1DB 1JG2A 1SG0A 1E7YA 2HXYA 3LUHA 3K31A 3F6EX 1DS6A 3DEFA 3VZBA 1Y3FE 1WV1A 4B0PA 1LZKA 3RYCB 1XTKA 4TS3A 1MZVA 2O0MA 1BE6A 2XNKA 2EP8A 2Z2ZA 1HQCA 2O2JA 3A6GA 2VQ2A 4HMQA 2SNIE 4P86A 3RH0A 3ZGVA 4KITB 3GT3A 1VHQA 1YDGA 4XM1A 1Z0ZA 3INRA 3K1ZA 2WMNA 2C4HA 3TR5A 3D8RA 1TC2A 1JHPA 3GBSA 4YCAA 4QJBA 3F0TA 1Z07A 2IW1A 4MKHA 3D9IA 1Y8QB 3CEPB 5H3HA 3G2WA 2DETA 5AVRA 2PANA 3F6YA 4WZZA 2PUGA 4YT5A 4S24A 1SXQA 4RLYA 2D62A 1YE8A 1P61B 2GPJA 2YV5A 3HA7A 5E38A 5J2TA 3KEZA 3ZHZA 2WSLA 3NW9A 3L9XA 2OFXA 4NZZA 4PO8A 1ELRA 3MMNA 2B6CA 4Q4AB 1KZ4A 4Z86A 5ALJA 4B4DA 4CV1A 2PV7A 3BYZA 2PQRA 3ONWA 2VYQA 4IJKA 5ITZF 4BZXA 2IHZA 5AVKA 1I7LA 1N92A 4G9EA 2FEAA 1Z82A 3EJ6A 1Q1QA 4FHEA 4CU5A 3MGAA 3BMNA 3L6BA 1T2AA 5DXFA 4JSYA 1U6JA 4AMVA 3NCHA 4NX2A 1JFFA 1X4RA 2GZDA 3CVPA 4REOA 1ZB1A 3OXLA 3HZZA 2Z5GA 4XKBA 4Z6KA 4HTAA 1BIFA 3C3QA 5FNZA 5BOVA 3T9FA 4FFRA 3QARA 2FCRA 2P1RA 3C8UA 2Q5HA 3O82A 3BIXA 2PM8A 3KZCA 4JGBA 5K0NA 2OHJA 3OCJA 3ZDFA 4BB9A 5JQWA 2BP7A 3PKIA 4ZZ3A 1QKIA 4FUTA 3H0CA 4RVSA 6NULA 1IY8A 2FX3A 3FU0A 1PT6A 1QRDA 2VP3A 1NXQA 3O74A 3RT9A 3SEAA 3VMFA 3EDYA 2HMSA 4UMEA 2R8XA 5AW1A 1GYQA 1NJ5A 2XUOA 3FA2A 4LOIA 4TLLB 4KBYA 5KWVA 4FR0A 4UHCA 2RGUA 1JSCA 2JKVA 2W0MA 4U0KA 4XQGA 4JNCA 5ENQD 4YXFA 1GTSA 3QEMB 4LXGA 1NI1A 3QTLA 1GVNB 5EKSA 4HWGA 5HK9A 1YAHA 4UFPA 4K5BA 1YB4A 1I4EB 3G5MA 1ORIA 2XNHA 2GKGA 3ABSB 3HCWA 4I14A 4Q4LA 4ZCSA 1H3EA 5LMCA 4MS6A 2R8BA 2XQVA 3I34X 3KJEA 4NXNB 4ZVQA 1IWBB 5EZYA 4KAXA 1JDVA 1L7NA 1TK2A 3PC3A 4MWCA 1Z0DA 3FAKA 4GG1A 4Q1VA 1EQUA 1P2SA 4RAQA 5FR2A 3W5HA 3ZW9A 4TYQA 5KDLA 2P2LA 4TXJA 1S5PA 3DZHA 2XNCA 4RKRA 4F06A 1OLUA 1Z2EA 2HU8A 1NN0A 2P62A 3PYXA 4Q9AA 5AUQA 3H65A 4FGKA 4HLNA 3DOFA 2P68A 4XKCA 3AI2A 1JX6A 1MTOA 3E1GA 3IXQA 4G1FA 4PZ0A 5FL3A 3ZY4A 1SUPA 5H3CA 1L1QA 4FYKA 5BPFA 2CXUA 1HNWB 1GLGA 5I4IA 4J7UA 1S89A 5CCDA 3WRYA 4ZT5A 2VHXA 3DHYA 1NT4A 2A57A 3U9WA 2ZSUA 4FYJA 1K68A 5FP0A 3V1LA 1YZ3A 2J3KA 2NLOA 4BNDB 1J2TA 4JT2A 1D2GA 3RI3A 2E5WA 3Q7AA 3FHJA 3MT0A 4WBNB 2QRZA 4MWDA 1C81A 5LFAA 3CKBA 3FY4A 4OUDA 1BFKA 2CLKB 3EGIA 1QANA 1JDBB 4S1TA 2Z2KA 3NTOA 4QDKA 4BNNA 3A32A 1F2VA 1N8SA 3LX5A 1LPOA 4H27A 4UZFA 1TFUA 1VL8A 2CUNA 2HJSA 2QXYA 1RAIA 1EQAA 3O1LA 1KJJA 4RJ2A 4DQVA 4CKEA 2OK8A 1T3SA 1A96A 2CDCA 3QLUA 4C9BA 2C7BA 4QJ5A 2O0HA 5G41A 3X2SA 2JAWA 4Z7NB 3U61B 1ZRSA 1TE2A 2O57A 3H5IA 2VZ9A 3PVZA 4Q3EA 1OW3B 1ZXXA 2AOUA 2YQ4A 3GFBA 3L6RA 3SJCA 3WGIA 4MB6A 1TZJA 3IP5A 3THOA 1WVGA 4ETNA 4NCAA 3R2JA 1DO8A 5DYTA 1USUA 3WLTA 1XCPA 4P7KA 3RASA 4IRUA 2CDBA 3C48A 2V8SE 2FWNA 2X1MA 2HF2A 3GDHA 4X84A 3AM1A 4ER7A 3BJMA 1WZIA 1DBWA 3RT1A 3BH7A 4HNSA 3FH7A 1G6KA 2L42A 2PLFA 1DUSA 3HR4A 2DZNA 1QTNA 4AOFA 3F1LA 3OIGA 4WEOA 1WCXA 2JFNA 3NIDB 4XGIA 2N1MA 3C0KA 2W11A 4ISBA 4RVNA 2NUTA 2XE6A 1MB0A 4MRSA 4Q12A 4QQNA 4ZTZB 2GQ0A 2XOEA 3A25A 4OSEA 5T4BA 5J4LA 3FBTA 2AOVA 3WLSA 4NOJA 2PMCA 2DAPA 1RWQA 4ZOBA 3DE0X 3GMDA 1N6IA 3KJFA 5KNBD 2FWJA 2M1ZA 4BAUA 2WVAA 3WSTA 3HS3A 4DW8A 3DHEA 2G71A 1HMPA 1RRMA 1QIGA 2FW0A 5LUAA 3OZUA 4H35A 3T3GA 4MV8A 3AEQB 4BVGA 5A0VA 1CYEA 4QRIA 1KVQA 4FXOA 3TINA 4DMGA 4YRAA 5JRDS 4HADA 1ADGA 3L17A 3NTXA 2JJMA 4RY0A 2XBMA 1BQ3A 4TWRA 1M8KA 5L3QA 1SUAA 2P35A 1DRVA 1GQQA 3M5PA 4ZZ1A 2DQ4A 2DKOA 3BKWA 3NLLA 1K5HA 1RTKA 4ZCLA 4ALMA 1UINA 2HWUA 3Q73A 5KTMA 1TEXA 2ZIFA 3QFSA 3RRZA 1O4VA 3Q5MA 1TD9A 2A67A 1CZUA 2FV8A 2GPWA 2VHTA 3FCUB 1I36A 3LJNA 4MA5A 4N1AA 1H05A 1PFQA 1W2WB 2Q7XA 1GPAA 4D97A 3M1AA 1Z33A 3ML1A 3FUDA 4Y2JA 5BR1A 2V5UA 2ZWMA 4LZLA 5GGYA 2AC4A 2ZU6B 3ZWKA 3RS5A 4G26A 1QYCA 2QP3A 5A6SB 4I1OA 3D81A 2H8KA 1HS6A 3IIIA 4RIFA 5I7AA 4FIDA 1HYEA 2XEEA 1IDN1 2I2FA 2GCIA 4U0JA 1CY6A 3G2NA 2M32A 4TV8A 3QVLA 2HSGA 4WIAA 2B6NA 1X5BA 3B12A 3KDSE 1ECGA 2VYCA 1USKA 4H15A 4BATA 2Q3MA 2IIVA 4QFVA 2BGTA 3BGVA 5AR1A 3N8GA 3UF0A 1QO7A 2FX5A 3DC7A 1E7SA 1MQAA 1NE7A 3FPFA 4BUJA 1V43A 3C3BA 4Z2YA 1D7AA 1UWVA 1D04A 1VYTA 3MJHA 3TLAA 2YHSA 1WXEA 5LUBA 2LAHA 1C7FA 1ZIYA 2EINE 3TNDA 2OZPA 4LNUB 4HOQA 2Z30A 2FZGA 3KB1A 1I1QB 3AP1A 3M1LA 3E84A 4J9VA 4ZGBA 3HXBA 4YN3A 1XRRA 1TQ4A 3JVEA 4WFJA 4WNYA 3OE7D 3Q11A 2VT3A 1IQUA 4MOWA 4D5GA 2CFIA 2GF2A 4IXTA 5BV1A 4KWIA 1EBBA 1K8RA 