4N39A

Crystal structure of human o-glcnac transferase bound to a peptide from hcf-1 pro-repeat 2 (11-26)
Total Genus 283
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
283
sequence length
716
structure length
697
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title HCF-1 is cleaved in the active site of O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/substrate
total genus 283
structure length 697
sequence length 716
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n39A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n39A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4n39A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4n39A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n39A03
2HO1A 4RIGA 2WQHA 2ECPA 4RIEA 3GW4A 2AV6A 4YVQC 2HR2A 1C8LA 2IW1A 3MT7A 1B89A 2IUYA 3ZGQA 2GW1A 7GPBA 1FTWA 3OXFA 1IYGA 4GYOA 4BT8A 1HXIA 3UPVA 5LQDA 1FCHA 1P5QA 3QOUA 3HBFA 2FBNA 3LPZA 1YA6A 5TVGA 1M5RA 2ASVA 2FO7A 2QRPA 2SKCA 3RO3A 4ME2A 2XPIA 3C4VA 2XCUA 4CGVA 4N2SA 3FWVA 4N3AA 2VSNA 4X6LA 3S28A 3SYRA 3EBPA 2JLBA 3MT8A 4N3BA 1RZUA 4GZ5A 3G2HA 1Y8MA 3CK8A 3NCHA 3K9IA 3T5TA 4AMGA 2XGSA 1JIVA 2BFWA 2C2LA 3L7BA 3RKVA 4JA7A 4NQ0A 2IV3A 3G2IA 4BQEA 2QRQA 4GCNA 4F9FA 5DBKA 3ASHA 3MTAA 4GYWA 4N2QA 4LDPA 3EBOA 5A6CA 3IAAA 3CV3A 4W6QA 3NP9A 4MI6A 3WC4A 4CDRA 3BD6A 2NC9A 4WNFA 2FF5A 1E4OA 3ESKA 2ATIA 4XI0A 2X0EA 5G05C 4U07A 4N9WA 2YJNA 2XA9A 3MBOA 3S29A 5BT1A 2O6LA 3QWPA 4JHRA 5CHEE 3CK7A 1P2DA 1JIUA 3DDSA 4UI9K 3ZHEA 3CVPA 2Y4UA 1WUYA 4AN4A 2KATA 1L5VA 1F0KA 4RIFA 1P4JA 3GZ1A 2R68A 4M83A 4EKEA 5DLDA 1SXPA 5D00A 2KCVA 4WUYA 4G2VA 5FT9A 2DBAA 1ELWA 3QKYA 1KLXA 1QKJA 1YGPA 2GPBA 3MTBA 2VSYA 4B94A 2X0DA 3Q3HA 1NOIA 4MRAA 1P2BA 3T3HA 4REMA 4ABNA 4GA1A 5KJLA 2VCEA 3E3OA 3LYAA 2LSVA 4IN3B 3TG4A 2C0LA 4GA2A 5ENZA 3MV3B 5JJTA 4HOSA 2LNIA 1SXQA 3GZ2A 4LEIA 3BCSA 2LSUA 2QN1A 3NAZA 5FJYA 4WHMA 1FTQA 4KBQA 5IKOA 3VUEA 2VCHA 2R5SA 2SKEA 5HI7A 4NEQA 4X7MA 1P2GA 4NRHB 2FI7A 3ZCRA 2XGOA 4WADA 3MA5A 3CVQA 3S27A 4MHOA 4HOTA 3S7DA 3EDTB 8GPBA 4Z5XA 2QZSA 1UQUA 3MT9A 4Y6WA 4CTNA 3E3LA 2AW3A 3CKBA 2YQ8A 1XNFA 4EL5A 1L5RA 4J8EA 1Z6QA 4M60A 1HLFA 4RIIA 5M72A 4YVOA 3UYKA 5EKQD 1K06A 4I9EA 3ZCTA 3PE4A 1GPYA 3QWVA 3UUXA 1L5SA 4M7PA 4KYOB 1KT0A 4JL0A 2ACWA 2FETA 2VQ2A 3OT5A 4F97A 3S7FA 2IV7A 3T7DA 3L79A 1L6IA 4U0ZA 5KJKA 5LCWJ 1E1YA 2C4MA 1WUTA 5I45A 2SKDA 3MQFA 3LCAA 1ZU2A 3OKCA 3CEJA 2XCIA 3ZFWA 1FS4A 2BUGA 1KT1A 3Q15A 3Q5MA 2IEGA 1P4HA 1PYGA 2XMPA 3CEMA 2HYZA 1XOIA 5BNWA 4WNGA 3AMVA 3ASGA 2AVPA 1XKXA 3AS5A 3Q47B 3ULQA 3CUTA 3ZPJA 2UY1A 2QN7A 1RRVA 4BTBA 3RSZA 3HBMA 3DZCA 3AS4A 2GEJA 1QZ2A 3MS4A 2PYDA 1YA0A 3VTXA 1GPAA 3ZCSA 1JEJA 4BTAA 1Z6PA 9GPBA 3U4TA 1E96B 4F96A 4YNDA 3RIBA 3QKWA 1HH8A 1EXVA 3BCRA 3D0RA 3BD7A 2F3QA 1LWNA 3UQ3A 1PC2A 4WACA 1FTYA 2AZDA 2G9RA 4G24A 2IEIA 1XL0A 3O48A 4CTOA 3Q3EA 2H1HA 4AM9A 4G23A 2QN9A 5TMDA 1FU8A 4KQMA 5FZQA 4EL0A 3ASFA 1FU4A 4MI9A 3NB0A 3C4QA 5CCLA 2H1FA 2Q6VA 4GCOA 4XI9A 5CCMA 3BCUA 4NESA 1GG8A 4GZ3A 3HBNA 2V5FA 2WTXA 3L7CA 4MHSA 1Z62A 4J8DA 5EX0A 1H5UA 4EQFA 2P58C 2IFUA 3G2KA 3OXGA 5G04J 3GPBA 4GA0A 3UYLA 2C9ZA 2XGMA 1WW2A 2QN2A 1JIXA 4HOQA 1BX3A 1WW3A 2VG8A 4MICA 4EJ2A 4GYYA 2PRIA 3VDMA 1GPBA 2QRGA 4J8FA 3ZCPA 1F6DA 2XEVA 1WV1A 2R60A 2QLMA 3ZCQA 3QWWA 3C48A 3ASDA 4BFCA 2IF4A 2G9QA 3L7DA 5DXFA 5A7DB 2XCBA 3HBJA 5JJ7A 1JG6A 3PDNA 4N39A 3MRTA 1L7XA 1FA9A 2VGXB 1IIRA 3T3GA 3WXXA 3MEKA 2XA1A 3OTIA 5D0QD 3O3CA 4Y6CA 1NA3A 1NOJA 2HY7A 2QRHA 3CK9A 3S7BA 4A1SA 2IYFA 2OOEA 5GPBA 4G26A 5DU2A 4F3VA 3BEEA 2Y4TA 4AY5A 3FROA 3TG5A 1AHPA 5HQ8A 3SF4A 4HLNA 3QDNA 3E4BA 4BQFA 3COPA 2JJMA 3CX4A 3MTDA 2X6RA 1B4DA 3RHZA 5JTUA 4N5CA 1A17A 3OY2A 1NZFA 2X6QA 1OUVA 1WM5A 4I2ZA 2JZCA 2R4UA 2X0FA 3BEOA 5LCWC 2GPNA 3MRXA 3LY7A 3D0QA 1Y6FA 2IYAA 3LY8A 2F3PA 3IEGA 4AIFA 1ABBA 5TMEA 3N71A 2QNBA 3DDWA 3MRVA 3Q3IA 5DIZA 3G2LA 1O6CA 3CVLA 4RENA 4UI9C 1Y6GA 2F3SA 3D1JA 1C3JA 4GPBA 4UQZA 2F3UA 2C1ZA 3MSCA 3OTHA 4HWGA 3RU0A 5FZSA 2FF4A 3MV2B 1V4VA 2XCCA 4GPKA 3TOVA 5C1DA 1NA0A 4UI9J 3NF1A 1TJCA 4AMBA 3L7AA 4YI5A 4KQ2A 4CGWA 4XIFA 3PE3A 5KJMA 3RSCA 4QLBA 2UWJG 2PZIA 4HORA 3LKUA 3OKAA 3NPAA 1WV0A 2QLLA 2PQRA 3NC4A 2OFFA 3BDAA 1IXYA 2I6HA 3KAEA 4G1TA 5EX3A 5BW8C 3MS7A 2E2EA 1NLMA 2ACVA 1XL1A 2J9QA 4I17A 4RG9A 1AXRA 3WADA 4UQXA 4RELA 4X7PA 2QRMA 2GPAA 4KQ1A 1L5WA 3CEHA 4EKYA 1W3BA 2BGUA 5ARFA 2QLNA 3G2JA 4KXKB 5G04C 2C1XA 3L01A 1NZNA 1NZDA 4W9RA 4RBNA 1IHGA 1ZBPA 4I9CA 2G9VA 4HOUA 3DD1A 3ZCUA 5JTTA 2VGXA 4UQYA 3TGOA 1K08A 1C50A 4U0SA 1XC7A 3KD7A 4CTMA 1Z8DA 4YI3A 2PYIA 3VTYA 3KS2A 2WPVA 2G9UA 1Y8ZA 2VGYA 1L5QA 1A8IA 1FU7A 2MHKA 4I2WA 2R66A 3FFLA 5ARGA 1J39A 4WNDA 4PQGA 3MKRA 2F9FA 2GJ4A 4RIHA 3T3DA 1QQEA 3GYZA 3QHPA 3TAXA 3T3IA 2C0MA 2UY1B 1C8KA 5D0OD 5HXAA 1ELRA 4GZ6A 5JJ6A 4MI3A 4U04A 2GM9A 3CUVA 3CKCA 2Q7FA 1WAO1 2P6PA 2YHCA 2KCLA 4LEUA 5G05J 3IA7A 3OY7A 1PN3A 4NC9A 2KCKA 4FZRA 3OKPA 4G2TA 1FC0A 1RZVA 2GT1A 3CUWA 1GFZA 4BT9A 4I1AA 2PRJA 3R9AB 4H7YA 3ZCVA 2PQ6A 3WAGA 3U3WA 5IKPA 4APOA 3LY9A 4H7XA 3MS2A 3ZN3A 2FFRA 3SZ7A 1VGVA 1QM5A 3NP7A 3AS8A 2KS6A 1GZ5A 4U0UA 1P4GA 4BQIA 3S2UA 4AY6A 4X7RA 2VYIA 1PNVA 3CV0A 2KC7A 3S7JA 1UZUA 3CUUA 2BISA 6GPBA 1P29A 3CEQA 4RG6A 3ZHEB 3G2NA 5KJNA 1KTIA 3T3EA 3URZA 2ONDA 4WNEA 2QN3A 4JA9A 1XV5A 3RJVA 5AYWD 5FTPA 4J0UA 3CUYA 3OTGA 4BWRA 3S0JA 3CVNA 4L22A 3H4IA 4G25A 3RT1A 2AMVA 2ZB2A 3JYSA 1EM6A 1PSWA 4FKZA 3VUFA 1JG7A 1NVKA 3BD8A 2BGTA 3HYMB 4O6FA 1HZ4A 1GGNA 5FZRA 2FEZA 3H4TA 2R4TA 2QN8A 2QFCA 5TMBA 1NOKA 1UQTA 3SYMA 2L6JA 3GUHA 3FP3A 1LWOA 4N3CA 2XA2A 2GEKA 5D01A 3TSAA 3VDNB 3OXLA 2PL2A 3Q49B 3RO2A 3E3NA 3Q4AB 4YUAA 2PQNA
