4N39A

Crystal structure of human o-glcnac transferase bound to a peptide from hcf-1 pro-repeat 2 (11-26)
Total Genus 283
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
283
sequence length
716
structure length
697
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/substrate
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title HCF-1 is cleaved in the active site of O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 283
structure length 697
sequence length 716
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n39A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n39A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4n39A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4n39A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n39A03
2QN7A 2F3QA 3RHZA 4WADA 4J8FA 1KTIA 5KJMA 1M5RA 3L7BA 4AMGA 4YUAA 5LCWC 1XL1A 2QFCA 4BFCA 3MS4A 2QN9A 1VGVA 4MRAA 4APOA 3FROA 1WUYA 4KYOB 3SZ7A 4JHRA 1NA0A 3U4TA 3MTBA 3L7AA 2BISA 4AIFA 4M83A 4LEUA 4G26A 4H7XA 2P6PA 2R4UA 4EJ2A 1IYGA 1FA9A 4YVQC 3EDTB 4Y6CA 1E96B 3CUWA 1ELWA 2HY7A 4W6QA 5KJKA 3QKWA 1K06A 3G2NA 3ULQA 2WPVA 1P29A 1C3JA 3ZCUA 2IYAA 1QZ2A 4KXKB 2AZDA 3MRVA 1ZBPA 2HYZA 2E2EA 5HXAA 3T5TA 3C4QA 2AMVA 1JG6A 5EX3A 4UI9J 2X6RA 3C4VA 4MHOA 4U0UA 2KCVA 2LSVA 1XL0A 3GZ1A 3SYMA 2L6JA 3CEJA 4AMBA 1UQTA 1Y8MA 2OFFA 5JJTA 1NLMA 2QRQA 1L5SA 1WV1A 2IEGA 2QN8A 1GPYA 3LY9A 3TOVA 4EKYA 4MICA 3ZCTA 3UYKA 2KS6A 2C4MA 5TMDA 3T3DA 4HWGA 1FU4A 4F9FA 2DBAA 4G2VA 4HOUA 2GJ4A 3T3IA 2F3UA 4RIIA 3CK9A 2ATIA 4UQXA 3MT9A 3U3WA 4HORA 2AVPA 3QOUA 2XGSA 3O48A 5TMEA 1F0KA 2R4TA 3Q3EA 4YI3A 4A1SA 4H7YA 2PRJA 2GPNA 3T3HA 4XI0A 2H1FA 4NC9A 1OUVA 1FCHA 3WXXA 3K9IA 4L22A 3RU0A 2GM9A 1IIRA 2XEVA 4MI3A 4U04A 4KQMA 2FF4A 7GPBA 2G9UA 4REMA 4QLBA 2ONDA 4I17A 1RZUA 4N2QA 4CDRA 3PE3A 1RRVA 3ZCPA 4G24A 4JA7A 2SKEA 2GPBA 3OKAA 2IV3A 1C8LA 3DDWA 2SKDA 1B89A 1L5VA 4GYYA 4G25A 3ZN3A 1P5QA 1GFZA 3VUFA 5GPBA 2F3SA 1H5UA 3TG5A 4GYOA 2VSYA 2C9ZA 4I1AA 3JYSA 3UPVA 3S7DA 3EBPA 5TVGA 2G9QA 1WAO1 2IFUA 5C1DA 1NA3A 3HBNA 3WAGA 4F96A 3RT1A 1P4HA 4XIFA 3CKCA 4N5CA 2IYFA 3CEQA 3GUHA 4RELA 4J0UA 3BCRA 2X6QA 5EX0A 3E3NA 3CUVA 2KC7A 1Z6QA 3SF4A 3RSCA 3CK7A 2PYDA 3NP9A 4J8EA 1L6IA 1JEJA 1NOKA 1P4GA 2XPIA 2QZSA 3LPZA 4NEQA 4EL0A 1TJCA 3R9AB 4MHSA 3UQ3A 5LCWJ 2J9QA 4O6FA 3RSZA 4GZ5A 2I6HA 4I2WA 2MHKA 2IF4A 3ESKA 5FZQA 3QKYA 3GPBA 1FTQA 2Y4TA 3ASHA 4WNGA 2ASVA 2GEJA 1QQEA 3G2IA 4GCOA 4J8DA 3O3CA 2QRMA 2C1XA 3CVLA 5G04C 3AS8A 1WV0A 1XOIA 5DBKA 1P2DA 2QRHA 4WNFA 3QWWA 2QLMA 1WM5A 3MBOA 3VUEA 3S7BA 5BT1A 2QLNA 4CGVA 5D00A 3S7FA 2QN1A 2BGUA 4GZ6A 3RIBA 1XC7A 2OOEA 4GA2A 1WUTA 3BDAA 4IN3B 3NC4A 3S7JA 3GZ2A 1Z62A 1PSWA 2R60A 2WTXA 1F6DA 3CEMA 5CCLA 2BUGA 3LYAA 3ZCSA 3S29A 2VSNA 4HOTA 5G05C 2X0DA 4WUYA 3OKPA 2HO1A 3BD8A 3Q5MA 1QKJA 1HZ4A 3LKUA 1ZU2A 3ZHEB 2P58C 4AY6A 5TMBA 1GPAA 4FZRA 4N39A 3T3GA 2YHCA 3MS7A 1PN3A 1Y6GA 1JG7A 3OY2A 3CEHA 4JA9A 1K08A 5IKOA 2XGMA 3G2JA 1KT1A 3HYMB 2QNBA 2QN2A 4N9WA 2KCLA 2C1ZA 4X7MA 5JTUA 5I45A 1NZNA 3OXFA 3ZCQA 4BTAA 3S28A 1Z6PA 2R66A 2XA9A 2GPAA 3N71A 4CTOA 1C50A 3VDNB 1UQUA 1C8KA 3QWVA 3T7DA 3L79A 4Z5XA 2ECPA 4UQYA 1YGPA 5JTTA 5FT9A 1Y6FA 3E3OA 3NAZA 4KQ1A 4U0ZA 3CUYA 2AW3A 4BWRA 3H4IA 4MI9A 1V4VA 3MT7A 5A7DB 3TSAA 5BNWA 2WQHA 3RO3A 1NOIA 3E3LA 4BQIA 4UI9K 4G23A 3G2KA 4G2TA 3SYRA 2XCUA 3L7DA 3Q47B 1FC0A 9GPBA 2LNIA 1E4OA 2AV6A 2Q6VA 3T3EA 1IHGA 4HLNA 3H4TA 4N3BA 1Z8DA 2FFRA 2FI7A 1P2GA 3ASDA 4HOQA 1JIUA 1IXYA 3RO2A 1XKXA 3QDNA 2PL2A 3FP3A 5D0OD 5EKQD 1JIXA 4NQ0A 4BQFA 4NESA 2VG8A 1HLFA 3KAEA 2QLLA 4X7PA 1AHPA 3D0RA 4F3VA 2PZIA 1P2BA 3BEOA 3LY7A 4AY5A 1A17A 2BFWA 2SKCA 3MV2B 4N3AA 2R5SA 3CX4A 2IEIA 4YVOA 3Q4AB 2FBNA 2XMPA 2NC9A 3VTYA 2QRGA 2FETA 3OTIA 4RIFA 3CVPA 3NPAA 3MT8A 2GEKA 4N2SA 2FF5A 2JJMA 1B4DA 3Q3IA 2ZB2A 5DXFA 3WADA 2BGTA 1Y8ZA 2PQ6A 1KLXA 4RBNA 2LSUA 3GW4A 5FZSA 3HBMA 3ASFA 2IUYA 3OTHA 5IKPA 5AYWD 1E1YA 2O6LA 2G9RA 5HI7A 3L01A 1YA6A 5KJNA 2H1HA 3BEEA 3AS4A 4WHMA 4U0SA 5G04J 4LEIA 3EBOA 1GZ5A 2HR2A 2FO7A 3IAAA 3AS5A 5CHEE 2UY1A 4GZ3A 2C0MA 6GPBA 4RIEA 2JLBA 1RZVA 1SXPA 3CKBA 2KATA 8GPBA 4BT8A 2XCCA 1FU8A 3LCAA 4G1TA 3VTXA 3FFLA 3ZHEA 1WW3A 3CV0A 4ABNA 5D0QD 4CTNA 2X0FA 3URZA 3NP7A 4KBQA 3MKRA 4RIHA 4BQEA 1HH8A 3MQFA 4EQFA 4GYWA 3PE4A 1WW2A 5D01A 3MRXA 2VYIA 1KT0A 4ME2A 2ACWA 2VCHA 2XA2A 4X6LA 5G05J 2UY1B 1FS4A 3TAXA 2XA1A 1L5WA 3E4BA 1FTWA 1P4JA 2Q7FA 4JL0A 1LWNA 5ENZA 3OXLA 3CVNA 4I2ZA 2KCKA 5LQDA 3Q15A 4XI9A 3ZCVA 1EXVA 5ARGA 3VDMA 5ARFA 4EKEA 3UUXA 3C48A 2FEZA 3DDSA 3KD7A 1L5QA 2GT1A 1L7XA 3S0JA 4WACA 1FTYA 3NCHA 2JZCA 3RKVA 3BCUA 5JJ7A 3LY8A 2Y4UA 5CCMA 4M60A 4Y6WA 1BX3A 1GPBA 1NZDA 3NB0A 4RIGA 3S27A 4UI9C 5FTPA 2QRPA 5JJ6A 1HXIA 3OY7A 2UWJG 3G2HA 4AM9A 1XV5A 1J39A 3DD1A 4GCNA 1YA0A 3Q49B 1W3BA 1L5RA 4X7RA 2VCEA 4YI5A 4RENA 4BTBA 5A6CA 3UYLA 2IV7A 3KS2A 2VGYA 4NRHB 4YNDA 4RG6A 5BW8C 4FKZA 3D1JA 3D0QA 1NOJA 3TGOA 3ASGA 4BT9A 3S2UA 2YQ8A 3OT5A 3HBFA 4PQGA 3WC4A 3AMVA 3FWVA 2X0EA 5DU2A 1UZUA 1EM6A 3MEKA 2PYIA 4AN4A 1ABBA 2QN3A 3BD6A 2F3PA 3ZFWA 1FU7A 3QWPA 4HOSA 2ACVA 3CVQA 2G9VA 3TG4A 4M7PA 4F97A 3COPA 3PDNA 1SXQA 4I9EA 2PRIA 2PQNA 2R68A 5FJYA 3IEGA 1NVKA 1PYGA 2XGOA 2C2LA 3L7CA 2XCIA 3MSCA 3ZCRA 1PNVA 2V5FA 3CK8A 1GGNA 4B94A 4WNEA 4CTMA 4GPKA 3GYZA 3MRTA 3HBJA 2YJNA 3Q3HA 3CUTA 3OTGA 1PC2A 4GA1A 4GA0A 2VGXA 3OXGA 3CUUA 5DIZA 3MA5A 1NZFA 3MTDA 5M72A 4EL5A 4RG9A 4KQ2A 1XNFA 4N3CA 5HQ8A 3OKCA 4GPBA 1A8IA 5FZRA 4LDPA 3DZCA 4UQZA 3BCSA 4U07A 3RJVA 1O6CA 4W9RA 1ELRA 1QM5A 3MTAA 1GG8A 3QHPA 2PQRA 3ZPJA 1LWOA 1JIVA 1AXRA 3G2LA 3IA7A 2IW1A 2C0LA 3NF1A 3CV3A 2XCBA 4CGWA 2VGXB 4WNDA 2VQ2A 5KJLA 2F9FA 3ZGQA 3MS2A 3BD7A 4MI6A 4I9CA 3MV3B 5DLDA 2GW1A
