3PE4A

Structure of human o-glcnac transferase and its complex with a peptide substrate
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
714
structure length
695
Chain Sequence
THADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human O-GlcNAc transferase and its complex with a peptide substrate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 275
structure length 695
sequence length 714
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pe4A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pe4A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 3pe4A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3pe4A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pe4A03
3LKUA 2P6PA 1P4HA 2UY1A 4AY5A 4X7MA 2FBNA 4I2ZA 3NP7A 4GZ3A 2QN7A 3DDWA 2R66A 4NRHB 4G24A 4YNDA 1C3JA 3MSCA 1GPBA 3MA5A 3CVPA 3GZ2A 3EBPA 1QQEA 2F3QA 5I45A 5EX3A 1NZNA 4KYOB 2IEIA 3AS8A 3UYLA 2KCKA 3Q4AB 2XCBA 1Y6FA 3GZ1A 4GCNA 3CUYA 2QRHA 4EL0A 2G9RA 2L6JA 5EKQD 3OKPA 3RKVA 1NA3A 2BISA 3Q47B 4YUAA 2J9QA 5IKOA 2VYIA 4I17A 1J39A 3G2HA 1YA0A 3G2KA 2R60A 4UQYA 3IA7A 4RIIA 1QZ2A 1PN3A 3S28A 3RJVA 1C8LA 2YQ8A 1FU4A 5KJLA 2F3PA 3NAZA 1PYGA 2WPVA 2XEVA 3LY9A 3CUTA 3L01A 7GPBA 3S27A 3ZCPA 3T3DA 4NEQA 2VCEA 4F96A 5M72A 4PQGA 4YVQC 5DLDA 4N3AA 5G04C 4WNEA 3UYKA 3TG4A 3MKRA 4UI9J 3RIBA 3CK9A 3S7DA 2C0LA 2GPAA 4A1SA 4J8DA 5C1DA 3QHPA 2QRQA 3CV0A 2IF4A 1P29A 2PRIA 3RO3A 3E3LA 4EKYA 1W3BA 2KCVA 4MHSA 1B4DA 3AS4A 2C9ZA 2AZDA 1FTYA 4W6QA 5G05J 3WXXA 4J8EA 1P2GA 2GT1A 2BGTA 4NESA 4MI6A 4H7YA 3VUEA 1WAO1 2F3UA 1IHGA 4MI9A 5G05C 4MHOA 4BTBA 1P2BA 5DIZA 2IV3A 3AMVA 1Y6GA 3MT7A 2VCHA 1K08A 1HLFA 2Q6VA 5D01A 2PQ6A 2OFFA 4GA0A 3COPA 4HORA 4G2TA 3LY8A 1L6IA 2X0EA 3MTBA 4YI5A 1FS4A 5G04J 5FZRA 5JTTA 1L5WA 2IEGA 1GG8A 2R4TA 2E2EA 4AY6A 2JZCA 3CX4A 4M60A 3TOVA 2GW1A 3E3NA 2YHCA 3BEEA 2SKDA 3H4IA 4NC9A 3RSCA 4U07A 1JIUA 3BD8A 2IFUA 1NLMA 1P2DA 3ZHEB 2GPBA 3AS5A 1KT0A 5ARGA 1VGVA 2O6LA 4WADA 4YVOA 4Z5XA 1SXPA 5FZQA 4UI9C 2V5FA 1HXIA 1YGPA 2QRGA 3ZCRA 2X6QA 2XCIA 2PQNA 4LDPA 1IIRA 4WACA 3GW4A 4XI0A 