chains in the Genus database with same CATH superfamily
3M2PA 1Z29A 1U3WA 1JVNA 4PG8A 3KOYA 5EIBC 3C24A 1QH9A 3UMCA 2FBNA 3BGIA 2ZUWA 3FTPA 4I55F 4YUXA 5EQJB 3NPMA 1Y8AA 2XIJA 2CWDA 2OHFA 3MT8A 2Q1XA 4CM4A 1BROA 3RUHA 5CIYA 5EJEA 4RLFA 4PS1A 3OTQA 1JA0A 4OI1A 1JMVA 1ML4A 4YRDA 1VDMA 3MBOA 4LNUD 3IBTA 4MIEA 3UJ7A 5CURA 1W4BA 5IC6A 3GPLA 3QMVA 4CKBA 2JJ2D 2B8JA 2IA5A 1UXKA 1YFZA 4HX9A 4LQ4A 1U0SY 4TKUA 1V9LA 4J8YA 3ELWA 1HKUA 3MJ4A 5AW3A 1ZD4A 3O90A 2C8JA 3VTZA 3KG2A 3BL8A 4M76B 4KQEA 4ZEOA 1SELA 3HHPA 2QVGA 3C7TA 3M6AA 3TTVA 4N5NA 2JFXA 1CR6A 1RXSA 1T36A 3D81A 5IJWA 3MZLB 4P7FA 3WNZA 4X20A 3DEJA 3R9XB 1SBNE 3BMQB 5KOJB 2NO9A 3KLOA 3P7MA 1UWCA 3R76A 2C4MA 4DDVA 1S2LA 3W5JA 3VSBA 4QA9A 2VPWA 1E2KA 3AMVA 3SBOA 2OILA 4NS4A 3ZYQA 3R5SA 3L1IA 4H15A 2DX7A 1NNSA 1WEKA 4IDFA 2BLLA 3ABIA 3WMRA 1D8TA 4WA7A 3P2BA 4EJSC 1X74A 2QN9A 1IXVA 4U2DA 1YACA 4MUMA 1XCLA 4FOPA 3I34X 1I2DA 2ZJBA 1R8YA 5B2EA 3IKLA 3BXOA 2WMNB 5K03A 3NW9A 2JD1A 2DPGA 4YRAA 4RA6B 5FPYA 4J91A 4AULA 4Y9RA 4KXUA 8ABPA 1U9CA 2AJ8A 5DTIA 4B09A 1OROA 3DBLB 5DLQC 1VB3A 4O33A 5EIDA 4ILKA 2ZSEA 4QUKA 1EUYA 4HL6A 3E2PA 5ALOA 4HD8A 5LXTB 2X6RA 3F90A 2ZYTX 3HXKA 3G23A 3HZZA 5F52A 2PL5A 1IEXA 2R1VA 1BJKA 1S7CA 1F6WA 5D66A 4UDYX 4ND3A 4S1TA 1N5OX 1QH8A 5AVKA 3HYTA 2IPAB 1D6JA 3DEAA 5K01A 1CU1A 5J90A 2CLOB 3NC4A 4CM5A 1JSRA 1QV6A 2ZBVA 3V4FA 4JJEA 4LX8A 3NTXA 2QL6A 2JIQA 3S4YA 3UB4A 3UT7A 3JXIA 4N5DA 5ARFA 4LSZE 5I48A 5AKZA 3KPVA 1YRHA 2L0TB 4DG5A 3G2PA 3I6MA 4C76A 1KOJA 2GCNA 1ZBDA 2EKPA 4B0OA 2HO5A 3CH6A 1I1HA 3DAYA 3HDQA 3T3DA 5HXAA 2QF7A 4WPGA 3SU8A 1YH3A 2PFSA 2QTGA 4MV6A 2B3TA 5AFSA 4EY6A 1RLUA 2WJZB 3DHYA 2A78A 4EG1A 1E6MA 2HR1A 5BMVB 1JHRA 3DPDA 3FUTA 2P9SG 2FG6C 3TTSA 2DU8A 4NE9A 1E7MA 2G63A 1SQSA 3VPAA 4YV0A 2P75A 3WQBA 5BUZA 4YPFA 4QBIA 1WDTA 5DHTA 3TMAA 2A90A 1Y6IA 5E0KB 3ELYA 3MAJA 3HYMB 2GXQA 2JZOA 1QP7A 1H93A 4HAYA 4H9GA 2PAAA 2RH4A 3ZKJA 4JMPA 4G8LA 3AIMA 4UNRA 2VLIA 2RIRA 3L43A 5FOTA 2VH2A 1J0CA 5KKCA 3JUIA 5K6AA 3UT5A 1YAJA 2NYVA 1DHTA 4G67A 2JLQA 3CLSC 5LZ4A 4KR0A 3I12A 4BFUA 1O7JA 5IYZF 3FRJA 2B2XA 1IATA 4ZOLA 5ULLA 4JYCA 4RSRA 4TPKA 4MDFA 3K0CA 1JEEA 4RWEA 4NQ0A 1YQDA 1OASA 1DAFA 1M74A 1VHLA 4WDRA 2IS6A 4MK4A 1RT9A 3HYNA 3S2YA 4D6PA 2GPTA 2KATA 5EA2A 1W5FA 5FV7A 4NURA 3PUVA 1NXWA 1SVIA 2OAGA 3GY0A 2RJOA 3ROQA 2W6PA 2UYYA 3DYVA 1R4NA 4HOSA 2ZDGA 3I37X 1L7BA 4XB2A 4KIFA 1QCZA 5DTMA 2P9QA 4NBNA 1XNQB 3MA5A 3BWCA 4JQYA 4HAZA 1ZC3A 3ZVRA 2DKOA 2GBIA 1YS7A 5KTRA 5AENA 5JCXA 4F4HA 1YI0A 1C3LA 4RULA 1DAOA 4M60A 4HEHA 5I7UA 4WVFA 4YXWD 3TL3A 2HA7A 4DCGA 4WK0B 2V4ZA 2ODPA 4KQIA 1L7VC 4YY3B 4MYCA 4YRLA 2VHVA 1IM5A 2VJYA 2PRZA 3GCWA 4OHVA 3CF4A 3CKKA 2JIBA 4MQ4A 5JNUA 5LZ7A 5BV1A 2DLCX 5DLPA 1FZQA 2SECE 4B3SB 1E60A 4WKPA 3D0RA 2IYEA 1N7HA 3LO8A 5AK6A 3QA9A 5K3BA 2B7LA 2D8AA 1M1YE 1GQQA 5AMXA 4O1HA 2X8AA 1N2GA 1QZTA 3ROMA 4XWKA 5HCNA 4CF6A 1PL0A 3TQQA 3DO6A 5TF4A 4GNKA 4XPIA 1W581 1TNOA 4YRIA 4M0EA 4GOJA 1JVSA 2WKPA 1MH9A 1OCOE 2YXLA 3DE7X 5JH7B 3S8MA 3MWKA 3TW4A 2VSFA 3CGHA 2YWDA 4DSTA 3QPVA 1K4KA 5D6OA 3OG9A 4A1SA 3ROXA 4L28A 2FN4A 1WSDA 3MLEA 3TLXA 1BDHA 5FX2A 4G8KA 4J2OA 2FKAA 3SBEA 1MOPA 3KFLA 4CL8A 5KWJA 1WXQA 4GPBA 4GPZA 3WHPA 1XQWA 2GERA 3GJ8A 4CFYA 2XCCA 4AVYA 1E6EA 4GRDA 1X70A 3AG4E 4QVKA 1H3FA 4H08A 4J43A 2D0PB 3G2OA 1S8AA 3R9MA 2I71A 3IAS1 3CLUC 1YAHA 4JQOA 5EWMA 3F5FA 3ITNA 5G0VA 2DWZA 3Q12A 4YGXB 5EFOA 2CXRA 1M2VA 3BULA 3GYBA 4OF4A 4RVDA 2XCSB 1F20A 1F8FA 5J23A 4YQZA 5ED0A 1UW4B 3AFGA 1ICIA 3I2IA 3EXIB 4YQYA 2I54A 3SC2B 1YDHA 1J39A 2HE0A 3TUJC 3CLSD 3WJ2A 1RXCA 2ZZMA 4B83A 1YT5A 2R87A 4TZ6A 3D02A 3UA3A 2FPSA 2RG7A 2QR2A 4MQUA 1MX3A 1NBIA 3C3XA 4KXWA 3JYNA 3HEMA 1CNEA 1K6XA 3G9ZA 1JSZA 1G3MA 1IBCA 2HWXA 1T35A 5J2TA 1BMDA 1YCFA 3U4HA 4MVJA 4CDNA 3KXKA 1DSSG 3D6TB 2O5CA 2XPZA 1P72A 4LAFA 3MGGA 4OMUA 4A27A 2WIKA 3GUHA 2JL1A 4B82A 3BE5A 5T6MA 3UMFA 2P2GA 2BP7A 1M2OB 3IPAA 5BSKA 2YOHA 3GJ5A 1W4LA 5TLSA 3A9UA 2F00A 2OR3A 3OXFA 3DBRA 4M1SA 4AWBA 5AW7A 3WLKX 1YA6A 1XTBA 5JNRA 2ECKA 3FNBA 4MITA 3RC9A 4P33A 1FFXA 4LI0A 4O4JB 1ZGGA 1DDOA 1M8KA 1OZAA 1KJJA 3QVVA 1GAQA 4V02A 1BI8B 5JCJA 4F9FA 4N2QA 1DCKA 2XUDA 4AJIA 2UUAB 3GZNA 4GPEA 4EHLA 3IBFA 4N8SA 3IUYA 1MB0A 2C9BA 1D4ZA 5TJHA 4X8MA 3MTBA 1ELWA 2H9AA 4PSCA 5EOVA 4RTJA 3KAJA 3QWBA 4H7DA 4J7XA 1BXKA 3AR5A 4QHSA 3TH5A 4DM3A 2VHYA 4OHCA 2B69A 4L4YA 3FSJX 3WIDA 1QFYA 2QZJA 2PAFA 2C9MA 4BTVA 1GGKA 4CZ2A 4D5GA 2O8FB 4OQPA 1JB1A 3V8QA 4ZGBA 2GZSA 1SK8A 3JQQA 2W2QA 1L7MA 2JJQA 3FWHA 3SYTA 2NTVA 1L7QA 3NZUA 4RABA 1AMOA 4LVOA 3OM1A 1JEQB 3HNRA 