2DRIA 2CXHA 4LDPA 4LCJA 2C4WA 5LOVF 2EX1A 1A4XA 4C20A 3A1VA 4Q37A 3EG5A 1G5RA 1VG0B 1P0CA 1C3XA 5C1DA 2DWUA 1JDNA 2NZXA 5L4NA 4IP0A 3ITDA 5AOCA 4FJ1A 2IC5A 2VHEA 3D5QA 3DVAB 3H75A 2FPLA 4QBHA 4YP1A 2H2WA 4UTRA 2E89A 2ID4A 4TXQA 2IZ0A 2JDID 3AHEA 4RG6A 2W2KA 3M6VA 4FGLA 3OCYA 4RVGA 2UUOA 2WDZA 4AUMA 2W0SA 2IOQA 1R6AA 2ZYUX 5DN9A 2MIIA 3UK2A 1PNRA 1DHTA 5LP6C 4QWMA 1LY1A 1U2DA 4PFJA 3M4ZA 1FX0B 1N2CE 2M6RA 4A9AA 1FFXA 2DMRA 3REGA 3P9SA 1UR5A 2I8CA 2BJWA 1P5ZB 5J4VA 5JAIA 5DX0A 4RFSA 4X44A 2I65A 4YRSA 1VCIA 1SC4A 1NPDA 1I2CA 3HB5X 1S2DA 3KZVA 2ORIA 3OZVA 3PS9A 4BFVA 4V0RA 5AHWA 4F04A 2EX0A 2LKCA 2YXEA 4J1TC 4H7KA 4HORA 5A4FS 4B85A 3IUNA 1LBIA 5ENTD 2AMLA 3SZ3A 4K03A 2VP0A 3RYHB 1FS4A 4X3OA 3JQ9C 3WP1B 3SHTA 5AI8A 4TZ0A 4FIZA 4RQIA 1I0LA 2FQWA 2JG3A 5SY6A 3LBIA 3MWGA 1GPLA 4IVNA 4KE9A 3W77A 7REQA 2JLUA 5ULLA 4E5UA 2XWJI 1XCBA 1RBMA 3IAEA 4DDUA 1KKLA 1BWSA 4HCJA 1DEKA 1XAGA 1ZLXA 3KOOA 1W85B 4Z8YA 3WYAA 4EYEA 4B93B 3BRQA 4B44A 2XTJA 4ZDJA 4PGAA 3BGDA 4KPUB 4TWBA 3ZHSA 5LU8A 1UBGA 4MEJA 3UJHA 3R7SA 1NP6A 3SIXA 6PFKA 3OPVA 4HSEA 5ANRB 5C8YB 3QVWA 4FHKA 4N18A 2CJYA 2WYIA 4E32A 4HGRA 2KM1A 4O25A 8MHTA 2FSFA 8LDHA 4W5TA 1U04A 4L7TA 2DFVA 3LPDA 4I8DA 4NE2A 4O0MA 4YQYA 1R74A 4ZO7A 4YDSA 3JZIA 3GP8A 3NC4A 4RZ3A 3U62A 5HF6A 2YWGA 4AJEA 1CERA 3T5AA 1MC4A 4KPUA 5BSMA 1P9WA 3Q75A 4G5HA 3S28A 2V7PA 3SZMA 1TZKA 4MI1A 4UDXX 3JCKC 2AOXA 3FMVA 3BN3A 5AM5A 4ZDWA 3RRJA 4L23A 2F2TA 5EXDA 4AL4A 3DBRA 1KXZA 1P7WA 1YS4A 2G9QA 1N4SA 3FIJA 3QVJA 9LDBA 2CDNA 1V71A 3N71A 2PS0A 1DV2A 2YKGA 4YMWA 3TMKA 1I4WA 1ZIDA 3HYLA 3ZJUA 5IJ9A 2Y71A 3TCNA 1OJ7A 4IIJA 4YONB 4MYRA 4B80A 2BV3A 3VHXB 2HN9A 1AE1A 3H5OA 4KE6A 3H5VA 4N40A 3ZY6A 1YBVA 3JZDA 2ZTUA 1F3LA 2W22A 3DHWC 2HOQA 3HBFA 4GP6A 4AZSA 3PI7A 4P3YA 1QIJA 1TNDA 2GN6A 4AG5A 5JC1A 3ZWDA 4FB5A 3HN2A 4LBYA 2XKBA 4R40A 3UV7A 1QH9A 1J8YF 2C9OA 1EX6A 4FDLA 8ADHA 5AVSA 4MUXA 3S5UA 3DSSA 1GKKA 2OHHA 4TWJA 4JJZA 5EJMA 5HI7A 1JYFA 1U3CA 1ZMTA 1NMXA 1VJCA 2XCUA 1L7BA 3K2QA 4OM7A 5EJ4A 3GBVA 2X8LA 4HNRA 1RQ7A 3Q9LA 5EUMA 2AKEA 2I3ZA 3DWEX 3GJ0A 1SUCA 4D9NA 1DAKA 4CIVA 5JFTA 3LSYA 4LHXA 3SJBA 3WS7A 5C5EA 3KKNA 1J56A 2CHWA 4O29A 5HRYA 1C41A 1XMSA 3M4XA 3UUWA 4BEBA 4F86A 1KJYA 1V96A 3UM0A 1OAKA 3IAUA 3BL5A 1N2XA 1NTRA 3RAUA 1JTEA 1SCIA 4KZKA 3WGTA 4DEYA 4GE3A 1SFRA 3ZNGA 2A4KA 1XQ9A 4KW7A 4BGUA 4ZMBA 1S6YA 2XDWA 2LCIA 3SQNA 1BHQ1 4FLFA 3F9CA 3C72A 4RZUA 3TOVA 3CRW1 3ULKA 1NOIA 4EPVA 4YBRA 4NSNA 3WXXA 2Z5VA 2OCAA 1DX6A 4I9FA 3CVWA 1E20A 2WHXA 3O7MA 4C30A 2I55A 3VSDA 3WYNA 1FUIA 5IU6A 1VP3A 3OIVA 4ZXFA 2EZUA 3Q49B 1OIWA 2CHFA 3TL3A 4EPZA 2WKRA 5IDQA 3C6KA 3T4UA 2V98A 1CIPA 4M86A 3H7AA 2R65A 3AM5A 3QXGA 1ZJ6A 4ES6A 4ALKA 4UBOA 5T3YA 1US8A 3UOWA 3PNTB 1J0AA 1M6VB 2FEPA 3GJQA 4NG5A 1F5SA 1RMTA 2XF2A 2W6JA 4RGBA 3FR7A 4X8MA 1M3SA 1U5CA 2O20A 5DNCA 1AXGA 1NN1A 1Q44A 2QQEA 2RGCA 2WJ3A 3ESYA 4LF4B 1XTJA 2P6NA 3N8KA 4HB3A 2HUNA 2J5BA 5ALVA 4M89A 4IZ6A 4XUEA 4YROA 4UTZA 5JFGA 5LOVB 4MULA 4M54A 1Z8FA 3JQ9A 5I8WA 3PZRA 4YI3A 3ZC3A 2WJYA 4PZPA 1YWGO 4DJEC 3K8ZA 1OHHD 3EWAA 4RSGA 1GTRA 1HLPA 4BTAA 2GTHA 2YZGA 1TTQB 4EJSA 5C1PA 2JCSA 2GFIA 3FMOB 5KYVA 3RHTA 1MX6A 3V8VA 4C6RA 4WQMA 3CLSC 3BH0A 3I12A 4YLEA 3K5IA 5EAIA 3X1ZA 4BMXA 4YMGA 3QNMA 4TQUS 2ODNA 4X3PA 3D5EA 5ER9A 5A2GA 4QQFA 2OGTA 2QIOA 3LK6A 4AX8A 4TKLA 5IEJA 1A1VA 1CBUA 1II0A 1TO2E 5T6BA 5FUQA 1TGYA 1KKMA 2VHCA 4RHEA 4J90A 3NHAA 4BNYA 1WSAA 1USGA 2XE4A 3KQVA 5J58A 1VHTA 5E76A 2O2XA 2VEOA 1F38A 3ZKWA 1U6KA 2B98A 5IULC 3VC2A 4JMLA 1TUEA 3ZZ1A 1SD1A 4CUJA 4F97A 4YVQC 2NU7B 4UMVA 3HJFA 2A9JA 3FF1A 2AXZA 5GONF 4DPLA 3FPLA 1LRKA 1TJ3A 2QLLA 2EIJE 3GFGA 4A6EA 4CMEA 1NHWA 4DI4A 4Z0PA 5ADVA 5KYXB 2ZBEA 2VJCA 3H5LA 4EJ0A 5KSWB 4J75A 1ULAA 4GYOA 3RYFA 1IONA 3EJNA 2O7QA 2ROQA 4PC3A 2FLWA 3GRCA 5KWDA 1C50A 1PWHA 1SVNA 4HN2A 5CVVA 2O52A 2P2DA 1T91A 3Q7TA 4GZLA 3H8JA 2ZSHA 4IH9A 4TRJA 3OQOA 1MX3A 2LNDA 2WTNA 3GNSA 1PAUA 1NNI1 2FSUA 1EXWA 4ROSA 4GPAA 2IOFA 3F5DA 4G0QA 3CHRA 2NU7A 4C3OB 1HNNA 2OAEA 3IMEA 3HDYA 3OLZA 4IM7A 4LRSB 2R4TA 4AXBA 1N5MA 1DV1A 4WADA 5JNRA 1RFLA 2WRZA 1CE8A 3DMGA 3JQAD 3T7TA 4EI8A 5B4UA 5C31A 1GKYA 3AFNA 3Q7EA 3UWMA 