chains in the Genus database with same CATH superfamily
3DEPA 2W6ID 2XYGA 4ARBA 3A2MA 1ULTA 1XL1A 4IIXA 2A4ZA 5JHBA 3SQDA 1DLIA 3AVYA 3K9LA 1JA0A 2IY9A 2J3IA 4R68A 1M54A 3EB9A 4M0UA 5I7SA 2BAGA 5IKEA 5K8CA 3W5CA 2ECQA 1QF9A 5IJAA 1ZBPA 4FHFA 2WHPA 3I2KA 1D7AA 3TLZA 3BCHA 4BKUA 1B6SA 3P26A 4X1IB 5JFTA 3AZPA 3EUFA 4G4GA 1XROA 2C99A 3Q8KA 3VAYA 2C31A 4KXLA 3U60B 5M5BA 5IVDA 3UFBA 4QT4A 2ATIA 1N4SA 3SGLA 2WQ6A 4ZVTA 4R1OA 4A1SA 1U3DA 2GM4A 1E1CB 2BEUB 1FCHA 3AIIA 1BDJA 5D3QA 2PQ2A 3EIQC 5J4LA 4LHXA 3C72A 4KRGA 4HN2A 1A5TA 3H2SA 4QNMA 1YB1A 4G25A 2O8FB 3DEFA 1PJZA 5DISB 1U8EA 1WAO1 1CCWA 1JU3A 3K0CA 3SNKA 4UXJA 3ROTA 2HADA 3E03A 3W3AD 2O7QA 3CWCA 4M0CA 3BTVA 4GWLA 3GEDA 1SVLA 1IQPA 1WKBA 3GJZA 2FWMX 4ARZB 4PWZA 1QQEA 3EXHC 5LOVA 1Q7BA 1W73A 1DAIA 4UZFA 4CQJA 3ROFA 1IOVA 2PGNA 3LDUA 3RIBA 4UE6A 5HIAA 5LIRA 3PIIA 3PCXA 1R0LA 3PC3A 1MF7A 3KOUA 3HMQA 4ESVA 1RCFA 2FMFA 3S29A 5DYYA 3E7FA 2CEAA 1UZAA 4BWGA 3X44A 3QJGA 4NR0A 3UAWA 1COZA 2VTVA 4QM7A 3HJHA 4D4JA 1UMBA 2VJCA 2AD1A 1L7RA 3T1YB 1JFFA 4KC0A 3ZGOA 1YJQA 1N8TA 1TZKA 4BWVA 3CX3A 2NSLA 5I9BA 3NBQA 4H0FA 4E0BA 4PAMA 4IHJF 3GZTB 3U7JA 3DNFA 3JRNA 4KYIB 2PT5A 1JHXA 2Q4DA 5AKHA 4I7EA 3NORA 3U0BA 4M99A 4LMPA 3F9RA 1E59A 1Y5IA 4KP7A 5EINA 4JCCA 4F53A 2XT9A 1G2OA 1B4DA 4CIBA 3QVSA 1QYMA 4QBIA 5HVNA 4ECEA 3RWBA 2H16A 1L1QA 1T8TA 4I4IA 4FA6A 1G3NB 1YA6A 4ISBA 1Z37A 3I01M 3ME5A 1KEVA 2VHUA 3WG9A 3R75A 2B98A 3GLIA 5TIIA 2MSDB 5EGSA 1W85B 1LD8A 1NY5A 4QJBA 4WUVA 4JL0A 2OGSA 5ERGB 4MKRA 1NUTA 3EOBI 3JD4A 1UJ2A 2GM5A 4UU1A 4G8JA 4HQLA 2EINE 5TF0A 4EO7A 1X2EA 2HSWA 3BDVA 3LTNC 4AIRA 3S1AA 4RVCA 1J6UA 1IONA 1TYDE 3HY3A 3AM3A 4XQCA 3D54D 1IZ9A 4JUAA 4Q9HA 3DF9A 4BJ6A 1RYHA 2IONA 2Z30A 5TJHA 3N7UA 5DFAA 5EILA 2PBZA 4L1KA 1CYDA 3HJCA 3IO3A 1E3LA 2V0PA 1NC3A 5FWXA 1IN7A 3SLRA 4B4UA 4MKHA 3KEQA 3CKLA 2QT1A 2IW1A 3O75A 2F9FA 3W04A 3X0DA 4ENPA 2CFTA 5AHXA 2OD2A 4XFJA 4PAGA 2MHCA 3K1AB 3D02A 1TL7C 4J6FA 1F12A 3LC1O 5JAHA 2HO4A 2FFGA 3D2CA 4B6JA 3KZMA 3CVJA 2A9KA 4BE4A 3FTSA 3FUDA 2GA9A 1XZIA 2J3LA 3FOAA 1XNQB 1G3RA 1KDOA 4UTZA 3MJSA 3UCEA 1Z7EA 3UB2A 2VF4X 3KFVA 1TKAA 3HLYA 3IERA 3JVEA 1PFVA 4MQMA 3DMTC 4DDKA 1YRHA 4Q47A 2JA2A 3H9QA 2H6GA 1T1GA 2YQZA 1G8FA 5ESRA 3GV0A 2PMKA 4AJLA 4QHYA 1Z4JA 3AU4A 4E70A 3IIKA 4EBAA 4BP3A 4EB3A 5FPKA 1FDIA 4QWMA 2PQMA 1P3DA 4PZYA 2WJAA 1G5FA 5BSKA 4REQB 2AK3A 3ORRA 4WWNA 4DBVO 1A5BB 2B8NA 4EMTA 4LF7B 3NUGA 2YXEA 3HCRA 2JGMA 1LQ2A 4RAQA 1K3UB 3CIFA 5DNAA 1CZNA 5U4XA 2AOUA 2KZTB 5K05A 3JR3A 2PMCA 1R5OA 3LQ2A 3K5PA 1H0HA 4TLBA 5DHUA 3ASHA 2PL9A 4EW2A 5AKYA 3FOWA 5HKBA 1RQRA 4Z4EA 3S7BA 2PVPA 5DT2A 3VXKA 5CR9A 1G5RA 4BQPA 3UMFA 5K8JB 4IGKA 1E2NA 4LUCA 3PUJA 4BGDA 2JFUA 3QLVA 2XGGA 5B1BE 1SKYB 5FBRB 1K4MA 3FOEC 3LPMA 2RCNA 4DIEA 1V9CA 1B43A 1SZJG 4ALIA 2PGJA 4KODA 1PN3A 2P9GA 2FKNA 4PPFA 3NBKA 4HS2A 5M2QA 3B1ZA 4OMDA 5JZOA 2GPWA 3UWSA 1DV2A 1DELA 1E20A 1FS5A 2C2HA 3F9CA 3JD3A 3WS7A 2WP0A 1R6TA 2H9YA 3RUDA 5K3AA 4CF7A 4JR2A 1F60A 3LQRA 3EIWA 1V4VA 4OQNA 1KS9A 3SP1A 2OCDA 3GYBA 3RYCA 2FH5B 2UVPA 1C1DA 3A25A 3NVAA 3KAEA 4CR7A 1B2RA 3BB3A 1IHYA 3SYKA 5TEVA 3LUKA 3EU9A 3F7TA 2C04A 2AN5A 4KKVA 4Y6QA 1IN1A 4JV5B 1WCIB 3PPVA 1K63A 5THKA 1XQYA 3JW8A 3DGFC 2R3SA 4KHPB 1FRNA 4AC9A 1WSDA 4BNLA 1XP5A 1ZK1A 2VBGA 1E3MA 1QBQA 1RZVA 2HRQA 3FIUA 4D8TA 4NBNA 3D8NA 2A0KA 4FK8A 5C37A 4GG1A 5H5JA 3O1LA 2ZBRA 1JNRB 4IRXA 3FF1A 4JLAA 1UT6A 2KPOA 1U8UA 4GM1A 1TM5E 3NUZA 4RKWA 1JHOA 3HC7A 2F37A 4IZOA 2KHZA 2V3VA 2C2XA 4CL2A 1VSBA 3IJEB 2MSEB 1U9JA 2BTDA 3QENA 4KX5A 3DUFA 1YA0A 4IYJA 4BTBA 1SKAA 1KF0A 5KJ6A 4HFJA 2X0EA 3VSAA 3N8HA 5L7WA 3U6KA 3A04A 5PNTA 1LU9A 1KP2A 2QLBA 1ISFA 4YA6A 4X20B 3TB6A 2C2LA 3CLRC 3FUCA 2QR2A 4RSMA 3OE7D 4RVUA 2W0MA 1TTPB 1XTBA 1KQGA 1TFUA 2J87A 3RR2A 3FMVA 2HBQA 3TTVA 1K97A 1U2SA 3IMGA 5BW8A 4DLVA 4PC6A 3T1HB 1NTRA 5EHGA 2BDTA 1P80A 3A6KA 3NUQA 1DI0A 3LXRA 3DFIA 3M89A 4TS9A 2D6FA 4XB6B 3P94A 4E11A 5FHQA 1WUYA 2H6HA 4X65B 2PPLA 3TTTA 4E6PA 1MRNA 4I5IA 3W8FA 4MQ5A 3A1CA 3ZU7B 3MBKA 3WRWA 5IARA 3O4VA 5P8WA 4E5UA 1MFPA 1GCGA 4YDRA 4AV7A 2B6NA 2PMDA 3B38A 5JA4D 4OBWA 3RBAA 3LO8A 4FZJA 1VP9A 4O4HF 3WBBA 3B6KA 3MYYA 1KOLA 3S5JA 3V1LA 1R0WA 3FU6A 2O23A 5A9SB 3I72A 2Q5OA 4X00A 3TDNA 4E7PA 1T0UA 5TMEA 4ZODA 1W93A 4GR4A 1YJ5A 3ONVA 5BQ5A 1SHJA 1AUPA 3BFPA 3N70A 2OGTA 2A88A 4H1WA 1FQOA 1NJ8A 2Q2OA 4KPUA 3A6HA 3EHDA 2G70A 3D7MA 1Z26A 3HSYA 3PEFA 1EE1A 2R2GA 4MUMA 2HIAA 3JSAA 1FNDA 4C0QC 5J4KA 1VBKA 1XGKA 1E94E 2YW9A 2F8TA 2Z04A 4L8FA 3TQQA 1QIEA 3AUSA 4LYGA 4PQRA 5HQ3B 