2CLIB 1GR0A 2OHIA 4R9SA 3U6KA 3QPUA 3O3OB 2LXNA 2Q27A 1QGAA 3GJ6A 1QNFA 4I1IA 4V03A 3P0IA 1PZXA 1G3UA 4K9PA 5B4UA 1E1NA 4OHFA 2VH5R 3KHUA 1V43A 2MSNA 2GRMA 3L6EA 1RYYA 1BGXT 1HWYA 2RJ3A 2V6JA 2D1TA 4KRXA 1OBHA 1N4DA 3BB3A 4B7CA 1YZHA 2Q5OA 2WF9A 4IQGA 2IYRA 3ZKAA 1AK1A 1LY1A 2ONYA 3CSUA 3PRYA 4EQZA 1C4KA 3LP6A 5JJCA 4A2CA 2P6NA 4K6MA 1DC4A 2AG8A 2YY7A 2ZSFA 2GO7A 4P0TA 4KQCA 3I01A 4MRRA 1WW3A 4MI1A 4B3CA 1M7GA 1ODTC 4FOSA 5CCDA 1YB2A 3DLAA 2H1IA 3O38A 4XJXA 2FR8A 2XUGA 3RYTC 1D0SA 1AGYA 1T3SA 2I55A 1SCQA 3PNMA 3HCPA 2VJNA 3FPSA 3CNOA 4DYHA 5JJLA 2OGUA 3RBVA 4E21A 1X8XA 1HA3A 1N5KA 3ZS9A 1EUCA 4HLNA 1QZXA 1V8FA 1B76A 4KH1A 3AINA 3F8TA 2CFRA 4DUIA 4BB9A 1O95C 1EPUA 1DKQA 4PX3A 4CNQA 3QHQA 1A5EA 3EF3A 4DARA 1N32B 2R97A 1E8OB 4YJ2A 3PWKA 4N3NA 3DM9B 4HZIA 3OZAA 5AESA 4UI9J 2H1LA 1VHTA 2O0JA 4BZWA 1VLLA 3AF6A 2BBOA 1E89A 3K3PA 3W2EA 4KACA 4S0ZA 4X7PA 3EQ8A 5LD2C 5NULA 1TC2A 3D5EA 2BFNA 2WTNA 2ILVA 4V0SA 1XEFA 2J7PA 2ENWA 3PB3A 1LD3A 3RUFA 3HKDB 1GGHA 4HUQB 2V3VA 1G18A 1NVGA 2P62A 4LQCA 3DXFA 5KKNB 3NIGB 4DOMA 4MA4A 4BT9A 5IK2D 4I1AA 3KLNA 5I9TA 4K28A 1SCBA 4RNCA 3F9CA 3QNMA 3LY9A 5I7FA 3TF5A 3LDZA 3E7FA 4YCCA 4X1KB 1S8FA 3IOYA 4KFCA 4B7AA 2BTDA 2QKYA 3B51X 3ZBTA 2AF4C 2G5TA 5HZHA 2NW6A 1HNNA 4R9NA 3DBHA 3KJZA 5C5CA 3EDYA 4L6IA 4FX2A 1V7PC 2EJUA 3AIOA 1WO8A 2QR3A 4B5KA 3HGMA 4BNGA 4DR1B 1E9VA 1AO3A 4NG4A 2GEKA 1SUSA 3TSAA 1PV1A 3OJXA 1JIKA 4WXEA 1QQTA 3I6YA 4OXXA 1Y1TA 4TWRA 1C8LA 1JKIA 2V0GA 2R79A 3QWIA 3HWX1 1SA5A 3HDYA 1P5QA 1N11A 2FG7C 3C3DA 4BFVA 1SVXA 4AZSA 2FE1A 1MRZA 4PYLA 2HDOA 1Y8MA 5LQSA 1BQEA 2Z0MA 3K9IA 2X38A 2J6BA 4NV1A 1X4RA 5L95A 3O4HA 3PU6A 4HTFA 1QYMA 2HCFA 3AW9A 4WLNA 3PHHA 2UXCB 3RV3A 1E4OA 2C2KA 2P2NA 3DOHA 3TOCA 1V41E 4TGLA 3A0RB 1Z6TA 3PS9A 5HQ3A 4MB0A 2NYRA 1ZSYA 2I80A 2C98A 4BO7A 2PGNA 3TOXA 1D1PA 2CDCA 1EX9A 2VYFA 4EDFA 3ORRA 1OOEA 2G1KA 4BFRA 5HS4A 3QTLA 2IFTA 2UYGA 2DTEA 4PYNA 1NI1A 3HWSA 1H5QA 3ABME 4M98A 2WSSD 4PG7A 4XYEA 3CKMA 3HYRA 2YHIB 3T5AA 3BYZA 3HKCA 2IS4A 3E3LA 3QOXA 3FB1A 1KO8A 3DS8A 2BZ1A 3OAAA 2F8YA 1P3DA 2D2VA 1OC4A 2IITA 4TXPA 1NJSA 3DZJA 4P7JA 3IUQA 3Q6IA 1XRLA 1B6GA 1Q1GA 1LPMA 4HGNA 4BDTA 4FQ8A 3WICA 4DJAA 4GXTA 5CFLA 4PF1A 3GWZA 4OQMA 3IMEA 1PUIA 4B76A 3LQ1A 3KQTA 2ZYVX 3D9IA 4YAGA 3A28A 5TRTA 4IIVA 4KI0A 4AO8A 4O4IF 5KYGA 3E37A 3A1DA 3UAVA 2K4MA 3QMWA 4S0XA 3M5WA 4YPVA 3INRA 3C5CA 4QSHA 1XEWX 1M75A 3KT8A 1GITA 4R2HA 1V35A 5LKRA 3JZIA 4HLLA 1SKMA 1H5UA 2Z95A 4UEJA 5CRUA 2ZRKA 4IVRA 4XX0B 4E5DA 2NSLA 1ZNXA 3KCQA 3S2SA 4WXMA 5F23A 2CXXA 4LJLA 4II7A 5INTA 1WB9A 1N4RA 3PNLA 4OGWA 4FEAA 3AKDA 3FFWA 3K9HA 4J75A 1DAEA 1T91A 2Z8YA 3BMNB 1P6XA 4Y2XA 3W9SA 3ZR4B 1OLSB 3E5MA 3UC9A 3BTOA 4NL4H 4PGMA 4AXHA 3JPYA 3H9JA 1U8XX 4QJ4A 1NJ6A 2P2CA 5IARA 3DZGA 4JROA 3C8DA 1QKKA 5TGTA 3O6VA 2GBFA 3NVAA 5DDIP 3RREA 1A1VA 2AN3A 4TKZA 5KOHB 3UOWA 4EGJA 2L6BA 3FXAA 2RGYA 5HBRA 2PLWA 1E8MA 1S3GA 3QQ5A 4I1RA 3KPUA 1KP3A 5HJ7A 4LZZA 5J9FA 1ZVVA 4HAIA 3SMQA 1YC5A 3KZ1E 4AX8A 3FU5A 4YUWA 2ZU0C 3QLUC 5H16A 4BATA 4X65B 1UT5A 3BM5A 3ANSA 4TXJA 3V1KA 5BSTA 1X1EA 2P5SA 5G40A 2TMYA 2IUFA 2BFBB 3KYDB 2EINE 1NM5A 2I6GA 3R5TA 5IM5A 4JAVC 1GPH1 2GM9A 4YAJA 5E6UB 4BOYA 5FPTA 3HNOA 1JR6A 2IHTA 3RI3A 1R16A 1XHLA 3ZCVA 3QE0A 2WP0A 3EOZA 4NH0A 4WKOA 5DWVA 1GYQA 2GRNB 3WYCA 1DFHA 4ARUA 3AL2A 1M1YB 4YRNA 3Q8KA 3RBAA 4ZRMA 2ZIUB 3U1TA 3I2YX 1PL7A 5A1JA 1TN7A 1TRHA 2E4XA 3LQ4A 3FYSA 2ZXWE 1T10A 4DJEC 3OX4A 1HT0A 3FWKA 1H22A 3KAPA 5FNVA 1A69A 4OXNA 2PJDA 5GMOA 1YONA 4CV2A 1S0UA 5JVDB 3IBSA 2JFZA 4J29A 3OQIA 3A3YA 1NE2A 3WLPA 3HDVA 2OG1A 5DWDA 2H1CA 3TM5A 3A2LA 1U02A 3WA6A 4D82A 2BBTA 4JUCA 3EIOA 2BEJA 3BU8A 2X13A 2UVDA 1NIPA 2C2LA 4TSRA 4C4XA 4HWPA 3IAS6 2PX6A 3FVVA 5IKXA 4QUDA 1AC5A 1I4EB 3C7DB 5DYTA 3ESKA 3QW2A 5FRDA 2YJNA 5KYWB 4ZC1A 2YR0A 3LF2A 2W2LA 3S29A 2O8DB 4CG2A 1JKXA 1L2TA 1UMDA 3JZMA 5BN3A 1XZBA 2DH6A 4E4RA 4AZ3B 1P2BA 4BCBA 1IXRC 4XPZA 5FOQA 2B9EA 1VYHA 4OVVA 1EE2A 1Z13A 2FVXA 1I10A 3IL2A 3D2BA 1UMBA 1UFOA 3X2EA 2RAUA 2ZBRA 3CF4G 4DPMA 1NAIA 4IIYA 4KVZA 1N1EA 3GP8A 2Y4OA 4ZALA 2ZZKA 2E4AA 3H2KA 1Y9EA 4KX5A 2Z6UA 4JA0A 2Q2OA 2YQ8A 2OHJA 3B1YA 4QFMA 5DCLA 1WVIA 2JZNA 1T25A 4IYJA 3P97A 5LA6A 1YR2A 2XDQB 3RTDA 1JWLA 3UK2A 1DMSA 4KO3S 3RC1A 1PGJA 1UDRA 3QVGB 3GF4A 4L6AA 3CA8A 3VPDA 2WD7B 3CVYA 4LF8B 2LD4A 3HKEA 1HBJA 2GN4A 3S2FA 5EMNA 4BLUA 2YMQA 3IESA 3LHIA 4QQ8A 1D7AA 4DR3B 1KQ3A 3Q7EA 3TG2A 3CZ4A 2DFLA 1T6XA 3PGVA 3PLRA 3GJSA 5B2FA 4AWXA 3PFFA 4B6QA 1KDVA 2A1UA 1CVRA 1F51E 4L5JA 5JYBA 4EX7A 3T1HB 4GWLA 1K0FA 3B9QA 2YH2A 2LUOA 1STOA 4H7EA 1Q7TA 2ZJFA 4EPWA 3W5UA 4KKVA 4O0MA 4O2RA 5LU9A 1T1JA 5A3JA 2FW9A 3PL5A 4WAUA 3ZNOA 1V1MB 2L19A 2H5EA 1ZOIA 4AP9A 4B3GA 3KL4A 4TSFA 3DGEC 4N7RA 3QWFA 4FHDA 4BDSA 2F4VB 2EGGA 4E07A 1HY3A 1Q14A 4E6PA 5LCWC 4PLYA 1OF1A 2FN7A 3A2NA 3N71A 4V0LA 4HBDA 1VHDA 8MHTA 1JHUA 1WUJS 4EARA 4YWJA 4RY0A 5LOVF 3OU6A 5D7NA 5JS7A 4TMVA 4L76A 3HFSA 3UIEA 5KWEA 1KVSA 5JSZA 3NHKA 2XTAA 1NVEA 4QFVA 2XECA 2KMLA 2VK1A 3IVGA 3TKLA 3RBXA 1BX1A 4J1TC 3O4FA 2JLWA 1H6OA 4LY6A 5FFFA 1PKEA 3COJA 5C7OO 3EIUA 4QDKA 3I2JA 1ELOA 1PJRA 4HN4B 