4N39A

Crystal structure of human o-glcnac transferase bound to a peptide from hcf-1 pro-repeat 2 (11-26)
Total Genus 283
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
283
sequence length
716
structure length
697
Chain Sequence
b'CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
molecule tags Transferase/substrate
source organism Homo sapiens
publication title HCF-1 is cleaved in the active site of O-GlcNAc transferase.
pubmed doi rcsb
total genus 283
structure length 697
sequence length 716
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n39A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n39A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4n39A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4n39A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n39A03
3MS2A 2GEJA 3IEGA 3WAGA 1GPAA 3OXFA 4N39A 4AIFA 1Z6PA 4Y6WA 3L01A 4F3VA 5D00A 3VDMA 3ZHEB 1L5SA 1YA0A 3OKAA 3ZCUA 5CHEE 1RRVA 3L79A 2QN3A 2VSNA 3SYRA 2UY1B 3CV0A 1F6DA 3O3CA 4NQ0A 1XL1A 5DIZA 2R5SA 3ZCTA 3HBMA 3ZN3A 1FU8A 4GYOA 3UQ3A 1FS4A 1KT1A 3CKBA 1VGVA 4L22A 4REMA 4AN4A 5JTUA 3C4QA 5DU2A 2QN1A 8GPBA 3FROA 1WW2A 5LQDA 3CVLA 3DDWA 2XA1A 4GA2A 4YUAA 4HOTA 3U3WA 2YQ8A 3DD1A 4UI9C 2XCUA 5LCWJ 3UYKA 3ASHA 4U0ZA 3S7JA 1Y8MA 1YGPA 2F3PA 2HY7A 1GPBA 2SKCA 3GZ2A 1Y6FA 2L6JA 3HBJA 2FFRA 4J8FA 3BCRA 3CX4A 1PSWA 3MS7A 4WNDA 2IV7A 2I6HA 3S29A 1P4HA 1KT0A 4GZ5A 7GPBA 2VGXA 2C1ZA 1F0KA 4KBQA 1GZ5A 3BD6A 3SF4A 2VYIA 3OKPA 4F97A 2XCCA 3PDNA 1NZNA 3CEHA 2C1XA 2G9UA 5G05J 4RG9A 3ZPJA 4MI6A 3WADA 5D01A 3Q15A 3Q5MA 3LY9A 3U4TA 1FTQA 3HBNA 9GPBA 4ABNA 2QZSA 3HBFA 3QDNA 1C8KA 2X0EA 1AHPA 4XIFA 2XGMA 3S7FA 4BQIA 4G25A 4N3AA 4MHSA 3ASGA 3MA5A 2J9QA 3CK9A 1GPYA 3TG5A 2PL2A 2G9RA 2BUGA 2JZCA 1JIUA 2F3SA 4MRAA 2MHKA 4RELA 1Y6GA 4JL0A 2XMPA 4KYOB 4RIIA 2KCVA 3NC4A 3IA7A 4NC9A 3D1JA 3MRTA 1PYGA 2GPAA 1FU4A 1RZUA 3OY2A 5JJTA 2DBAA 2XEVA 1IIRA 5TMDA 1QKJA 3UUXA 3CEMA 5JJ7A 2O6LA 1SXPA 2IEGA 2H1FA 1PN3A 3RU0A 2FI7A 2ACVA 3WC4A 1IYGA 3E4BA 3K9IA 1ABBA 1PNVA 2XPIA 4J8EA 3URZA 4AMGA 4G23A 2XCBA 3BEOA 1JG7A 4N9WA 2Q7FA 1EM6A 1QQEA 3OTGA 4BQFA 2UY1A 2IUYA 3TSAA 2KCLA 3VTYA 1XKXA 2IFUA 2GM9A 3BD8A 2XGOA 4YI5A 3KAEA 3S7BA 2GT1A 2YHCA 1ELRA 1JIXA 3RJVA 2X6RA 3QWPA 4LEIA 3ZCQA 3DZCA 4KQMA 2ECPA 2SKEA 4NEQA 2R66A 2QNBA 1QM5A 2P6PA 2JLBA 2FEZA 2P58C 3CK8A 4APOA 4MI3A 1NLMA 3WXXA 4YVQC 3T3DA 2ONDA 4CTMA 1B4DA 3SYMA 3Q47B 2XGSA 3NAZA 3Q3IA 2Y4UA 1ELWA 2E2EA 1XV5A 4X7RA 5DXFA 4G1TA 4G26A 4GYYA 3RKVA 2Q6VA 3L7AA 2KS6A 2PQ6A 3T3HA 5ARGA 5KJKA 3BDAA 3DDSA 4WNEA 3MV3B 3S2UA 1P4GA 3QHPA 4CGVA 1WW3A 2X0FA 4J8DA 3HYMB 4GCOA 5LCWC 3CKCA 4N2QA 1UZUA 4CTOA 4CTNA 4H7XA 1L7XA 1FC0A 3H4TA 2BISA 3FP3A 4J0UA 5BT1A 4N2SA 3G2JA 2LNIA 2XA2A 2PRIA 4QLBA 2QFCA 3QWWA 4NESA 5CCMA 2YJNA 3ESKA 2Y4TA 2QLNA 1E96B 4MHOA 2KCKA 3GUHA 4AY5A 3OT5A 2G9VA 2GEKA 3E3OA 3COPA 2AMVA 5EKQD 5A7DB 4X7MA 1UQTA 4RIHA 1WAO1 2X0DA 1L6IA 2IYAA 1WM5A 4LDPA 3SZ7A 5D0QD 4I1AA 4BWRA 4RIGA 1OUVA 2C4MA 2JJMA 4AMBA 3LPZA 3MBOA 5KJNA 4WNFA 5G04C 3KD7A 3T3EA 1GFZA 2C0MA 3E3LA 2KATA 3GZ1A 4I9EA 1A8IA 3G2HA 5D0OD 3QKWA 5FZQA 2QRMA 1Y8ZA 2V5FA 3D0RA 3OTIA 2GPBA 4HOSA 2QLMA 1IHGA 3CUYA 1JEJA 1A17A 1GGNA 3OXLA 4N3CA 3TOVA 2FF4A 2C0LA 3Q49B 3Q4AB 3E3NA 4BTAA 1FTYA 3MTAA 4G2VA 1P2BA 1UQUA 4EQFA 3UYLA 1NOKA 4FKZA 4KQ1A 3VDNB 5BW8C 4HOQA 4AM9A 4EJ2A 5BNWA 4PQGA 1C3JA 1V4VA 2G9QA 2QRGA 2KC7A 1YA6A 2BGUA 1TJCA 4LEUA 1ZBPA 1P4JA 3R9AB 1FA9A 5TVGA 4F9FA 3GPBA 1NA3A 3VUFA 1PC2A 1H5UA 3L7BA 1WV1A 3JYSA 3MQFA 3N71A 4GPKA 2VSYA 4Z5XA 2LSVA 4N5CA 4BQEA 4MI9A 1QZ2A 2NC9A 1GG8A 3S7DA 4F96A 3CVQA 5M72A 3T3IA 3AS4A 4EKEA 1LWOA 3O48A 1NVKA 4NRHB 3G2LA 2OFFA 3FWVA 1NOJA 4EL5A 2VGXB 2ATIA 2ACWA 3IAAA 1W3BA 1RZVA 2AVPA 1C50A 4W9RA 4MICA 4KQ2A 3L7DA 5GPBA 3LKUA 3AMVA 3Q3EA 1ZU2A 4YI3A 4I2ZA 4X7PA 1JG6A 3T3GA 3MTDA 2H1HA 2R60A 2VCEA 2IW1A 5A6CA 1HLFA 4RIFA 5FZRA 4M60A 1IXYA 3S27A 4GZ3A 2XCIA 5AYWD 2XA9A 3C48A 3ASFA 3NPAA 3MKRA 2PQRA 4UI9J 4RBNA 4EL0A 2SKDA 2UWJG 4WHMA 4JHRA 4B94A 2BGTA 5CCLA 2F3QA 2R68A 3L7CA 3NP9A 2LSUA 4I9CA 3G2IA 3MRXA 3Q3HA 5ENZA 5TMBA 3ZFWA 3LY7A 4YVOA 3NB0A 2HO1A 1NOIA 3KS2A 1E1YA 4G24A 3TGOA 3MS4A 4BT9A 2VQ2A 5FZSA 2PRJA 1HXIA 2OOEA 3VUEA 4BTBA 3RT1A 2BFWA 4G2TA 4BT8A 4CDRA 3CUTA 2QRPA 1J39A 1XC7A 2IYFA 4JA9A 5FT9A 1LWNA 5C1DA 1WUYA 5JTTA 2AW3A 3OXGA 5ARFA 1K06A 3OTHA 2C2LA 4W6QA 2QN8A 3CUUA 4M7PA 4RG6A 3TG4A 4XI0A 3S0JA 3CEQA 3QOUA 1O6CA 3LY8A 1K08A 4X6LA 2F9FA 2AV6A 4YNDA 2FF5A 4WACA 4RENA 3CK7A 2IEIA 1C8LA 2QN7A 3LYAA 4GA0A 1XNFA 4ME2A 4U07A 2VCHA 4H7YA 1BX3A 2R4TA 2FBNA 5JJ6A 3EDTB 4O6FA 3RIBA 3CUWA 3NCHA 2IF4A 3LCAA 2PYDA 3MTBA 4HORA 2PQNA 4WADA 2IV3A 3TAXA 5HQ8A 3BCUA 1SXQA 3QWVA 4GA1A 4GCNA 2QN9A 3NP7A 3ZCRA 3ZHEA 5FJYA 1Z8DA 4GYWA 1P2DA 3CV3A 4HWGA 1HH8A 3MSCA 2FETA 3BEEA 1XOIA 3H4IA 1KTIA 5DBKA 1Z62A 5EX0A 3PE3A 3RSCA 2GJ4A 2VG8A 1M5RA 4FZRA 1KLXA 3MT9A 3CUVA 2QRQA 3RSZA 3MV2B 3T5TA 2HR2A 2ZB2A 1Z6QA 3GW4A 2VGYA 4WNGA 5DLDA 3ZCVA 4XI9A 3RO3A 3T7DA 1FTWA 3PE4A 3QKYA 3FFLA 4I2WA 2F3UA 2WTXA 4WUYA 4GPBA 1EXVA 1L5QA 3EBPA 4HOUA 4N3BA 4UQZA 3D0QA 3RHZA 3ULQA 2QN2A 4I17A 1NZDA 3BD7A 2GPNA 4IN3B 1L5RA 3AS8A 3OY7A 1WV0A 4U0SA 1XL0A 2PZIA 3MEKA 6GPBA 4JA7A 4UQXA 1L5VA 4GZ6A 3ASDA 2AZDA 4M83A 4KXKB 5IKOA 3RO2A 1AXRA 3CEJA 1P29A 5HXAA 3NF1A 1L5WA 1P5QA 4EKYA 1HZ4A 3MT7A 3OKCA 4U04A 5I45A 2WPVA 5G05C 3GYZA 3CVNA 3EBOA 3S28A 4HLNA 3CVPA 5EX3A 1JIVA 2PYIA 4U0UA 5G04J 3BCSA 3G2NA 2C9ZA 1E4OA 4BFCA 2GW1A 2QRHA 5IKPA 4Y6CA 4A1SA 5KJLA 2WQHA 4UQYA 2ASVA 5FTPA 3VTXA 2X6QA 3C4VA 3MRVA 5HI7A 1FU7A 2R4UA 3AS5A 1NA0A 3ZCSA 1WUTA 5KJMA 3ZGQA 2QLLA 3MT8A 3UPVA 2FO7A 4AY6A 1P2GA 3G2KA 1B89A 4CGWA 3ZCPA 1FCHA 4RIEA 2HYZA 4UI9K 1NZFA 5TMEA