4G26A 3RT1A 1RZUA 3D1JA 4BQFA 4H7XA 1F0KA 1FTWA 3MT8A 3O3CA 4MICA 3G2NA 1XNFA 3EBOA 4U04A 1ELRA 4BT9A 1NZDA 3T3EA 3U3WA 3S0JA 4G25A 3Q15A 4AM9A 3VTXA 1GPAA 1K06A 1EXVA 1L5SA 2QZSA 1V4VA 2HY7A 1XKXA 1ZBPA 2Q7FA 5A6CA 3KAEA 3CUWA 3ASFA 4CTNA 3MT9A 2AVPA 5JJTA 2KC7A 3PDNA 2PZIA 2PRJA 2QN9A 1BX3A 1FA9A 2GJ4A 5CCMA 5CCLA 3NB0A 1QM5A 2FF4A 2AV6A 3OTGA 2QRMA 5HI7A 4GPKA 1NA0A 4G1TA 5JTUA 3BCSA 3CEMA 1Y8ZA 2WQHA 1WV0A 3WADA 2PYDA 3DZCA 3OTIA 3RHZA 2XA2A 1GFZA 4JL0A 5IKPA 1UZUA 4RIHA 2LSUA 2OOEA 2GPNA 4BWRA 2QFCA 3Q5MA 4L22A 3NP9A 2H1HA 4I9CA 4KQ2A 3ULQA 3ZCQA 3S7BA 4APOA 2P58C 4N5CA 3S29A 2XA1A 2QN3A 3FP3A 2X0FA 3MV3B 1AHPA 2DBAA 4HWGA 4WNGA 5D00A 2G9VA 1LWNA 4X7PA 2QLMA 2MHKA 4I9EA 1WUTA 2XA9A 4RIEA 3SZ7A 3D0QA 2KCLA 2UY1B 4I1AA 1XOIA 4N39A 2I6HA 1JEJA 1ELWA 4F3VA 3Q3IA 4GCOA 3BEOA 3SYRA 2VSYA 3HBMA 4ME2A 1EM6A 2F3SA 2FEZA 4N9WA 1QKJA 1UQUA 1Y8MA 3U4TA 3ZCTA 2XGMA 5D0OD 3WAGA 4GYYA 5D0QD 5FZSA 5BNWA 3CKCA 4W9RA 4J8FA 3Q3EA 3QWWA 2AMVA 2SKCA 4AN4A 3Q49B 3LYAA 4CTMA 3E4BA 1NOIA 2QN8A 1JIXA 2XGSA 4HOSA 3GYZA 3PE3A 3QDNA 3LCAA 4EQFA 2JJMA 1L5RA 2QRPA 3KD7A 4BQIA 2NC9A 4LEUA 4JA7A 1FC0A 1E96B 3QKWA 3BDAA 2ONDA 3IEGA 1A17A 4U0UA 3OXLA 3NC4A 3TGOA 3MRTA 4XIFA 3VUFA 5AYWD 5FTPA 3KS2A 3LPZA 4N3CA 2H1FA 4EL5A 4CDRA 8GPBA 3ASDA 3L7AA 2QNBA 3UQ3A 3S7JA 1KTIA 2LSVA 2IYAA 3R9AB 1JG7A 2IV7A 4KQ1A 3QOUA 4CTOA 2XCUA 3TG5A 4RENA 1P4JA 2C4MA 2XMPA 4GYWA 3CUUA 4IN3B 4G23A 3CEQA 4HOQA 3WC4A 2VGXA 1NOKA 4HLNA 4KQMA 4GZ5A 5EX0A 2FO7A 2ATIA 3MBOA 3EDTB 4AIFA 1XL0A 3IAAA 5GPBA 1ZU2A 3K9IA 1WM5A 3OY7A 2BGUA 2VGXB 2QLLA 3G2JA 3RSZA 2PYIA 3DD1A 1HZ4A 3NPAA 5LQDA 4O6FA 1PNVA 4WUYA 3G2IA 4U0SA 5TMEA 2HO1A 2PQRA 2XPIA 2F9FA 4WNFA 5LCWJ 3T3IA 3VDMA 4RG9A 3HBFA 4RELA 4RBNA 1JG6A 2IUYA 4B94A 4NQ0A 2SKEA 3CEHA 1FTQA 1C50A 1GGNA 1L5QA 1L5VA 4Y6CA 1TJCA 5KJNA 2YJNA 3CEJA 2QN2A 3D0RA 2X6RA 3CVLA 2C0MA 3HBJA 4LEIA 4YI3A 4EJ2A 4N3BA 3ZCSA 3C4QA 2Y4UA 2LNIA 4J0UA 3G2LA 4BQEA 2X0DA 3ZGQA 3ZHEA 5FT9A 1GZ5A 2IYFA 3CUVA 3UUXA 3OT5A 4QLBA 2HYZA 2PL2A 3CK8A 3T3HA 2R68A 1PC2A 4F9FA 4GYOA 1JIVA 3T7DA 1A8IA 