1HNWB 1W30A 4FQ5A 5A4IS 3BE8A 3R40A 3D7KA 3ANNA 4OUKX 1UBKS 3ELUA 2M9MA 3BH6A 5E6RB 1L7RA 3DKPA 2EHJA 4GBJA 4DI4A 4DV6B 2AQKA 1MP0A 4F3YA 3JVDA 1BE6A 2JK0A 4CUZA 4FMPA 4H6PA 1ZIOA 4IQFA 3RYFA 4E5UA 3BG1B 2ZRAA 2AH5A 5JARA 5AYWD 3FUFA 2HV8A 2IXGA 3OCWA 3GG2A 4WV3A 1E32A 2G83A 2GD0A 2I6TA 1IJFA 1Z82A 2XMCA 1DINA 1JMKC 5AW0A 1IHPA 4GEKA 3A9VA 2BMAA 3UENA 5FKJA 3ISTA 1VCHA 2J9GA 5L4NA 1GQRA 3KSDO 5F5XA 4EMBA 1RI5A 4RU1A 1Z5PA 4ILHB 4L8FA 1UEJA 2I9PA 2XB4A 1XZ8A 2Y93A 5DMXA 3Q8LA 3N76A 3CH5A 4JJFA 3AHIA 4E2XA 1L4FA 1MABB 4H27A 2IVZA 3REQB 4DIOA 3TVDA 2E4YA 1KK3A 1QQBA 3QX7A 2IBMA 1YRWA 3UWPA 4RFSB 2CXUA 1UJ6A 4GX0A 2SHKA 2R68A 4B44A 5JO9A 2HDNB 1KZ7B 1F06A 4ZA2A 3VR6D 3T4PA 3TB4A 1VFNA 4EJMA 3ONFA 1TE2A 1HQKA 3T06B 1JALA 1IKND 1J07A 5TQ0B 4IXTA 1U0JA 2GEDA 1NUHA 2FQXA 4HBGA 3JATA 4EHBA 1QO9A 3L7OA 3WGUA 5F1YA 1NKTA 3KDAA 1BVYF 3B7BA 2FF7A 1WZEA 4AY2A 2JKZA 2TMKA 1Z36A 5JMTA 3RIMA 1E1CA 4G0ZA 3U7EB 1I2BA 5JH7F 3FZGA 4QEKA 3RT9A 2EJBA 3FPFA 2VDKB 2QIOA 3EMKA 1I7NA 1WXIA 5KJKA 2C4KA 4WUTA 2WE8A 3BRSA 4EBBA 3O9MA 1P9NA 2KZTB 5FR2A 1IVSA 2B37A 1XKXA 1QIKA 1XXHA 4RY8A 2FYTA 2QRKA 3EWIA 4FK8A 3L0OA 4Y0VA 4DCCA 5ALWA 1RFGE 4KQGA 4AZVA 5D3MA 3OFNA 5FFMA 1D5CA 5E7QA 4YC7A 2BKLA 1D8DA 1Y98A 3RVNA 3WXMA 3D31A 4TL9A 5BSMA 4QATA 4O2BA 3NZEA 2C5FA 1KI6A 5ARBA 4MP6A 3HDGA 3DMPA 3UJ6A 4UQLA 3CX8A 2J0UB 4JIGA 4ZTZB 4WCVA 2EFHB 3RSFA 5AW6A 2XTNA 4H60A 1VJTA 3UEOA 4R4JA 4FMDF 2XA1A 1D4FA 2ZRLA 3ZV4A 3KB2A 1OWNA 4PN7A 5A9SA 1G19A 5DU2A 3MJDA 1ID8A 4E15A 2MOWA 4XLLA 4YJFA 3COZA 3F8SA 2R59A 1RI3A 1LC3A 3ER6A 2O52A 2PZGA 1VCOA 1NATA 3NCTA 1B8NA 1EWKA 4D4IA 2JH9A 3VKFA 2QNBA 3WKAA 1C4OA 2O5RA 4LMBA 1GILA 4QAQA 4W5JA 4WCDA 2ZREA 5CVEA 4KPYA 3EJNA 3DP9A 4OHYA 1GUBA 1OPRA 1EFCA 2AFRA 3W7AA 4CGWA 4I7EA 4DUGD 3UATA 2CT8A 1H2XA 4DJJA 2Z2XA 1SH7A 1G6OA 3HCWA 4HF7A 3JYOA 4CKXA 1E1RA 3HZRA 1MQAA 2K7FA 3WLMA 2N1MA 3ML1A 1PY1A 3EOAI 2JVJA 3RSQA 1OXXK 1PDWA 3QI7A 3EXHB 2FRDA 3FAKA 3EISA 3D8RA 4LGMA 3VPXA 2WPVA 2DY0A 1E20A 3FRHA 3PNSA 4RC9A 4H0NA 3LUDA 1PGPA 3GHHA 3THYB 2H1WA 5D5PA 4LZJA 2VHXA 4GL2A 3MWGA 4G4SO 4MO9A 4GRIA 2BKVA 1MXFA 3PXBA 4O4JF 4HWSA 1J22A 1GUAA 2WWYA 1V95A 1NTOA 3DKKA 2OBLA 4WGGA 4WBXC 3IULA 4PS0A 2UZ3A 2F67A 3L9WA 1CEEA 3B1KA 3ROZA 3FZNA 3K1AA 2DY1A 1CK4A 2IONA 1J2YA 3NTQA 4Z9YA 4H16A 4RZXA 2OZEA 1Z74A 3RODA 1JKMA 2JCBA 1XMSA 4MMXB 2BI4A 3NDPA 3VJRA 1DOHA 2RAFA 1QYRA 5ILOA 1ACLA 5EJ4A 1J56A 1KK1A 2IOFK 1O1TA 1ZJWA 1HDCA 4M86A 1UMKA 3VZQA 1ZMOA 2H7CA 4RY2A 2RKKA 3M4YA 3PYLA 5EE9A 3EDMA 5HQTA 2OXTA 5TGZA 2Z4RA 4OB8A 4AJHA 5K3EA 5HKBA 1CQIA 5DBKA 1MZPA 1E99A 3D3KA 2HLPA 4XD7A 1OYVA 4TXMA 3RSLA 3EQZA 1WM1A 4KI7A 2ZVQX 4F7WA 5C35A 2XKKA 2EFCB 2R96A 2B20A 3L54A 1ZD8A 5HEKA 3TX6A 4OXIA 1KQNA 3LY5A 2GDZA 2AW6A 4LKOA 3CJRA 3TIFA 1PCXA 3K8OE 2PM8A 3BCSA 3VAZA 3CR3C 3WK7A 5F7JA 1MX1A 1DIOB 5AQBA 3QUQA 4WXRA 4LCBA 5FLYA 1FW6A 5BYJA 1Z3YA 2GTHA 3MMXA 3UAOA 1R0BA 3QVWA 4C0EA 4BGUA 4ARBA 1BVHA 3L6OO 2RFLA 3DHEA 6ADHA 2IS2A 1NL3A 1W6UA 521PA 4DSOA 2OZPA 4C88A 2B30A 2UVQA 3A1CA 2XQIA 1AG9A 3IHWA 5MN4A 3SF8A 3E6AA 5FIUA 3I5XA 2QZZA 2WU4A 4EYGA 4UCFA 3VZBA 4HYYA 5MN5A 4LE1A 4JR2A 3UINC 1E1QA 5LIPA 3EU9A 1X7HA 1PVDA 4IICA 3URKA 2P0EA 2L9BA 2W6ID 5KDLA 2H65A 1MCZA 2HF2A 4IILA 4MAAA 2BMDA 4OAVB 3ZV7A 3CS3A 4L75A 5JADA 2VJLA 5BSHA 1JHOA 1RI2A 2J3JA 3ZY4A 4QL3A 4Y6RA 2GCPA 2KM4A 1QQAA 1DT3A 9ABPA 3G7SA 3GNQA 4GE0A 2NVWA 1U6KA 4NPCA 1QVVA 2O2CA 4BVFA 4K6CA 4RTPA 3ASDA 3T95A 3AL0C 3QI2A 2VPIA 1LD8A 3QE9Y 3FCXA 2XOXA 5DBFA 5A5FA 3C8MA 1BMFD 4AQYB 4AKGA 1FX1A 1WZNA 4HB2A 1D6NA 4UPVA 3OOJA 2O2ZA 1MTOA 5EYPB 1LH0A 3KEQA 4G26A 4WN9B 5BY2A 3VC1A 1GNLA 4OO3A 2GA8A 4UMDA 3I5AA 3USCS 1ZVQA 3HB4X 1A98A 4IZHA 4U9UA 4CPDA 3T4EA 3BUSA 2QP9X 4MUFA 3W9BA 3LD9A 4E5MA 3E5RA 2VHZA 3ZEAA 1GPNA 3KCNA 3MAGA 4JK3A 2BEDA 5ALQA 4HWGA 1SGWA 1UG3A 3DWLG 2Q1WA 3JQ8B 4M1MA 1JHDA 5FYDA 1AGXA 4DLNA 4B4DA 2DPYA 121PA 1G2OA 2I8AA 2RK3A 5GY7A 1MAWA 3VOAA 1TLFA 5KDOA 4HAVA 2CF5A 3ADDA 3K09C 1XZDA 3D9MA 4LYDA 4BVAA 1ZG3A 4IRUA 3BXXA 4MP3A 3NT4A 4UQYA 2WD9A 4NZNA 1J0EA 1W5AA 3VU1A 1HO3A 3DA8A 4ASUA 4WNDA 4JB0A 1H94A 4ZQIA 3HHEA 3IAUA 4KXMA 3BGVA 3DBVO 4K6OA 3SVLA 4KK3A 4V39A 3AR2A 4OBWA 5K0BA 3TLJA 1JDJA 2AX4A 4N6NA 1KIMA 1NGSA 1V9SA 2E49A 4QHTA 4GGPA 4ACKA 4C9BA 3DVRX 4U5QA 5CEDB 4D44A 4BGDA 3CTMA 2V0CA 1GRNA 3LWZA 4I3FA 4BX0A 3U7GA 3ERCA 4PM4A 4OUDA 1HDRA 2IYOA 2J0EA 5JDIA 3W1VA 1TYQG 4DA9A 5T8KC 4TLCA 4TLMB 2NO6A 1GAEO 3ORFA 1UQTA 1M72A 2PIDA 1PVVA 3LQQA 3R3JA 1Z28A 3EY9A 4WOJA 3SMVA 5FHQA 2YZKA 3X43A 5EYLA 2YDYA 4AVXA 4ZPXA 4BUJA 1A2QA 2WY2D 2Q2VA 1GPJA 4PBRA 4GI1A 4RLHA 1TVCA 3EHMA 2BGRA 5THXA 3OCCA 5KIAA 4IEFB 5D84A 1F6BA 1ZCFA 2P79A 3B53X 5HRUA 1VIDA 2NX2A 4D4JA 5C4MA 4XUDA 5KQPA 5CJPA 2G71A 3FCSB 5ESXA 4L6CA 2PZBA 3DNMA 2I4OA 1MC8A 1L5VA 2R5NA 4KWCA 4W4TA 3QVSA 3WHKA 4UFOA 1J70A 5I8PA 2X3YA 2QY6A 5K8IA 2J41A 2FMFA 2NOAA 4BLOA 2WIGA 2Y1OA 3C1OA 3FDFA 1LRLA 4WNAA 2H6EA 1RRKA 4HDSA 1CY8A 3HVEB 3ME5A 4PC7A 2HGZA 4EVSA 2VP4A 2DQSA 3PGJA 3WDKA 3ZX4A 5BWNA 3PQDA 4WAFA 4O29A 2H5IA 4DQKA 4GI7A 3ZJUA 4OPMA 5BQ3A 4Y98A 