3KJNA 1YF3A 3IKMB 4FHJA 4KB5A 1T1IA 1VCMA 2ADOA 2E48A 4RIIA 2ZPTX 3E70C 4MMYB 5FWXB 1RRCA 1LDNA 1HH4A 4QRDA 3T0IA 4GNRA 3AHDA 5BW6B 3WWPA 1WB4A 2JA2A 3I4CA 3VR2A 2J4FA 4UU0A 5SZKB 4BFUA 4QBKA 1ZHOA 4IKEA 2RIPA 4FDVA 2OSBA 4GE0A 1HKUA 1NVAA 5CT9A 3UK7A 1UPFA 3UHPA 1CQJA 3K1AB 1DZIA 3AIKA 4K05A 4AD8A 4F8YA 3SY8A 3O95A 4KQKA 1ZMRA 4D98A 2B25A 1PTJC 4P32A 4RS4A 4A0SA 5HP4A 1UK6A 4WNAB 3K70C 1GNPA 2ATVA 3DAOA 2GRMA 4Y6LA 4Q9LA 3I1JA 4FMDB 2X9GA 4JEHA 1RAFA 1K9VF 4MR8A 1V1MA 5IKOA 5TARA 2WUEA 4L5YA 3JX9A 1C3OB 3TCXB 4ZTBA 5CEEA 2X19A 2DCUA 4XI0A 1V7PC 4KQEA 3S68A 4DKXA 4EHAA 1XELA 4ZVNA 1XTVA 1HYGA 3LPZA 1XLTA 2GZSA 3L0YA 3KX2A 2R4QA 3TLKA 4IJVA 3TUIC 3Q8KA 3OQPA 2PNNA 4CGWA 1BDIA 4DREA 3K1YA 4WBNA 1CLEA 1M5UA 2Q5FA 2DIWA 1VE7A 2F1OA 1ZJJA 2QM7A 3DXYA 1ZIOA 3RWMB 1GHTA 5FQ8A 1KPHA 3B13B 3OLXA 4K9MA 4Z0HO 2A5GA 5BYBA 4KR2A 1T1RA 3LU1A 1PC2A 5B7GA 5E3JA 1XVVA 1VSQA 4Q48A 1M83A 2WTEA 4V0OA 1CR0A 5EFOA 2FCAA 1RRVA 2REQB 4NICA 1C30B 4YJ2F 4UAVA 3W1EA 1OWMA 1QG2A 4DQUA 4RTMA 5IN5A 1ZU2A 2R1TB 4P4SA 1QBQA 1A1SA 1EVKA 2QUJA 1SOWA 4F7WA 5JH7A 1Z6XA 1WXDA 1DEXA 3EIQA 5CITA 1PZGA 2PEYA 2NOAA 1O87A 2J41A 1PGJA 4R16A 2D7CA 3C5WP 1JUQA 3DBHB 3GZ1A 3DMYA 3IPAA 3DLBA 1GIAA 5CH8A 4EHKA 1E1CB 2ODAA 1W88B 3Q85A 4TUYA 2DB3A 1LDYA 1UXGA 2F0YA 3F8WA 3ANLA 1DCMA 2VK1A 2ZYGA 3EYWA 3GFTA 4FONA 3NEAA 3TI9A 3KJZA 1GSOA 1H2TC 3AIMA 3N0TA 5ANRA 4K9KA 3TJRA 3IVAA 1R18A 4R2MA 4M8NE 1QZXA 4X7PA 2O2YA 1DKNA 3BSWA 4QGSA 3H4IA 2RAUA 2HJVA 3VU9B 3EZGA 4K3VA 3PUJA 1TAHA 2NZ2A 1GYRA 2BISA 3G82C 3IO5A 1WY6A 3HJAA 3AETB 4FILA 1DC6A 3FDXA 3IV7A 4WLNA 4YCMA 2C98A 5B7PA 1PV4A 3CG4A 3FUMA 3IALA 3VPCA 5BNWA 2PD3A 1KH3A 1O5IA 2BFNA 2WNIA 1XMVA 3BD9A 3DOCA 3VLDA 1XRPA 2DUMA 3U4DA 3B1FA 1U8XX 1Z26A 3TWXA 4INOA 1AK2A 2ILRA 2R02A 4ZZ2A 1DBPA 2C95A 4JA7A 1GG5A 4P31A 4EUHA 1JJFA 5LQDA 1J22A 1X1AA 4GZ3A 3F6QA 3GGGA 3OZWA 4M9QA 1A5BB 2G9NA 2DOKA 3FSGA 4N0PA 3O8QB 4ARZA 3A4VA 2ORED 1L7DA 3U0BA 1Z0KA 4R41A 5KOYA 4OHYA 2Q99A 4NYIQ 5CEFA 3VHXA 3DEOA 2J0VA 4TXRA 2VA9A 3VH3A 3SU8A 3IE1A 1QPZA 2VGXB 3UWOA 4QGBA 4P7BA 1UODA 2LRHA 4HQNA 1N0VC 3GN2A 1VE5A 3FPEA 3VOAA 3DZFA 4D8WA 1RZRD 3ABOB 3QSYA 1N32B 3UHFA 1EDDA 3DSTA 4TKUB 2NYUA 2EBHX 4QNRA 3BFKA 4L57A 2VJLA 1RZ4A 3UB4A 5KJMA 2H59A 4BXOB 1K7SN 2RHRA 2MDTA 3UAGA 3ILXA 4RF3A 1U3TA 4WHMA 1ISFA 2QM8A 5ED0A 3UH0A 4I5EA 1NXPA 3B8HA 2AKAB 3THWB 3Q8LA 4AW9A 5A6VA 1KMQA 2WM9A 3EHNA 1EQ2A 2LD4A 2J3DA 3H99A 3SC4A 4D8YA 5ENNA 2GPYA 2V0NA 4HLEA 4XLLA 4DL9A 1D03A 2GPTA 1JNYA 2ODEA 2WFLA 3OTGA 1S3FA 1P6UA 1O94C 4AF7A 3DDZX 3TTUA 4JLAA 3KXPA 3NF1A 3B7BA 4LCEA 2P2SA 2REXB 3AF4A 1UOOA 1H8HA 5B1DA 5D1NA 3W2FA 2HQSA 1S4QA 1VBKA 2ZJFA 3K9FC 2PSFA 3AM3A 3M9LA 3ZBPA 4B3FX 3SNHA 2AMJA 1D0VA 2DUJA 5HZKA 4FQ7A 4JELA 3ZOZA 1T15A 4WOPA 2GCNA 3PJGA 4MGEA 5ESDA 2IRWA 3FWVA 1CQPA 2EOAA 4FBLA 2C9BA 3NBUA 4LOAA 2P0YA 5CK4A 2QB5A 3VPXA 1NXWA 1YDFA 2AD5A 4YRFA 1LF5A 2QZAA 5CT4A 1PL7A 4BZWA 2I4LA 5EY5B 4BCDA 1KI2A 2VQEB 3UINC 1X81A 1ZESA 2DWZA 1U80A 2VTEA 1RRKA 5FOVA 1V8ZA 4RKYA 3B38A 3F4LA 5AK0A 4BVLA 2XMSA 2K6GA 1JJIA 2OWDA 2XAAA 2WVHA 1OBHA 3CMMA 5CFOA 3K70B 1S3GA 1P18A 2EKPA 5HM6A 2QR2A 4KR7A 4CR7A 3BU8A 4JHJA 1FEZA 1U8TA 1L1RA 1YULA 3AS4A 2P78A 1RHUA 3PDUA 4N5MA 4QTTB 4TV9A 4U7WA 3SPXA 1GCAA 5I9SA 3ROXA 3JYQA 3IMFA 3JQPA 4LZAA 3EOBI 4JASB 5LMUB 1OX4B 2JEYA 4M9CA 4OEHA 1KIMA 2WT8A 3QFFA 4D25A 2XGSA 3JVDA 4FSDA 4GPTA 3ZN3A 5F77A 1Q11A 3PK0A 5AXBA 1YQXA 4DEXA 1SKMA 2MSCB 1M2GA 1DKPA 2JRCA 2LPMA 4NENA 3TSWA 3LUKA 5FTWA 3RUEA 1ZD9A 4M6WB 4HRNA 3QBDA 2V97A 1CUWA 1JR4A 3W6NA 3V97A 2B92A 1TM3E 1I13A 2VVTA 3SQVA 5BUQA 1FP2A 1U8EA 4YP6A 2Z3VA 1RNLA 2XB4A 2W6QA 4UQXA 1DIAA 1KIAA 2N46A 1Q92A 3TX2A 2CZQA 4EI9A 1BLXB 1ZM2A 3O4HA 4NLLA 5ALNA 3V1KA 1ODFA 1ZH8A 2NXWA 3PT5A 4E3WA 1IXKA 2E6KA 2ZISA 1FQKA 1GL3A 3GLHA 3NZEA 3JD0A 4LC0A 4UUMA 1YR2A 2G28A 2L0TB 2WVJA 4U5XA 5FA5A 3DGEC 1UDAA 4M22A 1JA0A 3TPFA 1E66A 4WOBA 4CM4A 3LBNA 4KVOA 2EATA 2HRCA 3VQTA 2RK3A 5CDGA 2QSYA 3B1XA 3W0LB 1B8VA 2VI5A 2XKJE 3IB3A 3S5JA 1BYIA 2XNDD 3CG0A 4OU5A 5F76A 3IAM1 4I46A 5T6MA 4B3XA 2GX6A 5SYNA 3D6AA 4LJ5A 3BD6A 2GXQA 3FDZA 4ND3A 5F21A 1KTVA 5DCWA 5IM4F 