chains in the Genus database with same CATH superfamily
1ZKMA 2RHTA 1UJRA 2I62A 1DOAA 4XGIA 3VNRA 1GPAA 1HFWA 2JS7A 1DPGA 1M2OA 4E94A 5DN6A 3E1SA 3PUWA 1C8VB 4OXYA 3WMGA 5LYJB 1L4HA 1VYVA 4UWLA 4KLRA 3TZQA 2M1XA 3ZCUA 3LDHA 1YBAA 3A36A 1CE8B 4GZDA 1ESDA 2WJGA 4W1RA 5LUBA 4CDGA 5BV8A 2CF6A 3P2OA 4JJEA 3TD9A 4UBKA 2BUCA 4KXVA 3PZ4A 1N32B 1NMYA 2GZ2A 4X6UA 3PDIB 3NYWA 3K9HA 3DSRA 4AS1A 1E0DA 1P7CA 4CQLA 5KWDA 2IO2C 1WAMA 3X2FA 4L5JA 1DDGA 2ZTMA 9ABPA 1PDWA 1TEXA 2CKDA 3A3OA 5AVWA 1JHOA 3U56A 2C8VA 4C6SA 3DE2X 2XCQA 1JSXA 4IKEA 2HNAA 3U4AA 4BFUA 4OQYA 3A9CA 4CUJA 4GAAA 3H2HA 3FOZA 1ZS9A 3A05A 3HU3A 3IIMA 1U9JA 3JYQA 4MTLA 5GV7A 1NBWB 2JGNA 3EHDA 3TUJC 3O9MA 3AC0A 1SBCA 3VO2A 4ZU1X 4LSGA 1T5OA 2AJAA 3AB7A 3AY6A 3K1JA 2L0TB 5CA0F 3K05A 1YZFA 2XOKA 3D7LA 1YB7A 3KAPA 4YB8A 3MS7A 3TBHA 3G82C 4IIJA 3Q12A 1VIAA 4RANA 4L4ZA 1HI9A 2ZRLA 3DVQX 1B8OA 1H69A 2CLKB 1YAJA 3LOPA 2MMGA 2WSSD 4QT0A 1Z13A 2HIHA 2XDWA 3AKEA 3CR8A 3R6WA 1GZ5A 5T4HA 4DN6A 1ZUNA 5JMOA 3B38A 4JYZA 3H2IA 3ZWCA 1YB6A 2WIGA 3FNQA 4JUAA 5FOXA 3UVEA 5G05J 4MI6A 1USGA 1L1EA 4X1OA 3TOCA 4DABA 2QZSA 3AVUA 4W9MC 4AVYA 3ZWYA 4MVJI 1XCOA 3KQMA 3R3ZA 2IZ0A 2V59A 3SJCA 5IG2A 1RC8A 4AJOA 4HMQA 1MIOB 4YRSA 2PGDA 4MAMA 5KZMB 3HG0D 2V4LA 1IVYA 1Z5GA 3VMFA 1XA0A 1GNSA 1NLFA 3HCBA 5HIKA 3A9TA 4LJAA 5EUCA 3FI9A 1SIOA 3GRYA 4BATA 3QTTA 1VJ0A 2B8TA 3QXSA 3CLSD 5IUNC 3A11A 4O4HA 3PCTA 3UV7A 5EVCA 3GT4A 4I8IA 3F6EX 4IHKA 3WSTA 3C6BA 5EIWA 2DUNA 3D6VA 5SICE 3U4GA 3VOTA 1OLUA 2XVXA 2XR1A 3BB3A 5J9FA 2YXBA 3IDZA 2YICA 3ZIUA 2CFTA 4WKCA 4EQ6B 4I1VA 4B3SB 2XEVA 2RE8A 2OEWA 3PLAE 3CJTA 5LCXA 3R5XA 2JGMA 1P3Y1 3H86A 3HN7A 1QE5A 3TLJA 4C6RA 1JBEA 2WKQA 1CVLA 2J0VA 1KJJA 4BVEA 1Z56C 5FYDA 2FI7A 4BERA 2HWWA 1RYYA 1N5MA 1YV9A 2Y68A 3HKBA 2JI7A 3WC4A 5E4YA 4CT4A 3FZEA 3BE8A 1PNVA 1K3TA 4G1CA 4IBOA 3IMFA 4NAHA 1VCHA 1U2ZA 2ZU6A 4RTKA 4W5NA 2DR0A 4DV1B 1NQWA 4ZCLA 4NZNA 2HRCA 4V3CA 3FCAA 3GDWA 4QJBA 3GLFE 1YK1A 4F06A 2AJ8A 4IJUA 1K3UB 3LQQA 3B3GA 3TUZC 3F6CA 3U3DA 3FH0A 5BR8B 4J1TC 4O8CA 4K6OA 4R8RA 3EGDB 3WDKA 2DFKB 2WXLA 3OEEA 5CDUA 2HSWA 1LDMA 1S9DA 4OXNA 4DSAA 4P7FA 4CEHA 1Z17A 1JBKA 3WB1A 1ZRHA 3ZS8A 4XSVA 2ZBPA 5ICFA 2X6RA 3F8WA 4MV8A 1YDFA 1VB5A 1R88A 2GJSA 3B1WA 1NMXA 5LB4A 3I1YA 4AS3A 5ENRD 3GLHB 3D8TA 4C5AA 4E5KA 2GEDA 2WTEA 2JLBA 4EUNA 2KSQA 2WC1A 3JATA 3MGCA 5TXGA 4PG8A 3NG1A 3HLTA 2WABA 3W9YA 4CLOA 5TEWA 3MD9A 2EIKE 4CKCA 3EHQA 1ZYUA 3LUAA 2W11A 4R2KA 1HTBA 3TMKA 1HR0B 3K70B 2NU8B 4DLSA 4RVCA 3Q47B 1RBYA 2XGSA 1XHFA 2HSGA 4E5VA 1ZA1A 1ELWA 2Z3ZA 2VNAA 4DIBA 5AVQA 3KPUA 2BM9A 3PEWA 4OQMA 2LWIA 1EHYA 2EHJA 4TKZA 2O8CA 1C1YA 4B09A 1DRKA 2IYNA 5DP1A 4CMJA 4W7IA 3JD0A 3OQVA 2O8DB 3MV3B 3DSWA 1B2RA 1NP7A 3KUCA 3L0OA 1X74A 4FGZA 1X1CA 5ERYA 2F8XK 2X3YA 3CFYA 3GEEA 4BO4A 1PNTA 3KQTA 5DYGA 3VV3A 1MZVA 1T9BA 4I4CA 2CLMB 2V6MA 3VPHA 3HJNA 1HDRA 3JQ9A 4IZOA 1WXGA 4H1HA 1QFSA 3E9NA 2QSZA 4N2SA 3G2JA 2GSDA 1QGDA 4C08A 1JWLA 4YCLA 1A95A 2DLCX 1WCV1 2JZOA 3NLLA 4V03A 4Q1BA 1QC5A 5TJHA 4ZVLA 4C0WA 4GU5A 2QFCA 3B5IA 2B6NA 3W0LB 3G68A 3VU9B 1NG1A 4YRJA 1ESNA 1KI7A 2QLNA 1P9LA 3AXSA 3D8BA 3GDFA 4A3SA 5AW6A 1YHZA 2Z2JA 1SUAA 3ORRA 1MHTA 1RRPA 3IV0A 2WXJA 2GEKA 5ELMA 4EARA 1R6XA 1KZ4A 1S9HA 2X1HA 4PLHA 3EPLA 1H1TA 1LVHA 1YMQA 4UHJA 3MWYW 1VC2A 3WZLA 1OGYA 2Q4TA 5BNTA 1Z6AA 3CN7A 3QMWA 1SK8A 4OI4A 1EG2A 1F7UA 3PIRA 1WM5A 1WY6A 1YGYA 2BEVB 3EUVA 4KQKA 3CX3A 2R0QC 3HVKA 3OZVA 3P7MA 4LRYA 5DLQC 3EZXA 3KXPA 5CA1B 5CK4A 2AHOA 2NQ8A 4G1VA 4X1IB 5JD6A 1JHAA 4LJSA 3SHFA 2IEYA 3M6WA 4RXUA 1XZNA 3BQ9A 4ZVTA 4A3TA 6CHYA 5CA0B 3WVNA 2CHWA 5I8WA 4WNFA 4R54A 5DYIA 3C3OA 2QMYA 4O3MA 2Y05A 2FEOA 3G0DA 4Z4CA 1WETA 3MJRA 1TEZA 4J2HA 4L4YA 3WGMA 3SLRA 4QG3A 1YDHA 5I3CA 1US8B 1VPWA 4A03A 4RVGA 2K2WA 2Q3FA 2C2KA 3N70A 4RF5A 4CEIA 1NG9A 3CM0A 4Y2UA 3NI2A 5G4KB 1MP0A 1P0IA 2EJTA 1U5BA 3D6HA 4PYMA 4FU3A 3TLCA 3ST7A 4XE0A 2GPBA 1EIZA 3GGDA 1FUYB 2QLMA 1IHGA 1V96A 2D1YA 3GOQA 5JPDA 4B5LA 1UAGA 1XTRA 2NO7A 2WM3A 4FZ5A 4INZA 3S2GA 4FPXA 4LF4B 1QJCA 4IH4A 3ESRA 1BO6A 3LF1A 1B42A 5KYWB 4K3UA 2WSMA 1AVTA 4Y3UA 2VP4A 5FOWA 3ZR4B 4Q6BA 1L4KA 5E1BA 4U7EB 1T1JA 4G5OA 3VR2D 1XDBA 1KJWA 3W77A 4ZHQA 4M1KA 2C0CA 3GDGA 3O2QB 2Z8YA 3CKYA 4EH1A 4A15A 4EQFA 4URUR 2IHVA 4F0JA 1J0DA 4BLWA 1NQAO 3B5EA 4PWZA 3D8NA 3HCPA 1QAOA 1OY3D 3E5MA 2C42A 1FJGB 1GKKA 4PQGA 3G8YA 4Q6WA 4TXJA 1U28A 3IB6A 3RLIA 4PXAA 1I3OA 4JENA 3L6AA 4DRYA 1QCDA 1IONA 4OGFA 3T34A 1GYRA 4AZ0A 3KEZA 3OO1A 3GGSA 5J4VA 3NDIA 1Z0DA 4R2IA 3JYSA 2FPIB 3DVAA 