4C08A 2QWXA 2VTBB 1L5YA 4TVKA 2PV0A 4C5AA 4E2ZA 1GA1A 4TKLA 1D9ZA 4B4OA 5DHQA 3B70A 5AQ1A 2NUBA 3DMNA 4HQOA 3HSKA 2PQMA 1G64A 5IVDA 1ZK4A 1YOVA 1MQ8B 2XQGA 3FPAA 1VJGA 4KRGA 2GD6A 3KKMA 3ECSA 4BFZA 1O03A 4BFTA 3HB0A 4PN3A 4G89A 4G1UC 3WGJA 4CGZA 2D0DA 1NXTA 5BV8A 4X3OA 1EVLA 1QPGA 3OIWA 4DB2A 3IHYA 4M8KA 1NF8A 4RCVA 5I7RA 3D0KA 2VAXA 1G5TA 4KEAA 5KC9A 3WWYA 3WIVA 5K05A 2CW5A 3TQFA 2PZAA 3M7IA 1KGDA 4AXXA 3UMMA 1N1DA 2RKOA 4N39A 3MRTA 4UKDA 1TM7E 3E1KA 1NW3A 4ZQCB 5AUNB 2LXLA 5AICA 1TQ4A 3DCNA 1YNOA 1A17A 2VBFA 2MYOA 1JGTA 1PS8A 1GPLA 4CLXA 2I3BA 2CWWA 4MV7A 4JJGA 4BBJA 4LNUA 4C0AC 3E1SA 1FX0A 3AEKB 1V26A 3NEPX 4RNDB 1FNDA 4R2JA 2CCJA 3SIWA 1YIDA 1BI7B 2IH2A 2B9VA 3PEUA 3R5HA 1G7RA 3MHTA 3S1AA 4CQJA 4DA7A 4G1MB 4MS6A 3KB8A 3OPYB 3KJEA 3UUEA 1J2EA 4NACA 1JA1A 1S9DA 4BJ5A 2OP0A 2JLXA 1CS0A 4K5QA 2QMOA 4L85A 4WOCA 1U4SA 3DOIA 1BFKA 2C9OA 4EB0A 4W9RA 3GC6A 4J0CA 2HIGA 3KTAA 2HCTA 3TDKA 3U4AA 2DSNA 3ZVLA 1DWUA 3GLQA 4IOKA 4L2YA 3W0LB 2DTDA 2QSZA 1I2ZA 3P9XA 3QHPA 1NVVR 2O23A 3TGPA 3RJTA 1SIUA 2Y0BG 3UJ9A 2ETAA 2QUZA 2O7NA 1GCGA 3UV3A 1R6TA 3CHPA 1MGPA 3WWEA 3ZXPA 3RUAA 1RMQA 2FFGA 2RE8A 4Z4IA 1ORIA 2CXTA 4MVJH 4RPJA 5BPHA 2JBWA 2FZGA 4D57A 4ZI3A 4NCKA 3ZZMA 2EARA 3P9YA 3M6IA 2BCJQ 1Q0QA 5DN6D 4LRWA 1RAAA 3HYLA 2J9XB 3J7TA 4MV9A 5GJCA 3UB3A 4PU0A 1CXZA 3ZHRA 2LGJA 5CT5A 1G0OA 5LYYA 1XFAA 3BTVA 3HCDA 5BQPA 4MA5A 1SQ0A 4K8OA 2WXQA 4KZ0A 2AOVA 4C3UA 4U5XA 3TINA 5IVHA 5IJ0B 4D3FA 3MCWA 1A4UA 2ZBQA 4HDMA 4YCAA 3ROGA 1PJTA 1EXDA 1E9AA 1DKOA 2ZYAA 3JQPA 3GDWA 3C4VA 2NNLD 4NMHA 2WNHA 2MT9A 3M49A 2QG4A 3FTXA 4PVDA 2DQYA 1V6SA 2OGTA 3SLGA 3J80A 3QARA 3K6KA 5TPZD 4JLNA 1E0AA 3SJUA 3HNPA 4LHZA 1KMCA 1UDCA 2QYSA 4Q19A 3LKBA 3DMFA 1SEPA 1CQJA 1MIOB 2ZIRA 4AN4A 3PQ8A 2F0YA 4XGNA 5GONA 4WD3A 3FDJA 3GJYA 2IE8A 5FD8A 1AZWA 1N6RA 4KPUB 1A5BB 2X42A 3KM0A 4XEUA 4MWZA 3U3MA 1C7JA 4HWRA 4ZYTA 3VNUA 2YZMA 3PSAA 4K5BA 3WYEA 1TW3A 5DLEA 2V7EA 3S7DA 2ZVDA 2FXIA 5AM5A 5BN4A 3ND5A 4Q37A 2WR8A 3WZ2A 1XQYA 4AG6A 3OOEA 3VDRA 4FGWA 3EU5A 3R0VA 4QWMA 3MUNA 3IXQA 4CV0A 1CUYA 3CEMA 4AG3A 3VLFA 2Z43A 3C8ZA 1WKCA 2PVSA 4JY7A 3A6JA 2Q1UA 3V8VA 5BPFA 2EG9A 2WMOA 3FMFA 5ESDA 1HH8A 4B73A 2G5GX 4WACA 3TDNA 3F7TA 1V45E 2AQIA 5FZQA 4KDEA 2WQZA 3JSXA 4R3WA 1OVGA 2P9ZA 1PJBA 5A3VA 1XU7A 3DQPA 2I22A 4Z6KA 1O0BA 5F33A 4J8FA 1KKUA 1IN6A 5BR1A 1QCCA 2C96A 2DQ4A 3RJZA 1P60A 3ZKWA 2OV1A 4HT3B 6NULA 3QFSA 3PPVA 5JA4D 1FA9A 2C4UA 3BWEA 1G55A 1MJ0A 2AZ4A 3H9CA 1Z56C 5AVRA 3PRHA 1RXVA 1H2VC 3U39A 4DQVA 4EZKA 4AZWA 1L9KA 1W47A 2XMDA 3AEUB 3PC4A 1KO4A 3FB4A 3D8NA 4RXMA 4KE6A 1HNXB 5EE1A 4ZVMA 2B1RA 1Y6FA 4MQLA 3VGJA 3SOZA 4C2BA 5DSTA 1ADBA 4HFGA 3G2LA 5LR6A 3ZUPA 1E90A 2NV2B 2OXEA 3HSSA 3IDZA 2D0OB 2O48X 4EJSA 3HUDA 3E48A 3UB2A 3RRZA 1U9ZA 4GZCA 1FVHA 4B80A 3LBAA 3PXXA 1NW9B 3TMYA 1MC4A 1E2EA 5FUMA 3A6LA 2AXZA 4KQ1A 5ENTD 1FFYA 5G04C 1T2CA 2ZJ8A 3EGEA 3L01A 3EZYA 5IC5A 1XZKA 2NU9B 2OY0A 4XDGA 4XW2A 3L8FA 4LJ9A 2YS7A 1H1TA 5FBVB 4IJMA 2E5WA 2WWHA 4FNGA 1K88A 5K3AA 3MKRA 2GZ2A 1TEHA 1W1IA 4P4TA 4L16A 1WAO1 4PSVA 2BCEA 1I30A 2CGEA 3LPMA 3NIWA 3V42A 4GSLA 2WF5A 4BMNA 2DECA 2X0IA 3PPWA 1K7CA 1ZCAA 3KTDA 3O21A 5E4TA 1R9NA 1BFDA 4PEVA 1NMZA 4TL8A 2XMQA 4L5AA 1ZJJA 4BNFA 2Z3ZA 4ZO9A 3AP1A 5L3QB 4QQIA 1ZJZA 5J2UF 4EVQA 4MW9A 4KUHA 4BLTA 4GTMA 2RCYA 3RVBA 3U60B 1QFMA 3W06A 5FJIA 3B78A 2WMDA 3OVMA 1OX4A 3T15A 5FWXB 1JDZA 4GRAA 2JFOA 3N6VA 1XAGA 2E89A 3MCXA 2G76A 2Y3IA 3ZDFA 4OBBA 1GXSA 3AUAA 5EZYA 4QUBA 4TXNA 1TR4A 3SHFA 2FO7A 4B87A 1AUPA 3CHOA 1VL0A 3FJOA 2ZAYA 1OAAA 4XVUA 1FPQA 1IN1A 4GICA 3R7RA 1SNYA 1JKJA 3FCEA 2MR6A 3RKVA 1TUBB 1JX6A 1XHEA 1HNZB 5AAOA 1AHNA 2QA5A 1A9YA 5C3UA 5I3ZA 1LX7A 4LJ5A 3H9BA 4A92A 4BLPA 1WHTB 3HB7A 3Q6MA 4F2PA 4AP6A 1W0JA 1KVRA 2YV1A 4QXRA 4P54A 3H8JA 1Z4IA 2PGLA 2W6MA 1AA9A 4W82A 1C9KA 4N5MA 2C4HA 4JBNA 1YS1X 2J5RA 5EIOA 3THWB 1PEDA 5FDFA 3PZ2A 3TPCA 1CJCA 1UK9A 4W5TA 4I5GA 4WNYA 3W1WA 2ODBA 1VE6A 2YMLA 2NO7A 3GI1A 4MW4A 5EKSA 1WMAA 4DIDA 4LMRA 4OGLA 4GMRA 5JSUA 1NE7A 4EL5A 3LP8A 1TO6A 4Q16A 3NHWA 2R62A 3KEFA 3D3MA 3VR5A 5EKQD 1PQUA 3JARA 3FCUB 4GMGA 3O8QA 1T0HB 2CZCA 1QO7A 4X64B 4FFOA 1TKBA 1NN5A 4YMTA 9LDBA 4D8VA 1R10A 3SP1A 5BMOA 1YA0A 5TT0A 4S24A 1TF5A 2DBQA 2AYZA 1IZ9A 2WAYA 4JOQA 3ELDA 1QHFA 5J4HA 2O8VA 4AECA 3DPSA 4IJ6A 2QL9A 3DWGA 2PMWB 3L77A 2BGJA 1NFRA 3CZMA 2AQHA 1VI6A 1H1LB 3KKEA 2DAPA 4WLOA 4WZZA 3ZCPA 2BHRA 4Q9HA 3ZWMA 4L3OA 4F8JA 3S40A 3G2UA 5CNJA 2OBNA 5CT4A 4QNMA 1GHTA 2HJHA 1T4DA 1NSFA 1M6VA 3ZVVA 4P3KA 2PQ2A 4RKQA 3ASNE 1DAIA 1LA2A 5T4BA 1VE7A 3FN4A 3H6HA 1Y7LA 4F1PA 3AG5A 4P3NA 1KVQA 1S63A 4D0GA 3TQSA 3S2AA 2RK4A 3VQTA 2YWHA 3BTSA 1NZFA 1EE1A 4YBZA 3UZUA 3R4VA 4L7VA 3IR7A 2VBGA 5ALVA 2FVYA 1VDZA 4RH0A 4I4LA 5TMEA 2XS1A 3U4QB 3LWNA 4CU2A 1G4AE 1ULZA 4QEDA 1YJ5A 1NIJA 4LTMA 5CB4A 2IGTA 1C3JA 2MR5A 5A3RA 2HF8A 5REQB 4GP7A 1GVNB 4C6RA 1RRCA 1Z5ZA 1DG1G 1OKKD 4YDSA 4CT4B 4UU0A 4IDGA 4IIEA 2CJPA 3R7SA 4XVQA 3LLUA 1ZWLA 5JU6A 1KFEB 1OIXA 1S8OA 1DBIA 2RSLA 1Y8RA 4HOUA 3GPDG 1IB0A 5DLYA 1QORA 1IBRA 3BZWA 1JPJA 4OYLA 4MIKA 5LQNA 3UFBA 3COYA 3ASUA 2G5CA 3RVRA 4I5DA 2ZIVB 4QASA 