2XXAB 2GBPA 2ZI7A 5HX7A 3AEUA 2ZJ8A 4AG3A 1PBNA 4L5IA 3AILA 5BN5A 4NF2A 4Z68A 3AUTA 2XUDA 2B8WA 4AKSA 3AR6A 2IDJA 1CIJA 3FDZB 3E8SA 3SEZA 1Y4UA 3Q7RA 3QWBA 2V7BA 4R7TA 4NPCA 3NDBB 3G2OA 4IQ4A 4EDFA 5JSUA 3GLHA 2I8AA 1K6JA 4N39A 3SS8A 5AJDA 4JA9A 4UAUA 2VPYA 4HYYA 2ZIGA 3THWA 3AYZB 4R3UC 4YJKA 4J3FA 4RHTA 5IUJC 4Y2PA 2FEPA 4HLDA 4YHHB 4YDQA 3WL5A 3LQ4A 4BLOA 5B1IA 1E77A 4ES6A 1SG6A 3H4IA 1VIDA 2J30A 3EAGA 2BFDA 4WLOA 3BFKA 4Y7CA 4KQIA 1D09A 3SKVA 1CJSA 5CIQA 1G9SA 3PC7A 2CHUA 2Y1KA 1TADA 1FBNA 2PUDA 1Q50A 4HDSA 4F3VA 4BGEA 1GVHA 1IUKA 5ICCA 3P4YA 3DZGA 4OI0A 3RDPA 2Y0EA 4FQ5A 1NW4A 2HF2A 3OQNA 3GN2A 5FPYA 2D2VA 1CJUC 3Q3IA 3H16A 4H27A 4XLTA 3H5WA 5H02A 4MVYA 3PPIA 1T0BA 1PSDA 5IKPA 3B89A 4B3SB 5KYUA 4WEQA 4F3CA 3Q7IA 3PJGA 2XMBA 4Q7QA 2J6BA 1IXRC 2QYUA 5LUAA 2WBLC 5GM2A 1OLUA 1FJGB 1G0NA 4PLTA 5EJ7A 1UMDA 5BSFA 1OYVA 2IJGX 4MYHA 3ROKA 4EX6A 5H7PA 2M1XA 5B36A 4A2WA 3K1JA 3LS8A 3L1IA 3MWKA 3M5WA 3EN0A 4EOGA 4YCMA 3AF6A 4XI9A 1W4CA 3FTDA 3AUXA 1N2XA 4J0HA 1JDSA 3GLUA 4EB0A 2GYVA 3KXLA 3BJMA 2RH8A 3LCCA 1ECGA 2XVAA 4YQZA 4K0RA 2EKBA 1I1NA 2PEYA 1MCZA 1GTSA 2MR5A 2I78A 3DD1A 4TYMA 2K4MA 3BXHA 2AF4C 1DEKA 2RIRA 3RTCA 4DR7B 2NZXA 2A59A 1DZ3A 4KLCA 1G0OA 3ESBA 3JD2A 5EE1A 3FIJA 5DWQA 3MUFA 3ZWQA 3IMFA 5D7BA 4KYVA 3ZFWA 1RWXA 3K5WA 4GXTA 4ZMRA 3KUXA 5LMNB 5JS7A 3DRAA 2Y0CA 4CM3A 2DQSA 3ZK8A 3JQAA 4KMMA 5KSYA 2QD4A 1K8RA 1RKVA 3NIGB 2VUUA 1GM5A 1WU7A 4XE0A 4K86A 1E9FA 1QZ3A 3EQ8A 1LTHR 3HXQA 1F8XA 3V2OA 4AG5A 1XRJA 2C0LA 3L8ZA 3I6BA 4XRGA 1OX5A 2ZKLA 5KJLA 2J4FA 4UBKA 4BGVA 2L9BA 1UCFA 4MVJI 2WWIA 4RYLA 4X97A 4D3FA 5G1OA 4OJNA 3WLTA 2ZBDA 4PY2A 3TTWA 3NJRA 4KQKA 4PS8A 4KFTA 4KVZA 2OPBA 4BMSA 4R81A 2PH3A 1N2BA 5EKXA 4AZTA 3C39A 4XJSA 4NZMA 1BG6A 3CT4A 1PLLA 1CQXA 5J5AA 5DSTA 2ZRLA 3SSAA 1G21E 1J09A 4HPJB 5E2IA 4R3NA 2XOEA 4J43A 3AU8A 1DIOB 1MX4A 5H81A 3FWYA 3TWOA 2QQGA 2JRLA 5B57C 2QM3A 3T54A 1OI7A 2OMKA 2H4YA 2K5UA 4DT1A 2DH5A 3ZG6A 2XHZA 3IQFA 3EC7A 3A6ZA 3K0CC 4JKYA 1J20A 1ETUA 1HGXA 4I1UA 1VRVA 3NVKI 4Q9AA 4UU7A 3H7IA 2RMKA 3RSLA 4OHXA 5EE9A 4RDCA 3QUCA 5JATA 5K3OA 5L51A 2A9JA 3CZ5A 1FFHA 2ONJA 3BGSA 3GFTA 1L5VA 1FUKA 1RRKA 1OVGA 2C9ZA 2JLSA 4RPJA 4ENSA 3K9FC 1PW7A 3FY4A 1K9VF 3QNMA 5F78A 2VZLA 3OEEA 3QKSB 4I4TF 4GLLA 4OH7A 2NYVA 3CEQA 2WF8A 1CYEA 1SUWA 2VNAA 3LPZA 4EL0A 4K5AB 2E85A 2XE8A 5KYVA 1PFQA 4LE0A 4PSDA 3JQGA 4LA4A 4K7JA 5LP1A 1WV0A 2PGXA 2MYOA 1EEHA 1ODFA 3GDGA 4JWTA 1ZH4A 1CY8A 1RQNA 2YWDA 1RJEA 4MDYA 5DTMA 1BD4A 5HKKD 4WKGA 4JYBA 2BUGA 4A8JA 4TTRA 4G3XA 2HO1A 5EMJA 4Q39A 1IK4A 2JHPA 3G79A 5KYXA 5EUBA 2IO3C 1Z36A 4BIIA 5CRVA 1GR1A 3UC5A 4U2CA 1YD7A 3TYXA 3MK31 1H1DA 2DWOA 4GMHA 3GJYA 2ONCA 4W1QA 2UAGA 2WY2D 2YIVX 1FDUA 1YKGA 1OZFA 1G63A 1HC7A 3WGYA 1JF8A 4URWR 1VOTA 1WJGA 1A7UA 2CL0X 5KBYA 3GRYA 4QPCA 4ASUD 1OJLA 2PD4A 5F2NA 1X42A 3O2JA 3DVAA 3QI2A 3BB1A 4B7CA 4L6AA 4OLFA 3OIFA 3SHWA 5LZ8A 1P2GA 1FZTA 4IIGA 4QXAA 5JAPA 2RJNA 2WFMA 3WQHA 3UGKA 2GZ3A 5I8ZA 3NM6B 3GLGA 2ZWOA 2YZKA 4ZJZA 3RU9A 3Q6NA 1YRYE 3OCCA 4CW7A 4DBLE 2ZJZA 4LNUA 4CF5A 2PX4A 4YJGB 5HA5A 2VXBA 3IE2A 4ATGA 3HPRA 3PC2A 3IPAA 4E46A 4ZZ2A 3R7AA 1QC5B 3BMNB 1N3YA 2NSYA 1IAQA 4H60A 2JVKA 3E61A 1ZEJA 5BN4B 2HK7A 3LSYA 5IAAA 4ZJYA 4CEHB 3WO0A 2PEZA 4H2DA 2EQ5A 4KGDA 2Z56A 3TWUA 2NO5A 4CUJA 1MV8A 1VIMA 3GWGA 3AEZA 3EPLA 3ISTA 1M6WA 5TEWA 1IVSA 5DTEA 2IXBA 1BE8A 2QY6A 4M37A 5G2NA 5JNUA 2VTEA 3H3JA 2ZP1A 5KQPA 4MUHA 2YHIB 5KVQA 3E9ZA 4JVMA 2FMKA 4IDCA 1E63A 3ND5A 1VHJA 2GARA 1LS1A 3VYTB 2VP9A 2L19A 4KX3A 1CERA 8ATCA 4GPEA 2OZKA 1D04A 5BN1A 2ZSDA 2I76A 2FGJA 2G9VA 2UUPA 4RSGA 4M98A 5ALQA 2ZXWE 2B0CA 2P0AA 4B94A 1Q2UA 4UW9A 1NAHA 2C0PA 2VHJA 5FADA 2RI1A 1MENA 4N3NA 2BJVA 3BSFA 2HPHA 2O6HA 1UG3A 4UOZA 1GG8A 4PSUA 1XTVA 3KQNA 1LWOA 3B78A 4TQGA 2EL7A 3DTYA 1IY9A 1QAQA 3T61A 5JXGA 1CUYA 2XX3A 3DDOA 4L5AA 3FYTA 4I19A 2CHQA 5EOVA 2AUNA 3PEVA 4G8KA 2VK4A 2VJYA 3L7KA 2QAJA 4CTKA 1P0MA 3KQQA 4YAJA 4ED9A 1JRLA 1PT5A 3Q4GA 4DSZA 1UP7A 3HXBA 1SUFA 3KSLA 3DE6X 3EPKA 4TWIA 4XEIG 4UHDA 4LYYA 3ZCUA 3Q11A 2HWKA 4LQDA 1AKYA 3MB8A 5A4IS 3AP3A 4U0UA 5KWEA 1DIGA 3WMEA 4EQ6B 4YJ3B 5HW0A 3BTOA 2OBMA 4U6SA 1AU9A 3T7JA 3ETLA 1QR6A 2XOKA 3BBPA 3LIIA 4UULA 4LJ8A 3ZDRA 4EJ6A 4DJDC 1NUPA 1PX0A 2WTMA 3K4HA 5AOXB 3FTPA 1GZ4A 2HA5A 1SC1A 1ONOA 4K6MA 1OH8A 4BV9A 1GFZA 1J9EA 2IH5A 4QM6A 3FTVA 4IXMA 1RU3A 4B93B 2HSZA 4RVDA 1BJRE 2XDQA 3DBRB 2I7XA 3SLGA 3DT9A 5ED4A 3QLVC 4YRJA 3B8EA 4DHWA 3GCZA 1WMEA 4D81A 1JBQA 2B94A 4F21A 1LI4A 4AUKA 1ZJYA 2Q5LA 5CA1A 1LC0A 2OV1A 3UKUG 4JVOA 3JALB 4XR4A 1PQUA 3QWWA 3VI4B 5JQGF 1TNZA 1ISHA 4F1WA 2AZ4A 4N82A 4O63O 3FCSB 1AM4D 3BG1B 4CBVA 4O2BB 1FQKA 5IVPA 1FDVA 3I01A 3W5IA 3BD8A 3O7MA 3U40A 1Z38A 2B1JA 4R01A 5B1SA 2GQ0A 3EQ6A 2J9GA 2HNAA 3MLBA 5EEHA 2E37A 4PRZA 2CF6A 1E61A 2GRUA 3GJ7A 1E6CA 2EBWA 1J5EB 5JY1A 2PBFA 3EK2A 1CW2B 1IY1A 1V48A 4DWWA 1KC3A 2BUAA 2OV6A 2XCQA 1IWOA 5F51A 3IQGX 4LXTA 4IJ6A 4B6SA 1ADYA 3Q78A 1H23A 4Z9FA 4DJJA 2C9BA 1DCEA 2PIAA 2QAGA 2CLIB 4UYJB 4FIZA 4X1KB 1N75A 2RK4A 2PT6A 3OX2A 3OZXA 4Y6SA 5COQA 5BVGA 1FFCA 2H5JA 4UEQA 3KJFA 2ZU6B 3ANMA 4DJEC 1VB3A 3VTYA 4YXWD 