3N58A 4MRRA 5AKLA 3R9XA 1LDYA 1SHKA 2X0NA 4KLCA 1YRAA 4JB8P 4KVFA 4M0KA 3T9KA 2WPNA 2O8NA 4GWGA 1WUHS 4A2CA 3ZY5A 1N3IA 3ZYMA 1NN3A 1EJ0A 1UXOA 1XTPA 1TIPA 2J67A 3Q40A 3U7GA 2IBSA 2VTBB 1PX0A 3WKEA 1CUBA 4A8PA 1NQUA 3W1EA 3DO8A 3PL1A 3CLUD 2ETAA 1MPTA 1ZNYA 3RS3A 3N8GA 2JGRA 1JEEA 3NB2A 1V3VA 3RSEG 2DFVA 4QREA 4S3MA 3K1YA 1USWA 3G2LA 2ERXA 5BXOA 5ALQA 3PFIA 5FOSA 3UJ8A 4AIIA 4BMXA 6NULA 1JL3A 3Q8LA 4UTZA 4ZYXA 1U0OC 2E1RA 2ZTVA 2Q62A 1MMFB 3H17A 1MGPA 3IRVA 4NYMQ 1OCEA 1UUFA 2C9DA 3DE0X 1V9CA 4PAOA 4RW0A 1UN8A 1SBYA 1RM0A 2ZBQA 3AR9A 2R60A 2IXGA 4JT4A 4FKBA 4Q4DA 3ROXA 4C0QC 5G1PA 3U3ZA 3IE0A 2SCUB 3SC4A 4M60A 4WOKA 4DCJA 2CNWD 1SCQA 4BVHA 2E18A 2XCIA 4EJSA 4OREX 2XLCA 3NXKA 5KJ6A 1CIPA 2PNJA 2MR5A 5KQSA 1KFBB 1YR9A 4IMJB 4DT1B 3OFND 1KJNA 3TSOA 3PENA 2QBYA 1BPOA 2R00C 2C3UA 2YOFA 2B7LA 4UI9J 3OP1A 2IXFA 2AOWA 1DRUA 5AK6A 4ZKEA 5KOJA 3I9OA 2VUSA 2FCRA 1CJVC 2ILVA 3VHXB 3L6BA 4F4HA 4TN1A 3CMCO 4UE2A 4EG4A 4PFQA 4JHKA 1Z06A 4JHJA 3HB4X 4LUCA 1KMQA 5AUPB 4UJ3A 2VJOA 3OE1A 3L13A 2D3WA 1UJCA 2EWMA 2RGAA 1IPHA 3EUAA 4UXHA 1UH5A 1HLGA 1NPDA 2ZYHA 1A04A 3AHGA 4I5EA 4ZCQA 2E4VA 4IX1A 1M2KA 1LXCA 2JFBA 3G9QA 2PH5A 3IUQA 4RHCA 3EGWA 1JFFA 5DT2A 3GFFA 3BVPA 1MAUA 1JVSA 3GGPA 1GO2A 2CNNA 1CEQA 1U3DA 3TTSA 2R6JA 1JR4A 4HAVA 2WAMA 1I14A 2WTMA 2Q2OA 4FOSA 5JXWA 3BL5A 1UKZA 1E1CA 1WE2A 1HF3A 3EVGA 1XTJA 2YRXA 5L7YA 4GOOD 4LVUA 1ZH2A 1M1XB 3CKMA 4TOIA 3HDGA 1S8FA 3HV2A 4W6QA 1U0HC 4HADA 2GBGA 4TGLA 4ZVNA 4RG6A 4HPWA 2NW6A 4W63A 5THKA 5JISA 4BVAA 3C6KA 3GAZA 1NAHA 2VJ8A 2YOGA 5JCOA 4BQRA 3RC3A 5K2OA 4M9UA 2Q2NA 1G3QA 4HWOA 2ZSFA 4RK0A 4WGFA 3ENEA 1UT5A 3BMQA 1V26A 3LK7A 2OFWA 4MYHA 4XAQA 3T35A 1HNZB 1XJCA 3NDPA 2PUVA 2VT3A 2N75A 4LHZA 3D4OA 3VYRB 4QYWA 4QFMA 2I91A 1OI7A 3VFDA 2EFDB 3B7SA 1CWUA 2QTCA 3D2BA 5CCBA 1MJNA 4DLRA 2B5OA 3HLKA 2CV1A 4AKXB 3W06A 2H51A 2JFYA 5U4QA 4BGDA 3N1UA 3AP3A 3P0FA 4GCNA 3DAYA 1RM4A 3UBTA 3ZI0A 1U81A 3TLZA 2XYGA 1J9GA 3L4BC 5HCIA 2VK1A 4GYWA 1TJNA 1M2GA 1VJGA 3IODA 3C6ZA 1UXIA 4FHDA 2GHTA 3GGOA 1GTG1 4EKGA 4PCVA 5FPQA 4YRIA 2PT9A 4RCVA 1YRBA 3P9CA 4CM9A 3OQOA 3RSCA 3IHWA 3DFIA 2QTBA 1Q2UA 1XA3A 2YY6A 1KLXA 2CNLA 4TTAA 5C7YA 4LJRA 2B94A 1Z5UA 2BH9A 1GQSA 2Y4OA 2HR2A 3UQYS 4YCMA 3SY2A 1Y81A 3ROQA 3Q7FA 1G8MA 3B7WA 4GTTA 2QY9A 3DONA 3TW4A 2BP7A 3I4CA 4JCOA 5CITA 5C8XA 3K6KA 2RI6A 1KI9A 2PJDA 3NALA 1DG1G 1Z33A 3L92A 1L9XA 2FTKE 4Y2RA 4CE6A 1SN7A 2I2BA 4GX0A 2ZBDA 4UPEA 1JNXX 3BFJA 1DJPA 4MRVA 1IQPA 4KKXB 4HLLA 1NX6A 2LKCA 4BZZA 1DCTA 1CJTC 3S8EA 1DQZA 1CETA 2NUPA 1UFRA 3ML9A 1FYFA 4NDZA 1YACA 1PKEA 1E2FA 3GFSA 3K0KA 2GRNB 1RCUA 2WLTA 2AN5A 2VSOE 2VNJA 2YQZA 3F9CA 3JASB 3OP4A 4K9LA 1H9CA 2FH5B 4DX1A 3N2YA 4QYMA 4IVPA 5DOZA 3WLRA 4GP7A 2I3DA 3I04M 4Q3BA 5DM70 4Q3OA 1AMNA 4RSMA 2VQFB 3C8ZA 1S0UA 1GFIA 4FT4A 4R9SA 3USES 3A2KA 3MM4A 3T0FA 4N49A 4TYPA 4CR8A 5EIBC 5GINE 1JECA 1Q7EA 1ZGZA 3LT1A 3PITA 2RKKA 1CRWG 2GDJA 3QV2A 3VCXA 4RNDB 3TLXA 3ZYCA 4BO0A 4DYVA 1H2TC 3EA5A 2B2NA 3HC7A 4A9AA 3ZDEA 4KG7A 2X9QA 3FOAA 3NF1A 1LDGA 3EZLA 3V5NA 3R3YA 1NV9A 2B4QA 3GI1A 5G05C 1T3TA 1JU9A 3HA3A 5ALTA 2HRDA 4P4UA 3OQNA 3UV6A 3SEFA 3C3MA 2ZE8A 4J4TA 5EJAA 1IM2A 1SA0A 3KQVA 4EBAG 1VCNA 3QLUA 3JY6A 1VJRA 1QC5B 4PYKA 1Y3DE 2A35A 4J0JA 3LOUA 4YLGA 2RBEA 4ZJYA 5FL7D 3VSDA 3RF7A 3ROZA 4XARA 5A2GA 1T9ZA 2QE6A 2BEJA 3T8KA 3CVYA 1KORA 2AH5A 1NT2A 2R4UA 3SI5A 3PQ2A 4RF2A 3WLEA 1OXVA 3BE4A 4TMTA 1XSEA 3WYNA 1PT7A 2ZM6B 1SRRA 1YCGA 3GPCA 2YZKA 4N8SA 4IIUA 3WYEA 3TW6A 3E8XA 5EP1A 2VHEA 4MQEA 1R5NA 4LNUB 2ZS7A 4JJFA 5HJEA 4C22A 3MYYA 1T91A 5TVKA 2VNHA 4KMSA 2ONKA 2Q3BA 2ZJ6A 3UIEA 1J42A 3MWDA 4LZAA 4XOIA 3E15A 1DKUA 3PWSA 1FFHA 3I4GA 1N7IA 5BWMA 5IBPA 1LLFA 3DZFA 5D00A 1QHNA 1K8XB 1CS0A 1PJBA 3FDFA 5HWSA 1P19A 1XNQB 1TZCA 4G8KA 2H08A 4RQUA 1E8MA 3IMEA 5E6UA 1KI6B 1PWEA 5FOUA 2LAIA 5T4EA 1L5LA 5CHEE 4ZK6A 4B40A 2FLVA 4BFYA 5C18A 1LBHA 3KJEA 1G5PA 1VXOA 4ZP1A 5B55A 1I7NA 4F7DA 3WGHA 1BVHA 2R2LA 1F6DA 2J0UA 1P4RA 2DWQA 3UJ6A 3T3MB 5ITVA 1ZJWA 1MGOA 2ZRKA 3GRVA 2I5PO 1ZC4A 3PICA 2I0FA 2AFVA 3IH5A 2XS1A 1RLMA 3RM3A 2PRZA 2HHJA 3AGPA 3HXEA 3MAAC 4JR1A 3FOEC 3GFBA 3MXOA 2AG0A 5DU2A 1YRHA 2OGUA 4QQNA 3P0EA 1VIVA 2DBYA 2GS9A 3SXPA 3ZGXA 5ARCA 1QPBA 2BMJA 1TKBA 4ZAWA 2Z83A 2IYUA 2OBMA 2FPWA 1MJ0A 1N36B 3E48A 4MP3A 3U4MA 3BQNB 1BNCA 3SYKA 3OEHA 2WFAA 1YGPA 1Q1QA 1A5EA 2DX7A 5IY5E 1PKXA 4C7JA 1N9GB 1QRRA 2OSBA 4JSTA 1MTOA 1ENZA 1XDUA 3FDJA 4P32A 4XQ9A 4O2BF 1IBLB 3OZRA 4HWPA 1GAXA 3UINC 5CPFA 3I53A 3FGNA 2YWEA 3ISJA 5LQUA 4A55A 3SSMA 3EVTA 2XMRA 2QB5A 3W9BA 3BCHA 2VL7A 1Y4ZA 1J6UA 3C7KA 3MLAA 5BN5A 1AMUA 3H6GA 1DEOA 1RXCA 3M9LA 1TTHA 2COUA 4NLLA 3W8FA 1T24A 3HCOA 4YP9A 4LF5B 1XCMA 4K05A 4MPDA 3ZJYA 2ECQA 3U7JA 1JQDA 1ZPDA 3CRNA 4R71A 1TB4A 1KAEA 1VIDA 2R8OA 2BFEB 2IUFA 5K4HA 1DP4A 4LG6A 1RC0A 2O7SA 4KUHA 4Q24A 3HWX1 4H17A 1HBJA 2WJJA 3BGDA 8ADHA 1JA9A 4KDRA 2XBLA 2G1JA 3RAFC 4JI4B 3RUFA 4JEUA 2RGWA 4ICIA 4H6VA 3PIIA 4MRAA 4P5DA 5FPYA 4KO4S 2XMPA 1T2UA 3RKSA 1HSOA 5IYZA 1P8JA 1Y1SA 5FNVB 1U99A 1KQGA 2JLRA 4QQIA 1LVGA 3D7RA 3HK2A 2YWRA 3BFPA 4GC9A 4H6PA 1N6HA 4XWGA 4CUZA 2FWRA 4DQDA 4UFNA 1F8UA 