4KBGA 3KXDA 4HZUA 4ON9A 2Y05A 3EZ2A 3Q1LA 2JCXA 3JD4A 2EILE 3TSZA 2OPBA 5K4HA 4QPZA 1VMIA 4K3UA 1Y5MA 3C3PA 1YXMA 1EQAA 1KI9A 4UUOA 1PT9A 4BVKA 1RBZA 4MZXA 5C2YA 5AWFC 4OP3A 3HVJA 3LJNA 1NQOA 2ZBUA 2GRJA 3HYCA 4AZ0B 4CDMA 1JFFA 1I3LA 4WNEA 4EEKA 2XE8A 5HBGA 2I6FA 3SE7A 4Y6PA 3C16C 4DX5D 2C5LA 5HSGA 2FCAA 4E5KA 5EXPA 1PEAA 5I6DA 3BX1A 5A9TA 2PO5A 4CCWA 4EO9A 3DSTA 3BIJA 2Q6IA 1PV4A 2X7XA 3F3KA 4FILA 4G4IA 3PQ3A 1FTWA 4J6IA 3L7KA 1QIDA 2J3LA 1KQGA 5JLJA 3KYBA 3PFCA 3LTNC 4DLXA 3TCXB 3QAQA 2WV7A 2QV0A 3U3KA 4NCIA 3EEBA 4PYRA 1GGEA 2H2HA 4QHYA 1EFVA 4YP7A 3VR1A 4P31A 3IERA 2V7QD 2NVUA 1IWBB 4YT5A 2OK8A 2WHRA 1I4DD 4UNQA 2IX3A 1RM4A 3V2UA 1SKYE 2XA9A 7AT1A 1YBVA 3PK0A 3V7NA 4M7RA 2QTVA 1VLHA 4CMHA 4NQRA 1A82A 1US8A 1P4JA 4J9UE 2VPQA 3EF0A 2W98A 1T3TA 1HUQA 3AGQA 1QRSA 1CEYA 1HT3A 1XRQA 1C0KA 3RWOA 3EGVA 1Z5SC 2C3UA 2Q1SA 2OC4A 3G0OA 2DWQA 2WHEA 3ZU7B 1S2GA 2VOEA 2VP0A 3E22A 1KTVA 3IQGX 2FO1E 4X1IA 2WA1A 4KT6B 4ZO8A 3GOQA 1GPYA 5DX1A 4NV0A 3DTYA 2B0JA 5IEJA 3CBQA 5AJZA 2IXEA 5EYPF 4R69A 1SHTX 2VHUA 4L0CA 4M8NE 1L8AA 3HPQA 1KMNA 2GZAA 2GNOA 3APDA 2HHLA 3VTXA 2XXAB 3OPXA 5B1HA 3JZDA 3MD0A 4RVSA 4ABTA 3IMKA 3V4ZA 3DLPX 2ZI5A 2QTTA 2V4UA 4BEJA 1KNXA 1I33A 4BVHA 3IELA 2X5TA 3BQMB 4IBOA 3N8DA 1V3TA 2YWFA 3LXMA 1RZ3A 3WL6A 3E23A 2GH1A 1GV0A 3L16A 1ZXXA 2HA2A 1JFSA 2C4TA 3H2BA 5K0ZA 3DLTA 4WUVA 3FSRA 1WXDA 1W88A 1HMPA 2ZRJA 1TEVA 2WM9A 1Z5OA 3RAUA 5CLJA 4DCNA 1WXEA 2IU1A 2CV0A 3JWIA 1EZZA 3F6BX 3WNBA 1JEYB 1OC2A 1WDKA 3I0NA 3ZYMA 1FFAA 4HSEA 3VU9B 1QFXA 3KB6A 4MKGA 4C6TA 2KLBA 3I8XA 2FFHA 4RENA 4JZYA 3BWMA 5AKYA 4EB3A 1NDUA 2I7XA 3KEGA 2HADA 2DWUA 5H0IA 4FONA 4YP1A 1GIAA 2HCBA 2SCUB 2DH5A 4L7TA 3NORA 1CNMA 5M7EA 3E5HA 1VL5A 3IB6A 4I17A 4NFYA 1R64A 4AJJA 3UC5A 3GFOA 5T67A 1MAAA 1I0ZA 3MTGA 4MQFB 2XWSA 3W2HA 5F2NA 3CJQA 5AK0A 1ZUHA 3HS3A 1P2FA 4JNKA 4GWGA 3P2IA 1ZFNA 3P8ZA 1YZLA 4IFEA 1K3UB 3E30A 5EVCA 3ETDA 3MNFA 2UYHA 2YZGA 2PWAA 1HE1C 4LEUA 5COQA 1P1FA 2VJQA 3VV3A 2NP7A 3A2KA 3O8OB 2PUEA 1E3EA 3RS5A 1FDTA 2VO1A 3FNEA 3JXEA 3SFXA 4C48B 1S3FA 3ZN3A 4M0MA 3HJBA 4QGFA 3TD2A 1XNHA 2JGJA 1O95A 3OFSA 4K6GA 3FMIA 3KELA 2GPSA 2GJSA 4DRXA 4W5NA 3T3EA 2C9DA 4RQTA 1Z4QA 2MOKA 4BMXA 2CMFA 3DPIA 1NR7A 2AG5A 1THZA 5T8IA 4P9NA 3LCCA 2PG3A 5L45A 1XFDA 1NC3A 1QAMA 4MVJP 2A84A 1R3UA 1DC6A 4NFLA 1P2UA 3WGTA 3MCUA 4LJYA 1JAZA 3X1XA 2WDZA 3A4IA 1D9SA 4ND5A 2SICE 2O8BB 5L51A 4R1OA 2EBUA 1RHRA 3T8KA 5LXTF 5DNCA 4UNSA 3ZY2A 3JWPA 2FJDB 3RW9A 4F91B 1Q7BA 4RTLA 1KFBB 5J5VA 3I2KA 4XYMA 3JASA 4M4SA 2P9BA 1C0IA 4KGVA 5DGXA 1P61B 3EE6A 4LYHA 4PHFA 3ZWQA 1H4TA 4CM9D 2YWCA 4P81A 1R8QA 2ZM5A 1DGQA 1UP6A 3CW9A 2JC3A 3AY0A 4HDNB 3ENEA 1FRFS 4NP6A 4KQFA 3QVXA 1IDN1 3PWTA 4REMA 2ZYDA 4GAAA 3M6MD 3KB1A 2GB4A 5FBWB 1R3DA 4MPRA 1TTPB 1SC1A 3ASVA 5FB3A 4GKKB 4FYXA 1QHEA 2WPDA 5CDUA 2ISQA 4PFQA 3PYMA 4M36A 4FP7A 1UEIA 4BZQA 1LQUA 2HF9A 2I4RA 4I5EA 1CC1S 2Z8XA 2FPUA 2O8EA 3H1GA 3EMDA 5FI1B 4ALIA 1H6KA 3SXUB 3T7DA 4BO5A 3WNQA 3HB9A 1OLOA 3LNTA 5JHGB 1K1EA 1XZAA 3LA6A 2YFKA 5BMVF 2CV2A 3W7BA 5E3IA 4B6JA 3GLRA 3LCJA 1PR2A 1BCSB 3MCZA 4Q4HA 5KNDH 3CHRA 3C97A 2N1BA 1A95A 4S04A 1LPOA 2A9VA 2IEIA 4IDDA 4URXR 3INGA 2JIMA 3LFTA 2QPTA 1FL9A 4KO4S 2Z5LA 3W4JA 1HMYA 4UPEA 3ASFA 2R4QA 4ACBA 3GLTA 2Z56A 1HV8A 3K05A 3CZ9A 3VTFA 2Y1KA 4U39A 1AWCB 2ZT5A 3U6BA 4HQLA 3NOCD 2N75A 2P2DA 4WKCA 4ES6A 3X1MA 1AV7A 4MV5A 4XWAA 2ODWA 4MB2A 3CLJA 2GN1A 3AM4A 3GT7A 4RKFA 1C1DA 4ENSA 3W90A 2PEZA 3LAWA 3PJRA 3NAGA 2V5VA 1KRXA 3P9SA 4Q9KA 3TG8A 1CR4A 1CW2B 5IJXA 3TOZA 5BN5A 1TW2A 4FXPA 2XXJA 4D81A 1N0QA 1HE8A 1QCYA 3QYJA 3IQZA 3RRNB 2XHEA 3E81A 3LUCA 5ARDA 4JMLA 1KE2A 5EJ5A 4K5CA 4E7PA 2C2ZA 2MSDB 3R0JA 3MRXA 3A58B 1E8WA 2WK1A 2P3LA 1UBTS 2PRSA 3EVGA 1OI7A 4HNRA 2DK6A 5ENRD 4DJDC 1RLIA 2Y0BA 4CMAA 2K2WA 1DARA 1E62A 4W1SA 1CBUA 3W6NA 3VJLA 4YWHA 4P7GA 3SJZA 1YJQA 3AJRA 1M0EA 4RAQA 1BA2A 1MEJA 3KX2A 2AXQA 3SYNA 5F64A 4JVOA 3VLDA 3T7IA 3NAWA 1Q92A 3FOWA 4CL3A 3AI3A 2VDWA 1MB4A 4Y1EA 4WIAA 5PNTA 4YACA 1U3CA 2BRUC 3ZJ5A 1A2KC 3ZZTA 5JSHA 3EHNA 1XDSA 2HIMA 2HMSA 2AEMA 1GLVA 4NMLA 2R66A 1R00A 3Q41A 5AOAA 4PQGA 5DEIA 5DBOA 2UY1B 3QYPA 2XNDD 1AH2A 5KX5A 5IG2A 1C7IA 4B3FX 5SV2A 2PWZA 3TD9A 3HO1A 2BW0A 4BNHA 3HO8A 5HTKA 2KQUA 1BWQA 2COKA 3VR3D 1Y9AA 1SCKA 2Q41A 3AB3A 4AJLA 3JVEA 2F17A 4PYMA 4IQ8A 2PT7A 3X2QE 3QEMA 1KBOA 2WF6A 1L1RA 3SE0A 3UBTA 4DHWA 1C9DB 4KRYA 1K5PA 4NOMA 3ZBQA 3BWBA 5H9WA 2NSHA 1JG7A 3MFQA 4M55A 1SB8A 1VMAA 1HF3A 4KN6A 1YB6A 4YRPA 5EPEA 2ZE7A 1O96A 4QC2A 1K1AA 1IYGA 2ZJAA 1FCHA 3FDHA 3BDIA 4ZT6A 4U7JA 4P38A 1AA6A 4ZT5A 1DC5A 2JJYA 4G0YA 4JJ7A 3ST7A 2HBZA 1WU7A 3SR0A 1R4MB 3ZW7A 1B3BA 4RL6A 3FPCA 1N95A 3ESLA 4OV6B 1FLNA 4GZLA 5FWYA 2BUCA 2ZAOA 1X38A 2FJBB 2HU5A 2AZTA 1AMNA 2OG2A 2HK8A 2INGX 5BV0A 2C2WA 4AJ4A 4LWQA 1AF4A 4YAEA 4RJTA 2WUWE 2VSOE 2H5LA 5BW5A 2ZW9A 3MRSA 4ZDWA 4HDRA 1O08A 2C0LA 2R2AA 3SQWA 1FXWA 3CRMA 1R0YA 4TRNA 2W2MA 4MVXA 4EHJA 3LF1A 4HPXB 1I32A 3FMOB 4IIBA 4UBLA 3MCAA 2VP3A 1XLUA 1QG0A 2AUTA 2YRFA 4UYJB 4Z5XA 4UDOA 2ZR9A 4QXOA 2WZCA 3FUHA 3IJEB 3JTEA 4EAAA 1Z6XA 2VK4A 1UK8A 3OZDA 1ZN8A 3GEGA 5F3WB 1Q74A 