1M0EA 4IQGA 1E8OB 3ADKA 3NBKA 2GA9A 2P9SG 5DNEA 3WYEA 4RY8A 1OFVA 2CE7A 3DEHA 1U4SA 1Q91A 3IR5A 1ODCA 4QG7A 4YAFA 5EQDA 4Z9XA 1OT3A 3HN6A 3SQMA 4ZO6A 4BRUA 4PC2A 4MV1A 4WY5A 4QUHA 2NU6A 3O1IC 5LQMA 4X8QA 1WMFA 2C5EA 2XUZA 4IOJA 5C4IA 1V8PA 4YJ2B 2JFPA 5JYEA 1TFRA 3DE4X 5I51A 2PMEA 4G5YA 4IYPA 4V3IA 4KAAA 2GGFA 4EJ2A 4X65B 2EEPA 3L7MA 5CRUA 2VJMA 3QU4A 1J2UA 3UT8A 1JG6A 2X1LA 4H3HB 3KPVA 3WJAA 4EG0A 2W6IA 4IWXA 4LJLA 1Q1NA 4OL9A 1XXHA 1I3NA 2XCLA 2IY7A 3OPYI 1F7VA 1XT6A 1JHAA 1A2OA 1PR9A 2LTAA 2I1JA 1TN8A 2GH1A 3R5FA 4NS1A 2BFMA 1SQGA 2LBPA 1YRLA 3GL9A 3ULQA 4H17A 4JP5A 4L5JA 2I7CA 4NOKA 4PZZA 4RC9A 2X3FA 3WOVA 1Y7TA 2NU6B 3SF8B 3ASFA 4JQSA 4KLCA 1GRCA 1WX1A 2J3HA 4RPJA 1MH1A 4XE0A 2ZROA 2X6KA 2DKFA 3EA4A 3LCJA 3IQZA 3ROMA 4F9TA 4YJHA 5I01A 3TGLA 1YOVA 4GPIB 3TRFA 5HPYB 3K9GA 5LIPA 4QQ8A 3V4FA 1EUYA 6ADHA 5FHRA 2VF2A 3QDNA 1FRZA 1NXXA 5EXEA 2R6HA 4M2LA 3HRIA 1XIVA 2C77A 3OZEA 1U0TA 4HAUA 3KYCA 4LECA 2PZJA 4DVGA 3D3NA 2ZIUB 4IIEA 4BTEA 3QKRB 5I4CA 4CV0A 2I5PO 1TUBA 4MYUA 3CHOA 3STVA 2RDMA 4OCZA 3OCVA 3WDMA 5D7NA 4KBQA 1BE1A 1O5MA 1FFSA 1N4QA 1PR3A 2IVFA 3FWHA 1YBFA 4TKZA 4XARA 5DNVA 4ZT3A 1KEZA 4YPVA 2VNIA 1E0SA 4HNQA 1YOVB 3RNOA 3L8EA 1BKSB 3LX4A 4HX9A 1X86B 2PPVA 4GWKA 2FPOA 2X23A 2C0MA 3CC8A 1CY7A 1KDRA 2ZYHA 3MN1A 3QI2A 2RGBA 2CNOA 1T5HX 3KYBA 2VDUE 4G97A 1EP2B 1XD2B 1FF9A 3DZKA 2EFDB 4K1LA 2WUWE 1K5DA 1YFLA 4FD3A 5AXCA 3D4BA 2NNLD 3PEVA 1TYQG 3TNYA 4DEVA 5LJLA 2I6HA 4D3YA 5JU6A 4PS0A 5J1SB 3TLYA 3BJRA 4RE6A 4NBLA 5J5AA 1J4AA 1E7MA 3R0ZA 2QVLA 6ABPA 4JV5B 3HRAA 2WYOA 3KQKA 1U3FA 3L7KA 4XDYA 1YL5A 4DCCA 1O6FA 2AW5A 3SF8A 1JU9A 4N3NA 2OCCE 2DHQA 2ZW9A 1QGAA 2Y0PA 3MAJA 4ZOLA 4G41A 3O38A 1K98A 4DWJA 3EAGA 1E0JA 2VWHA 1K4YA 3ZWMA 1SOMA 5JASA 5CBOA 1J39A 2XODA 5CECB 3L6CA 3R3XA 2XQGA 5FTNA 3DBSA 3DD1A 3HUDA 4LG1A 4MNTA 3QVSA 3PRZA 4ZI5A 3CHQA 3PEEA 2V5FA 4L9RA 4ZVOA 3CVQA 3G2VA 1SCAA 3QPAA 4S1VA 3UJBA 3TEFA 3UV3A 3VNAA 1HFKA 1V35A 2I8AA 2W93A 2WWFA 2XUDA 4HDMB 3V4PB 4C07A 1VL1A 1YFZA 3OF3A 1P7CA 4JQOA 5HTKA 5ES4B 4AS1A 4P58A 4N4AA 4BO3A 3BIOA 1H9AA 4CU2A 5IWCA 3MFYA 3PC8A 2L6JA 1MVOA 2YCBA 1T35A 3IAS6 1NY6A 5AJUA 2QK4A 5HXAA 2H2AA 1UBLS 3OAAD 4YT4A 2FSVC 5A3RA 2XY4A 1WS6A 3GEMA 2FJPA 4O2BB 1GDDA 2HF7A 3PNPA 4Y1FA 4UAGA 2FSHA 1AA9A 3AG5A 2ZB2A 2FWMX 4R9VA 4RSYA 5JAPA 1GNTA 1G4HA 2JFQA 3FFAA 4B74A 2C7QA 1LLQA 1FTGA 2BDEA 1AMOA 1CP2A 1HY3A 3L0OA 2JFGA 1UKBA 1XV5A 4I0WB 1BVRA 2BUBA 2WW8A 3Q87B 5LCWC 4HBZA 4ER0A 2UYOA 1YRWA 1FS6A 3L2OB 3PUWA 3UXYA 3KTDA 3WFJA 1KJ8A 4CF6A 5AFSA 2YIDA 2JJ1A 2ZJ2A 3QTBA 1PTKA 4OYLA 5LZ4A 4P34A 2J59A 3I6ZA 3RUHA 1BTOA 5SZIA 1V26A 3IESA 1E2JA 1O57A 3BKXA 1EFRD 1V6CA 5CT5A 2A0XA 1PX2A 1OX6A 1TQ6A 2JI9A 3D8NA 2VSFA 4ZVRA 1OC4A 1VIAA 1P6QA 4INAA 1JEDA 1K63A 4BWFB 2YICA 3LI2A 1X9HA 3A11A 5IAJA 2ZBRA 4HH1A 2QVBA 3DW3X 2RFMA 3QHQA 4II3A 4W5JA 4F4UA 4PW0A 1EWVA 2HPZA 5FUYA 4P93A 2VBIA 2AEEA 4ND4A 3VR6D 1U3UA 2OKCA 4ZGWA 4HAWA 1MO4A 1IYZA 3GYXB 2VUHB 4OJQA 4YQZA 4BNDA 4DMLA 4P9NA 4GRAA 2D5IA 5FBRB 1KO5A 2XRYA 1H2VC 3QAQA 3OIWA 3FW1A 3M4JA 4YRRA 4COKA 5CDSA 1VXRA 2RHDA 2ZITA 1U28A 1L5MA 3JATA 2M6KA 2IKSA 2A9VA 3IPYA 2OV8A 4PCLA 3ULYA 1QMOE 2FQXA 1T6XA 3DAPA 2PX4A 3OU2A 4QX6A 5TRTA 1F1JA 3GI1A 3IYLW 4FGJA 3HXDA 1B8NA 1P1JA 3CGHA 2WXFA 1XD2A 7MHTA 3JYLA 4BN5A 1M2HA 3TVTA 4C1BA 1IE3A 4FULA 1GGHA 1W0JD 1GD1O 2GYVA 2Q1WA 5TMEA 5A9SB 4BZZA 4B71A 2Y9PB 3O7WA 4FFOA 1XEWY 3Q1LA 2BI8A 3WAKA 5JXHA 4W1RA 1U0FA 4XGKA 1N78A 3MSCA 1YV9A 5FI3A 2F55A 3KV3O 4WCDA 4QJ3A 4A8PA 1L8LA 2WU0A 4J2TA 2X86A 3BEEA 3UIPC 1TM5E 1ZK4A 1OASA 4DR2B 4I2ZA 4AN1A 4F2GA 5E8JA 3B95A 1XRQA 1EGMB 4YEDA 1PQYA 4KXWA 5EQFA 1GGMA 4AXHA 1ZCJA 2C3UA 4QAJA 4URFA 1XX6A 4GI7A 2QQ0A 5EPUA 4HAIA 5LYYA 1SXJD 3MWDA 4U7FA 5FBQB 2QAJA 4WK4B 2VOJA 4MUEA 5JH7B 1IQRA 1WOMA 1KMCA 2XUPA 4MVJM 4TYMA 1UOEA 5K3BA 5FAXA 1ZH0A 3SZOA 3TS1A 3CW8X 4KX5A 1UKZA 4AMYA 1PWZA 3MK31 1S0PA 1FUYB 4MVJA 4P7JA 3VTAA 4Y6PA 4P0TA 1LRLA 4TN1A 3UKRG 1B8PA 4IDQA 4KAJA 2RFAA 1W36D 1AT1A 3C5CA 1OOEA 4LOJA 4CEHA 3JWGA 1A7JA 2KBXA 4BNLA 1NIPA 4Y2SA 2PK3A 4NHOA 2JFVA 4URVR 3QEJA 1L2TA 2PN1A 1AK1A 3IO3A 5EIHA 4M98A 2BN4A 2RB5A 2ZG6A 1MJGA 