4B3DA 5B4VA 1LBEA 1RQPA 4B2PA 4G1MB 4UEWA 1SD5A 2XAAA 1ZY2A 3LY5A 5IP5A 1NWHA 3CXRA 5ABPA 4E46A 5KSYA 2I2CA 1CU1A 4MKIA 1I1OA 2BMVA 2HF7A 3EHNA 1AUPA 2QD4A 3C8MA 4I5FA 4LZLA 1G66A 4M0MA 3BK7A 4R69A 3G1UA 1Q0PA 3WNVA 4B43A 1MRNA 3D5QA 1JDPA 1ZUHA 2JI9A 2AFIB 2X38A 2YMQA 4ITVA 4DIKA 1OREA 2VSOA 5BT9A 5KDOA 3HSKA 4IILA 2QVYX 4A2WA 4LDQA 3GUZA 4WNAA 4ILGA 4H1UA 3K9IA 2A9JA 3ZGOA 1KDTA 1YC2A 3CNLA 1KI6A 1ZQ9A 5BN3B 8ABPA 3RCBA 1KK0A 4BESA 2IY9A 2C88A 3LDFA 5GONF 4DR1B 1QRUA 4FWIB 3LE8A 1O4WA 4P36A 4AYXA 4F6RB 2QRZA 2PMKA 3I04A 3NDRA 4U3JB 3OTGA 5G40A 2I4OA 2X42A 5K5EA 1WA5A 3E33A 1KMIY 3D2AA 3SC2B 2I29A 3VTYA 4JQCA 4BLSA 2GAAA 2LGJA 3FYSA 4URXR 2DK6A 5LN1A 2Q2VA 1X7WA 4N0DA 4YI5A 4P31A 4TMXA 1QVAA 2A58A 2XUZA 3AY0A 4ENTA 4UXJA 1DDOA 4AF8A 4Z8YA 5HZKA 4FQ8A 2AUNA 4L75A 3KR2A 3RIMA 3SEAA 4KREA 3CNBA 1TM7E 2Q45A 3H1GA 4PGMA 3VJKA 5ALRA 3GY0A 3BWBA 5LZ2A 5A0TA 2DE0X 4XB2A 4B81A 1M72A 2I7VA 4TLMB 2AD1A 4MV0A 4XPIB 3MQ4A 2QW0X 1Q12A 2YW2A 3LI2A 4RSGA 2MSKA 2HWKA 3SBOA 3VH1A 4DJDC 5KOJB 5JSFA 1SGWA 2CB9A 2FWAA 4CKBB 4FX5A 4ACAA 4GTQA 3UHFA 2GK7A 2JIBA 3A6HA 5DHQA 2W42A 4DUZB 5ETJA 2WB4A 1XCPA 1BXRA 2QM7A 5FPPA 4EF6A 4R8LA 4V2IA 4CTMA 1DMRA 4MPTA 2E2EA 4GMRA 4YGYA 5H83A 2ZIAA 1TZMA 2GTPA 5JDCC 1H6AA 2G17A 4QM7A 5M04A 3REFA 4BN0A 2Q4EA 1OJ7A 1BS2A 5AM3A 5B3LA 2RB4A 3BBLA 3T7RA 3UK2A 4FUQA 3S2UA 1N2ZA 1T0PA 3GVHA 3IKJA 4L15A 4WK0B 2HK8A 3PX2A 3RYHB 4DS3A 1BAPA 3MKQB 4PHGA 3KOUA 5I9NA 2EATA 3RNOA 1QX3A 2VLIA 3BE5A 1E9AA 3NGXA 4F3TA 4JLSA 3MTJA 1O1SA 1E8DA 3QEJA 4CMGA 1PVDA 1TEHA 4P4NA 3EK2A 3MCXA 4TSRA 2O0JA 5HP4A 3ZD8A 1MC1A 2FPGA 1I0LA 2ACEA 4DMGA 4OOEA 1GADO 2R6R1 4E5YA 4YRAA 1TQ4A 5B1YA 5IYZB 3PLRA 4MA4A 4ZRMA 3UTCA 4CT5A 2OD2A 4KAJA 5TQ0A 4RLYA 4IV8A 1SUCA 3OT5A 4U9IS 2ZP1A 1EVEA 1Q77A 1SNYA 2AOTA 2G9VA 1M1YB 4XB6B 4FIDA 4RKWA 1IDOA 3S2SA 2AMVA 1JFRA 1G41A 3SC6A 2UXBB 2FSPA 2J08A 2X5OA 3NZEA 1AHHA 2H3HA 1N25A 5EJ4A 4X93A 5D87A 2QYUA 3AOGA 4C0LA 2DHRA 3PEVA 2X5JO 4OSPA 1KEWA 1NW8A 2ZIRA 2YDYA 5IHPA 3ADBA 2V1UA 4DGSA 1O9HA 1RU3A 2YWXA 3AOEA 1L5FA 1RZ3A 2X6HA 1N2EA 3D3MA 3RRUA 4YC7A 2ZB7A 2IPOA 5G04C 1Y5RA 4HMPA 4K28A 3ORSA 2GYVA 1ZB1A 1YDEA 1NMSA 3AEKA 3UPDA 1RLUA 4IDGA 2WKSA 4X3CA 4GNRA 4J7AA 1IQUA 1GRCA 2C1EA 1TT7A 5EA2A 3E9DA 1CDEA 1CUIA 1FQKA 2C98A 2MMCA 1LBTA 5JMND 3TI9A 3VMMA 4YS6A 1AKVA 4DIFA 1MUUA 3K15A 3P0HA 5C3UA 3C3RA 1T4MA 2ODNA 4ACKA 3HCRA 4NCHA 2RC5A 3HB7A 1JVBA 1WXEA 4NXMB 1EEHA 4PSCA 3VZBA 5BVGB 4ALJA 1RZRD 5JSZA 1HG1A 4GAEA 4RMIA 4D10C 1UT8A 4MJ3A 5AHKA 1PQPA 1ZVQA 1N77A 4DOMA 1XZBA 5DLYA 4IIXA 2QOEA 2WHPB 1O6BA 3PPVA 4R3NA 1U0LA 4JXZA 4KQ1A 3EPJA 4WXMA 2J9YB 3M9WA 2O8EB 2LCIA 4ZO8A 4DQLA 2R5WA 2HJVA 2IVFA 3PDCA 5BQ3A 3K53A 3GLRA 1YS2X 3OQJA 5H02A 1EXMA 3ZJVA 2N1BA 1E98A 3KBOA 3QU4A 5EQDA 1OAKA 3R8XA 5BMVA 1HYHA 5EJFA 2XB4A 3BJMA 1A4XA 5LMCA 4I6JA 5D6OA 1A0OA 3DW3X 3K0AA 2BW0A 3TAHA 4OH1A 4BPBA 2RIRA 2Q46A 1J9ZA 3FVWA 4W8OA 3CIAA 2B37A 2GQ0A 2J3QA 1QGZA 2PZJA 1RW2A 2WMNA 1GD1O 1QB8A 1YIOA 2M6SA 1NXTA 3CH4B 3WISA 4GTOA 4MB6A 4JLAA 4QOGA 4B83A 8AT1A 4J8SA 5KWVA 1PV1A 1QH1A 3SG0A 2VHCA 1PDOA 3B7RL 1U6IA 3B6IA 3D5TA 1ESZA 1ZXBA 3NEPX 3NVMB 3NIWA 2EYQA 4GOXA 1JQBA 4J7XA 4I4TA 1OIWA 2PLRA 4MJLA 3WNCA 3KE9A 1ONOA 5CRVA 4QPCA 4R5MA 3L9WA 4PICA 4CQJA 1FZTA 4R6WA 3E34A 1HOXA 5GY7A 5HJ2A 2QYJA 1QHEA 2ATIA 2CF5A 2K5UA 3WHLA 4JL6A 3VDXA 1SXHA 2C4TA 1HDXA 3N05A 5JCJA 2OK8A 1L3BA 3LKUA 1IHDA 5H7PA 5E1OA 3ADDA 2J4DA 1Y4DE 4ZI2A 2PX3A 3V4SA 3PWZA 4N6NA 1Y6IA 4X7PA 5EZ5A 1EINA 3RFFA 4Y6SA 2D1SA 4OKNA 4GTMA 2JAOA 3LYHA 2BSXA 2DPXA 4M53A 4RZIA 1F8XA 1AC5A 4UOQA 3RUIA 5K2MA 4TUMA 1VDZA 3U4HA 3WHKA 5LQKA 1JEYB 3S27A 4BJHB 3EIQA 4OD0A 4LFAB 2PRYA 4HS9A 2C59A 1IY8A 2J3DA 4G5GA 3RSOA 1GTZA 4GDFA 2D4AA 3DL0A 1BDBA 2REQA 4WHMA 4E2ZA 2XZLA 1A9XB 3UTDA 1IUOA 3O74A 1YB2A 4C6HA 3TFQA 1W47A 1MDBA 4O2BA 1CY4A 3MB8A 4GQAA 4XJSA 2KYRA 4BBAA 4TVKA 2NTEA 4K2HA 4KQIA 4X9XA 1CVIA 1G3RA 2L0XA 2ZWOA 3ZU6A 3ZFWA 3UOGA 2BEWB 4UBOA 1E1YA 1N54A 2W9JA 1HZZC 1N8TA 2OP1A 1GGHA 3DBHA 1KTVA 4IIYA 4KN8A 3WGJA 3DR5A 1AQLA 3QVMA 1TTQB 5LXTF 3M5DA 4RL4A 1E63A 3COWA 4IWXA 4GMKA 3P2EA 3KHTA 3JQEA 1FDOA 1R00A 2ZJ7A 5SV2A 1CY1A 4Y98A 3L40A 1JCQA 3FF1A 4ZRNA 3UAYA 2IDZA 2I33A 3PXAA 3I6IA 2I7XA 2GVZC 3PF8A 4ED9A 5IXYA 1KEKA 1CP2A 1GNRA 1PGJA 4QJ4A 4BGEA 1XX6A 4KAAA 2O8EA 2PD3A 4PQEA 4EZJA 1T5TA 2AW3A 3H6HA 4CDMA 4H2DA 2P6MA 3RYFA 2YWJA 4HFNA 1ZP6A 2VHUA 4MVJG 3RC8A 3S2AA 2PJUA 4G0WA 1TA0A 4GT1A 1SQFA 1V5EA 1L5KA 3OTQA 3UGJA 1QGOA 4HGQA 4J76A 1RBMA 4YNDA 3K0AB 3NJ8A 3PWKA 3RVDA 3BIJA 4NNJA 2E6KA 1NTOA 4NK5A 1FFXB 4DWVA 3AF6A 2CWDA 2HDWA 3NJ4A 3C5HA 1V5WA 2HTEA 3E05A 3EVCA 4DLNA 2ZSEA 3GZJA 3FPSA 3OD1A 2V7EA 5A6SA 3GA0A 5CEEA 1H4SA 4H7YA 5IWCA 2WWIA 3V32A 3HHPA 3GMSA 2XB2A 1E3DA 2O7NA 4UDYX 2W2PA 5JH7A 3QYFA 3V7FA 2VHVA 2YZ2A 2VF8A 2P2NA 4WNAB 5LDGA 1RJWA 3L77A 2Y93A 4EBFA 1XVTA 4J1NA 5BYKA 1DWQA 1QLHA 2F90A 3D5EA 3HCDA 1Z8DA 2ZI7A 5LPNA 3AZOA 1J33A 3PFCA 1HNWB 1Q91A 1ZCAA 1G20A 3MSCA 1KI3A 4MYTA 3T6KA 3LQFA 4BLPA 1BX1A 1ORWA 3D1VA 5B53A 2V7TA 5HPYB 4RTMA 3P0RA 3TZBA 2FX3A 3U60B 2VJQA 1Q14A 3TTTA 1ZN2A 