2EBHX 4UM9B 5DGDA 4LPSA 3LCAA 5DEOA 1UKAA 4EPXA 4KR7A 2O5EA 1QWSA 4LMAA 1NBAA 5A6SB 1LVUA 3L07A 3DXMG 1YS2X 2GRUA 3DVSX 5JEDA 2EZ8A 4FDAA 3KYIB 3NYWA 4MUNA 4MVYA 1QJ4A 3U40A 3I4GA 4DKXA 4LZNA 1H23A 3E05A 3PGLA 5KPJA 2C7RA 3LT4A 1NW6A 3TXMA 3NHAA 4YJGA 4JJ4A 1FVFA 4D9CA 1H66A 1GRRA 2XLBA 1TVKB 1T9DA 1R0CA 3TU3B 1SPBS 2C5GA 3OJCA 1K75A 1PT5A 1XQ9A 4R41A 2FMIA 1S5PA 4WA8A 1MAVA 1JQ3A 4UHBA 5LSAA 4OGGA 5FEUA 3JD0A 1HFEL 3THXA 1RR6A 1SKYB 4QU9A 1WULS 4AU1A 1N4PA 2C95A 3WRWA 3O8RA 1K7SN 2VJCA 3HC7A 3M9XA 2X6QA 2QENA 2LWIA 5EP2A 4JX9A 5CEJA 2BSQA 3RGGA 1BYIA 5L9AA 5AVWA 2DKFA 3CF0A 3HU3A 1KC3A 5AKHA 1QMGA 1T0UA 3ETHA 4BFWA 2C1ZA 821PA 3DEKA 5JSFA 1GG5A 4OXYA 3MBKA 1FSSA 2CMKA 2CJFA 4ZYZA 3PJGA 4NCNA 4E03A 1UDBA 3U9LA 3RIYA 4YH1A 4A1OA 2PKXA 3KAEA 5ALJA 1M5UA 5HWSA 4EO7A 1PFKA 2ZWAA 4LRUA 3D5TA 1PT6A 3CNEA 3ET4A 3NNDA 4PAOA 5KOYA 4GC5A 3C5EA 5GVSA 4XWWA 1Y8ZA 3GN2A 5D1HA 1C9EA 3ETJA 5IAJA 3OZXA 3KT6A 3OZCA 4I55A 2E1RA 4JT9A 5AM3A 5F9FA 4Y1GA 1T2FA 2L18A 4NEGA 4ZJYA 4M7CA 3BORA 4FIZA 1SQGA 1ZCZA 2FTKE 3U44A 2OHHA 5ES3A 3GA0A 4E51A 4BNZA 3D54D 1KJ8A 1CJUC 1U3GA 1PEYA 2HHCA 1ODJA 2CG2A 3SZ7A 1V9CA 2CD9A 3A4NA 3IODA 1GNSA 4ZD6A 4M9XA 3ZIAD 1K2WA 3HGTA 3OMXA 1B8PA 4O02B 4UW9A 4EYQA 4FLHA 3OCJA 2HSDA 1GG9A 5D3QA 4PR3A 4WWHA 4EG4A 2IF0A 1GNRA 4ZVPA 1NVKA 3FU0A 2L6JA 1RPAA 2D5LA 5EJGA 3HLKA 3JU3A 1W2WB 4UTRA 3X3HA 1HSZA 3HU2A 3MOSA 4TTVA 1E3IA 2WSIA 4NU6A 3UGJA 4QIHA 2JLSA 5CXSA 1Q77A 3N3BC 4U1RA 4WW0A 2CVQA 4M22A 4CGVA 3S28A 1KO1A 3V1LA 1SKQA 3K1JA 5MGNA 3NCHA 5LP6B 3BJIC 5K8LA 3T7CA 3N2ZB 1UM8A 1L4YA 4QREA 5E9QA 3TDMA 1ZIDA 4D3ZA 3K53A 1SA0B 1K9SA 2XWQA 5LDDC 2EVWX 2AA3A 4L07A 1P2DA 4I66A 2Q0HA 2AYXA 1EGMB 1QTNA 2OZVA 4PSKA 2GVNA 3FHTA 2VNKA 3NVKI 5LQRA 2N0SA 3GZ1A 1SUWA 3HVHA 4PFKA 1T2EA 4A91A 1VIYA 1QZUA 3U3RA 5GADl 2FKNA 3B2QA 5KJLA 3FW1A 1AKTA 3ZNPA 4KAJA 5KBYA 4MHTA 3TL6A 4CIAA 2E6UX 5CVTA 1CUCA 2BY4A 2ID9A 4DIFA 1D0VA 2QZ4A 1U7ZA 1Q16A 4HAOA 4BVJA 4G9EA 3FTNA 4IWNA 5HILA 3DZHA 2GHIA 1PAUA 1IN4A 2V7WA 3DEYX 1VG8A 2HIAA 3UKJA 1F4PA 3N9IA 2A59A 3ZWKA 2MSCB 3VFDA 4OXRA 3HFGA 3Q10A 1Y7TA 1RKUA 3AP2A 5KMGB 1L7OA 3ZY5A 3QUAA 4XOUA 3KV1A 1XOIA 3OT4A 4BFYA 2IIPA 5CLFA 3SS8A 1G20E 3VHQA 2QN7A 3NM6B 1ML3A 3HBMA 4U2BA 4RW0A 4GPMA 4GG1A 4HXFB 1P5FA 4F85A 5FOUA 4GXQA 4J0DA 1EK2A 1X7ZA 2VJDA 1TJ4A 5K09A 4MS4B 4EA9A 3D8SA 4G23A 4PZUA 2G0NA 3H2JA 2V5FA 4G0VA 3U3OA 1QX3A 2CSUA 1JDTA 1VYVA 2ANCA 3ZWOA 2ANBA 1FVXA 4J0GA 1WWKA 1TZJA 3IHTA 2V7GA 1E9CA 4P5DA 2I2DA 4LRQA 1Z4LA 1QAOA 3F6QA 2PN1A 4GBED 4G86A 3Q5DA 3H2GA 2WTUA 1ZRMA 2B82A 2EBWA 1CHNA 2XNKA 1T4CA 3U3XA 4P86A 2OD7A 4UNNA 4CLOA 2PRYA 1B15A 1V5GA 1QLHA 4X3CA 3E03A 2VRNA 3GLHA 4TS4A 2J30A 1JXMA 3L04A 3U4CA 2X23A 5FA8A 1FMFA 3VVMA 1XTJA 1AIPA 3SX0A 3TEFA 3Q3JB 4J16C 5A4KA 5KYXB 4P08A 3MKQB 4R31A 2F3SA 1ND6A 1I1OA 3MSCA 3KQUA 3HY4A 1EDDA 2AXVA 3L4SO 4KWEA 1TZ2A 2PZIA 4IIDA 4P92A 4W5WA 1V16A 1N2SA 4CCYA 5K4GA 2PWPA 2J9QA 1AGNA 2P8SA 2WZDA 1O9BA 1YQEA 1G21A 4TLAA 2PD6A 4CYMA 1KEEB 2VTVA 4A1FA 5KNHD 3VU8A 4YRBA 5F2KA 2ZS9A 5JPCA 2YCBA 5ISMA 4CTMA 2DE0X 4A3SA 1G8GA 3U4IA 1X7WB 1JZSA 3KZXA 2AVDA 1LTQA 4FDVA 3C3BA 5IYZA 1IOWA 3IV7A 3R6TA 2FXVA 1KZYC 3NWOA 3IT0A 4QDOA 5GIPE 4J7WA 3CRQA 7REQA 4JLAA 3L0BA 3T1VA 2GBCA 1T9GR 3C3KA 5LZ5A 1XMOB 4YYZA 2XD9A 4UBNA 1ZUNB 2F1HA 1YD7A 3S2UA 2VT2A 5I51A 3U0VA 1EYZA 1NUQA 4PAMA 5BORA 2I33A 1O87A 4WOBA 1Z6GA 3CLKA 3D6JA 5DISB 4RTKA 3CUYA 1ODIA 4YDWA 5TS3A 3FLAA 2ZTMA 5JI2E 3F8WA 1S2IA 1XJ5A 4RF5A 1UP4A 1SWWA 1X0XA 3TTYA 5ITWA 4YUYA 1RJDA 5GWXA 2HKIA 3EBLA 4R8RA 3U7IA 1JN0A 3HXCA 3ZW3A 3EXHC 1A9QA 2ZQYA 5EHIA 2Z3WA 1C7ZA 3F98A 3NQ41 4Z4GA 4EF6A 3EZ7A 4PHTA 5F4ZA 3ZNNA 3VGPA 2Q9BA 3MTAA 4BO6A 3EBOA 3I04M 3D6NB 4AKIA 4BZXA 1A5AB 3PR2B 4BGIA 2VATA 5G05C 1MHPA 1G5HA 1Z6YA 2V5UA 5FHRA 3R6GA 3PHGA 3EZXA 3KZKA 4ZK6A 3PKZA 1UZAA 3BWXA 1P17A 1LKZA 2ETXA 4DCPA 1BHJA 4B94A 5EUCA 2DYSE 2W9XA 1QMPA 5ALYA 1Y37A 5BR8B 2Y8EA 4UMFA 3CHYA 1BE8A 2ZTSA 1P74A 1HK7A 3QFHA 2YXPX 1FRQA 1ZVJA 1Z2CA 2SKEA 3DV0A 1HEIA 3SM9A 1KZGB 3I61A 2FPIA 4HOTA 2GF9A 5CITA 1PJQA 2W2KB 1YASA 4CN8A 2BLNA 4M1YA 4CTNA 2YV3A 4R6WA 3LOUA 1ZAKA 5J47A 5DM0A 3F2IA 1EYHA 5B7QA 5TQ2B 4OYSA 3ZCTA 1FSZA 4GM1A 1CQXA 3GGCA 2OCLA 2JJ2A 3EUWA 1H2HA 2PXXA 3IC5A 1A97A 5CPBA 5CFPA 1IDOA 5WRFA 1Q1BA 3A05A 2GETA 1F8GA 2ONCA 1EE9A 1XRRA 1C0PA 2DFKB 2J87A 1T9GS 2XF8A 2F3QA 1IVYA 1H4VB 2R8OA 4V3BA 3L49A 3V2GA 1XL0A 4M8IA 4RDHA 4C0JA 5KUTA 3H16A 2M32A 4B6OA 2Q6VA 4I46A 3SEZA 1EFPB 2EWWA 3U31A 4D4GA 1OE0A 4BKMA 5JVDF 2P58C 4RSYA 5CB8A 3O93A 1L5HB 1KSGA 1JH9A 5NLLA 3BFPA 1K8RA 5EKTA 3JYHA 3WB2A 1Q12A 3G0DA 3LSYA 2DFTA 3OJWA 1QKIA 5KC8A 1KAMA 4CKYA 5EWLA 5ANRA 4NENB 3SZGA 1YMPA 2HW8A 1OGYA 4DWWA 1K8XB 2FPOA 5JS2A 1WR8A 1MBZA 3TLMA 1R50A 3OM0A 1TIPA 3F6EX 4N03A 1EX7A 4UU8A 5DK4A 3VKVA 4N5CA 2RGCA 4LXQA 5IF3A 5C8ZA 4BFXA 3H0KA 1DXHA 3SGHA 4LTNA 1ZM2A 1M34E 3DSSA 2AG0A 2HLHA 2IYAA 2ZWIA 3KJXA 3PDIA 1CUBA 4MKRA 2V7PA 5D3ZA 1DIRA 2RI0A 5KQSA 4EG8A 3D3WA 2IWRA 3IT1A 1H4QA 1DIGA 4DY4A 5LQAA 1DWPA 5KJMA 4DIEA 4RPLA 5F1KA 4AKEA 4UD6A 3RASA 1JCQA 3K0FA 5EI5A 