1B89A 3ZCVA 1UQTA 4I2WA 3OXGA 2XCCA 1LWOA 2FI7A 1RRVA 3BD7A 1FU7A 3SF4A 2FETA 3ESKA 9GPBA 2VQ2A 4REMA 1F6DA 3L79A 3OY2A 4RG6A 5ENZA 3CVNA 4MRAA 3BD6A 3FROA 3GPBA 4N2QA 1NZFA 3GUHA 2JLBA 5KJKA 5HQ8A 1RZVA 1WUYA 4FKZA 3L7CA 2Y4TA 1H5UA 3L7BA 3O48A 1HH8A 4WHMA 1NVKA 4KXKB 3CK7A 3N71A 4MI3A 3URZA 4RIFA 1XL1A 1PSWA 2VSNA 3BCRA 2ASVA 3RU0A 3FFLA 1L7XA 3S7FA 2ECPA 3RO2A 4FZRA 4G2VA 4UI9K 2R4UA 2BUGA 2GEJA 5JJ6A 1C8KA 1E1YA 3PE4A 1P5QA 2ZB2A 3T5TA 3C4VA 4N2SA 3VDNB 2C1XA 1XV5A 2QLNA 6GPBA 1IXYA 4EKEA 2ACVA 5TMDA 3MS2A 2ACWA 1O6CA 1SXQA 1Z6QA 3QWPA 3QWVA 5HXAA 4GA2A 4U0ZA 3MTAA 2VG8A 4BFCA 4WNDA 5JJ7A 3SYMA 4BTAA 3OKAA 3HBNA 4RIGA 3CV3A 3TAXA 4M83A 1OUVA 3C48A 5LCWC 3QKYA 3CVQA 3UPVA 4JA9A 1P4GA 3TSAA 3MRVA 5CHEE 4HOUA 2C2LA 3ASHA 3NCHA 3FWVA 1Z8DA 3NF1A 5ARFA 2KATA 2FF5A 5TMBA 3S2UA 3H4TA 2FFRA 5DBKA 2G9QA 1FU8A 3T3GA 3MS7A 3L7DA 3ZPJA 3ZN3A 2WTXA 4BT8A 3OKCA 1WV1A 3ZCUA 1XC7A 2KS6A 1WW2A 5DXFA 2AW3A 5FJYA 2BFWA 3ASGA 5A7DB 3Q3HA 3HYMB 1Z62A 3LY7A 1AXRA 3MEKA 1E4OA 2C1ZA 4KBQA 1GPYA 3OXFA 1KT1A 1M5RA 3ZFWA 1FCHA 2XGOA 3E3OA 3MRXA 5BT1A 4ABNA 3MQFA 2IW1A 4HOTA 2GM9A 2HR2A 4CGWA 1YA6A 3BCUA 3JYSA 4CGVA 5KJMA 4M7PA 4UQXA 4GPBA 3DDSA 4F97A 4JHRA 4XI9A 2R5SA 3MV2B 5TVGA 4UQZA 2VGYA 4X7RA 5DU2A 3MTDA 3MS4A 5BW8C 4Y6WA 4GA1A 2G9UA 1Z6PA 3VTYA 1NOJA 3CKBA 1IYGA 4AMBA 4X6LA 2GEKA 4AMGA 4GZ6A 1KLXA 1WW3A 2UWJG 1ABBA 2QN1A 3OTHA
chains in the Genus database with same CATH superfamily
3LKUA 5D5HA 4WXYB 5LDHA 2IO3C 1FPPA 2Z8YM 5AJTA 3VC7A 1LW6E 1Z82A 5J9FA 2ZJZA 3R7LA 5JZMA 4X7MA 3VHXB 2OPBA 1K66A 2GN6A 2PT5A 1NQTA 5THXA 4M0CA 4I4CA 1C7RA 3UXGA 2C8JA 2W6IA 2R66A 5IASA 1M73E 4G24A 2X5OA 1SIBE 5LN1A 1J2RA 1YUNA 4J6IA 1CIJA 1LZLA 1ZUD1 2XMGA 1UZMA 1GPBA 1KVQA 2I62A 2CJXA 4O3MA 2WUDA 3PRYA 4DHEA 5HOEA 4EPRA 2REQA 5NULA 3X44A 5BVHA 4RFSA 5EZ5A 5ANLA 1C9YA 4F53A 3M33A 4OM7A 3GLHB 1D9ZA 4RS4A 4NU0A 1T5HX 4XLTA 4YJGA 2O5CA 3CH5A 1FQKA 3NEPX 3VDQA 4EI2A 1OA0A 3CLKA 3Q7EA 4RQIA 1RXSA 4HGZA 1JLLB 2HQBA 5E6SA 4CDNA 5FTNA 1K68A 3WWCA 4MROA 4QYWA 2V3CC 2QRVB 3LTEA 5CPBA 1RCTE 1U7UA 2FI1A 