3SC4A 1EG7A 1RLJA 2IYTA 4GX5A 1ISPA 2DT5A 1UBCA 2WMNB 4IMJB 4WHMA 1EUDA 2ZRAA 3EZ6A 2J5KA 1HX8A 5JOQA 3Q87B 3WGKA 5DN6D 1UBGA 4P1ZA 3WGNA 3BGOS 4YO8A 2O2ZA 3U4MA 3PE4A 1THMA 3K71B 3PFNA 4JB0A 1U2QA 4ETMA 2ZPTX 3PQ2A 1NI4A 2J32A 5JXIA 4S1WA 3NHAA 1E1DA 1VB5A 4LTMA 5FPSA 2COKA 1L7XA 2YWGA 4GKJB 1H2TC 2QTLA 2L0TB 1SELA 5D86A 2Q1SA 3FA2A 2QRPA 3AI7A 1AUOA 1AZWA 1Q7EA 1IFXA 5EKTA 3IV9A 1QP7A 2HRDA 5BW8C 4ALNA 4CV1A 1DXQA 1JHYA 3HXMA 3PDHA 4R2IA 1IK6A 1T13A 3ZJUA 3CLSC 5KC9A 5CHEA 1SQ6A 4P32A 1YIDA 5JROA 2GCEA 4QBKA 4AS3A 2BD0A 2I71A 1X8XA 2VUSA 2BLNA 5IMBA 3L4BA 4FNOA 2XODA 1OE0A 4HATA 4AO8A 3CN7A 2WWXA 1CY1A 4E85A 3VKFA 1JV2B 2OM6A 3ZKWB 1XNHA 4ZOLA 3EW9A 3ILVA 2O54A 2X1VA 4F91B 4QFDA 1EFKA 3R7SA 3OD5A 2RB4A 2JJ8A 3ZJVA 2O20A 3A7DA 4PAQA 4UE3S 4RTKA 1DOAA 4IQ8A 2HCRA 1D03A 1NX6A 4UBMA 3IIJA 3KV3O 3R23A 3ZU6A 3L7AA 2A0YA 3IL2A 1U1CA 4E5DA 4QDKA 5JCOA 3SZGA 3ULQA 1UJKA 2OCIA 5CVEA 3CCCA 4B44A 4EUNA 3CPEA 2DFTA 2RGWA 3GZ1A 2H1LA 2VRBA 1Y7PA 1NUSA 4BO8A 3DJYA 2QL7A 1GTVA 3BSWA 5H3HA 2B83A 3ZKJA 3D8RA 4QUDA 1OASA 2ZT8A 2PN1A 2G5CA 1ZSVA 1A9QA 4WY8A 4AJPA 1JL3A 2ZSEA 3FWKA 3NFYA 4CRWB 4OREX 3E9EA 4OF4A 1RAHA 4CKCA 2NMVA 2NOAA 4JLSA 2OV4A 2F1HA 4EI7A 4EHAA 1RRVA 4HCJA 1HE8A 2GPBA 4GYYA 4BVKA 1MX2A 3FMPB 1BH6A 1EVEA 2NGRA 5KX5F 1XVLA 1FXWA 3MOIA 1C80A 2R7KA 3Q2OA 3TOZA 3QEAZ 4MPRA 3D0OA 3B7RL 1MQSA 1KEEB 1WXXA 3PNTB 3TLXA 1CJTC 4D4IA 1C3XA 5KVSA 2JHFA 2P9UG 3D7RA 3FCUB 1R8JA 1TAQA 3UEOA 3VX4A 2WTXA 2JFBA 2H6EA 2F1OA 3VJKA 1U2RA 1GTG1 5EIBE 4KTTE 4G9BA 2PZKA 1JEOA 4IGIA 4Q7LA 2F00A 3MS7A 4FMDF 3CEHA 1PR9A 4JBLA 2LVBA 1JNYA 1QWSA 3L7OA 1PU2A 3HV2A 3VC1A 1PV2A 3AVPA 2VNIA 2ZI6A 3BE6A 3RAJA 1UQUA 4Y2TA 3ML9A 2E4XA 2DBVO 1SAYA 2OXCA 3KQUA 2GRMA 4OUDB 2YYZA 2BBOA 3IIMA 1Y8AA 2J08A 3O4IA 4TXQA 5I9LA 4S1NA 4K6FA 2Y76A 2ORIA 5AICA 2QSZA 5CITA 2NO6A 5D84A 2BMJA 1W5TA 2EW1A 4BN0A 4BV2A 3T3OA 2QRVA 4KXUA 1VLLA 2BR5A 1RWWA 3IOEA 4D9GA 1N1EA 1OIWA 3FDIA 5CFLA 1JQKA 3OU2A 5B2FA 2GAFA 2ZM6B 4CKYA 1M34A 4FDMA 1EINA 4C5CA 5EWJB 2DT8A 4NARA 4WZAA 1UINA 1ZD5A 4U7TB 3G9TA 3DMYA 4CN9A 1NYRA 5K9ZA 2Q7OE 1Y6IA 3EVZA 4Z1MD 1NVAA 4C4TA 2IEBA 1J2JA 1NJ2A 4OYRA 3K9QO 5D0QD 4IKPA 3IP6A 4B3DA 2Q41A 1U5CA 1O5IA 4WK2B 2NU9A 5J59A 5DCUA 3GFRA 2XYQA 4DUYB 1EQ2A 4GDFA 1RWQA 4B80A 4E08A 3D64A 1RKQA 5EJ6A 2FEZA 2FJUA 2QYOA 4TMTA 2OVFA 1IEVA 1Z4QA 2HLDD 5JJ7A 4X60A 3ZW3A 4UHBA 2CNLA 5TRTA 3UH1A 2IS6A 2EIHA 1FS6A 2HC9A 1QV9A 3WLHA 4G5QA 1N6PA 2VJKA 2HL6A 1NOJA 3ASGA 4BO2A 4LECA 2ZI3A 4KQFA 1CUXA 3NW9A 1E7VA 1LDMA 3BGIA 5L3RA 3PDNA 3WWOA 3KAPA 4PS3A 3FUWA 1QCYA 4WNIA 4XEHA 5LUBA 4KWTA 3PRHA 2YJ6A 3OCUA 1T3TA 4KXYA 1E2LA 1EB8A 3IVCA 4XW2A 4DK5A 5ESWA 3T9BA 4MCIA 2QN7A 5EYPB 3G0DA 4UQLA 4EYSA 5KAMA 1DMSA 1T6NA 4EVRA 3NTUA 4CLHA 2WJVA 3UAGA 2UUCB 2O2JA 1YMPA 3TZKA 2R4UA 3ZWXA 4MPJA 4A3SA 1KI1A 5K3FB 1MB4A 1M1YE 3X1YA 1J7KA 1PT8A 4H7FA 5E7IA 4Z3OA 5I9IA 1E9CA 2P27A 1U2DC 2LXLA 3DFKA 4EG4A 4CCYB 3CHPA 1K88A 4M8KA 2GHRA 2PRZA 1IHPA 3IS3A 1JFTA 2P9BA 3WL6A 1FEZA 2VXCA 3BJIC 3AC0A 4R1LA 5G4KB 3LCUA 2P4QA 2Q3CA 4V0OA 4JI6B 1P4SA 4FHDA 5GPBA 4J0FA 5C31A 4MZDA 1DCFA 2VSYA 5C2YA 4YFVA 3KUUA 2DTXA 3F1KA 4MJLA 5CXQA 3WL4A 2C5HA 2DHQA 2Z2YA 3ENZA 4A63B 5TPZA 1DCMA 4V1CA 3I9KA 4A8JC 1T4CB 4YJFA 2WMOA 1ONPA 1G66A 2BBWA 4MHSA 2QTTA 1USKA 1F8GA 3SEAA 3FVVA 2F1RA 3UX4A 1KETA 2G1PA 4BY9E 1RZRD 3PL5A 3TWTA 4QOJA 1T8PA 2DBZA 1BXRB 4C76A 4Q00A 1ZVVA 4DZTA 2X19A 1QTRA 1H6OA 3MGCA 2PO5A 2BBTA 3IQXA 1E79D 1C30B 1A4RA 5L6LB 4CUKA 1B6TA 3AJEA 1LVUA 3M9WA 2WUWE 4QXOA 1X9GA 2KJZA 1Z5OA 3FUHA 3ZZNA 3I2HA 3G0BA 3WLEA 4I81A 3OAAD 3THXB 1ZY2A 2LNIA 2WLTA 5L9AA 3BIXA 4R1PA 2Q46A 5E6SA 4Q7KA 4Z7JA 1DX4A 2CFCA 2GCIA 4DR5B 4H16A 3QSYA 1HLFA 3L18A 1E8YA 4AZ0A 1RT9A 3GJSA 4RVSA 1P2BA 2EVWX 4ZO6A 2VPTA 3HZZA 2RH5A 4K0KB 4DYVA 5FFMA 5DP1A 4KFCA 1CZRA 3A1TA 1ZSYA 5CGQB 4JZKA 5AXDA 1T34A 2ZG6A 1XI2A 4R8LA 2O6LA 5GAJA 4WKCA 1QP8A 5DTJA 3PPYA 3GWZA 5EDSA 1LDGA 4D96A 1QHIA 2ZDHA 3HXLA 5JWOA 3UG7A 1YQXA 3IJRA 2O8CA 1EFVA 4ZYXA 4WBXC 4AK9A 3V4LA 1EGVB 2AFHB 3PQ6A 5FI0B 2P6OA 1H65A 4ER5A 3KQKA 2I4OA 5JS2A 1ML3A 3PWZA 2GKOA 2FMHA 1KNXA 1A3CA 2VHEA 1M8KA 4KQXA 1WUKS 1GPLA 4D02A 2P9LG 4RF2A 3T9AA 3O82A 1I0ZA 2B25A 2LDBA 4WLFA 2C2KA 3G2PA 3W3ZB 5M3BA 1K3TA 3QPAA 1SIOA 3HCAA 2OESA 2MR6A 4F4CA 3C7KA 4HJXA 4MZXA 2R7MA 2AXEA 4ILGA 3KXKA 3GROA 1N57A 3EG9B 3PA6A 4GP7A 3F7NA 3U61B 4A03A 1VKZA 3JVDA 4KPFC 4Z7QB 3PQ7A 3RYFB 2WTBA 2PKQO 5EIOA 4EJ0A 4YYZA 1J2RA 1NE7A 4UM7A 4OB6A 4XOUA 5EA2A 4YECA 1V3QE 3VVCA 3UANA 1EX7A 5FBVB 1F0YA 4QGAA 1PFWA 3H0KA 1NVWQ 5I4BA 1JE1A 4JUCA 4H7JA 1S7CA 4JP1A 3DKKA 3G2LA 3KR0A 3NCTA 1TJFA 2MMGA 4OLHA 2QIOA 2X38A 4UARA 5DLDA 4IGEA 4CF4A 2QTGA 5KJMA 3AIOA 4PRKA 2X0IA 1IQRA 4C1NA 2HMYB 4HL6A 4DLPA 4E2ZA 5GP1A 4FYWA 3ZDEA 2GYUA 1QOPB 3E9MA 2ZIEA 2PH5A 3P4XA 2XR1A 4Z4GA 2IYAA 1SA0B 1VJTA 4Q18A 1SBQA 1PX2A 3DV9A 3C3KA 2EKDA 1Q1NA 1NJ5A 1TQ2A 3A2NA 4R1TA 5AI4A 1TM2A 4JAVC 3EOZA 3KQPA 2BTQA 3O9VA 5L3QA 4US2R 3GA7A 2VHTA 2YOHA 4B40A 1NT4A 1QYVA 5LC1A 5C1OA 1RW2A 1PJAA 3LQFA 1TEHA 4ZQGA 4IHAA 5AVWA 1DC8A 1NN5A 1O95D 3U26A 4PQEA 2X9LA 2XWJI 