1HDYA 1S9HA 3NHSA 3GZ4A 4YCJA 3ASOE 1M6NA 4GTQA 2Q4OA 1VRWA 2JGMA 2O1WA 2QIPA 3HRHA 4PHGA 5TT0A 1QBGA 1YA8A 3GP5A 3FXAA 3ZJVA 4CGYA 4WACA 3ZW3A 1O1TA 2OVBA 2GO1A 3U9TA 4X6LA 3VHLB 1T1EA 2JFWA 2AJ8A 1XNHA 3L13A 1KK0A 3FYUC 1EZ4A 2FW6A 4J3FA 5FO1A 1PE0A 4IZOA 5L4SA 2NWQA 4QYTA 2JCVA 2B82A 1GA4A 4KGVA 4BP9A 2X9VA 1D8AA 2PH3A 3ONLA 3QFCA 2BCGY 1A3CA 3WIUA 4EY6A 5A6SA 2QPTA 3CRZA 3NTRA 1ORTA 3BMQA 4W6QA 4NDNE 1MAHA 2Q50A 4OKSA 2CLFB 4YDWA 2QX7A 1N6HA 3SD5A 5DISB 1BYUA 2F48A 2Q2OA 1MHPA 4B2PA 1E69A 1C30A 1IMJA 4L8YA 3RRFA 1A2BA 4EGCB 4XAQA 2PSSA 5A5DA 4HNVA 1U8UA 1EX7A 2PLWA 4BVJA 3GUHA 1T36A 2PUJA 2R4UA 4KLRA 4BFSA 2AA3A 2BPOA 1RD4A 3RHSA 2BYTA 5JI3E 3PFKA 5C8ZA 1BX1A 1F14A 2FVYA 1NUPA 4MYHA 3E0XA 5CYGA 3T7SA 2XZDG 3Q3CA 2HNBA 1BDHA 3SLKA 2I3DA 5DBHX 3NONA 2PQMA 2HDOA 5BN4B 4BFXA 1P4JA 1S02A 1FVOA 3DDCA 4G85A 4H6VA 4J0HA 3P9PA 2JRLA 1I1HA 3BDVA 2WQHA 1IZ0A 4LJYA 4YJFA 5ETJA 3ZYQA 2W7TA 5GV7A 1H2WA 4CLRB 3SSOA 1Q7TA 4A36A 3PX2A 3KPJA 4NONA 4BLPA 5FWAA 3L22A 2V8BA 1G2QA 4AQ7A 2YMLA 5JDCC 2O3QA 2X4LA 2XQ0A 1JT2A 3FGOA 3RVBA 2QY9A 4LE0A 1Q0TA 1QO9A 4U8HA 1AQJA 4ZK2A 3OC0A 3SO8A 5CCBA 2D8AA 3KB8A 1OXVA 5DGCA 1DKQA 3AERB 4KSCA 4HPWA 3SR4A 3CLKA 4P4NA 3S1SA 3RTAA 3TWOA 4F3CA 2GR9A 1TN7A 3A9CA 3BMCB 5EKTA 2HMUA 2HF9A 3VJMA 3PRKE 1A9SA 2C4UA 4E33A 5E2IA 4PS7A 1KYWA 3UK6A 1XKXA 1NT2A 1DQPA 4MVJH 2R85A 3D6VA 3WADA 1L9KA 4I1PA 1AP7A 4JS0A 3DW1X 4EA6A 4NESA 3LVRE 1PNVA 3HYCA 3QW2A 4HBDA 1JB1A 1T1GA 1Y8RA 1FTYA 2CLOB 1F20A 2JJQA 5D85A 5DTIA 5TR9A 1CUYA 1SHKA 1EFHA 5DOVA 5K9ZA 2ODWA 1H6KA 3QX8A 4GTOA 2HGSA 4WNAA 2BFCB 2CD9A 2J3IA 3T8KA 1UM8A 2XOKA 3FCSB 3PRHA 1WR8A 2IYTA 1OPXA 1IBLB 3PRJA 1V1JA 3FH0A 4KGZA 2G04A 1JQ5A 2AZDA 3QKSB 1I14A 2O8FB 1CUUA 1XPOA 2C54A 1ISHA 4RCZA 1NZJA 4JLVA 1ADJA 2GTIA 3PVSA 4NH0A 3AVUA 1GQOA 2QN7A 3CB4A 3DBOB 3AG3E 1VPWA 2LDBA 5I7UA 3FZEA 4O2RA 1U1EA 1JVSA 1XLUA 2JCXA 3H13A 5EWJB 3NB2A 1PX0A 4RPKA 4EZBA 4KZ0A 3CX8A 3CCBA 4WLUA 4M38A 2IYOA 3K0KA 2J9RA 2EYUA 1MB9A 2QM0A 2ZPUA 2J6HA 1YI0A 4M7OA 4MXDA 4GDFA 1FRFS 1UPAA 3F67A 5GWXA 4KR0A 4FR2A 2DFLA 4PPQA 5EXSA 1V11A 4Q9KA 5DX8A 3FEYA 2JEKA 5KMGA 4X7BA 4C5CA 1L6RA 3P96A 2AKYA 2CBXA 1CJTC 5ALYA 5C8VA 2V3VA 1FU4A 1E64A 2FF5A 1E3SA 2QTWB 3UENA 1NM5A 4DX2A 3R1IA 4JR1A 5J2UF 2XXBA 3C3WA 1SC3A 1K6IA 3COWA 1ZKDA 1UBEA 2AMVA 3LYHA 1B2LA 5BWBA 3GT4A 3NHRA 3PR3A 4HVLA 3IEIA 4LHYA 3V4LA 4MDEA 4HTFB 1R10A 1R37A 3E3MA 1GUBA 4UATA 4DYDA 1E2LA 5KOJA 3VSEA 1IL0A 2P67A 2BCEA 2ZYWX 4Q66C 4MUFA 5KQMA 2C5FA 1VHJA 4ACAA 2FX2A 3GFQA 2FRXA 2GASA 2JFBA 3DH0A 3NAZA 1THMA 2MSKA 4P7FA 2WWHA 3RC9A 3WL4A 3AL0C 5IJAA 2D2VA 1KR5A 2RIRA 4Q15A 3PGLA 3L01A 2PL5A 3H8WA 2F3UA 4ILEA 4MRRA 1GLVA 5FJYA 2GZAA 2CFUA 2QTMA 3BXHA 3DMHA 4P29A 1T0PA 1WEKA 2I1QA 3E15A 3HN7A 4RKEA 1JEJA 2C31A 2CXOA 3LLUA 1W85A 1I4LD 4XIFA 2APJA 1IZZA 1L7OA 4R8LA 5CLGA 1Z8HA 2DGDA 4HZUA 4O1HA 5P21A 3U4QA 1SG9A 1G55A 3SXPA 2HPAA 3JSAA 3O4FA 4CT5A 1NBWB 1KMMA 2E18A 1XP5A 4C4OA 4P81A 1UADA 2IHTA 1QHNA 3VYRB 1C9JA 2Q9AA 4JDPA 5FADA 2HBQA 3LJ3A 1GUFA 5HBRA 3DS8A 3I9MA 3FUIA 2NVUA 3A1CA 3BA6A 3L8HA 3Q9NC 1UT6A 5CDFE 4RVFA 2C5HA 2W4QA 1A9XA 1T9ZA 2PZBA 3LBYA 5ENVA 3DLCA 1YIOA 4Q4CA 3C16C 3RK1A 4NYJQ 2H6GA 4HNTA 4UQOA 3C7DB 3MCVA 4HQ0A 2DBQA 1WDMA 2ZB8A 1E1MA 2KCVA 3T1QA 4WNDA 3PUYA 4JR0A 4AMGA 3LKZA 1GRRA 3P2IA 3V8BA 2HLDA 2VZ0A 4KWCA 4LG6A 5EHGA 2F7SA 4U2GA 1TA0A 3D7LA 2JD0A 3TWQA 1PFUA 3NB0A 1N1DA 4J7AA 4M0UA 1MO5A 3CUEF 2PWZA 3LHIA 3ZDCA 3N8HA 1MBZA 5AARA 1JYSA 3P0JA 4MEBA 3ROFA 1HK7A 4AX4A 2VAPA 4LF8B 2EWVA 1ISSA 3W8NA 3L4EA 4ILKA 2QMOA 4TX1A 5AXAA 2CJXA 5I9BA 2XB6A 1XZFA 2NZWA 4BSXA 2ORVA 4Q4DA 1GPYA 4GOOD 3EGDA 5ITVA 3ZCPA 5K05A 3TBFA 4OM8A 1OGIA 2IK8A 4TXNA 5JA4D 4GGOA 2ONDA 1J0DA 4CM6A 4AJWA 4O4JA 1AHHA 1HFWA 2YXNA 4GMDA 4L3VA 4Q82A 3J81k 5C4GB 1PKEA 4B76A 2CCJA 2A5FA 3RM3A 2B6HA 3U7JA 1QSGA 2BH9A 2OD9A 1YDHA 4XVUA 1U2ZA 2V4ZA 4XASA 1Z73A 2V6IA 3ZE8A 2EZ9A 5KQLA 2MSLA 3TW4A 1P4RA 3PP8A 4L95C 2GT1A 2XMDA 2RC5A 3PFNA 4MV3A 4EL0A 3LP8A 5M34A 3A2KA 1DT5A 2CVOA 2ZRLA 2XCIA 5IX8A 1H4SA 3QEKA 1IPEA 3WVNA 3P2YA 3DXXA 4UXIA 1G98A 1SCBA 5JCPA 4HJRA 5KJKA 5KHLB 2FW9A 3T5CA 3QU7A 1OFHA 5ARGA 