1VKZA 3GMDA 1GSAA 2VRWA 4FR0A 2P4QA 2FPWA 4B4VA 2ZU6A 1FUEA 2OKGA 2PR7A 5H7PA 1Q50A 1AN0A 3VKGA 3D9KA 3C74A 1OBCA 4KVOA 2OYCA 5LLSA 1M0SA 3I1JA 4QVGA 1KWGA 1VKOA 4JEIA 1ZESA 3P4XA 4MJLA 5JR3A 2FPLA 3FEXA 1GARA 1XMIA 3R20A 3GPCA 5KSZA 2J31A 1MJ5A 3CKCA 4ND8B 4NARA 3B6IA 4GSYA 2PQ6A 1BKYA 1N9KA 2YWJA 4NU8X 1QM5A 3LZCA 5JFOA 2I0FA 2VYIA 5A5VA 5A7FA 3ZWYA 1XD8A 4CF3A 5CA1B 2PLAA 3TSCA 1R0XA 2XCQA 1JUDA 3MPUA 4TRRA 1IBLB 1N36B 4C7OB 3O1IC 4Y2PA 4LJ7A 3DBSA 1U8FO 2R1ZA 1K27A 3R0QA 2Q4EA 4O4LB 3VKUA 3IIIA 4IWYA 1LNZA 4JL6A 4KRFA 5C1IA 1UAGA 3I4FA 3PTLA 3P0RA 2GN8A 3K09A 5J2UA 2W0MA 1EM8A 5KKAA 4K9LA 3GWGA 4AB1A 1X15A 4FM9A 5JJ5A 1O94D 3U7RA 1JFTA 4HMOA 5U1PA 3KQKA 4JJAA 1HZJA 2IV3A 1Q2ZA 2R6FA 1FYVA 3SK1A 4ZICA 1WMSA 3AEQA 4UWGA 4E85A 2E48A 3DTNA 4HAWA 2VF8A 3Q2IA 3M89A 3O9VA 4RPGA 4HUTA 2ZJYA 4ONEA 4MMYB 1SZ9A 2P9UG 1E6KA 2OORC 2MRIA 2UZAA 3NYQA 3PCTA 5KZMB 1EDBA 4RSGA 5KEIA 1ORWA 5T8KA 4JUBA 4K7JA 3IVAA 5C46F 3B5EA 1RTTA 5CDHA 1HYGA 1JE0A 5HX7A 3DE0X 3CVXA 3ZU3A 3MWDB 4D10C 3CRZA 5JT1A 3TLCA 1VE1A 3DBIA 2PGJA 3C5VA 3VR5H 1L4MA 1H05A 1WQ4A 2X3FA 2KJZA 2B7BA 1KT0A 1QRDA 4A9AA 3R7WB 4RA9B 1U2QA 3O7WA 3OT5A 3MQFA 3FX2A 1GYRA 4WNGA 3ASOE 3SEAA 2IBSA 4B2IA 5TPWA 4FD3A 2GEJA 1M2JA 3K9FC 5EPUA 3IE0A 1DE0A 5JW6A 1O5MA 2X5HA 3R8CA 2P67A 3QPBA 1ZD5A 3BD7A 2VSQA 1DPFA 1D7OA 1GKKA 3TWQA 4JHXA 5SY9A 2WVHA 3D7LA 1JMYA 4YQFA 3BREA 4B46A 3EK2A 3JALA 2PZKA 2C9ZA 3IBYA 3A25A 4MYSA 3ZIUA 2VF4X 2CVFA 3FM9A 2CNNA 2JCVA 3DMTC 2RB5A 3ZXUB 4YXWA 1KRWA 4N48A 2ZSAA 5TE9A 4FZJA 4OL9A 3R8FA 2VGXB 4BKRA 3G5TA 4NBUA 3E18A 3OTIA 1O5OA 4BY9E 3ND6A 5HNKA 3AETB 2OOEA 1XT6A 1UBNA 2AD1A 5AARA 2HTEA 5CA0B 1Y1RA 5B7GA 2GBLC 4TVSA 3MM4A 1HURA 5DYIA 2GLXA 2WAAA 1I6LA 1TTTA 3FUXA 3GU3A 3JQBC 2A0KA 2JGRA 3WL4A 1PJAA 1WU8A 3CRRA 3DDWA 4QJBA 5ICSA 4LOKA 2QL5A 4UQZA 3BEDA 1LS6A 1A8PA 1V4VA 4BIIA 3IP3A 3I3SR 3H1FA 3TXAA 1B43A 4Y30A 1F2UB 1NI3A 3IXMA 3K30A 1NLMA 4IOLA 5HCIA 3WGVA 1PNOA 3MF4A 5I5EA 3AUXA 3CEHA 1W3BA 2RARA 5TJ9A 3QVUA 4CEIB 3WTBA 4P5EA 5LDHA 3O4ZA 5I9SA 2HN9A 4YMIA 1D2EA 3EFHA 1YZVA 4UUNA 5A7GA 1QUEA 1G20B 3R3XA 1L8QA 1YJ8A 4YNBA 3I05A 1T15A 4PSUA 4U2CA 4YCJA 1T43A 4KWHA 4KREA 3CTPA 3AIIA 1TFUA 2OLEA 3A3PA 1OT3A 4QM7A 5JZBA 3TX2A 2ZIZA 1TB4A 1J0DA 3CV0A 4M46A 7ABPA 3CEQA 3VMFA 4LSWA 2QN3A 1Z0DA 2GCOA 3OE1A 4YV1A 5A5EA 1FFGA 2AMVA 4XEHA 2VAWA 3EH1A 2YCLA 4Q1DA 3JY6A 1ZUIA 3O2NA 4C4RA 3RRBA 2CL7X 2QTBA 5FPPA 5E1DA 4B2PA 2PUGA 3U1VA 3KUXA 3OT1B 2R9VA 4O08A 2RHRA 1YVPA 2PUCA 3OZFA 4ITVA 5JNWA 4KIUA 3DL2A 1X81A 2ADMA 4LUCA 4BFLA 5EHQA 2FB9A 3GA7A 2LDBA 4IV8A 4Y0NA 3UAYA 1GQOA 2JNWA 4BQEA 4A26A 3T7JA 2XYGA 3OLZA 2WP8J 5EMJA 3O8NA 4IH4A 2E6KA 1NQXA 1M6EX 4KHPB 2CLEB 1LPNA 5EILA 4O4IA 2XAAA 2ZYWX 5BW6B 1TMGE 3IKOB 3DSUA 4CMGA 1R0ZA 2PD4A 5CT8A 4PZ9A 3V4OA 3OPQA 1LPAB 5C18A 2H4JA 1I6WA 4JUDX 5CTAA 2G7MC 1G66A 5IDYA 1PD0A 3ZI0A 2QY7A 1NQVA 3TAUA 4URFA 3HB5X 1CUUA 3U5TA 4L5IA 3IMFA 3W5VA 1NWHA 3F7MA 4MEJA 1P7ZA 2CL6X 4PRLA 8GPBA 1R74A 4I3HA 5CVVA 1AXGA 1VSQA 5IAGA 1JBQA 5DM4A 2CYAA 1DP4A 3M82A 1ZNZA 3QPCA 4Z9XA 3G9XA 2P30A 4UWFA 2BM8A 5CFZA 3M8KA 3UFXA 3AY7A 4GMKA 4EHIA 2B8TA 3GB9A 3ASGA 5JNTA 4YDYA 5EN5D 3UMBA 2UZ1A 5EIHA 4HWKA 3MWFA 1E3SA 4CRWA 1EBBA 3IV9A 3L8HA 4FS8A 2B1GA 3V9AA 3UOGA 1A8HA 4KQMA 3DWEX 1Z3XA 4BBAA 1B6TA 4RAOA 2OBYA 3C7CB 1S3IA 2WHXA 3B1VA 1C3EA 2QRNA 2XNSA 4CKEB 4OP2A 1NLUA 5C32A 1IUOA 1WIWA 3VH1A 4LMPA 4F21A 1DWQA 4HPJB 1QIMA 3GH1A 1URPA 1E7VA 4HGYA 3VHXB 1LRJA 4C6SA 1R9JA 4YRMA 2ZXFA 1RJFA 4D2IA 4D79A 3BC1A 3ICWA 3H13A 3CIOA 5C81A 1QVZA 3PQEA 3T8YA 2P9LG 3E58A 3EPRA 3QBJA 1KZOA 3IAXA 3CH7A 3OM9A 1XN1A 3I9V1 1M1NB 2QXUA 5HUHA 4RTRA 3E8SA 2QG9A 5TARA 2J45A 1SG6A 4URVR 1CZKA 3EGDA 1ILEA 1WB6A 1WF3A 5EIWA 4QULA 3RD5A 4J0IA 2IYQA 2TECE 1PW7A 2Q1YA 5CU7A 3CVLA 4QYIB 1UPBA 5ENPD 3RGWS 2FPPA 1ZGJA 4JENA 1WUHS 3EAGA 3OZWA 3K1TA 3Q1KA 4KQHA 3L82A 1WPRA 5TVKA 3C85A 4PYOA 3RAEC 3PYXA 5ER6A 2V59A 4U2GA 3C5HA 1EA7A 1I5RA 2GZRA 4YAFA 4PLTA 3LDAA 2Y99A 3QK0A 1T1EA 2A33A 1W5BA 4PWZA 3G8AA 2A5LA 1EAMA 2AMFA 4FB4A 1YUBA 4LCTA 1QK4A 1USUA 2XH8A 2A3NA 3R9XA 3OY7A 3JCZA 2ZSUA 3TL2A 3BMQA 3Q8WA 4MWTA 1ZQ1A 1GQSA 1PHRA 5LP6F 3AKCA 1QTRA 1K9VF 1XYYA 3EYAA 2CXQA 2FOXA 1W5EA 3NTLA 3V2OA 1ESCA 4HS2A 1FLAA 1WAMA 1RWBA 3BQNB 3KLBA 1Q5PA 1HM5A 5DTQA 5I47A 1JDBB 1I4OA 3H5NA 3ZOKA 4PAGA 3S2EA 2ZTHA 4FC8A 3MTIA 3DFMA 5HUQA 5IMSA 4DA8A 3A6EA 4MWDA 4UZSA 4L23A 4K5AB 2PANA 4HDKB 1D2HA 3OP4A 5FJJA 1U8YA 2PM6A 3NEJA 4RDIA 1U1IA 5JAPA 2PH5A 2FEOA 1M5RA 2CDBA 2HXGA 3H5WA 5IK2A 3AYXB 4RA6A 4MB6A 4IGEA 4U9HS 4L15A 1YZYA 2FE4A 1CTQA 4ZJUA 1M34B 1W6RA 3G89A 3HVIA 3VA7A 4YRZA 4U07A 3LRXA 1N4QA 1E3DA 4QX6A 2DHQA 2HRBA 5B6PA 3ZHEA 2RFMA 5LXTA 5FI0B 2PX0A 3EARA 1VHQA 4FUQA 4PIMA 3A9SA 1NOIA 4GA1A 1GZHB 4TLDA 4HAXA 4ZXFA 1PZGA 4Q1CA 1H2FA 2QT0A 3JD1A 2A4KA 2G36A 3BXGA 4P58A 3RTGA 2GKSA 5BWLA 1R0LA 2GQ0A 5JY1A 2FMXA 4O0LA 3MEQA 1XKQA 1MENA 1ZXBA 3V9PA 4OX9B 4I1SA 3GNSA 4DA6A 1OLUB 1T1IA 1UJCA 2JDID 2AW3A 1IZYA 1GKYA 2D3WA 4IOMA 3PJDA 3I9LA 1LFDB 1VM6A 1XZMA 3QWVA 4R71A 2J9YB 4G1FA 2IZ0A 2QDXA 3CEJA 3SZLA 1P4HA 2O7QA