4IS3A 1PVDA 2Z3VA 4MRNA 1D2CA 3RO7A 3HA2A 3IOYA 1LPOA 1P4HA 1B8VA 4DI3A 1TZCA 4Y2SA 2PMFA 4HAYA 4NCHA 3MJ4A 2PLFA 4DUGD 3K7EA 4L76A 2ODNA 4BLQA 4MP6A 4XFDA 1XFDA 4YO7A 4JUBA 3ED5A 1CF2O 3GT4A 1ZICA 2WM8A 4ZU3A 1ZP6A 1X7ZB 3N2ZB 1OGIA 1YRQA 4ZCIA 3SF0A 1FIUA 1P2DA 2BEKA 2C00A 2WA1A 1G8KA 1G8YA 3QEMB 1S2GA 3VHLB 2J6IA 5BXUA 2FY8A 4JVSA 3GZ2A 2IOFA 4MA4A 1WXWA 4R9RA 3HSKA 3RFVA 5G05C 1X1EA 2OYSA 3R3YA 1CDZA 2QAGC 4XCQA 1L7PA 3QBVA 2B8TA 3CM0A 5AKZA 4TYQA 5E95A 3DCNA 5EESA 4C7JA 3OEHA 4ANWA 1BCRB 1SH7A 3C3MA 3TXNA 3ZU4A 2I55A 4ANUA 4RHFA 3AR2A 3GQBB 4D79A 4JUFA 3TLBA 1PFGA 1W88B 2KM1A 3KALA 4X6UA 4ZTBA 4L3WA 4P7FA 3DMDA 4PCAA 4YONB 1W5FA 3VC2A 4RD3A 1R9NA 3DZKA 4BQIA 1N4AA 2HMSA 3BXOA 4IVQA 4QUKA 3KQVA 3NWJA 3ER9A 5CYGA 2XH8A 2WD8A 3KJXA 1ZOIA 4ZC1A 4NOMA 2C7PA 2VFAA 3GNTA 1Z7WA 3K94A 2CWWA 1JLRA 2IL1A 2ZWAA 2ZW9A 4HNRA 4YASA 3EGXA 1LJ8A 5IWCA 1G7CA 3E7PA 1WUJS 2WXNA 4XQ9A 1R6BX 2AMLA 1ISMA 2JLBA 5ANRB 1SXPA 2B69A 5BSEA 3QKUA 1L3CA 2GCOB 3X1MA 2X7HA 1M73E 4IKEA 2RD2A 3Q15A 1OFGA 3GRFA 3P0HA 4LW8A 2D4HA 1A96A 4DLLA 3ORSA 1DIAA 1DNPA 3FF4A 1QR2A 4RZHA 4QE3A 2IBMA 5KU7A 3L4BC 5HS0A 2A86A 2DETA 1ZB1A 3Q49B 4RJ2A 5JANA 4BFTA 5CMLA 5CTJA 1C0KA 3N0VA 4DDHA 3WC4A 1NQOA 4FCTA 4HVLA 3MEKA 3AKYA 2YXLA 4PFJA 1WXHA 2F3PA 1GLGA 4HZIA 4BTLA 3CVQA 3DM5A 1UOQA 1G8MA 3JASB 3BQOA 5ED0A 2QZPA 3MRTA 4TT8A 4XGNA 4B2PA 3RWOA 3WGUA 4BBJA 1CNFA 1KE1A 2ETAA 4EPWA 1V1MA 1W2HA 3H1BA 5DOZA 1AUXA 1L4LA 2R4QA 5JCOC 5KNGA 5LN1A 4D10C 3ZK9A 4M9QA 3TL6A 5A7GA 4FSHA 4RW0A 2GA8A 3VOBA 2X1HA 2GRNB 3K8ZA 5JVDA 1P8JA 5JIBA 3WGJA 4QZVA 5JBQA 2FG5A 1R3UA 2WZQA 5L4LA 2QFCA 1MW9X 5ITZB 2XZLA 3CONA 4Q7MB 4RZ3A 1DXOA 4GQIA 3NDIA 4M49A 2FJ0A 2Y67A 2DPXA 3CEAA 2AFIE 3SQOA 4CV0A 4OK6A 1KS2A 2JCBA 3EUEA 3M6XA 4RSYA 4XVQA 1M5TA 5SY9A 4BO5A 3KVNA 3D1LA 1HE5A 1Z3YA 4URXR 1V35A 3K0KA 4RH1A 3LRPA 2C4UA 1G5HA 4ENVA 1IPHA 3ET4A 521PA 1P7PA 2X42A 2QRJA 3O8CA 5CFRA 1D2RA 3KX2A 4BB6A 1JZSA 2C9OA 3H4VA 4UQXA 3ZN2A 1N1GA 2CCGA 2GETA 4TMWA 3R5JA 5DK6A 4WGFA 1J8YF 1BZYA 1DBRA 1RI5A 1V5WA 1B16A 1ZN9A 3JWIA 4D0GA 5E6RA 5AVVA 1Y0BA 4W99A 1IYZA 3ENQA 1YU9A 3PNBA 3ND9A 4P9NA 2CC2A 4RJLA 1NMXA 3CKCA 3W9BA 3JXIA 1V45E 2HO5A 4H7KA 4AKIA 3VZDA 5DXAA 1QHYA 4KFRA 2FR0A 1O96B 4QAQA 3QVJA 4WZZA 2Y9MB 3V7FA 1FTQA 1TTQB 4FYHA 4MGZR 2B4TO 1YCDA 4J2TA 3ZS8A 3HUEA 2GZ2A 1RR6A 3KJNA 1X74A 3DNMA 3PEEA 1COWA 4J16A 4X1IA 4Y9UA 1E1NA 3A1FA 3DBHA 3OEWA 1Y9ZA 1BROA 3VYUB 5B3LA 4ND5A 4M1MA 3OQOA 3PU6A 1FFWA 3RFXA 2P58C 1AKRA 1VG9B 3IA2A 1E1CA 2BEUA 3FPLA 2YKGA 3HR4A 4X7MA 2RARA 2NYRA 4NVRA 4IMRA 4E21A 2X8WA 1Y89A 2GXQA 3FPEA 1XLVA 4MRUA 1C50A 5K0EA 2O8FA 1YRWA 1Z63A 1D9XA 1O2DA 4U63A 3RAFC 4WW0A 2Q1TA 3FNHA 1UFKA 5G0SA 3C8DA 1P0CA 2QORA 1FQJA 3QU4A 4E2YA 1TB4A 2NIPA 2V8BA 1JH9A 1XKXA 4EZEA 3HP4A 3UXMA 5FRDA 1TK9A 1I0IA 2IHBA 5DNDA 4ARZA 1YWGO 2CBGA 2F62A 3ITEA 1PJQA 2V6IA 1Z5GA 1XLTA 3IQHX 3N3AC 3GC6A 3PGMA 1MPXA 5K0ZA 5CLIA 1GAWA 2DECA 1UPTA 1J0CA 2QU7A 3QH4A 1YFJA 5AIJA 3VDQA 1UPAA 1R0SA 4M22A 3OMXA 2E6UX 1NP7A 3TU3B 8ADHA 1UBNA 4GT1A 4E22A 1WW2A 2C88A 2BZ0A 2VAVA 5LM3A 4X6LA 4OAPA 2JHGA 5GVRA 5LBUA 3RIYA 2VJNA 2PX8A 4H17A 1VMEA 1KP9A 3HE3A 1XVTA 2IYXA 4MIEA 1H3NA 3MTQA 3QE9Y 1OH7A 4MRMB 5F5LA 4FB5A 3DEZA 3IAXA 4IQFA 4WZ6A 5FR1A 4BMCA 1WY6A 4DGSA 2EJWA 2XRZA 4DR1B 4TZTA 2WHRA 1AH2A 5F1PA 1DKOA 2V7QD 4YCDA 5HRUA 4BT9A 3S2UA 1BH2A 1ZL0A 1T0HB 1KY5A 4FLBA 3CN9A 2Z58A 1Z0KA 3GT0A 2BGIA 1N8NA 3RF6A 3QU9A 1C7QA 1H2YA 3I8XA 1Z6ZA 3ZE9A 4NL4H 1ZW6A 3PT5A 5JS6A 4KE7A 4HBGA 4HMPA 2WU1A 2H4FA 3KYIB 1N7HA 2J49A 1HYEA 3QV1A 5D5QA 4QL3A 2B1IA 2Q8QA 3I45A 2IX9A 1P2TA 4ZVQA 4CMBA 3AY7A 3FTYA 4UATA 4HR7A 4XJTA 2R17C 4IWXA 1JVSA 5D51S 3HXCA 3KQSA 1J9ZA 3Q3VA 3IKMB 4G2NA 1DO0A 4MUBA 3Q1KA 4QQ8A 2GN2A 5H68A 2J6HA 1L7AA 4JYMA 3IHWA 5A2GA 1IUNA 4MV6A 1AY0A 3DFFA 4F71A 2JI7A 3OSUA 2PWYA 4GKKB 4HVAA 1FA9A 3WGQA 3T9KA 2HR1A 3ZHXA 1FSPA 1VJRA 3TXYA 3CLUC 5HXAA 1LKZA 4G8LA 2R8BA 3OJWA 4FKBA 1SB9A 4EZKA 3CH7A 2BT4A 3O2QB 2BMEA 4ZXPA 4JBIA 4F9FA 2B8JA 4XKBA 4C2BA 1Y5LA 4JI8B 4DIKA 3TL3A 2IZ7A 1Z4PX 3W5HA 3ZVVA 2I6UA 4D45A 1OUVA 3AUKA 2MMCA 4CLRB 4UXIA 1H5NA 1IXZA 3F1LA 1ODCA 4ZZIA 4AYXA 2DY0A 2Q07A 4RNDB 1LPAB 5CM2Z 4I1SA 5TV2A 2BMWA 3FPSA 2OLKA 1RRGA 2HREA 5A02A 3K1AA 4IVPA 4AJ4A 1WDWB 1MO3A 3D9LA 1SUCA 2QW8A 3BQNB 3VVMA 5C3UA 4HH3C 1C2YA 5LDHA 1TDJA 4AP6A 4O59O 5C5EA 3WIEA 2GTHA 4L2IB 2G82A 4JR1A 1LVHA 4C0WA 3ABIA 1XPUA 2P7HA 3KE9A 1ZJZA 2NP7A 2IYUA 3UPDA 4PHTA 4RGBA 2OQVA 4PBTA 4OKSA 3MMZA 2QY9A 2BL4A 4EY4A 2F55A 4FS8A 1WG8A 4BVAA 2AEEA 3FR8A 2Z2IA 1OHHD 2AEJA 2ZYHA 1KU6A 1KKLA 4PLVA 3ECCA 3IR7A 3HB7A 1E9EA 3I6MA 1OW3B 4UCXA 4OQEA 3CH4B 4EY3A 5JNSA 2Y71A 1IEXA 2V7GA 4BNNA 4TL7A 1A9RA 4KAXA 3VO1A 4CM6A 4NCNA 2GGSA 2QTCA 4JT9A 3PSHA 3FUKA 2DWUA 2HFJA 4Z5XA 5DWVA 1J1ZA 3BE8A 4LRWA 1ILEA 3RC7A 1UFQA 2C7VA 4PC7A 1EQAA 4B6FA 5IK2A 2WWRA 5CFZA 1O97C 4LDRA 2E4AA 4ACKA 3VU1A 5T41A 2AHOA 2LE0A 1POWA 3A4VA 4ZVNA 2KZTA 4DM3A 1PZMA 3DSUA 2PKQP 4XZ3A 3CF2A 1KP3A 3KTAB 1N1MA 2LD4A 3ACBA 1KZ7B 2NTVA 2EX4A 5U4QA 3MAAC 5SICE 1VDZA 2IELA 3ASFA 3M6MD 1UQRA 5H80A 5HCIA 1X87A 2ZS8A 