2HO1A 1XHLA 4PRYA 4MX8A 5KREA 5B6IA 1EJ6A 1AURA 3WO1A 4CKCA 4ONEA 3A06A 3O0TA 4KFCA 3L9TA 2VHJA 3NNSA 3VR4D 4G37A 1XEFA 5FOSA 1X92A 4M7RA 1DOHA 3K2EA 4AWBA 4WECA 3L8YA 4A10A 3SGHA 1AGXA 1Q7EA 4AZ0A 1FUEA 2IZ1A 2OCKA 3R23A 1EHCA 1YNOA 3CRNA 1E1YA 4I4TA 4BJ6A 3FNQA 2VQFB 1ZI9A 4EY3A 2JF0A 3O90A 4PRLA 1SVMA 2FWBA 4L50A 3DE3X 3OM1A 2ISSD 4WXPA 3MJCA 5LBIA 3RUDA 4G8CA 3IP7A 3N7AA 4ZOQI 2R60A 4Z4GA 1JTVA 3M5WA 4NFHA 1T0HB 3BB4A 5JD4A 3BXGA 1TJYA 2WAOA 3OO0A 4X1IA 1CHDA 3CBGA 4R7GA 4ALJA 4E6EA 2X7XA 3SYMA 1QIMA 3VO2A 3ZNNA 5LWQA 4HWKA 3VNVA 5EN5D 2J4BA 3IUMA 4LX8A 1GG2A 4FMPA 5ILOA 4CMCA 1HDIA 3GAMA 3R6DA 2WXPA 4N5QA 4TOIA 3W06A 2Q3LA 1Z5PA 4YRQA 1GEGA 2QZSA 1G7SA 1BU9A 1NYLA 3V32A 3ZWWA 2E4AA 3NGXA 1L5NA 5UKDA 4CVNA 3U48A 5JNSA 4QT4A 3VDMA 1TYEB 4IDGA 4YAWA 3W2GA 4LRZA 1SBIA 4J6EA 2QGZA 1S01A 4TSKA 3PNVA 3DDOA 5LWHA 2C99A 1U98A 4YCSA 1NPYA 3QU5A 4F2DA 4GGMX 2JH3A 3I1IA 4UE2A 4WRRA 2YJ6A 2PSJA 4RM2A 3IXLA 3L8DA 4OQLA 2QMQA 1BMTA 2VDKB 5HF9A 3VYWA 5TDHA 1OREA 4QOFA 3WRWA 4GYYA 4WJKB 2FP4B 3RVPA 6GPBA 5JPDA 3SFVA 3APDA 1SPXA 3WO0A 1U3DA 1G7TA 1PV2A 5I4BA 1RCFA 2XMCA 3TU3B 1FIUA 1NYTA 4WMLA 1VTKA 2HXSA 4C4XA 3DBLB 1SZJG 4NECA 3WQSB 4F92B 3O8OA 4A5SA 4QEDA 3CZPA 1SB8A 2ILTA 3VTFA 1IRIA 2G0AA 4DRZA 1Q95A 2UVPB 4F45A 3M5DA 4Y9UA 4MRVA 1Z38A 2WIKA 4FX5A 3FBWA 4LTNA 5KVSA 4GLOA 4AP9A 2ISCA 3CLJA 3VKWA 2GLUA 2B4RO 2R8PA 3ZXYA 4DYHA 3EGDB 1CVLA 4N65A 2A5UA 3TL5A 1FNDA 1IEQA 4F6RD 1A0OA 4HFGA 1GR1A 3WMXA 3N58A 2YYYA 4GZCA 4KWHA 1OB2A 4NARA 4YAOA 3H2SA 5LMNB 3T41A 4JC4A 4JJAA 1EUDB 2J3MA 3S0JA 1UEIA 4GB9A 2DJIA 4RA6B 2D00A 1X6VA 1VE1A 2A30A 4QUBA 2J9QA 3D3EA 3SP1A 3B6EA 1XP8A 3DSUA 2RHWA 3WR5A 5CA1B 3VKGA 4B43A 3BTVA 3IVRA 4C2AA 3NYQA 1KDYA 4QO7A 4WVLA 1FYXA 1JQKA 4FFDA 3V33A 2H1RA 2CL5A 2HDHA 4MV4A 2XH8A 3JRNA 1AHIA 2B1IA 2LCQA 3RVOA 1O96A 4UE3S 3K94A 3VZQA 4HGNA 5JANA 1QZTA 1EA5A 3NOQA 3BB3A 1DLIA 4LV8B 3TLMA 1WB6A 1V39A 5E9QA 5BPHA 2QD5A 1RIIA 4HLUC 4NRHB 4YALA 3V30A 4LEUA 1IOWA 1FLAA 1E6UA 1T34A 1WVIA 2GK3A 1O2DA 3DXMG 3T8MA 2AWOA 2HA4A 3OA0A 5IAGA 2EERA 2X15A 1GKIA 4EA7A 3H6HA 1JT9A 2YJGA 4DMMA 1NRXA 4R4JA 2FUEA 4XJXA 4DN6A 1L4YA 1F17A 3C24A 2Q2WA 3RK0A 4NK4A 4RD3A 3COVA 2FGKA 1SQFA 3RO3A 3KWFA 2Y1OA 1GL6A 4FYVA 3FVWA 1BO6A 2H0RA 5EIDA 4DA9A 3E5NA 1G2OA 2I80A 1U1GA 3K09C 3THYB 4RUKA 2ZSEA 1NXSA 1SC9A 3O31A 2FW1A 3MTAA 1UBNA 3P4UA 5I47A 3UCEA 5JYDA 1Z7GA 2J67A 1QHFA 5TS3A 1KT0A 3BGOS 1FRVA 2WB4A 3AKDA 1BS1A 4HAOA 4L6IA 3KKEA 4F85A 4TTSA 4UM9D 2IONA 2PWPA 3RGWS 4FSXA 5EILA 1E1KA 3SM3A 3ZE0B 3B2QA 1MAWA 2EIHA 4DIMA 1ST2A 4GCOA 3L9WA 4LJ8A 1ST3A 2Q5OA 2Q9UA 3QUCA 1EG2A 5AOVA 5LP6A 3KLMX 2XLCA 3N7TA 5FUBA 1LJUA 1Z4PX 3ICWA 5KCZA 4W5RA 3PHLA 3H5NA 5IVPA 3O9MA 3UI2A 4M60A 3HH8A 1UK7A 4NACA 5KSOA 1M10A 2QG9A 4YAKA 1R3DA 1X7ZB 2CHEA 1KZHA 5IBPA 1YRYE 2BR5A 2VJKA 2HRQA 4U7EB 3AHFA 3GVHA 4O4IB 4R51A 1L5LA 3Q7PA 3QLEA 1KARA 3G9UA 4K5CA 3ZY2A 2FXIA 4B6JA 2FG5A 2WWGA 4YRZA 1TN6A 4OOEA 2X5GA 4WV3A 1PSWA 2GCPA 2WF6A 3GELA 3SR3A 1Q3TA 1SHLA 2FPPB 3U16A 5H80A 3WJ7A 2B30A 2IHUA 1ZM7A 3H2ZA 4HRYA 2H18A 2J6IA 3CNEA 2WV9A 4GMFA 4PX9A 4PYJA 3OKCA 3PHGA 4R3WA 1V2HE 1H3NA 1CUVA 4CCWA 3S27A 3PPWA 4JP8A 2WZQA 1P0IA 1WZEA 3TJMA 3CJRA 2AUNA 1G0NA 4B82A 2NSZA 1B74A 2CN1A 2OO7A 5ECYA 4I6GA 2F8XK 4RDXA 2X9QA 2L0IA 1OKKD 1O94A 2YHBA 1U99A 2WU1A 2ECOA 3CLUD 3HR7A 4KR9A 2ODBA 4CEHB 4ZYYA 1Q7BA 1VYVA 4RTQA 2RHGB 3EXEB 4HVTA 3O26A 3PF8A 4OFWA 4Z68A 2AN5A 3I6BA 4CKXA 2FPPA 4J7CA 1IOLA 3B6JA 5JPIA 1H19A 4OLBA 2NAFA 3ZYKA 4AI6A 4B7AA 2DLDA 2YY7A 4HNAD 4ZCPA 4YFVA 3F3YA 3GDOA 1NAHA 4DBZA 3E82A 4PNPA 4QXAA 1M8JA 3TBKA 2J0UB 1V5GA 3ZIUA 4EYGA 1MA0A 3FJOA 4S0XA 3NBZC 4IUBS 5DSXA 5K3EA 1ZEJA 4K87A 3CE9A 1R9JA 1ZD5A 1VJDA 3HJCA 3OZCA 3B1JA 4CODB 3V4SA 1RWMA 3QZUA 3HXPA 1IEXA 2QI9C 3R0XA 1JIXA 1LTHR 3RV4A 3TTXA 5D00A 3NEPX 2F59A 3BIJA 1EUCA 3BB1A 1LD8A 2OESA 4LXHA 4MR9A 4ZRNA 1ZK0A 1LKZA 1FVHA 3AFMA 3EXAA 1MT3A 3LA8A 1II8A 1XDZA 4B48A 2IQCA 4IR7A 1R0CA 2ECFA 1SKQA 2YJZA 3KCNA 3S3TA 2R7MA 2NW6A 5K8LA 5CURA 2PMFA 3P9IA 2WHRA 3BHIA 1NA3A 2HQRA 2R44A 2VS1A 1CP3A 3OZSA 4G5RA 5CFZA 3OT1A 5AW6A 1P9NA 3OFND 4J91A 4ZYZA 3PH0C 3HZHA 