3GW8A 5PNTA 4EF4A 1LJ8A 3BTUA 4DDUA 5JLAA 1PO7A 2XQIA 3UJ9A 1AS2A 1SVIA 3GLVA 3TEJA 1JH8A 2LVBA 4AP2A 2Y2VA 3WYGA 1PK7A 3AG3E 3DXMG 1BMQA 1J2TA 1V71A 3A6LA 1NI3A 1XK7A 3G9XA 3P9IA 1RBZA 1E6EA 4HBDA 3Q15C 4KN6A 4KRYA 1NI4A 1T26A 3V3TA 1C7EA 4AYWA 2JLVA 3FUVA 2BFMA 4D9BA 3ANTA 1VL0A 4AUEA 4C4RA 2J9ZB 2WLSA 1MLDA 4CKZA 1XZQA 2IVZA 3IAFA 4X85A 2A67A 1NJ1A 5F3DA 1JG1A 5C5DA 4KR7A 4F9EA 2C5GA 3ILHA 4N12A 5E6RA 3S8YA 3DPSA 3M6IA 2ZM5A 4DEYA 1YR1A 3EMKA 1CC1S 3FXAA 4DG9A 4NFSA 4DMFA 1TA4A 5EPOA 2HJWA 3BD7A 2QZAA 4IN3B 1BOOA 4PSAA 4C0MA 4WBNF 1Z3YA 5BWNA 4U0SA 1JHZA 3H3FA 2ETXA 3AV3A 3JVUA 1T8TA 2PZIA 4KO3S 4NH4A 2XEHA 4A7PA 2N3ZA 4UUQA 5DPMA 3VC1A 4TLDA 3DE3X 4DJ5X 5FULA 1GGJA 1H0RA 4AJHA 4TVOA 3TZ6A 4KXKB 4TXPA 2Q6IA 2QLJA 3EAQA 4JFAA 4K8OA 3WK5A 2EBHX 1AKTA 4RACA 4EPVA 5IDWA 5HTOA 4TLLB 4Y1EA 3AG1E 1CY0A 4E21A 3RD5A 2EBWA 2F1IA 4ZZ2A 2N46A 1TF7A 2SHKA 4R81A 4RHXA 4C6TB 2JAUA 2RHBA 3GUCA 1N3BA 1GDHA 1Q3KA 2JLCA 3S28A 5GZ1A 3W3ZB 1HMPA 1EKXA 3BDIA 3DR3A 1F5SA 3DS8A 3DV2A 3I4FA 4PAWA 4U5XA 3O94A 5DASA 4ZQCB 3U0VA 2GEBA 4P0TA 4EPXA 4IDFA 4UQYA 2ASVA 2IITA 4WD3A 4DLTA 1IUNA 3D54D 3PNLB 1U0TA 1JHQA 1TK9A 1A5ZA 3MJCA 3HGQA 4LRXA 4UM5A 2WKRA 1Q1AA 1VHDA 3ZLUA 5CLFA 1MV8A 1BCSB 1N5IA 4L3WA 2C7PA 3QA9A 2A14A 1ODSA 5HS0A 2O14A 3K8YA 3FSGD 4UBIA 1GZHB 5A1TA 2QTNA 2VHXA 4DLKA 2XNKA 3BIFA 3KXKA 1U0FA 4Q0MA 5EFOA 1TFRA 2FDRA 2GZAA 1YJXA 3FUTA 2DXIA 1C4WA 3C7DB 3UX4A 4PPYA 5FAKA 2E6UX 2EFEB 4RIEA 2EZUA 1VKJA 5DEIA 2C9MA 2IYSA 1OCCE 1VE9A 5LD2C 1NZFA 3QPDA 1SOAA 2RI1A 1GVHA 1V45E 1Y8RB 1JG4A 4FI3C 3JXIA 2Z95A 4R1UA 3V2HA 2C3OA 3E7FA 1HT0A 3AY7A 5K8VA 2VK8A 3B1YA 1ECJA 3THXA 5GADl 4KQCA 2HK9A 4PYJA 5K99A 2G7MC 2QUKA 3H5OA 4MV6A 3ZXPA 1QQ5A 3MMNA 5EXPA 1P75A 1KS2A 1AK2A 3IBCA 3L18A 4LC1A 4QFBA 2A8YA 3NHYA 2NZ8A 3OPQA 5DBFA 1UBRS 1M8KA 2IU6A 5GONB 2C83A 1RXEA 3A9WA 1RCTE 2FPIA 2WU1A 3RYTC 3FVVA 4WE3A 3EEFA 1VSUA 3LLCA 1OXUA 3BDVA 3UMCA 3VKHA 1A4IA 3HXCA 2HA7A 1KPHA 4XVRA 1KJ9A 5FOTA 5BQPA 2O1WA 4DWOA 4BXOB 3K96A 2I4IA 4YJ3B 1C30A 1K7YA 3ZIAA 3GYXB 1I9CA 1WW2A 1MFZA 1Q0SA 3AHHA 1A8UA 1BRMA 3AM5A 3HN2A 1O0SA 2H4HA 4EI7A 1EUQA 3C15C 1VA4A 2KBEA 5IDYA 3DD1A 3P4YA 1E2MA 4HNAD 1DC2A 1UJBA 3QX7A 2MYTA 3OOWA 4O3FA 4ENUA 2NXEA 2QDKA 3KQQA 1E2LA 4I9GA 5E6RB 5I7AA 3REQB 2JD1A 3KP1A 4HX9A 3EVBA 3TDKA 1NNEA 2XWBF 5IK2D 2SKCA 2AZXA 5AOXB 4Q1EA 1QCCA 4M37A 3HBJA 4J8FA 2I6GA 3DPUA 4WXEA 2C54A 3AFMA 5IT4A 2I76A 1YQXA 4MHTA 4I6GA 3O1LA 4QFDA 1KY2A 3DDZX 3T0GA 4KBQA 1HE8B 1EZ4A 3A6DA 1FQWA 3IHLA 3M3HA 3OKPA 4KE8A 4L3OA 4QOSA 4R1PA 4RVHA 2CMDA 3QE2A 1C0IA 3PHHA 4MRMA 5A05A 2ZT8A 4KQFA 5CP8A 3ZPJA 3KSMA 3KYCB 4IDNA 2DHQA 4B75A 4DUYB 3LY9A 2CXQA 2PR7A 2VOJA 5DBGA 4YV0A 1VJCA 3PH0C 5I9IA 3EOZA 1EFUA 2XGMA 4IKOA 3K9GA 3C74A 1KH2A 1RLIA 2IYEA 1Y1LA 3MA5A 1NV8A 2J9QA 3DP9A 2ZQYA 4G56A 4EO9A 3WLNA 3H19A 4CMHA 3D81A 5FWDA 4F4FA 1TCAA 3OCWA 3P94A 5AW2A 1GCGA 5HMMA 4QULA 2JZCA 1LSSA 4J4HA 1E1KA 3TJPA 3W7AA 4KITB 2IODA 3O91A 4I1IA 4G5FA 2EJCA 4NC9A 4XQEA 3U7QB 3NRBA 4JBIA 4WBNB 2IYLD 4ZCIA 5EEGA 2CK3A 3VSAA 3PNBA 3IV6A 4UM9D 1WTAA 1EVKA 2QXUA 4WSOA 5KIAA 4HDSB 1H0KA 3FGPA 5EL0A 4IF4A 5KVVA 3DE4X 5EXDA 3WJ2A 1OBOA 3KELA 1GTJ1 3UM0A 3BXPA 2FULA 2B99A 2XUIA 5AIAA 2Y1EA 4DDKA 2OGTA 1ZXXA 2ZBUA 1GY8A 1MO4A 4HRAA 1Y1QA 2E2WA 4WFQA 1GT91 1ZOSA 1ABBA 3A4YA 4QUIA 3RFTA 3Q3CA 4BASA 4BNHA 1KK3A 2JFUA 1RBQA 3CW8X 4AMGA 5KKCA 1D8AA 2XCBA 4C03A 3BEOA 1I10A 3EPHA 1LPMA 2GFIA 1PZGA 1JCRA 3AKCA 2GZDA 4BQFA 2O8BA 2ZAIA 1ID1A 3PVCA 1O5TA 2I2WA 5T8KC 1AK9A 4S0XA 4IYPA 3OZBA 4AQYB 2QKYA 3KEGA 5GTDA 4Q69A 3T7AA 4N5LA 4LZJA 3FBWA 2P9YA 1C4KA 1FP4B 1JU4A 2JJ2A 4M21A 2GJ9A 1R4NB 3GA5A 1KZHA 4G0PA 3ZD6A 2GT1A 4ZANA 1C0KA 1VA5A 5TX7A 3UC5A 3N5KA 3DVRX 4WA7A 4QUJA 4BB6A 1OI3A 1STOA 5E6UB 3LA6A 4OHCA 3INRA 4K0RA 1RI1A 2XNSA 1PJCA 1W7AA 4GS5A 1NUAA 2Q6OA 1F48A 2GM5A 3UUEA 3FEXA 3OCXA 3SIXA 2QRKA 1V11B 1PGQA 2Y71A 4MI3A 1Y1RA 4PUCA 3DHVA 3AIKA 3VC3A 2Z04A 3CIOA 5MFZA 2FX5A 2VXYA 2YHEA 2E55A 3FUUA 4HZUB 4X8OA 1JJ7A 2PWYA 2NXPA 4UYKB 3G8AA 2VPWA 2SNIE 1NVXQ 2PM8A 3QP9A 3IP7A 4DSUA 1SVOA 2Q6VA 4MZXA 4WBSA 1JDBC 3HUDA 1RRKA 3A37A 3HY3A 3S40A 5I7FA 1G1AA 3JQBA 4MRMB 4E6EA 3QBJA 4GOLD 1NKVA 1V48A 4RZSA 2HE0A 3TW8A 3SBDA 3SHOA 1EFVB 3T3NA 1JF8A 3V2XA 1SVWA 2FW6A 3HYMB 4HAUA 4XYBA 1UMBA 4HQKA 3CKCA 2UXDB 3PEYA 2QD1A 2PR2A 1AKYA 1BVUA 1YBHA 4U6NA 4O6VA 1KZOA 4J0UA 2FN4A 2K6GA 1KC1A 4MR7B 4X84A 2P78A 1UFQA 1PZFA 3EQZA 3WRYC 3ZHXA 4C7OB 2XA2A 2EEPA 2X5HA 4X20B 3IVAA 1BW9B 1FDTA 4QLBA 4OJQA 3QWWA 2D54A 3EY4A 3FVRA 3U40A 4KJZA 4KK3A 5CCMA 3AFGA 4MMYB 2W8BB 5CAEA 4HDCA 1U0JA 3N86A 3ND9A 1E96B 4RZQA 4CV3A 2KCKA 5JCJD 1IBRA 1F12A 1VBNA 3SQWA 2HA2A 5D3ZA 1OLSB 2H63A 1H3FA 2CXUA 5EWLA 5KNCA 2XUKA 2IO3C 4V24A 4R1LA 5IBRA 4FC7A 1PJLA 1XQXA 3AB8A 3ZHZA 4E07A 2UKDA 4LJKA 2EF1A 1MQSA 2EZTA 2JFFA 4IFIA 5GIPE 4Q4JA 2JHCA 4BWGA 3VX3A 2Q6LA 2G4CA 3L5KA 3M2TA 4L7VA 3RFCA 1WDLA 2JVIA 5F5XA 2QTVA 1JR2A 2FVXA 3VYWA 4HPXB 3RHFA 2XB9A 3EFOB 2QQGA 1QHGA 1W0JA 2YVAA 2XADA 1AO3A 3BRWA 2C4MA 2GPSA 1Z83A 2W6PA 1XTZA 4L1KA 3RU9A 1N78A 1M3SA 3K2QA 2ZOSA 3OHSX 4Y6OA 2HB6A 