4K9OA 2Z5LA 1B8UA 5H70A 3FH8A 1UPFA 4C6RA 3AS5A 1ZUD1 4B35A 5AOBA 2OHIA 3CLHA 2GERA 4HUJA 4G1TA 3VTXA 4RCVA 5B1HA 1CPYA 1G8SA 3L7MA 4G0YA 5F64A 2XQGA 1PJ4A 3E7DA 3CKMA 1UDBA 4K8RB 4MMZB 3RU2A 1VPLA 4XYGA 1DTWB 4L02A 3PXDA 3WB0A 4JI4B 3E15A 5K51A 2CVPA 2WWGA 1I7SB 1ZUHA 2A9OA 3QLJA 4YT5A 1NF3A 3Q6IA 1DINA 3OQHA 3S7TA 5CRUA 1SD2A 3FVTA 3ZD9A 2Z5GA 1N4PA 1NBMA 2CXUA 3P27A 1SXHA 3ABME 2X6KA 1S8FA 1VA5A 4U8YD 3BVPA 3RU7A 1WCIA 3H19A 4XWKA 4KWIA 1WABA 4QNNA 1EVKA 2RSFA 4BNYA 1T6ZA 3ECSA 3LPLA 1Z25A 2HA7A 1G41A 4RZQA 5HBRA 2EFCB 3WV5A 5TGTA 1CR2A 4ZQFA 4AWBA 1YCSB 2WXMA 2VTBB 2RAUA 2PSHA 3EAQA 3K9GA 4O8ZA 4RK6A 4NAHA 1D4AA 3VR3D 4O1MA 4W5OA 4EFNA 2WXKA 2OYRA 4YH1A 1Z2EA 1J9GA 2IOFK 4WOJA 4ZOCA 1HO8A 2W11A 2D1SA 3QE3A 1YR2A 4R1MA 3RBZA 1NVBA 2VOJA 2V55B 2GK6A 5B6IA 2N47A 2FWJA 2RFAA 5BWNA 4HB2A 4PONA 3NTRA 3RADC 2CXNA 3HH8A 1JG6A 4MHOA 2FSIA 2R05A 4E07A 3B13B 5AT1A 3B7SA 3A36A 5TT0A 3IQWA 3KKQA 2H2IA 3ILYA 3UJ7A 4X20A 5LMZA 2I3BA 5FYQA 1VZ2A 3N2KB 1BOFA 2NZJA 4NFHA 4IF6A 1PZXA 2ZWPA 5K20A 1UWVA 4E03A 1N7IA 2AW6A 2NVOA 4IDBA 4P54A 1YQGA 3KR9A 4AKTA 4UEOA 4ND4A 2CHVA 3VUFA 4AJJA 1U4OA 1UPXA 2HZ7A 2HMUA 3HWX1 4F2WA 3HXPA 2CCKA 1YR6A 4ZHBA 1E62A 2GZMA 4R8SA 5FTKA 1ZBDA 2NO9A 4X66B 4J1SA 2PYDA 1PUIA 1MP0A 3MOSA 3STVA 1MGPA 1JEJA 4YRQA 1YR1A 4WY5A 3OU6A 3UQ3A 2IOLA 3V7WA 2AG1A 2ZRKA 5BRAA 3EZ7A 5IUNC 2C1XA 2NYJA 1PNTA 4B47A 1QGOA 2X5JO 1FP4B 1CB7A 4NPAA 3W6ZA 1YDEA 2QV0A 4LQ4A 2GNPA 3P8ZA 1IRXA 4K28A 3FU5A 4I6GA 4B83A 1X92A 5A9SA 5GINE 5D5HA 2G72A 4YP7A 3GCGA 4GC5A 2X0KA 2ZSKA 2AR9A 1P9RA 1Y8QB 2Q8PA 4U5QA 1EFRA 1CULC 4QKQA 4R16A 1CY7A 3MG9A 1U1IA 1DJOA 4K46A 2ECPA 1XXHB 3TVYA 4JP3A 1PK7A 2X2EA 2JAWA 3EMDA 4S3MA 1HQCA 5A7DB 5J5CA 1OLXB 1SIBE 3ESAA 3ZGYA 3GMTA 3RUIA 1IHGA 4TX1A 2BKLA 1R7RA 2R2AA 2ZYVX 5TR9A 2FPPB 5HQ3A 2XXAA 3BM5A 4HI0E 1N6LA 2CVZA 3LVFO 1D2HA 2V59A 3PRJA 2VN8A 2VUTA 3OBIA 4CL3A 3Q15C 3KCNA 1NIPA 3FDZA 3HCDA 4KIJA 1AG9A 3WYDA 2P6NA 4EELA 2FZWA 4MX8A 2FUEA 2D7JA 2CF5A 2HSEA 1KZ6A 2ADFA 1W75A 4ZCRA 2HTEA 1VL2A 1OWMA 1WMAA 1DOHA 3PVZA 1PG0A 3HN2A 3SFTA 4L2YA 3O8DA 4EWLA 3C0KA 5L53A 1CUWA 4GOKA 1DOZA 3EIOA 1FRQA 1G8JA 2E4YA 3ZYQA 1Y37A 4TVBA 1JSCA 1W2WB 2O57A 2YJTD 1L5WA 1MB9A 1FBTA 2JCSA 1DWOA 2XEHA 4YPOA 2HJSA 2PCLA 1ZIPA 2UYOA 4JB8A 3NGXA 1XHFA 3I3SR 1J8DA 3DA8A 2BHRA 3UK2A 5AVRA 3FCCA 1EK1A 2P77A 4DCGA 4G09A 2OD7A 3ZQJA 2QW0X 3BXFA 4PPYA 4RG6A 2GF0A 2BPOA 3AMVA 3U3DA 2YVQA 3EXG2 1NN0A 3P9PA 5CH5A 3QUAA 3KYBA 1ZGJA 3RVNA 4WOCA 4L8GA 3NT2A 3RJ5A 4HTFB 3JVIA 2HLPA 4CETA 1M67A 3PSAA 3IXMA 2V5FA 5G1NA 3LT0A 3B7UX 3GT7A 1OILA 3ZLTA 4Y9TA 5DIZA 3MMPA 4DCCA 3BWDD 5IU6A 4N5HX 5E7MA 3DW3X 2FRDA 3R0IA 3BCSA 2YS6A 1QM5A 5F7XA 2E7ZA 1O3YA 5CXXA 5B7QA 5THQA 4KIGA 3MEQA 4XVUA 3REFA 4JUIA 5DTQA 4NK5A 3FHOA 3LVRE 1KAGA 1LI7A 2R6JA 4EHNA 1PF7E 1N11A 3QIVA 5JNWA 1M2EA 5LU8A 4JEHA 3QB2A 2ENUA 3P2KA 4WBSA 2XSZD 1J90A 5CNIA 4N54A 5H3CA 1FDSA 1W0CA 4BE7B 1QGZA 4LJ7A 4Z0PA 2IU0A 3KXPA 5EI5A 5BXQC 1XU4A 2QF7A 2GF2A 3O4ZA 2W6MA 5F35A 4GMGA 2ZWMA 1ZC3A 3T0GA 1D1TA 3C3JA 2FW1A 4H7HA 2HT1A 1TZJA 3A9VA 5ENOD 1MR3F 3KKNA 2Q6LA 4JX9A 2B4YA 4O5OA 2GK4A 5COAA 3EZNA 1Z7BA 2WKWA 3WGVA 4DDVA 4IRUB 3VHXB 1PJBA 3W2EA 3WYFA 1DJQA 3BXPA 1E9AA 3MWDB 3GEGA 2LCIA 1PQ4A 3DXFA 2FSFA 2VRNA 4KITB 1U3GA 3F3YA 2AFRA 1HE3A 4K6HA 3ZDDA 6AT1A 3UAXA 4K5QA 2GD2A 2PS1A 3S6JA 5KTTA 4ZEOA 3NHRA 4YQYA 2AWIA 3W9FA 1AKNA 3J7TA 4J16C 2CNWD 2IYFA 3WBFA 1FB5A 3GRCA 3G5MA 2CL6X 4KT6B 1S9DA 1DX6A 3ESXA 3HBAA 2JG3A 1U1DA 3TR0A 4FR0A 3RNLA 3HCFA 4LKRA 3PNOA 1JW9B 5ILOA 3L07A 2WAMA 1SVXA 3RK0A 3HI4A 3A6LA 1ADGA 4ZAYA 3NVDA 1T8RA 5DX0A 4LDQA 4DLUA 2Y27A 1G9XA 2XGMA 5JS8A 3D4OA 4CR6A 4LXGA 4OY3A 2VF5X 3CY6A 3O21A 5DWDA 4AP9A 4DCPA 1E6LA 2IYPA 2D3TA 1DWUA 4ETNA 1WOYA 2BF4A 2VHZA 1C29B 3MAJA 3PFGA 4F72A 4YMHA 4WKNA 2OCXA 1E5DA 3LW7A 2NNLD 2A9FA 2QE6A 1XQWA 3QKSA 4WZBB 3BXEA 3T7KA 1DG3A 2ZT6A 3OOSA 2XXBA 3WMFA 3IKJA 1X1AA 3ZVLA 1BDMA 1QK5A 1QO7A 1SMKA 5J08A 2HWYA 4RD6A 2CN1A 3SM3A 5LA6A 2JATA 3MLAA 3UNXA 1RYMA 2FBNA 3SEFA 4YPFA 2PAFA 4ZCQA 2XPYA 1N5RA 3H11B 3CPJB 3STUA 4CE6A 3OURA 1AE1A 5KYYA 1D9SA 3IUNA 4QU5A 3D3QA 1T2EA 4IYPA 5J1TB 1RZ3A 5CPBA 5DNCA 4B46A 2JW5A 1BX1A 1KDVA 1AB5A 5AM4A 3URZA 4P83A 5MF6A 2UVQA 2GILA 1LBQA 3EASA 2VQ6A 2FJEB 1FTWA 1LWNA 1KSHA 5IX8A 1CRWG 1QU3A 5JAUA 2V74B 1WM1A 1X6VA 1XJWA 5D1HA 4X85A 4UQOA 5IAGA 4E32A 1V7PC 3KKKA 2AJCA 4JB3A 3ORHA 1HR0B 5KOJB 2A5JA 3PUXA 3G9QA 1KQ3A 3E35A 2LR0A 4MQFB 4OD0A 1DQPA 1CR1A 5LP6B 1MJGA 1N9GB 1P5FA 5AWFC 3A4NA 4O2LA 3QK7A 2VIIA 4LRQA 4R2JA 2HRRA 4LJ5A 3SEQA 3JYPA 4CM8B 1F4PA 3A9SA 3RI3A 4YJGA 3IHLA 4PC1A 1XXLA 4TUYB 1P0QA 3ABRB 2ZYIA 3WWDA 1QIKA 3L1UA 2Y1WA 2PX0A 4Y1RB 1FXSA 2LXNA 4QGFA 4HDQB 4MI1A 2OT3B 1QC5A 3BMNA 4JBNA 1LRJA 3DV0B 3H87A 5DIFA 3L7IA 3KKMA 2C4WA 1XR3A 2XEDA 3DWLG 2WP8J 2JIPA 5BN4A 5HS4A 3G2IA 3JD1A 4CEHA 1P81A 2ZJ6A 5KWDA 1E6UA 2FX2A 1DJLA 3TLKA 1WEHA 2P5UA 3L41A 4DA4A 3U5ZB 3HG7A 1IUPA 3LC0A 3DDCA 2W2LA 1J56A 4NK4A 1FXWF 4OJKA 1O5MA 1VYVA 2YHIA 1ZD2P 2I6QA 2G08A 3ONKA 5F98A 1P7YA 2IDKA 3I9NA 5BQFA 4G9GA 4EJSB 4OH1A 3MZ0A 3WOVA 4LJLA 