4Q94A 4ZOCA 3FTVA 2YZKA 3SZUA 1QBKC 3MLEA 3W7AA 2VP6A 4LXYA 4D96A 3HWX1 3BRSA 4LJKA 4BLWA 4ZI7A 4RJLA 3FDHA 3LQ2A 3U3RA 1CRZA 2WKQA 2PZLA 1I4OA 3O5AA 4ANUA 2NSLA 1LLDA 4HZIA 4PCUA 3NOXA 1F8GA 1XMXA 2VKQA 4JXTA 2GS9A 3PE4A 1E0KA 4B0ZA 4Z0NA 1TU3A 2O48X 3JYHA 3SYNA 3NHKA 3SHVA 4FNMA 2OY0A 1Y6QA 3AHGA 5B3LA 5I7EA 1O97D 2ATIA 2A86A 2GROB 4JD2G 2AEJA 1NHGA 5FLKA 4WFKA 1BWPA 1OZ0A 3IHTA 4LXTA 2PTHA 3SOZA 4AVXA 1KFEB 1DCKA 1DUIA 1KYZA 3CWCA 4TYNA 4LZPA 5IASA 5CD1A 1LLUA 5BMVA 1OIXA 3IJPA 4R2HA 3E3NA 4AO6A 1H0KA 1KR2A 3BWYA 4QAQA 4O3FA 3G6WA 3RC1A 3TI7A 1T4CA 1YU9A 1PGNA 4EQ6A 3KELA 1TW3A 1PJSA 3IS3A 3L4BC 3NAQA 1YKGA 4P5EA 5ENZA 1QOPB 3WBJA 1G4AE 3A4LA 4MKTA 2ZJBA 1RW2A 3GR6A 3R4CA 3RRBA 3H9GA 4Q3LA 1E89A 3QBTA 4MUJA 3SS9X 3TFOA 1A69A 1M2VA 1NRJB 1YJCA 2WM8A 1K3ZD 3DSVA 3FCOA 3I73A 2IEYA 1JFFB 2V7XA 1H6PA 1W4CA 2FLVA 3G0OA 3MB5A 4TKVB 5HJ5A 4DV0B 5E6RB 4A0RA 1L3BA 3AONB 4FW9A 4F3NA 1LGYA 4JB0A 5DMHA 1ZG3A 2YMMA 4RW0A 2C2HA 3WAJA 4B8WA 2JLQA 4DV3B 1YTUA 1R8XA 3B78A 2WTXA 4B6SA 1H2UA 1WE2A 4LYYA 3DBVO 1Z5VA 3AWDA 4R81A 3J80A 1SK8A 1BXGB 3H0KA 2RI1A 3SYKA 4E03A 4N39A 3DMPA 4KKVA 2X9NA 3DYVA 2H54A 3IV6A 3L0IB 3OLWA 1AX9A 3STWA 4D0SA 4AXXA 5D8DA 2QLBA 5FPKA 2FR0A 3F73A 4ARAA 1JKXA 1VG9B 2BI4A 2E3JA 3PWTA 4JLOA 4JHKA 3P0HA 4FT4A 3T7KA 5GADl 3EBLA 4WZBA 3C6BA 3FNHA 5J5VA 1BMQA 3ICOA 1ODTC 3CV3A 4ZKEA 5E6SB 2QYOA 2BAGA 2CHGA 3ZG6A 5K8TA 5JJIA 1KJ9A 1CW2B 4RZHA 5K0JA 3Q4GA 2BE7A 5BRAA 4OHMA 3D2LA 3KO8A 1L7PA 5HGXA 5PGMA 1ZK2A 1N3LA 4LYDA 1IXRC 3WLFA 2DPXA 1I1NA 2GKSA 2I6GA 3ABLE 4FN4A 1SU7A 2RHJA 4MPRA 3OJLA 1E0AA 2AD1A 1OCCE 3PJFA 1JHDA 4BV2A 4H7PA 2Z83A 3MGBA 3KXIA 4EKDA 2PT7A 3QE4A 4CFZA 1KQGA 1NGSA 2XSZD 1H4VB 1NL4A 1ZIXA 3CONA 1LPSA 4B09A 2W71A 3K0BA 3HIZA 3EHDA 2XWSA 2JGKA 3VM6A 4Q4HB 1TJFA 3NC1C 3RTBA 2C7OA 3WB9A 4LF7B 4JGGA 4YWJA 2CNWA 1X1DA 4G63A 1EZ1A 2AF4C 3DSXA 2CVPA 4Z4IA 3IHWA 3OUUA 1I3LA 3DEJA 3TGWA 4ZI7B 5B1YA 1O5TA 4R1SA 3QYAA 3AJIA 4IHJB 1G16A 4UHJA 2ZOSA 5DSZA 3ZWVA 2OOEA 1LPPA 1P29A 3G89A 5G0VA 1S2NA 5BRJA 3HPQA 2RSLA 2R68A 2PRKA 2QSZA 3ISTA 1OAOA 4EJFA 3T7IA 2NO7A 4UW9A 2G4LA 1CUIA 1Q0QA 5FLEX 4HPXB 3K9WA 4NBNA 4HVAA 2Z5LA 4UZSA 5ALGA 2R25B 3DP7A 1E4EB 4HQRA 3ZI7A 1FFBA 1OLXA 3R9IA 4AQDA 4EG1A 4AZWA 1VECA 1KJQA 3NNNA 1XCGB 3AJDA 1DBIA 3R0VA 1E2EA 2Y9MB 3O4IA 2NVUB 2Q6OA 2FZKA 1GSIA 2QD3A 2VAWA 2WUFA 1OY3D 2YVQA 2VZLA 2CL0X 3PGMA 4R1TA 3GLQA 4RDCA 3OQIA 2BI7A 3CKLA 4WOJA 3ZUGA 5C35A 5KVVA 1GM5A 5JSHA 2IOHA 2KPOA 2RHTA 1OU0A 3Q5DA 4GECA 4QWWA 5AYWD 1D8TA 4AZVA 1X7WA 4MS3A 3V9PA 5M7EA 1ENZA 2Y1DA 4PE5B 4M46A 5KYYA 1IYGA 4RA9B 4C0HA 1SIUA 5A0TA 1ND6A 3HG7A 3K2IA 4EMSA 4QM7A 3CZQA 3AFOA 1BEZA 3JQRA 2R8ZA 3QELA 2QE7D 4I2NA 4OATA 3RJMA 2IV2X 1U7ZA 5EKDA 4QARA 2KX7A 3O4GA 4TMYA 1KORA 2FJEB 2ZI7A 2CD7A 1C9DB 2H4WA 3VU0A 4B94A 2NADA 3DBHA 2F9LA 3DOJA 4DF3A 1RBQA 1W35A 3U4QB 3ASUA 1L5OA 1TKCA 3K9QO 4G23A 4YR7A 2I7XA 3SC2A 1E8WA 4PIVA 1UC4B 3RD5A 3RYIA 1J23A 4GOND 4BJHB 3PEVB 1BD4A 3ERCA 3VX3A 5EX3A 1G8FA 1R64A 4OI1A 3E4BA 2HMWA 5AKLA 4WOCA 1YJAA 2NO6A 1WVMA 3M4YA 4LDRA 4QDOA 2R7AA 2XSZA 3BSSA 4QU5A 5FLYA 1SN7A 1Z6ZA 3C39A 3DM5A 1ZJZA 3PC4A 4IIJF 1QYDA 5AQ9A 5EKQD 1CUEA 4LQDA 2C2WA 4IIGA 1ZQ9A 2OAP1 5ADWA 4HI9A 2YJTD 3RT7A 5L53A 5AVVA 4XIIA 1NG1A 2XVXA 1QDEA 3AF2A 5HRAA 4N82A 1XVLA 3UGQA 2ZJ7A 2BHLA 3DRAA 4HKTA 4QHTA 4RA6A 2QSJA 2EIKE 3I5PA 2B4AA 2LZ0A 2YQ8A 4IUDS 3ZHUA 1MPXA 1AIPA 4Y2RA 1RHQA 2ZPAA 2ZYAA 3DKVA 2NN3C 1C14A 1WKVA 1QWSA 1RRPA 1ZM4A 3D64A 3LPLA 3QEMA 3RLFA 3ILYA 4PSCA 3C87A 4H9GA 3KJGA 1UEXC 4N0EA 3L84A 5BT8A 4I55B 4HDRA 4N3AA 3IXMA 3AEQA 3KC2A 3CUWA 4AM9A 3PNQA 3GUCA 3R7LA 3K05A 3X2EA 2UUBB 4UNQA 1QHHA 4D9EA 3NDJA 1UJBA 3AZOA 3KDPA 1F51E 3TK1A 5LQKA 5CEAA 1S8AA 2QN9A 1JUDA 4JOBA 1UMDA 5EJGA 3HWWA 4CCSA 1E6MA 2BGNA 3GXOA 4NOLA 3SJ7A 1U8ZA 1S64A 3U13A 2GEFA 2GUGA 1RMQA 4NFLA 2V96A 5CLJA 3FZQA 3L06A 2FSVA 4MCHA 4Q6BA 4A16A 4DLSA 1Q1ZA 3H5AA 1TL7C 1CUZA 2JFYA 2HMYB 4ZANA 1IJFA 2JGFA 3GARA 1GEEA 1A95A 1TI7A 4FA6A 2OD2A 4WK0B 4ZCTA 3ZYZA 1J9GA 3DBIA 1IBRA 1II8B 3CSDA 4OHOA 3V8QA 3SVTA 4X1YB 5KJ6A 3JCZA 5B55A 1ESNA 1MZCA 4MVXA 1JCRA 2QRHA 3OBBA 2OR3A 1JLSA 3GLTA 