4YASA 3UW3A 2WT4A 3FETA 5IVKA 2PUDA 3OSZA 3KEFA 2PN1A 2WG1A 4W5OA 3PUZA 4Y2SA 3F9RA 4F4DA 1XJWA 2QL6A 3DDNA 5F51A 3LMKA 3DOEA 4X5OA 3B53X 3TX2A 5EMLA 3QKWA 4EKIA 2PWZA 4PZEA 5FZQA 2FMTA 1MO3A 1XAJA 2P2YA 1GN8A 3OLQA 4LY0A 5CT4A 1TT5B 1OVGA 1U63A 1KIFA 1V8DA 3HBAA 1JU3A 4NL4H 1QLJA 1BN6A 1GPWB 1Q0UA 1A17A 1S5PA 1U31A 2YASA 1OU0A 3MLEA 2TMYA 2ZJBA 4HN4B 4PRYA 3EZNA 3KJGA 1KY4A 3LGXA 4UMDA 5E95A 1U7OA 1C3EA 1G8AA 2WMDA 2I3BA 2WTUA 4BLRA 4OMCA 2CMKA 1E7WA 1RWWA 4HDRA 4EB6A 4EUKA 2YVLA 3ZE1B 2B4TO 1Y3BE 3FTNA 2WNHA 1T6BY 3LT2A 4X00A 2FDCA 2Z08A 2O8VA 2PCLA 1D1SA 1P7YA 1VI5A 4HOQA 1ESEA 2M98A 1K6IA 2A5YB 2JCYA 2VJPA 2ZLBA 3DOOA 3P4XA 5JVDB 3VGJA 1R0XA 2WI8A 4FS3A 2G7ZA 3SXJA 3WQRA 4BAZA 4C3OB 2QRGA 2F43A 4KMMA 4OQDA 5JAMA 5D3MA 4AXBA 4C4XA 5HRAA 2WEKA 1O95D 2PKYX 1YO6A 4DR5B 2R03A 3PC7A 3LRXA 1E3EA 4HI9A 1NHGA 1LLQA 2O54A 1JVNA 2ZPUA 5KCMA 1T4CA 2WK1A 1S01A 3DHYA 1MJHA 1VKOA 3DMGA 3JS5A 3MQ2A 4MDHA 4FZVA 4RGYA 1FFEA 3W5VA 1XMVA 4ZI7A 4OFZA 5KOYA 4RNCA 3UA4A 4R0MA 2JGIA 1JTFA 1Z75A 2PKWA 1DO8A 5L3QB 4QYSA 5SZJA 4DC9A 3U19A 3DBRA 3WWZA 3CF4G 1E0KA 3CVQA 2VAXA 4P4GA 3NT4A 3WDSA 4POAA 1HG2A 3ANYB 1LVUA 4UVEA 1JHYA 4JV5B 2B6HA 3FCCA 2VGXB 4WOBA 2PL9A 5KVCA 1W3BA 5FUYA 2AVPA 1KPIA 2CZCA 4BGVA 1TTTA 2EERA 4G81A 4DB2A 4GZCA 3DLBA 2VGEA 4X3PA 2G0TA 3LW8A 2FZGA 1LV8A 1OV4A 4A1OA 3VHRA 2HH9A 3ZDZB 1M7GA 1U2DA 3AY3A 1SPBS 2H1HA 4KE7A 1GARA 1A8SA 5D66A 3DM5A 3FMFA 1DEHA 5DI9A 4RIFA 3SNHA 3ZLTA 4TKUB 1O0BA 2OPBA 2WXMA 1Q1BA 3KOXA 3WLAA 3H9QA 1IOLA 3JQ0A 1ZD3A 5CUQA 1CUEA 2QSYA 5FXMA 2X14A 3P0JA 3N87A 2H00A 1FDRA 4QOHA 5BQOA 4HPJB 3KT0A 4L74A 4CL8A 1O9GA 1EWYA 4YHHB 5HIMA 3HXMA 4DHEA 4TWAA 3H3JA 4F71A 4B94A 3CVUA 1S1CA 4IDQA 4U02A 5AD1A 4RTNA 5DZSA 4X41A 1M74A 3GPDG 3QI2A 3S0JA 2W2OA 5IAEA 1FPQA 1W4AA 2XDYA 4H18A 2O6HA 1PEDA 4M1WA 3B1KA 4PNZA 2R62A 3GD7A 3SQVA 3EGEA 4K26A 2PUGA 3DF9A 2VPQA 1T1IA 2HO1A 2O20A 3KO8A 2NSDA 1DAGA 4QFCA 1Q1EA 4LKRA 3UIPC 1C9KA 3UKUG 5FZSA 3PCXA 4PWYA 5B6IA 3Q78A 3PKJA 1IOVA 2GRPB 1JSLA 2B5VA 2K2QB 3RUCA 3O2NA 1D2AA 1O7JA 2G1AA 2NU7A 1RPNA 1DX4A 4N0PA 3RT1A 3TINA 1NDUA 2ZTUA 4NTZA 1H9AA 3A6EA 5CR9A 2D2IA 3FNRA 4F92B 3UG6A 1LF5A 1XNJA 4G8DA 2QORA 4YRZA 5IH7A 4F1KA 2G6BA 1A1SA 3QXXA 2AXZA 4TQ9A 1Q5PA 4QOEA 5CVEA 4CT4B 1G4UR 2AR7A 3I83A 4RLSA 3G0BA 5BNFA 3PFGA 4Q7EA 3ZWAA 4KDEA 4DA9A 1JNYA 1XYYA 1NQOA 2I9CA 2AHRA 2FR1A 2ZYAA 3IEIA 4UBNA 1ZVMA 2FJEB 2I1WA 2QUAA 3N0XA 3R1IA 1K08A 2XXJA 3CT6A 2YIJA 5JPIA 4DSZA 2IH4A 5KBYA 2QTTA 5I7UA 2Q4DA 3ELUA 3FTFA 2ZB3A 2ZULA 1MT3A 4ANVA 4B44A 5CXXA 2YCBA 2OXTA 3H2GA 1E3LA 1NSYA 1Z0FA 2W4IA 2WVJA 3RT7A 5ECDA 5KPDA 1YS7A 4GA0A 1UPXA 2PGAA 2YH2A 3KJZA 1TC2A 3JQ6A 4PVCA 5D3KA 3WY9A 2FBNA 1TA9A 4EY3A 3HUUA 4IUCS 2YFYA 3OZXA 4Y2XA 3TIGA 2QDXA 2EQXA 4FGUA 3URMA 3F0TA 4HCJA 4HYEA 2XQGA 1EVYA 3DPDA 2IXTA 2Q9AA 3AQIA 2I2OA 4LSWA 1ARZA 2OCLA 3OF5A 3WYBA 3GFPA 1P2TA 1YRYE 4LZNA 4PS0A 1OA1A 2APJA 4QLAA 5C7OO 1UG3A 2ZYGA 3QU5A 4M1EA 1Q22A 2Q4BA 1UJ5A 2PX6A 5CX4A 1I1NA 4GBJA 1C9DB 2DPHA 2WMOA 2GJ4A 4RD4A 4ZHQF 4QAJA 1R15A 1QOQB 1WDKA 2UAGA 3R3JA 3WI7A 5DNCA 3ZUVB 2NT4A 4KNYA 1Q16A 1MQAA 1NKTA 4G84A 1S70B 1GGFA 4MDEA 2X6FA 2ZGDA 1MTZA 4MQ4A 2ZPTX 7YASA 1RHKA 3GJTA 1USKA 4K6GA 1FLNA 4I5GA 2WNSA 4XXHA 2DY1A 1C1XB 2B30A 1RDFA 3K9WA 3LAWA 4ZICA 3O1IC 5IFKA 2HKIA 3V8QA 2C78A 2DY0A 1KE1A 3DMHA 4QUHA 5EP4A 2NVBA 3AJRA 1X81A 1SKQA 4G2NA 3SFVA 5E3HA 4EPZA 4ER5A 1SO8A 3M81A 4NKRA 3CLUC 1JUDA 1AT1A 3FWKA 3AJAA 4RVOA 4C4ZA 3NKLA 1NW6A 4R9VA 2WYUA 2F4NA 2I1VB 4Q4HA 4C7MA 6ABPA 4HLEA 3HHEA 3KXLA 3WKCA 1RJ9A 2Q1XA 5HKKA 1Z4MA 4HD8A 5A4MS 5FJJA 3EVNA 1DOZA 4GZLA 5C8YA 1TYAE 1IOWA 4R8SA 5CLJA 4D9FA 5DE3A 4PIVA 5EYPB 4DV5B 1DADA 1UOPA 1HQKA 1GZ7A 4S1VA 3CWZA 5EKUA 4Q3EA 1N2CA 1U8CB 3G2UA 2DWCA 2ZIXA 3HDJA 3MERA 5CX1A 4EKYA 2VWGA 4D4KA 2RKBA 3GYZA 3Q6NA 5H68A 3TX6A 2Y1DA 4V0QA 4BHTA 2ZPAA 4UHEA 1DVRA 4MUJA 2ZWVA 4YP1A 4H1VA 4C48B 1M2NA 1M1NB 1KBZA 2FHSA 2QJOA 3Q6MA 1CUXA 3ELYA 4ZA2A 1SCBA 4WERA 2IOHA 4W8HA 1VYHA 3WGGA 2OCCE 1DZIA 3KVNA 5EKTA 4FHCA 2XMSA 1D0VA 4JXJA 1FSSA 3K70D 5A0VA 1RFGE 2QTWB 3BM5A 4NCIA 2V3VA 3LUBA 4ETMA 4RJTA 3EDCA 2XUHA 5BSHA 4LVCA 4RESA 4Z0NA 1S0PA 1UP4A 1WCIB 3AZQA 3D0KA 3LT4A 4RZ2A 2YC4C 1C3LA 1F2VA 3N2KA 1MX3A 3R5KA 3NHBA 4D8YA 5K05A 5LP0A 5ED0A 1UWKA 1JSZA 1W0KA 1KBOA 2AWOA 4J0EA 3W8EA 2WYOA 4R4JA 2E3JA 4Q3AA 4TTPA 4B3BA 1MCZA 4YRTA 1N0VC 2OLEA 1SD1A 3UY4A 3V2GA 1T1SA 4JLUA 1O5IA 3OFJA 5K3FB 1JE1A 1YTUA 1KMHA 1PR1A 4FR0A 2HFJA 2JGFA 2GYUA 2KW5A 1U8ZA 4H1WA 1G1MA 2Q29A 3BMXA 3CHYA 1CQXA 3H87A 4X1KA 4DDVA 4HHEA 4QTTB 1VP9A 4C4AA 1X7ZA 2WUVA 4UVGA 4E22A 2C7BA 3R0ZA 2F2TA 1VCOA 3ET4A 3P32A 4UCQA 2EW1A 3AM3A 2FPMA 1QRAA 4ERNA 5IXJA 1KT1A 1HFEL 2G0AA 4KIJA 5FWXB 3QWFA 3C4QA 2OCYC 1N0HA 2BKVA 2HHCA 2P9GA 3MCTA 4Z9BA 5TV2A 3SM9A 4JGIA 3BICA 3CTPA 2AMFA 1M2VB 4ZYVA 2JBAA 4QT4A 2JBHA 1N1MA 2JASA 2W2MA 3CEPB 5DGTA 1MDFA 4YAIA 2KZTB 1JEDA 1X70A 2KJZA 3R4CA 1JUQA 1M10A 5CXSA 1GRVA 1QH8A 1USIA 1PNQA 2VTBA 1XKLA 2NZJA 1UWCA 3JWPA 1ZONA 3U3MA 1NY6A 2KLHA 4NCJA 2L6JA 1XXLA 3C3JA 2BMWA 3S68A 2CL6X 1PSWA 1XEFA 4WNDA 1PJQA 3U09A 3COJA 