2I99A 3KOUA 3BWEA 4P93A 3SS9X 4ILKA 4C0HA 1XAIA 3TTUA 1JEQA 5KIAA 3HVRA 1EUQA 4HNHA 3KPVA 3O4IA 3JQBA 4Q03A 2ZJ3A 2IE0A 4M1WA 4QU5A 5CRVA 2J9FB 3G2OA 4HXIA 2H6FA 5T8KA 2JGJA 1JTVA 2GQ0A 4HGYA 4O4IA 3JYLA 4KIWA 4MIEA 3WKEA 1IN6A 4DJEC 1JWFA 4L50A 4KGXA 4UMFA 3GRRA 3QA3E 4NBRA 3S27A 4XD7A 3VXKA 2DCPA 3PTLA 4WLOA 3IT1A 1FJ2A 1V26A 2VJCA 5IHXA 2GNAA 3IE0A 3P9ZA 1XMPA 4MYCA 5HQJA 1K4MA 5CA0A 5LFAA 1G55A 3B13B 3MCVA 4V3CA 4X91A 5DTMA 1U2SA 2B4KA 1E6CA 1XMJA 2VOEA 4GOKA 3KQTA 5EINA 2WWXA 3OJLA 5JD4A 3UJ3X 3T34A 1FW6A 4UPDA 5JATA 2WHPA 2IF4A 3GJQA 4KKVA 1QS0A 4FFBB 3LIIA 4F3YA 4P35A 5ENPD 1W3BA 3CKMA 2K87A 5T5QA 3H05A 4FQ5A 3N53A 3O4FA 3UOGA 1I7LA 1WJGA 3CW9A 4YREA 4KV9A 4CF5A 4ZYWA 4W6QA 4FFMA 3FZYA 1S63A 3HU5A 1R9JA 2BGTA 3TZQA 4LDQA 1V3TA 4DBVO 2JHCA 4MVJD 3VVCA 4O60A 4OI0A 4IDPA 1UC4B 2OR3A 4MHOA 2QTMA 4IIXA 1NF3A 2C78A 4FFVA 1I01A 2CJFA 4HXYA 5D6NA 3R7QA 2Y0CA 4P3NA 4AO8A 5IC5A 4O1HA 1VL8A 3TPFA 1ISIA 1CJCA 3UW3A 3WDSA 1BGWA 5IT4A 1SHKA 3OX4A 3N87A 4GRAA 3QU7A 4ZCLA 4GM1A 3E5NA 2OV1A 2RGBA 3R0VA 5BVGA 2M63A 5C32A 5L3RA 2QQ0A 3QU9A 3OZ7A 1NG1A 2GOYA 2ZTSA 3EWAA 4LQDA 4CBVA 3D43A 1FS4A 1HOXA 1W49A 2J7PD 2QE7D 1IG0A 2XQVA 3E05A 1UIRA 3ONNA 2DQYA 5ALWA 1OCCE 3PFIA 2IEGA 1MUUA 1Q0HA 3A4LA 4UEQA 4RPCA 3RYFA 3OLWA 3CLTC 1R6UA 5C31A 1EM8B 2IXTA 2ASEA 4B3RB 2AGVA 2E4VA 3PG5A 5GGXA 4FJ1A 4G4GA 1JFRA 2PX4A 1WBBA 1UPXA 1EJ2A 1LGYA 4XJVA 4A2QA 3LUHA 3BEEA 2QTZA 4Z2YA 3U3DA 2O8EB 2OC4A 2WVHA 4EPVA 2RGXA 1AKYA 2ZIRA 4NC9A 4OAVB 4YC7A 1R12A 1V4BA 2A1IA 3DE2X 2ZOSA 4QHYA 4MPJA 3GBVA 3SF8A 1LQUA 4REOA 3U7EB 2O8DB 3H19A 1JR6A 1VCHA 1ZXBA 3V48A 2V5FA 2AWOA 2OB1A 4WE3A 2FWAA 3PFHA 3TKAA 1RLTA 2F9MA 3D3JA 1E62A 3GLRA 1PR6A 3DHYA 3ER9A 3K5IA 4AZ3B 2EFJA 1DQZA 4C01A 4G56A 4KE9A 2L18A 3BXGA 1GZ4A 3PSAA 3QIAA 2IGTA 4IDFA 1YCDA 4C2AA 5BN1A 2A5YB 3IXMA 2JHPA 4Q02A 3LX6A 3SBDA 1J23A 1Y5MA 2ZAMA 2C2ZA 5G4KB 1Z7BA 1U28C 2ET6A 3LM8A 5E9QA 5FA8A 5HZMA 1TYCA 3GEPA 4IW3B 3UV6A 4XQ9A 4IDDA 2WSIA 1WXFA 4WOKA 1E9AA 3CF4A 4AWAA 2GBLA 1F2UB 3BH7A 1RWMA 3JQ9C 3ZD6A 1RZ3A 3S0JA 2TMGA 1JEQB 3MWEB 