5DGIA 2YOFA 4E70A 2EV9A 3AEUB 3EZ2A 3VDNB 3PZ3A 1R8JA 1B8OA 1D0IA 4UFOA 3AF5A 3IIMA 2A7QA 3UJ7A 1PR2A 4V0MA 1I10A 5E7MA 4NZ9A 3L8ZA 2CXXA 5KC8A 1T2DA 3BSYA 3O2NA 4GXRA 4OMCA 3RYFB 1A7KA 2A0FA 3KDAA 4EO4A 4NCIA 1AZLA 3NIBA 4OQNA 2WAYA 3KAEA 1EE1A 2EU8A 3LDFA 3F96A 1ZNQO 2Z4TA 4BGDA 5J90A 3WAGA 1OXMA 4MK4A 1NW5A 2JLXA 1FT2A 1PUXA 3E32A 1Q3HA 3QG5A 4FFSA 1P7PA 1PV1A 1NLYA 1YCDA 1YJBA 1ZCAA 3BXEA 3P5BA 2JD1A 3PXBA 4M0CA 3SFZA 4PX3A 5ESXA 3O4JA 3DAHA 2J0SA 4U07A 3LBFA 2QL7A 3V7NA 2ZRPA 3GJ7A 1NL3A 2GILA 3IA2A 3MS7A 3O8DA 4QXRA 4EG6A 3Q7IA 3TB6A 2PUCA 2ZCVA 4MICA 1E96B 5NULA 3F4BA 3EZFA 3HKEA 3MQ4A 4MA0A 4Q3DA 1SMKA 4Y6RA 1PFKA 4RJKA 3PNLA 2ZUVA 4QOHA 2BKVA 2F1KA 4M7WA 4MS1B 3F3KA 5TPWA 3IJEB 3AU9A 4BO6A 3SS7X 3DJYA 1HQYE 4DBLE 1VOTA 3C8ZA 3FDIA 3KFXA 4QPPA 1RT9A 1P45A 3M82A 4XW2A 3U1VA 3X1KA 3OQJA 2DBZA 4KKXB 3ZV3A 1G3RA 2WQZA 3H1FA 1DNPA 2XITA 4H1TA 1NUSA 5CW2A 5B37A 5LYJF 1HDRA 3LG2A 4R1OA 4D7AA 2DC1A 3W5SA 3IX7A 1Z17A 4D4JA 5ABPA 1GP2A 4JA0A 5FOXA 4YCLA 1N33B 4JVOA 4IDCA 1CRQA 721PA 4EKEA 1JIUA 1A5AB 4OLJA 1FXWF 2ISQA 3QVUA 2QRVB 4BTVA 4F9EA 2HCRA 1H1TA 3QF4A 2VNAA 4U39A 3U4HA 3ELWA 2Z8XA 4U5QA 3UHAA 4DUIA 3WMFA 4AKEA 4PZYA 2DQZA 3DO6A 3C6ZA 1B6GA 1TDJA 3WK5A 5ITZB 1I2ZA 7ADHA 1XZJA 1JFSA 5FQNA 4BNMA 5DCYA 1VGRA 3P0IA 3HADA 4DC1A 4E31A 2BTDA 1I7DA 5F3WB 4RGVA 5I9IA 4YK7A 5A5EA 1HEYA 3U5ZB 4Q18A 4YRIA 3TZQA 1C7QA 4CMHA 1G9TA 3FNEA 3AY0A 4K2AA 2Q6VA 1NR7A 4G65A 4OB8A 3SBTB 3KEFA 2DUUA 1ZR2A 3LFTA 4GL4A 1D07A 5AM2A 1TEVA 5BMVB 3S4YA 3CUYA 3HO1A 4DV2B 2XW6A 1FTQA 4OPMA 4QU8A 3SKYA 4US2R 2PA3A 4AKIA 2UZ1A 3JD3A 1K4MA 2FPMA 1Q3KA 2GVZC 3AESB 4X7RA 1OA1A 3MRTA 2IYPA 2QRVA 4AJIA 1XQXA 2CMDA 1Y63A 2MRIA 3I8XA 3P1JA 3QKIA 4JLPA 2NNWB 2X0JA 2JI8A 4QULA 4Z49A 2ZRBA 5DFAA 1UBCA 5F35A 5U4QA 4UULA 2J8SD 3EIOA 3UBMA 5FDFA 1DELA 2ATCA 4UREA 3VKUA 5I48A 2QBYA 3ML9A 1HKHA 3HBLA 5FBZA 4GMRA 4EECA 1IZ7A 1T9BA 3X1YA 5IZCA 2AJCA 2PX6A 4FNOA 2HA5A 3PQEA 5BV7A 3FYUA 2H17A 5JZMA 2Q6TA 3HMKA 1LQ2A 5FJIA 2P3QA 4ENUA 1P91A 3FCYA 3G5AA 2QNBA 3E61A 4N0QA 4X95A 1L3IA 2NQ2C 2XDYA 1M8FA 3CVJA 4FYMA 4DTIA 1HWYA 2C2XA 2XRZA 4FFWA 5FR1A 3AF3A 1HT1E 1O08A 3DCNA 2H63A 2R6R1 4H7IA 4WWNA 2YASA 1W6RA 5C18A 3KS2A 2ZI9A 3VR6H 4AJ1A 3MF4A 4FZVA 1ISJA 1RJWA 2HRBA 2XNSA 3LOQA 4QOSA 4DQKA 3RRXA 4QDXA 2I6FA 1EUCB 3G2HA 4W63A 3WGVA 1RQNA 5JADA 4GLLA 5BVHA 1D1QA 5ARDA 4YMUA 3KR1A 4FEYA 4JH0A 1MGOA 1NNUA 1GUDA 2ZSDA 3EQ8A 1AGPA 4GR5A 3WNDA 4D8TA 3QQ5A 1U0GA 5LOZA 3L93A 3VGPA 1I2BA 2C5LA 2YNMD 4N5HX 2H5EA 4D8VA 3UTDA 4DCNA 2ZJ4A 3PYMA 2B8JA 3JQ1A 1PRYA 4IGEA 2QYTA 3BD7A 4UHEA 2GDJA 3UMSA 4EGJA 1LRJA 3SBOA 1QIKA 1R0WA 1OZAA 2PGXA 3A4TA 4OLFA 4PLZA 1Z22A 3GFVA 3INYA 4QLOA 1WSWA 1EX1A 3B6IA 3HWSA 3MSXA 1AK9A 1A9OA 4MWZA 3SSAA 2J49A 4C76A 3A28A 2DYRE 2JARA 1WDWB 2E2WA 1IU9A 3E8SA 3GNLA 2C7VA 2YNMC 5HIMA 1CQWA 2AOWA 1KU6A 1XN1A 3LIIA 4IMPA 5FPHA 3SJAA 1P2GA 2OFOA 5T3RA 4IJWA 3WXBA 5FINA 5MFZA 4BXOA 3OPNA 5B3KA 3HLYA 4TLDA 3BORA 1W4BA 1SOAA 1ZI6A 4XOIA 1KHHA 1TNUA 1QV9A 3PZBA 4H77A 1XRNA 5IW8A 3R44A 1FP7A 2OG1A 3COZA 3H9EO 1DIGA 4TL7A 3UTCA 5TC4A 1YZLA 5FWYA 1ZCZA 5D0QD 1CVRA 1K7FB 1U0RA 2OO3A 2TMGA 1USWA 1Z06A 2WSSD 3BQOA 1RAGA 3IAAA 3T7CA 3NXKA 5CDHA 1P77A 1MOSA 1DIOB 2GHTA 4ZO9A 4GBMA 5FPSA 1GPBA 1SXJB 4ZQBA 1E0DA 3CCCA 5CDFA 3NBQA 2POCA 4I36A 2ZJYA 3C3XA 1VBMA 2Z09A 3DT6A 3CRRA 4QBFA 5KPDA 4W5QA 5JECA 1Q83A 4R8RA 3RYTC 4I7EA 1QAQA 1B0AA 5AW9A 2GCOB 1J09A 4K6HA 2GNOA 1PWEA 4G6ZA 4R98A 2P0EA 4TMXA 3ILVA 4E3ZA 1TJNA 1DAHA 2J46A 2YYSA 3KSQA 3GJXC 3KALA 5FZSA 3EZ6A 5HM8A 3ZIMA 5KC9A 3I64A 3EN0A 1FRNA 1SD5A 4NZMA 3QBEA 4KV9A 3R3ZA 2H57A 4XVHA 1XRJA 3JWHA 4KRYA 4LOKA 4HAZA 2WT4A 1IY0A 4M0FA 4QL3A 1NQVA 1TJ4A 2WHEA 4TV9B 1ATZA 2FW8A 1BVYF 1EWTA 3WDLA 5TY0A 2DPYA 3SHQA 3OCCA 1QAOA 3RFVA 3F8SA 2VRCD 4KNWA 5EJ8A 1EF1C 1K7CA 2IU4A 3I23A 3A6EA 3FSRA 4K88A 4ND6A 5ITWA 1DCFA 5DLPA 3CT6A 3VAYA 2OO5C 3R3UA 3AR5A 2HKIA 4LY3A 1QIHA 1NVKA 3TM5A 1WW8A 4XZ3A 3FCCA 4GEGA 3L4JA 3QWVA 2C9ZA 3I53A 3UFXA 2Y1KA 3S7DA 3GLIE 121PA 1LV8A 1Q84A 2OOKA 2XDQA 1QFSA 2I4IA 5CT6A 4AICA 4B79A 4Z9FA 1HEIA 1T10A 1IM2A 1TLTA 1C1YA 2TYSB 1T3HA 4NBTA 2WJJA 2CG3A 4WNEA