4EHJA 4G1EB 1WPGA 3WWEA 5AQ9A 2Y6VA 3MILA 1M10A 3BOSA 2QTFA 2O7RA 3HB4X 4IIDA 4RLQA 1NGSA 3H1FA 4TV9B 1BEUB 1QIHA 2XWBF 1Q1AA 5IABA 4PGMA 4UHJA 2WU3A 4BFWA 4EBFA 3Q7AA 4WVLA 2VQ3A 3OIUA 2ZVPX 2PKWA 4UM5A 3HWRA 1PR6A 3RARA 3NB2A 4B76A 4BX2A 4R5MA 3PNLB 1ZCBA 4GTSA 3H97A 3IBGA 4XE5A 2O2CA 4NURA 2WF7A 4L8WB 2CHFA 4MW1A 3OKFA 1I1OA 1QKKA 3PF9A 3OMLA 4DMHA 3UCFA 4RLHA 2NXJA 2ISSD 1Q1EA 4HDRB 4RSRA 4DREA 3KLMX 3GOHA 4INJA 2FPOA 2ZANA 4BZPA 4B73A 3L0BA 3TQHA 3FCOA 5IEBA 4TRRA 4UNPA 3RODA 4Q4LA 4FOTA 2XVXA 4BPRA 2HFKA 3IUPA 3REQB 1WBBA 3OFNA 2DR2A 4EQ6A 2BMFA 4J07A 4DQDA 4CGZA 4YJ3A 6LDHA 4RV4A 4U0KA 1OX4B 1REQB 2W37A 5FPQA 1U0OC 2V9CA 5HTKA 2OK7A 5CD9A 2FUKA 1PGQA 2PUWA 2B8EA 2IEDA 4DR4B 3ZIMA 2NXCA 1DFIA 3O93A 3HKCB 1VCIA 3M2TA 1IOZA 1WMBA 5IYZB 5AOXA 1E99A 3H84A 3HYNA 2Y1OA 3QF4B 4EM6A 3DAFA 3PGJA 1J23A 4DXDA 1SURA 2GBLA 4KPEC 1M74A 1Z0UA 4DVJA 4B3MB 5JYEA 4DUIA 3DBRA 1XJCA 4HGZA 2OMEA 3RTAA 1ZRNA 3FP3A 4ZGWA 3VLDA 4RM2A 3FW1A 4XYMA 2X4IA 3HYRA 3CZ9A 1KPIA 1UK6A 3D6MA 1PL7A 5ALIA 5KZMB 3RANA 3JALA 4O0LA 4CG0A 1NQAO 2BGTA 3NRBA 4NMLA 5ISMA 1SZAA 1MJ0A 4KVAA 3BD9A 3OHPA 3ZVRA 1IEWA 1WTCA 4O4JF 1KO5A 2PHZA 2PFSA 4O2BA 4GZ3A 3WLKX 3ZV6A 3KLBA 4BT8A 1PQWA 3TZHA 4EKGA 1M0WA 3G3EA 5TQJA 4ZEMA 3KZCA 5G05J 2GB4A 3I61A 1R12A 2PUGA 5DYGA 4UAGA 4KR2A 1MNAA 2GSDA 4RDHA 3RH0A 3JRWA 4I66A 4X44A 3EEYA 3G1TA 1E2DA 4Z3DA 5EXTA 1M76A 3CO0S 4ETIA 1V5GA 2GLTA 2FQQA 4FINA 5CM8B 4A91A 3KJGA 4ARAA 4X1KA 3D0QA 3MWFA 3Q9LA 4JEUA 4QOEA 4O08A 5BUQA 3SI5A 2ZU6A 4GI3A 1N77A 2FZVA 1ZNYA 2AEMA 3PJEA 4R8VA 4YLEA 5B58C 3F0TA 2WMNA 2DYKA 4N3CA 1M2NA 2ZJ4A 1WDMA 2PX5A 2G8LA 1U9YA 2GAAA 3ZQ4A 3A31A 3HO6A 1JLLB 4I1OB 1XTZA 3B7GA 1KH1A 1V7QA 1R0XA 2OV3A 1SHKA 4E5MA 1YRLA 4BZZA 1R10A 1S2LA 1VI5A 4JI2B 3GDFA 4YT4A 4JI1B 4JVLA 1YVRA 3DYIA 1BTOA 3IKLA 3J81k 2V7TA 3Q5GA 3I1YA 5EWMB 1AMUA 4FFSA 3C5WP 3AWDA 4I5EA 5A7HA 1S64A 2OXEA 1I51A 3CRQA 1AGNA 3UMCA 4Z1OA 2Q49A 2EJTA 2R1TB 3R7LA 2YHUA 4BGIA 2VDWB 1XTQA 1XZPA 3TW4A 2MT9A 2VT3A 2QN8A 5CT6A 4HXYA 2B34A 4LXHA 4LMAA 1NJ6A 4JJIA 2H29A 1RADA 5EHQA 3ASYA 3ONLA 3FUMA 3L4SO 1RHKA 1H2BA 3AKDA 4HLCA 1W4AA 3SHOA 2J09A 5IJZA 2WJYA 4M9SA 2Q0QA 3EDYA 5KTPA 3D8UA 5T4BA 1MZVA 2XEVA 3EU5A 5KCZA 5J5VA 5AIAA 3ZKWA 9ABPA 2E0IA 4DNQA 2QJTA 2WWYA 3OFKA 3CE9A 4F96A 1H9AA 1UH5A 3ISVA 3MQ2A 2ZGVA 5DRTA 2AQ8A 3A70A 1WB4A 3ZWBA 2WYVA 1ZOSA 3AW9A 4YT2A 1BMQA 3AFOA 2ANCA 4ND7A 5C8DA 1NMQA 2P62A 3W2FA 3REOA 1ISJA 1JECA 2SCUB 4PEVA 3VHQA 4US1R 3AHGA 2PGOA 1TZBA 3KQTA 3OT4A 1C41A 2PPVA 4OJYA 5J90A 1KBZA 5DNUA 3GLRA 5FP0A 2AOXA 2JFWA 4R5HA 3NQ41 3FD8A 3B9PA 4GTRA 4W4TA 1I1HA 1BFKA 2QX6A 2SNIE 1TMGE 2Y1LA 1KT1A 1D1PA 4CRWA 4CEIB 3L6OO 3BILA 2I29A 2OFPA 2HCBA 4HSGA 4URYR 3QQ5A 1U3FA 3LCJA 4ZT7A 4IHKA 3GN1A 4D3YA 2Q7DA 4ZO7A 4A0GA 4MI9A 4A2QA 1CJCA 3RFCA 3T9DA 4PGGA 3G49A 3MIIA 3O4RA 2O9JA 4F8EA 3AR5A 5HQJA 4XTRA 3QFCA 2ZRMA 1KXJA 1E1LA 3T7RA 1JEYB 4LGYA 2EC5A 1KEEA 3RK4A 5HPYB 3AGPA 4N3AA 1Y1LA 2QTMA 4L5BA 1TNYA 3N3BC 2QRGA 3FB1A 4M87A 2ZM5A 3QWFA 1RHQA 1IOLA 2GEKA 3ZWDA 4ACLA 4WBNA 1VBMA 4MB0A 3NNSA 3PPXA 4TVOA 3NM4A 1QJ4A 3KHUA 3FTNA 4GAEA 4G8BA 1F4LA 1E1YA 3PGA1 3I8SA 4HVBA 2I7CA 3QPWA 1K27A 3MWEB 1RPNA 3G8DA 2HR2A 3RG8A 1QHHB 4HPWA 4JJEA 4HNVA 3EVGA 1QRUA 4HQRA 3CGGA 121PA 3ADCA 2NU6B 3FEYA 3TAXA 1MLDA 2KCKA 1L5NA 1CIPA 4LWQA 3JQQA 4EKEA 1DEOA 3ON5A 1W19A 1GU7A 1L5QA 1Z8FA 3T94A 2O19A 3QX7A 4IZHA 3FBTA 3K15A 5AQ1A 4OUDA 4M60A 1KEWA 3NB0A 2J07A 4IO0A 3HUUA 5LOVF 2WM9B 3ZDXB 4HS4A 4RFVA 4A2PA 2PZEA 3C6ZA 2C7BA 3C3OA 1HYQA 2JGEA 4Q7EA 3EODA 1FQWA 4KMSA 4U7EB 1LBEA 2JCXA 1T6YA 1YB7A 5AQBA 3TKYA 3TG4A 1JLMA 5LJLA 2FI1A 4K05A 1AGPA 1RWPA 1ZM7A 3UK7A 5EWJA 4EP1A 421PA 2F3TA 3OCVA 2XZPA 4AQYB 4I6JA 3LHDA 1Z88A 3VU0A 2JFQA 4PG7A 5BSUA 3TL2A 5HEKA 2BKVA 2FZLA 4DEYA 4ZVLA 4UMDA 4J3JA 3GGJA 3H5TA 2VEDA 1RBZA 3IALA 1P73A 2QY7A 1W47A 1P2UA 4F3NA 1QMPA 1VE5A 1I9CA 3KHTA 4O4LB 5JHAA 4O6VA 4IUDS 3ZK7A 3TUIC 1FSZA 4TYNA 4OG2A 4FZ5A 3QKWA 4MNTA 3D9KA 2J3MA 4KO2S 2O2DA 1XMOB 2EP5A 2OHVA 3EE6A 3W34A 2H2AA 1LDNA 1XZ8A 3L0OA 1LLDA 2NQ8A 4QU0A 4H1HA 4KJZA 2C2MA 4IIFA 1QBKC 3RBVA 3VR6A 1TTHA 2WXOA 2AB0A 2B1QA 3I4FA 4URFA 1YU6A 3N58A 2J9FB 3VM6A 5FL3A 2NQTA 1ESZA 4NIMA 2FCAA 4A8HA 3A05A 1CZKA 3IBYA 3EVNA 4NICA 3DBOB 5JZVA 3S7DA 5EYPA 1TRKA 3P0EA 2L17A 5HJ5A 3MD0A 3BUSA 1ZAKA 1QCZA 1HE1C 2BE9A 4GPTA 1C81A 3HPQA 4DW8A 1XMSA 4LJAA 1XEFA 3NHUA 2CFZA 3KK0A 3QFRA 3ANTA 3ABSB 2RCYA 4I2WA 1RIIA 2A1IA 3SGHA 1J5XA 5K3FA 3H2YA 1Y6QA 2WTAA 4F3TA 3H3XA 3N9IA 4OK3A 1KH2A 2DCPA 1Q6ZA 4G8DA 1YVUA 1YZFA 3NR2A 4G0OA 2G17A 3BDAA 3GRRA 3FPKA 2LUHA 3HWSA 5KOHB 5CB4B 3GH3A 1QGUB 1VFPA 2Z2KA 4CCYA 4LOKA 2FOLA 3TZQA 2DFKB 5TSDA 2VPZA 2JGRA 4MPPA 3NO4A 1K08A 1Z2DA 2MDTA 3DMPA 4RTOA 2PUJA 1FLVA 1A97A 3VAZA 2I8LA 1GKLA 5G4KA 1TO2E 1UBOS 4MJ7A 5IM5A 4YRKA 4AMUA 2YWHA 1QP0A 5CVTA 3V5NA 3MT7A 4V0LA 1SZCA 4G23A 4D97A 3R3XA 3PJRA 3G2KA 5FUBA 3UC9A 5A4AA 1E4OA 1FDRA 2WPNA 1BQEA 3KSZO 2ODTX 3V30A 1FW6A 1T4CA 2B2NA 5H9VA 3OQJA 4CI9A 1CX9B 2ZETA 2OHJA 3BQ9A 2IEIA 2YCBA 3PI6A 2BUBA 1HL3A 3ZIDA 5AVUA 4FFWA 2C54A 1A9XB 4ZT3A 3N75A 1HT1E 