4KYUA 3PC4A 4HYEA 1ANKA 1D6NA 3SJZA 3PRJA 4LJ7A 3SFVA 3KETA 1L5SA 2DBQA 2XNDD 3GEBA 3IOCA 3PNLA 5KWJA 4JSTA 3CPSA 1KK0A 3F5FA 3W6OA 1Y7IA 4LBVA 2W6JA 1IHXA 3DNFA 3ASFA 1G98A 3K9LA 1G3IA 4ND2A 4RXUA 3WAJA 4C08A 4KW7A 1H22A 1N2IA 2GD1O 2RGYA 2A9QA 1AKWA 3LGAA 4YAOA 1KBZA 3UJAA 4DDWA 4IWXA 3VV3A 3DVQX 4G4SO 3JQ1A 3T7JA 2CHWA 1UDWA 2G4CA 3EZXA 1FP7A 1GXSA 4DMCA 1RWKA 3U1TA 3B6JA 3FPBA 2BR3A 3FF1A 4RFVA 5C7IO 1Y8ZA 3OEHA 4H4DA 4FGKA 2GCNA 1M2FA 2WUEA 3R6WA 4JA2A 5EPUA 3IT3A 1MPXA 1TDJA 1XTIA 3FUHA 4TRMA 1X7HA 3LXRA 4EJMA 1W4AA 5JUWA 4YT4A 2XT9A 5A4JA 1SXHA 4V0NA 1TAQA 3K09C 4KQ2A 4DB2A 3OMWA 3TOZA 4PLPA 4KO2S 5HE8A 4RPLA 3T15A 1KYZA 3C6MA 4GICA 4MLZA 3ONFA 1VJDA 4MR8B 5DHRA 2X0FA 5INTA 3UC9A 3ZIAD 1H3NA 2E6KA 1GGHA 2H57A 4AECA 1YF3A 1H94A 1QANA 1TMOA 3GLTA 3LQYA 4PGFA 4BWFB 1NPDA 5KU1A 2HRRA 5AOXB 4UCXA 1KEVA 2PGDA 3MQ2A 2AR9A 4UBMA 4PPYA 1NXQA 2JARA 5EQFA 3DDHA 3W2GA 1JKJA 4QZVA 5FAXA 5AHXA 1L5MA 3IIEA 1II0A 4ONEA 4KXMA 6LDHA 2RI6A 1I2AA 1Q0PA 2Y77A 3OOWA 4FONA 2C07A 4N9WA 4OKSA 2OUIA 1ZIXA 3T5CA 2WF6A 3CISA 3ZWMA 1Z4KA 1TIPA 2LXNA 3U0BA 1XQWA 4P82A 4HNUA 5GP1A 5B6JA 3A26A 1X92A 3JX9A 1ZMOA 4GEKA 1WXDA 4X00A 3P4YA 2VBCA 5BNFA 4AN0A 5LL6P 1GADO 1G21B 4N6OA 4K9NA 3AR3A 5CVCA 1BGVA 4GWLA 4MHTA 4XVRA 5DLEA 4V1CA 1KC1A 3G59A 3ESBA 4KVZA 2HHAA 2YOFA 4XJSA 5FJIA 3L05A 4A3TA 4NPAA 3FVQA 3I53A 1NLZA 2GM3A 3X2SA 2PKQP 3DWLG 3NNSA 3Q12A 3O5AA 2HK6A 4XR4A 1TZ2A 2C00A 1U3VA 3NANA 1OBOA 5A4MS 1HFKA 2XCOA 2ZIXB 2F0YA 3QF7A 1KC3A 4L23A 4DX7D 3NX4A 4FSDA 5AYWD 3NXKA 4BETA 5FTPA 1E3SA 4B3SB 2ICAA 3ZHCA 3L04A 3FYCA 5FXMA 5LOVB 1KO8A 1RI1A 2GHIA 4UYKB 4DAOA 2E4WA 4RHCA 1UDBA 1J7KA 1XF9A 2LSVA 1HT0A 5JA4D 1J9ZA 1TVKB 3BAZA 3B51X 3FNIA 2IUFA 1NXVA 2NACA 4JENA 3BF7A 4EHMA 4M9QA 2P6NA 4RENA 3TIVA 5HJ7A 3EOBI 3L40A 4KH1A 1W5AA 4MJ3A 4AZ0B 4N41A 1MO5A 3E9ZA 5CEDB 5DHPA 1GXSB 3RAPR 2L0XA 4LF5B 5LBUA 4C22A 4EA9A 4Z4FA 3GMSA 4U1RA 1QFSA 3R7DA 2XBMA 2J31A 4U7TB 1CVIA 3WB0A 4YMLA 5CAEA 1AXEA 1ODJA 1ZGAA 2YC2C 4U02A 5GWXA 4CNBA 5TGDA 5CDFA 3H5TA 3F4LA 3TDMA 1SQ0A 2RJ3A 4W8GA 1PEAA 1B3BA 