1P4HA 2FQWA 3QENA 2E4YA 1BHSA 2I6TA 4XGKA 5J4YA 4GZ5A 2G63A 4F6LA 2CE7A 4LI3X 1BSVA 4DG8A 3PQDA 4Y2PA 3FTVA 3SICE 1NVGA 4F97A 4B2IA 2GX6A 1I5RA 3FLEA 3NTUA 1GQ2A 4M1SA 4AAYA 5JNUA 1JEYA 4HR7A 5LZ7A 1R3DA 2HJHA 2HK7A 1BE8A 3RTBA 3WADA 3HVEB 4AK9A 3DV9A 1QFYA 1C8KA 2K4MA 2NZXA 2QX8A 2G82A 1KZ7B 4QZVA 3HA5A 2VH2A 2XBUA 3GCXA 4PFSA 1IPFA 5DB4A 3OT1A 3K92A 5TMPA 2V9ZA 3JQBC 1Y5IA 2XE8A 3KALA 4B3MB 1DXQA 2B7BA 3QSGA 4UYJA 1OWNA 3G0GA 4W5JA 3UMFA 3C87A 3UI2A 4ITUA 4JROA 1ONBA 3UKRG 2IQIA 3RK4A 4M9SA 1IK4A 2X76A 4S2EA 3PXUA 4BNXA 5K0NA 2VTDA 3F6PA 1HFJA 3H1AA 3QPCA 5CM9C 4MYRA 3KXIA 1WRBA 2Q5JA 3ITEA 4PCUA 3I8SA 4G5XA 2CHVA 5JO0A 2DBAA 2W7TA 5FNZA 3SR4A 4RK4A 4F4CA 3ITKA 1RKVA 2WF8A 1R4ZA 5K51A 5K3AA 3TS1A 1CF4A 2RAVA 1WNFA 3ICOA 4FFDA 2ACVA 2XNDD 4MUGA 5J2TB 2DTEA 4B3GA 3L22A 3I9JA 3SD7A 3GVCA 3TIVA 1J8YF 1TZJA 2ZWPA 1CFZA 5D5PA 4D9MA 1V1MA 1IZ7A 2XPIA 2H1RA 4RFLA 5DNVA 5A3RA 4PH4B 1CQIA 1MB2A 1TF5A 4NOJA 4D98A 3IR6A 1SUSA 2CUKA 3B20A 3UAWA 3KYCA 1IM8A 4JC0A 4FDVA 5BW6B 2O9JA 1CUFA 2GCGA 3B89A 3OIWA 2KCLA 3PC6A 1E3WB 3PEFA 1UT6A 2IFUA 2YX1A 4NBUA 1KH1A 3LZ6A 4JT2A 3ZHQA 3H5LA 1WSAA 3EE6A 2BHRA 3N6XA 3Q5DA 1XPJA 4PG7A 4Q9NA 2WSIA 5E8RA 5BPHA 1JDBB 1WHTA 2ZRFA 1RKUA 2ESRA 2PT7A 3GH3A 1BHJA 4LG1A 4PZCA 4HX5A 5FTJA 1CJCA 3OOYA 4S05A 3THWB 3QWPA 1RABA 3IKVA 4L5CA 3PCRB 1XO1A 9LDTA 3DKIA 1DAHA 2GZRA 4PBSA 3HYLA 1XG5A 1YI8A 4JJ8A 3HWSA 4Y2QA 3CSDA 2FW9A 3NFRA 3IKTA 2D6FA 3U7QA 1QM5A 3KQNA 1BYUA 1P1HA 1J07A 4DZZA 3C6XA 2P67A 3IVRA 1OC2A 5HGXA 3DWGA 3IAM6 4JJIA 3GJ3A 1PT9A 2Q3CA 4NJEB 4D9CA 4HK4A 4XGQA 3ZY3A 4Q7JB 4LRTB 1L4FA 5A3QA 4Z1MA 4PZUA 1DJLA 3IKMB 4PSVA 1R27A 2P4HX 3RGWS 1QYIA 2CLLB 4XYMA 4B0PA 2JIDA 5JQGF 3TD2A 3I3OA 1FYEA 1MV5A 4LZWA 4QAQA 4RWZA 3KT8A 1NVMB 4L8WB 3AF1A 2OXIA 3UMMA 3MC1A 3WYCA 4W4TA 2XODA 4IHQA 4KWIA 3J5QB 3P9RA 2PA3A 1B6RA 5E9WA 2QSUA 1KF0A 4MUXA 2O8BB 1YFJA 1E8XA 3CVOA 3MCVA 1RIFA 3IT1A 2FFBA 5IEJA 3VR5D 1O94D 1XXHB 2AYZA 3F1KA 3STVA 2V6FA 4Z7OB 2P75A 1J00A 1YQEA 2FP3A 2W2TA 4YJFA 4DX5D 2B69A 3HKCB 3O9ZA 4EPWA 4EG6A 1OXSC 1E2QA 4LX8A 3AR6A 3ZIAD 1H0HA 5F52A 4YRNA 4D0GA 4OAPA 4Y1RB 3ZK8A 1C3VA 4KR2A 5BRNA 2DSTA 2WF6A 4GKKB 1V11A 3V6LA 2DKNA 4CKEB 1JPVA 3FUCA 1XJQA 2I7DA 3PRKE 3DEPA 4C6TA 4JD2G 2DFTA 2QAGC 1ISHA 5JUWA 3A4IA 2I22A 2LPMA 1M2HA 3B2NA 3FYTA 5KJ1A 1QF7A 4RIGA 4V3BA 2DKOA 3AM4A 4JJ4A 3JALB 3UJHA 3KCQA 5GJCA 5HDBB 5LX8A 1R4AA 3F2IA 4LE2A 4O1HA 1FP7A 3UKDA 3IEXA 3FGOA 1YZKA 1BCSA 3I9LA 3IMGA 5DM60 4BNYA 2XPCA 3SDBA 1J99A 2Q3JA 1A8IA 2KM1A 4GC5A 1X94A 3TKAA 5E7MA 2FPPA 2WG2A 2X0KA 3L0SA 4URWR 1ICIA 2ROQA 1DUVG 2J4FA 1D6NA 3KCNA 3PX3A 5C4MA 2QRMA 5LZ4A 4MUEA 2MINB 2OCPA 2WD7A 3IP1A 3T1NA 2QMEA 2XB8A 4HNGA 4EHKA 3JQFA 1LW7A 2DCUA 2NV6A 3IOEA 4PZDA 2BFOA 3IEKA 2FWIA 4HOSA 1U0SY 1G6HA 3JWJA 4JOQA 4P6VF 3WRWA 4CQMD 2BZ1A 5FUMA 3TB4A 1L7RA 2AX4A 2PGJA 1O97C 3LUPA 1TLTA 1U3FA 2BEKA 2NLOA 4BU0A 1QMOE 2GF2A 2FF4A 4LERA 5ANLA 5EYPA 1CF9A 4PX2A 2NACA 1GG5A 4R31A 4C7BA 3R9WA 1TR4A 3AONB 2M6RA 1IC6A 5A7GA 2FG5A 3PGMA 2R25B 3SQOA 1KYVA 2AC4A 1P2BA 3I52A 1E79A 1TVCA 5FF9A 1QB7A 5F7OA 1VRVA 3UYLA 3TGPA 3ABLE 3GCGA 3L2OB 1JFLA 4K1LA 1T0JB 3G2QA 4OHOA 4EJ2A 4YDQA 3EF1A 1Z08A 1E4VA 1TRHA 2BFBB 2HF9A 4IIHA 1LRLA 2WJYA 1WM1A 4GM1A 1DVPA 2O57A 3SYLA 4IQ4A 1PZEA 3ND6A 4Q7QA 4LEUA 2GI4A 4LYHA 3ZKWA 1VHWA 3BWCA 4PZ0A 1HE3A 2WF9A 4BO7A 4D96A 4CU5A 3B12A 3M4YA 4FDUA 1VI2A 4G5YA 2DZDA 3LL7A 3MINA 2AE2A 4U0JA 3HNRA 5EFZA 2A0WA 1H2ZA 2H2GA 4IIBA 3RAEC 1D2NA 1M8PA 1U7TA 1ESMA 3VJRA 4K9RA 3PZ2A 4P54A 4JVSA 2FRXA 2J6HA 1J2UA 2QW8A 2X2OA 3K0BA 4KLAA 2J45A 3WLKX 1UR5A 5LXTB 4K46A 1PDVA 4EHBA 1SKAA 1H0AA 2EKPA 1V39A 2J49A 1X80A 4HB4A 3W7BA 5ENSD 1QH0A 5CW2A 4L2YA 1CR0A 2OB2A 1Z2NX 3QKSA 1NOJA 2PZFA 4O4HB 5H8WA 4U39A 4YJ2F 1RZVA 3Q8XB 1N6LA 4MKFA 4DUGD 4GXRA 2CK3D 4MS1B 4J6IA 1P1JA 5EYPF 1TIKA 1YE3A 3OLCX 1W34A 1ZI9A 4WV3A 2IUUA 3R7SA 4IYJA 3EQ7A 3NC1C 2YYZA 5HXAA 3EU5A 3MTDA 4L5YA 2A1UB 1X1QA 3BG5A 5DBEX 4Q00A 3WJ7A 1HFAA 1DAPA 5TGDA 2ZRMA 1QDEA 4AXXA 4IEFB 2P2ZA 3AI1A 2OAQ1 4RKYA 3EGOA 1YDMA 3HXTA 4MAFA 621PA 1CDDA 1P3DA 2ZIEA 2MYNA 1G5RA 2N47A 2WW8A 3I9NA 2IS2A 2XA9A 3RYCA 3N7UA 2YL2A 1LLDA 2A6PA 3HL0A 4HUTA 3C3AA 4LE0A 3EDOA 2PQRA 3DXZA 1J09A 3CO0S 4LI0A 4QGAA 2SKDA 3OZIA 3SZRA 6AT1A 1AS3A 4HNTA 2OFOA 2BGTA 5D2CA 2YV5A 2IDJA 4B89A 3JWGA 2EVWX 3BGIA 3OHPA 2YS7A 3MRXA 2XMBA 4IIDA 4M1TA 3PTLA 3I72A 1J23A 1KE2A 4ME6A 5KWEA 3LY7A 1U1EA 2WA2A 4YVOA 4H7KA 1T3ZA 1NOIA 3T1VA 3HR8A 1AGPA 3KS2A 2BKXA 3GROA 1TD9A 4FFSA 4G24A 1S64A 3EIJA 3HO8A 3TN7A 2MSEB 5FA8A 4ZVRA 3PL5A 3NH9A 3I5XA 3X1DA 1USUA 4IH9A 1OA0A 4NAUA 1IHUA 3K70C 2X2FA 4QBIA 2A33A 3ETLA 5CFPA 4ETWA 3OG9A 3HVEA 2X6TA 3C8DA 4B80A 4GWLA 2FOIA 4WLUA 5AENA 4EB3A 5JNVA 1FE8A 4JNCA 2C4VA 4I2NA 4E11A 4JBLA 1T36B 2VHZA 1UM9B 3EJ6A 4NATA 1LWNA 1BS9A 2JW5A 3QWIA 1DIAA 1LPOA 2OBLA 2WTAA 3TFWA 3WK7A 1J2YA 1UK6A 4RM3A 1JZQA 1YMPA 1QBQA 3U4IA 1UOHA 3MJEA 4M7PA 4MV5A 2POQX 5IPFA 1SHJA 4X66B 3KSAC 4HNAA 4ID9A 3WV4A 3QOUA 3LY8A 1U0NA 5KYGA 3SJBA 4M86A 2RCYA 2WIBA 3R5JA 2P40A 2M63A 2YN0A 4KN9S 1K2WA 1WLYA 4Q9LA 5DM2A 5HEKA 5IEBA 