3QU7A 4Z1MA 3VLEA 3NBXX 3H42B 4IDFA 4MWGA 1BXRA 3C97A 3CVWA 2PLAA 2VA9A 4OFBA 1OWLA 1IB0A 2BI8A 3I5UA 4Q66C 5B6PA 1NXOA 2V45A 5EN4A 4B4DA 1FP7A 1Q7RA 1Z3XA 1FMFA 4KBQA 4RIHA 1C30A 1OX6A 4LERA 3UAVA 4RTMA 1KZ9A 4ZDKA 1FDOA 2W2OA 2YJZA 3N39C 1Y3FE 2OYCA 2JLWA 4MVJE 2O7SA 2F1IA 2W9XA 4A92A 2BFCB 1MJGM 2WDZA 3PHLA 2NX2A 4FLHA 1GJRA 2FEMA 2WAXA 4RY8A 1PDOA 5HF6A 4MQ6A 3OY7A 3THXA 1BAPA 2IZOA 5CX1B 4D0NA 1IZ8A 4FE4A 1NDHA 2YNMD 1TNBA 4JYCA 1B8NA 1Z7GA 1VJ5A 4F92B 2HA0A 4WWOA 2JIRA 2PGIA 4GMDA 2O7NA 4YV0A 1L4UA 3SQXA 3PV0A 3UH0A 5ESDA 3BAZA 3K8OE 2GNOA 2HZBA 2B9EA 2D1RA 4HP8A 1T2VA 2RGDA 2OAGA 1QONA 2X8JB 3CUTA 2OBNA 3IT1A 3D59A 1TUBB 2JEYA 3RJVA 4ESHA 2CDCA 2Y2UA 3PHBE 4G63A 4WWPA 4XSHA 1V26A 5AO9A 4FMCB 1WMFA 2XUHA 1Z4IA 2X86A 3WFJA 2XVYA 3SJCA 3TGLA 4ARIA 2FJDB 4A6EA 1RP1A 5JLAA 1U0NA 2GRLA 1M6EX 2AFHA 5FA5A 1HI9A 2PKEA 5FDFA 3ENVA 1WVGA 4LFBB 1VGVA 5LBTA 1CD5A 4TRJA 4ZQEA 2F0YA 3ZGXA 3AJ8A 4FX2A 1YS4A 1XAHA 5K45A 2XKAA 4RCYA 5ABPA 1DIHA 1QORA 4EG8A 1SQMA 4PO3X 3QYFA 2WZBA 5K8LA 4BMYA 5EZ5A 5HDBB 4OX9B 2G0NA 4EBBA 3DSWA 3TRFA 3SBXA 4X6XA 3ZY2A 3EG9A 3G8CA 1IHOA 5CH3A 3W6OA 2DUWA 4FJ2A 5E3IA 1ORTA 1IWBB 1UMKA 3RYFA 2E2WA 5ALLA 2PD3A 1EK6A 3DSSA 2ZGGA 3BIOA 4PLWA 3G7UA 1YO6A 2GTPA 2PDAA 4F2GA 2C5BA 1SCDA 2X5TA 3HXTA 1PI3A 1EGHA 3TQIA 3W6NA 4OA5A 1A8SA 3OJEA 1UBMS 1CUJA 1P5JA 4DV3B 3MM4A 3WAGA 4OBEA 4EI2A 2AXNA 2AJDA 3QVUA 1QJCA 4RZIA 4KDFA 1KY3A 2FRXA 3G1UA 1OAAA 1L6IA 5AD1A 3A0RB 4D9MA 1RYEA 3GVCA 2PZJA 1DBPA 1GN8A 2OXFA 2QVYX 4QWWA 3AHFA 1RS0A 4GBGA 3U7QB 3BL6A 3ZHQA 2XZDA 4UREA 1SA0A 3DTVD 1VHWA 1LBTA 2BMVA 1QFSA 2QN1A 2GBLC 3HO1A 3CXUA 3RIHA 2X6HA 4UWGA 3T4UA 4BQQA 3OCXA 4QIHA 4AJIA 4A2CA 5ALKA 3ZIAA 3ZCSA 1JGTA 4MMXB 5CDSA 5AUQA 1EZ1A 3T12A 4WFQA 2ZUEA 5KNLA 1HLDA 3VJMA 5K0LA 5HFNA 1BVUA 2CXHA 2R66A 2EJCA 3NV7A 5C5IA 1NMSA 1KU0A 1YHYA 4UQYA 2DRIA 3EIHA 4H6XA 2AI2A 1I5OA 4BNMA 1FYEA 4KR6A 3SDBA 4PNEA 1FC0A 2X15A 3E33A 1ZMOA 1YUMA 1L4EA 3A1UA 4NQ0A 4O3FA 4X7PA 3E5MA 3YASA 4MV7A 3W7VA 1THGA 1WD7A 1MDBA 3P71T 3ANSA 5CLGA 4PYRA 1X7ZA 4NHEA 3O6VA 2W6IA 3H9BA 4JMLA 2E9SA 3MXOA 4NDZA 2GRPB 1NLYA 3T5DA 2F6RA 3QEMA 1Q15A 4AP5A 1Z8NA 3RKSA 2YV2A 1W85A 3RGWS 2JKZA 4LJSA 1U81A 1GEEA 5A3JA 4LSZA 2HJVA 4GOND 1NXQA 3E70C 3TCXB 1W34A 1UR5A 2H9IA 1SU8A 4QJ3A 4HDCA 2WMDA 3UK1A 3IDQA 1BCRA 3LT4A 1M66A 1NASA 3KQLA 5L40A 4ICIA 3ILXA 3GQBA 2VEOA 1I80A 3K20A 3AM4A 1M9NA 1T29A 1W88A 3P97A 2C4KA 4P92A 3P0IA 3TJMA 1C4XA 3RV4A 3CVUA 5HFAA 2BVNA 4MINA 1W8IA 1WB6A 4B34A 2FZ4A 1YDMA 3W5SA 1Z2NX 5CDTA 2V0GA 4FEAA 2BEDA 5F7OA 2DZNA 1UAGA 3R8CA 4Z2YA 1K0FA 5DGIA 3HGMA 2WW8A 3PC8A 1ABBA 3PFHA 1RI1A 3INRA 5CK5A 4I9GA 1OXVA 4PLGA 1NVKA 1QO9A 1GSIA 3UATA 2R5NA 4OOEA 6Q21A 1P1HA 4TPKA 3ZTWA 3W3AA 4HF7A 3OMSA 3IGFA 4W9RA 4H7PA 4XWOA 2G04A 5ANRA 4IJMA 4W5RA 3AR7A 1KFJB 4BJ3A 2R6HA 4CFSA 2GCOA 4QBHA 2RHMA 2DWPA 4F4UA 4C7KA 2ZZNA 5E9AA 1HL7A 4FQ7A 3W5AA 3EDCA 3QKRB 2RD0A 3IBTA 2D0PB 3NT5A 5L7YA 3K0EA 1N52A 4K9RA 1S3GA 4D9KA 3DTVB 3PXBA 3EGCA 1U2VG 3Q7SA 2ZISA 4Q3DA 4JI3B 2EG5A 5CXSA 1JXMA 2APJA 3DT8A 4PZLA 1DVPA 1VE7A 3B36A 5FBWB 2J59A 4OXNA 2JJ2D 2CFRA 2KWIA 1SCBA 1YH3A 4TTSA 4P4NA 3IAHA 1F2DA 2OB1A 3W4JA 4MVJG 2H7VA 3IP9A 1I01A 4EKYA 3R7WB 1AKWA 4ZYYA 1HPLA 3JASA 1JCQA 5AVJA 3R0QA 5GGYA 3MBIA 1FPPA 3FSGD 5F2KA 1JG2A 4REQA 4FC8A 3UF0A 3IQEA 3W5DA 4JLPA 4Q0MA 3NPMA 4GTVA 2A58A 1DAEA 1A5SB 3M6AA 4HRLA 3NHYA 2PV0A 2WDPA 1SUBA 4GF5A 1MTZA 1MVNA 4J03A 4JPSA 5C34B 4DUGA 1V4NA 4EY8A 3NHPA 3GJRA 3DVSX 4LBZA 4F6LA 621PA 1TMYA 3L0CA 4LTDA 5ITZA 3VVLA 2C7GA 5ELXA 4D0RA 4UHEA 3D9JA 3ZVNA 3EWIA 4KXMA 5IC6A 4BMVA 3VH3A 3VBCA 3NKLA 1G4AE 4MITA 2PSSA 4YUYA 2FN8A 5FZQA 4U7GA 3TD9A 4C4OA 1M8GA 1MPTA 3AS8A 3R5TA 3OJCA 3DHVA 1R5NA 4PX2A 2KI5A 4D44A 3RS5A 3PTZA 4RX1A 3I9FA 4PN7A 1EDEA 3UMGA 3TFOA 2X0DA 3OE1A 2II6A 5DP2A 3LKUA 2JLVA 4QT0A 5TMBA 1QF7A 5AVZA 1W36D 3LYHA 1CWUA 2PG3A 3AV3A 4Q4DA 3OF2A 1JILA 2R1VB 2YWJA 4FFBB 5A6SB 2PSDA 1I13A 4NOKA 3LXMA 2GRJA 3V4SA 5CBPB 3WYBA 4U0ZA 2W2KB 1DKPA 4NMXB 4GWKA 2HRZA 5EL0A 4BCCA 4F6CA 2J9XB 1U99A 3G82C 4UUMA 1J70A 4A6PA 2IUUA 3UK6A 4C4AA 5FQOA 5IBRA 4OHRA 1P72A 1PQYA 1KK1A 4CGYA 1S96A 2PL2A 4BQFA 4R51A 1T0IA 5ER9A 3RFUA 2X77A 2GVNA 2TSYB 1O96A 2ZT5A 3OCYA 3ZR4B 3DZDA 4EHHA 1LLFA 1HFKA 3NTOA 4FEEA 3H9JA 3QOYA 3V2UA 1JA9A 4I3FA 5KSOA 2WXRA 4P29A 4XUCA 2C0MA 2LO6A 4O1OA 2EWMA 3IR5A 2FJAB 4Q9DA 1DO8A 3TDKA 1V6SA 1LZKA 3QOWA 3FVRA 2DOKA 3FPFA 1WTAA 4UJ3A 2P9PG 1QVZA 5ARGA 2ZRIA 3G68A 1V39A 2IRWA 4E5KA 1UDCA 4KH0A 3RRYA 1NZDA 1ICIA 3TR5A 2IPAB 821PA 4U6QA 1EJ2A 3NVMB 3L4EA 1T2AA 3CIAA 2IDMA 4HB0A 5T4EA 4KOEC 1XZHA 3HRAA 4MOWA 3FWVA 2ZAGA 3M6LA 5EJ9A 1WOMA 2R8YA 2BEJA 1AQLA 1T9AA 4MR8B 1NRJB 4MAMA 3DE0X 1FNCA 2AN9A 3JQCA 1TCCA 4JSTA 1VQ1A 3HY4A 2NU8B 4I9FA 4RXUA 1EGQA 3K1TA 2IIPA 3WFZA 2O5VA 1YB4A 3D6UA 2C8VA 1E7RA 3R6DA 4ZT2A 3JQRA 1CFJA 3DZCA 1LCIA 4RV9A 3R7NA 4L95C 5CG1A 1LTKA 1C9DB 3W7BA 1VZ3A 1DG1G 2FUNB 1ZXXA 3DXXA 1TM3E 4DV6B 2J3DA 3UMSA 2W5UA 5JDIA 5B4VA 3ZUPA 4CT4B 4QQRA 4Q4HB 4TWAA 3T52A 2YX1A 1CRLA 2YN2A 3OPYB 2XD4A 3VBEA 1C9MA 2YR0A 2EZ8A 1E69A 1UANA 7REQB</