1X80A 4O4HA 4IEFB 4OP1A 4ROSA 1RPZA 1GDTA 5AVOA 3IEKA 4WUYA 3ZHOA 1MFPA 3OIYA 4PNHA 3REGA 3FUJA 4IYJA 2DQ4A 4G3XA 4GPIB 4PRLA 1M2EA 4RG9A 1SA0B 1EHIA 3IAXA 1IKND 1A4UA 2FEOA 3LP6A 2F3TA 4HFNA 2JA1A 4JB8P 1ZGZA 3G02A 1VL0A 4J94A 4QFDA 1KKLA 2WOOA 1PWYE 1BVHA 4AVYA 4XKJA 4FE3A 3WBKA 2WIFA 3ZKWA 2HREA 3U16A 4DIUA 4J0DA 5DEOA 1X7YA 5EIBC 2GPJA 1HQYE 2IBMA 2E7ZA 1MTZA 2Q0QA 3HBJA 4GBJA 4DNXA 2RIPA 2DBZA 3H17A 2ZUFA 3Q72A 3LUFA 1MABA 2WXKA 1Y5NA 3IQGX 3EXFB 4EA6A 3WGGA 2GEFA 1NNI1 2BMAA 2DB3A 4WKOA 4D92A 5L3ZA 1DJLA 3JD1A 2PGJA 3CUVA 2P2SA 3OT5A 3CXRA 2PGOA 2Q6TA 4IHAA 3T9AA 3TL2A 4E5PA 1GZHB 2COKA 2JIPA 3BORA 3H2BA 4J3FA 1W36B 4F6RD 3WO0A 1U7TA 3T7DA 4AJOA 1NMZA 1ZM3A 4Q66C 4RK1A 2HOQA 2CLOB 3INYA 3V46A 4EI7A 2TS1A 1L4KA 1Z3CA 1RAHA 3ZUVB 1NATA 2PIAA 1DXOA 3CZQA 4JXJA 1O95C 5F1PA 2BGJA 1K6MA 4D26A 3HJNA 3AOEC 3LVBA 1F6DA 4G09A 7ADHA 5BN3A 3I9JA 3OWOA 3AEUB 2PHZA 1YRHA 4ZICA 4ZT3A 1CY4A 1UMBB 2ANBA 2FPLA 3TJMA 5JDIA 4WI1A 4QGAA 4D44A 1T0IA 4Z9YA 1WWKA 3AUYA 2PSSA 5KYWB 3NW9A 3E58A 4DY6A 2Z09A 4TTVA 1H4QA 4L73A 1QG2A 3W2HA 1YJXA 1IZZA 2JGEA 4MQEB 2B1RA 2QTHA 2AEJA 4DF3A 5IKEA 1ODSA 3DAFA 3QE9Y 4EYGA 3RJZA 2X23A 2EFCB 3JXIA 3UX4A 1J20A 1KKUA 2P3QA 5JJCA 4D8TA 1MZPA 1U80A 1DEKA 4Y0VA 2FZ4A 1K2WA 1SEPA 3Q7AA 1EZ4A 1U81A 3AFHA 3V2IA 3WWEA 4DMUB 1ZU4A 4E5VA 3RO2A 2XUFA 5CFPA 3C6XA 5IUJC 1PIWA 2WPNA 1RWVA 2OMEA 2VP9A 4JLOA 3B6KA 5J4HA 3GDWA 1SKAA 4MGKR 4ZPJA 1E8XA 4M21A 4XYBA 1DADA 4FADA 3RAGA 5ADVA 1S3SA 5E6RA 5KYVA 3VDNB 4EG5A 3WRXA 1E99A 2Q5IA 3T3OA 5EJ6A 2R59A 1VYVA 4Q1DA 3HDGA 5GIPE 3SK0A 2ZWIA 3C3KA 4L8FA 2BEDA 4OX9Y 4FOSA 3BUSA 4JIMA 4I4TB 4WZAE 5H68A 1PJLA 2GWHA 4BUJA 5K0ZA 4CR8A 3K53A 3M49A 3QY9A 3WL5A 2FDCA 1M1UA 1NI5A 2DBVO 4IXTA 4YLEA 2EKPA 3NHRA 1UJ5A 4M0LA 1BMDA 1M1XB 3VR6D 3BE5A 2JH3A 3DCIA 3ABRB 4X8LA 4CR7A 1DI0A 3CV3A 3MJFA 1WAMA 3V4FA 3ND9A 4EBAG 3TAXA 1XKQA 1AGXA 2J9XB 2QUIA 4CCWA 1EFLA 3T5PA 2P9HA 4G01B 1RRCA 4HMQA 3ZXUB 2WXPA 2W83A 3SE7A 3UPVA 4JA9A 2AUNA 2D74A 1MFZA 4AIIA 1FW8A 3DGEC 1JJ7A 3T94A 1C2TA 2OHXA 2WYVA 2RD2A 3BRCA 4K6OA 2YFQA 5FTLA 5FYDA 