3T0IA 4KYVA 4S0ZA 2PZKA 4ZAFA 3NYQA 1F9EA 1M6WA 1GPH1 3S2EA 1YQTA 5IN5A 4FC8A 4EMTA 1XNFA 3NYIA 1T6ZA 4IPTA 4EW6A 3LIPA 3PU6A 4G4GA 5CDYA 4B3HA 1KYXA 1QAQA 4REMA 3RS5A 2Y2UA 1OB2A 4K03A 1HZZA 1WXHA 3FBGA 3JVIA 4HRVA 4TYWA 2AFHA 4HFJA 1CRZA 2C61A 3HA2A 1JMYA 4IRUB 1UJ4A 3T5DA 1Y7IA 1V1MB 1SZAA 2PVPA 4D9HA 4F2WA 2EL7A 1VLLA 2V7QD 3MCWA 5AT1A 2IUEA 1G6KA 1M73E 3GLIA 2O05A 2XEDA 3L1UA 1QHHB 3BTOA 2FJBB 4XUGB 5DBKA 4F46A 1U2VG 4Y2YA 1X9HA 1KK1A 3U9TA 1VFPA 2G1PA 4D25A 3INTA 4LCJA 4ARVA 4UQOA 3NNSA 1U1IA 4OQEA 2Z9DA 3MV2B 3LKZA 5CLIA 3RBVA 5BV7A 1MVOA 3ICPA 2G83A 3A9RA 5FAXA 1OUMA 4MKZA 1OH5A 1YULA 4NZZA 4OQZA 3TWSA 1C9JA 1X3SA 2COEA 1OTHA 2P9JA 3OURA 3RO3A 3MMXA 4IZIA 4NQRA 1DC7A 4UW9A 3T7DA 2IWRA 3OIYA 5IUJC 4WDQA 2RJNA 3FFLA 1WXWA 4KL8S 4IDPA 4ZODA 2R7MA 4MDFA 1TPZA 2ORYA 3K9NA 4LZPA 3A6PC 3MIZA 4A8HA 1IRIA 5FBQB 2BCJQ 5FIOA 1EXVA 2A7QA 4WRRA 3FJYA 5F7ZA 1UC8A 5A5EA 2Q6TA 4CGZA 4N3BA 3D0QA 5EWLB 5CD9A 2J6BA 3IURA 1H2UA 2REBA 3AUTA 3ZDAA 1QO7A 1VIYA 3KSRA 1F8FA 4JUIA 5AVUA 4PR3A 3WR5A 5JIBA 2O2ZA 2ZBEA 2WSLA 5JNWA 5KHLB 4UHFA 4QYTA 1J0XO 1OYYA 3KDSE 2VTEA 4Q4JB 3F46A 4HVCA 1OW3B 4A82A 4AXHA 2I71A 4I3FA 1R4MA 4IINA 4ZVVA 4Y2TA 4TRJA 2ZITA 3SXUA 2GRAA 2FEXA 3G5MA 3NTOA 2PL3A 1RRMA 3N7TA 4KU4A 3IIIA 1VBMA 4RD3A 5ILGA 4EJSC 2J07A 1GL9B 3DMYA 4CMIA 3NM5A 4E09A 1HZ4A 1Z37A 2VF5X 4U04A 2EJVA 1VJ5A 1KQOA 2I4MA 3QQ5A 4NMWA 4PHCA 3ML1A 1J25A 4Q34A 4UUNA 3S2YA 1GCAA 1MX2A 3QJZA 1ETHA 2IOFA 2QYOA 4KV9A 5K09A 2IYZA 1JMVA 2OT3B 3ASZA 4G65A 4UWHA 1HT1E 3T9AA 3WKBA 4ANFA 5FFNA 3NO4A 3VA7A 4CEJB 1G8HA 5KJLA 1XIVA 3V1NA 2JARA 3AETB 3GJZA 4GGMX 3OIVA 2VDRB 3I6BA 4RZXA 3F4BA 3HACA 4OK6A 2IEAA 1NNUA 4QECA 3HO6A 3AVOA 1N9AA 2PSSA 4WLVA 1SFRA 1FNCA 1U80A 3CPJB 3C16C 4EOGA 3DCIA 3F5SA 3PDHA 2JGDA 5HQTA 1KXZA 3QUBA 2NVWA 1YMVA 3BZUA 3JQRA 3L7OA 2HX1A 2WJIA 5AKIA 4FCCA 3S3TA 4AJ9A 5BO5A 3UJ7A 4B8YA 4B6GA 1UZLA 1V8BA 1DELA 1ZH6A 2EJBA 2J41A 3QF7A 1DRVA 1N3YA 4FYJA 4RD1A 5F78A 2Z3VA 3ZCPA 3WGQA 1KNQA 5JBQA 4CF4A 2DU8A 5M3BA 3ONWA 4LQ4A 4XEHA 3UEOA 4UD6A 3TMYA 5TMEA 1Y9ZA 1RP7A 2V5UA 3WAGA 5L53A 5B6JA 5JS8A 2D7DA 2Z56A 4I0WB 1EBFA 3OICA 3APDA 2BCGY 3MUFA 3LFHA 2G5GX 2PNFA 4YTEA 1R66A 5B7PA 9LDBA 4EVQA 2H3EA 2JHGA 3PXXA 4OKSA 1DAIA 2V7GA 3D7MA 4BVJA 3H99A 4BZWA 4GPMA 1GFWA 1U0EA 3CLRD 2BFEA 2DCPA 3Q2OA 4PS1A 4MW5A 5DXAA 3VBEA 2I4TA 1QE0A 3O3CA 1W0KD 5ALDA 3W79A 2XWSA 2ZYSA 5JRJA 4J0HA 2FPPB 4RQTA 4BO3A 2FJ0A 4MGHA 5JAOA 1GTSA 3RTEA 5JY1A 1ICEA 3LC2O 2ADFA 1RC1A 2MINA 4R1NA 1SHUX 1ILEA 3ZQJA 3BBPA 3CBQA 3GFRA 1FB5A 2DR3A 2FX2A 3WHIA 3ORQA 5LKAA 2AN9A 4EJSB 4K8RB 1C9MA 2NX2A 1CS4C 1NR7A 2V97A 4EG3A 1PWZA 4LWQA 2Z9CA 3KQYA 2PIAA 3UC9A 3D9NA 3SBTB 1MG0A 3L8CA 3UM9A 3VPFA 4B9AA 5KYUA 3N59A 4OQNA 2LE0A 3H42B 4CKYA 3CINA 4MR9B 4RGQA 2ZVDA 1Y8MA 1DIGA 3EX7C 3CSUA 4MQBA 4FWTA 3P96A 3PC4A 1MPXA 5AQ9A 1NF8A 2GGSA 2JK1A 5LP6B 3EA0A 4YAKA 4PAGA 5I7OA 1W19A 1MW9X 1QIHA 3W5UA 1QWOA 3KVRA 1XU4A 4ZAYA 5EHNA 5A4KA 5IBQA 1LJUA 1VYTA 3H8WA 3HCEA 4ALNA 4ALMA 1K3FA 1INZA 4FT2A 3B13A 4KQGA 4TTQA 2PD6A 2OR3A 4PS8A 4HEA6 5ES3A 5F77A 5BNZA 1F2UA 1F0KA 2V4MA 3TWQA 7ABPA 5EQJB 2GBCA 3PDNA 1R6AA 4TKUA 4KRXA 1DPFA 2GK4A 4FHKA 2AIRA 3AKYA 4YIHA 5KYYB 4F6RA 3MA0A 2OHOA 2G36A 2IKSA 5FWQA 1DXHA 3Q5MA 3QUSA 1WKCA 2IYOA 3HBNA 4L0MA 5LQAA 3BL6A 1PYOA 2P8SA 4JYCA 4OBXA 2X0EA 4JQYA 4XIFA 3C7CB 4ASUA 4MPJA 1EK5A 1TUGA 2ZRAA 2EC5A 2I87A 2VDWB 3CZCA 3ENKA 4HQRA 1U6JA 2QNIA 2JHPA 3AB3A 3ZGLA 4BEBA 5AKKA 3WLJA 4KQ9A 1Z0JA 1NUHA 3PI6A 1G5IA 4JDUA 4ZJZA 3AETA 3NOOA 4G8CA 5CNMA 3HWWA 4LXIA 4F86A 5AW7A 4F6CA 5M2QA 1Y6GA 4S04A 4JL0A 5FO0A 4MYUA 5I48A 3MWLA 3T1QA 4U8YD 3V6MA 3PD7A 3JQQA 3OQ6A 4JUCA 3DOFA 5CU7A 4BNLA 4XWYA 4D5GA 5AI9A 3QYAA 3Q5EA 1CUVA 1PHPA 3PYLA 3CTMA 2RGDA 2WZBA 1VE7A 3H5VA 4ZCRA 1SOUA 2QLTA 4D4JA 1BX0A 3SQDA 1HM5A 4NARA 1P18A 1ETUA 4D97A 1QQAA 1NNSA 3EXIB 5CFQA 2VOEA 3HRHA 4YYZA 1YIDA 3T8MA 3BOSA 5JNTA 1QH8B 1HG0A 5MGBA 3DYBA 2O6LA 3GZNA 2Q9BA 3B95A 1RI5A 3IBYA 2XOEA 3ED5A 2DT8A 4HY3A 4L7TA 1D03A 3EUFA 4ND1A 1MVLA 2E5FA 4WWOA 1GAEO 1C3OA 1X8LA 2E48A 3FPBA 3L7YA 4GP6A 5AQEA 3U7EB 3UATA 3UXYA 4LWPA 5FR2A 3OZCA 4CMAA 3SVTA 1GL3A 5CCEA 3NEJA 1O1TA 1T43A 3NHLA 2IBTA 3MKQA 3D3WA 1B8NA 3VR5H 3FHLA 3DFMA 3RVJA 4QICA 2XUAA 3FM9A 3QE3A 1ODTC 3ZRHA 4C3ZA 1XU7A 1GTRA 1PJTA 3TSAA 3IUBA 2C4HA 4EA6A 4CQLB 3BD8A 3DMPA 4NZOA 2CNBA 3H1TA 4HWSA 5IHXA 2ZIGA 3I45A 1E8ZA 2XNHA 1UJKA 4QO8A 1ZW1A 4TTJA 3OWHA 1XAGA 1XWIA 1JIXA 3RJVA 2OLKA 4IUDS 1E8OB 3D6UA 3KQSA 3QX8A 2P62A 4LEIA 5AVSA 1SC1A 5KWIA 1K66A 2WPDA 3DZGA 2EOAA 2YV2A 3KJXA 1TGVA 3FWPA 5DCYA 5AI5A 2H5JA 3SM3A 2XIQA 2R66A 721PA 5IJWA 2QNBA 5JVDF 5HNKA 5JAZA 1TJ5A 3GMTA 3KNZA 2P58C 2GLUA 2BONA 3IXLA 1N0UA 2QE7A 3T61A 4XWWA 5F9MA 4MQFA 2H1VA 5JZSA 3KZXA 2F1HA 3DZDA 4Q18A 2PY6A 1VECA 3NAZA 3YASA 2YNQA 2ZR7A 3P9NA 3QKTA 4AP5A 3E35A 2A5LA 2ONCA 2RJOA 3KXDA 3OPYI 4RHEA 2B1QA 4RLHA 4ZAXA 3STYA 1JTEA 3V1TC 4HAIA 3ZE2B 4ZK2A 5I4CA 1NUQA 4YAJA 2QM8A 3S1LA 4U00A 1ADCA 3I2HA 1XELA 3EVDA 3AZPA 3GG9A 4Q9KA 5JSQA 1QHYA 1IBKB 1SBTA 2GTIA 4Z51A 3I92A 4M0UA 4ZO9A 4KXQA 9MHTA 4UUCA 1RPZA 2PFKA