4LJ6A 4QUEA 4GS5A 1WRBA 3FUEA 1CUHA 1XA0A 2OSVA 1USWA 1WG8A 2G9QA 4RJLA 3T3GA 3MS7A 5EVCA 1NUTA 1YRBA 3PPYA 2G88A 1HEUA 2LVBA 1RHUA 2X5XA 2Q49A 2Y0PA 3KYIB 1K1EA 4UHDA 1R6DA 4QBFA 4TGLA 1L5OA 2E4XA 3ZNNA 1EINA 1SA4A 2AW6A 4HMPA 4NX2A 5TDHA 2VRWA 1HYBA 1LTHR 5MN4A 3QE2A 2C5EA 2XVAA 4CKBA 3FPSA 1EJ0A 1GHTA 1DT5A 1YU6A 3EIXA 3Q5DA 4FDMA 1FK8A 3KEFA 2FO1E 3JAKA 3CR8A 3TEJA 4JI3B 4OB6A 3ZHZA 5CDTA 3IHYA 1XPRA 1T8TA 5E7JA 1HF8A 3D9MA 1ISFA 3WSWA 2CV0A 2PUBA 3TW6A 4EZLA 3ICQB 3MRXA 1C9JA 2C77A 2VJMB 3MQFA 4MQ4A 4Y2HA 3VUFA 4QVIA 5M7EA 2EWMA 2QYUA 3EF1A 4O2LA 2WJVA 3JASA 3O3MB 4PTLA 4BFZA 3QHAA 4QXRA 5K3BA 1ZJJA 4LV8B 2EGGA 2WHXA 4POOA 3K4PA 1KR5A 3AF0A 4HN4B 2WYHA 4DLQA 3HXKA 1OXSC 3ZU6A 1ZM4A 3F90A 4XOIA 4RSHA 2KBXA 1OX5A 2R6AA 2RGNC 2V03A 1A5SB 4C7KA 2RGEA 3FRIA 3UK2A 5B64A 1I3OA 1XTTA 2Z30A 3HACA 4I50A 2BKKB 4J2TA 2ODBA 3DEFA 4I0WB 2FEMA 2DIWA 4OIMA 2DWCA 2V6FA 1HLDA 4Y6WA 3FTYA 1W87A 2CE2X 1WPRA 3VTYA 1NOJA 1Z33A 1GR0A 3FFTA 1PWEA 4GPZA 3TNLA 1DDOA 4JN6B 5B7QA 2QGFA 3R4VA 2PUEA 3T5VA 4KFSA 3C2QA 4QGHA 5FCDA 4WXHA 4ENPA 4K9PA 2K2QB 2QD4A 3STTA 3QELA 4KVFA 4MKFA 3CIFA 1JEEA 4ZPXA 1SBNE 4MP3A 2EV9A 4RKEA 1P75A 2R6DA 3CWZA 4I2VA 2ZYIA 1A4IA 2HCTA 3RU3A 1E3IA 4TXJA 1USGA 4JXZA 3W7AA 1C14A 5F9FA 1J0DA 3L9TA 1TEZA 3Q3JB 3AVUA 2AUTA 3KU1A 3I2IA 3L3BA 5DWVA 3GZ2A 3EBPA 3ZU3A 1A5BB 2NSDA 1NZNA 3RS4A 2YXNA 1G2IA 4A2CA 2E4AA 5AJHA 2HLNA 2VP4A 2ZR8A 5HRUA 5JQGF 4Z9AA 4U7DA 3INRA 4QREA 4M22A 2A1UA 2ODAA 2VPQA 4HDRA 1ORTA 2I1LA 3JXJA 3DS8A 5JARA 2RGRA 5TV2A 4F1KA 1C1XA 2Z2ZA 4FNOA 1ECBA 2R8XA 1BXRA 3DWIA 4GYJA 3DYVA 1HG2A 4V1CI 1ZONA 3O21A 1W1UA 1WEKA 2WZDA 4EX6A 1CR6A 1G5QA 3EHQA 1PN3A 2NIPA 4AP9A 4CU5A 1C8LA 1GNVA 2JBWA 3BHMA 3EU9A 1SHZA 5AHOA 5A0FA 4ES6A 1JHVA 1PYGA 3GZJA 5CT8A 5FHQA 2V7EA 5ECGC 4B6EA 1SC1A 1JIQA 3OZSA 1PFQA 2VBIA 3N70A 3QFTA 4OXQA 1Z36A 2F1HA 3GJYA 3QZUA 4NEQA 3OU2A 5EIXA 1LSSA 5C2YA 3HE3A 4H77A 4QC2A 2XHEA 5DHFA 4BCBA 1QQ5A 3IFSA 5IBRA 1BI7B 4Q34A 3NI2A 1AA6A 1XPUA 4RGBA 5B1SA 1TU0A 4XWYA 3CK9A 1I4WA 2DU8A 4YBRA 1U8TA 1B16A 4MB2A 3RJ9A 3EGWA 2NXPA 4ZCQA 4LYAA 4RTOA 5EMMA 2Q41A 1IQPA 1DOAA 4QRIA 4AK9A 4FHKA 1FS6A 2RHDA 2XMQA 3LX4A 4N65A 4EKYA 4TWAA 4DS3A 4U9HS 4F72A 1V25A 1V9LA 3KQYA 1Q7GA 3G5LA 4PS3A 3O93A 1KEPA 1QKKA 2XPCA 2W8BA 3JTMA 5IJZA 2C0CA 4R98A 3PNKA 5FUBA 4PLTA 2NVUB 4CWAA 2IONA 4GPD1 4PAMA 4Q69A 4UBOA 4GMXA 1HTBA 1JGTA 1VKOA 1DC5A 2ZTMA 3AEUA 4QXPA 2OUKA 4JDUA 1IHGA 1B8OA 4AJWA 4JT9A 3ROZA 1UIMA 4TV9F 4HOYA 1SUDA 1NI3A 2IV3A 1B23P 4XIYA 3VBCA 4ZGBA 1Y6GA 5F7ZA 1K08A 4C4ZA 2EATA 2DMRA 2XF8A 4GOMD 3UTMA 1WKBA 1M5TA 3IUMA 4RCZA 5C35A 1D0SA 1EBUA 2B35A 3LC1O 3NVMB 5BQPA 4YMVA 3K6SA 4M9ZA 3PLRA 1LC3A 4YCAA 4ZD6A 2IZZA 4YP9A 1Z6XA 4PE5B 1QCYA 2WM3A 1E8YA 4E1AA 1E9VA 3F1LA 4B3DA 2MYOA 1LF0A 3O90A 4J7WA 2PNNA 3HR7A 3HPQA 4KBYA 4L3WA 4B82A 5I7EA 1DC7A 1QZZA 2RAFA 1ZSVA 1YR7A 1QLWA 4FQ7A 4TYMA 8OHMA 3D3KA 2E2EA 1IN5A 1PFUA 4Y0AA 3I9MA 1SQMA 3QKSB 3SBXA 4ARAA 4DC0A 2BFMA 1FMFA 2J9RA 3CX4A 5JJKA 1Z45A 3A8TA 3GMIA 5SYAA 4FCWA 4LHWA 3ZDRA 4GF5A 5AI6A 3L8ZA 2IOLA 3AQ4A 3OJOA 4Y2VA 5AVZA 4Y6PA 3LQRA 2IFUA 2P7IA 2PUVA 3OQ1A 3QLUC 5D7BA 1Q5PA 2OENG 4S2EA 1EBFA 1XTKA 2O6LA 2H3HA 4MV0A 1U0HC 4Z5XA 1X1DA 2CV2A 1YNSA 4AKGA 4AZ3A 5FZQA 1SUCA 1LSOA 1TW2A 4KQWA 1Q17A 4Q21A 4WUVA 3WDKA 5CG1A 1MT0A 1HXIA 4EECA 2NU8A 2BEJA 2XCIA 3FPGA 4X92A 3JRNA 4TS4A 4K9SA 1E2UA 2XENA 4WACA 4ROTA 3ADBA 4CMIB 3RT1A 4HNVA 3M6UA 4ENQA 4PGMA 2C57A 2P68A 3BIWA 3O3CA 1QGAA 2GK4A 1AT1A 2XYVA 4GDFA 1OX4A 1RJEA 4I99A 4BEVA 3NWOA 1FUKA 2WB2A 2Q5CA 4DUPA 1ZH6A 3AU4A 1N6KA 2PWBA 4JR1A 2E87A 1HNNA 1SELA 4U2KA 3GDFA 1DRUA 5ENQD 2PA3A 4WDQA 2VPZA 4Y6GB 4BV2A 4JB2A 4OU5A 4ZEVA 4DUGD 4GH5A 1W4BA 4V0OA 1PQ4A 2YWDA 4DAEA 2BD0A 8ABPA 2FJ0A 5H4GA 1J4AA 2FQXA 4BMOB 1CDOA 1E4EB 3HYNA 4FDTA 3KJIA 2V7XA 1H0RA 1T9KA 4H3KB 2ESRA 4K8OA 4V24A 4O1OA 2E1PA 1UM9A 2OXIA 3BG5A 2BOVA 2WUVA 1X8XA 1EDOA 1U1GA 3OEYA 4OJKA 4OHPA 1C9DB 4EVRA 4UCFA 5TT0A 2QY9A 2QRLA 3HP4A 2GXUA 5BMVF 2H6HA 2H4HA 1OJ7A 2QTTA 3WWOA 4NDZA 1XDGA 1YDGA 1L5HA 5KAMA 1NFRA 1G8YA 1SUBA 4HPXB 2JEOA 1XNGA 1VI6A 2E5LB 3OZWA 4Y67A 5CLJA 1H0KA 1NBAA 1KYTA 2E2WA 3AETB 3OUZA 4M88A 2FPKA 4GSKA 4GMJA 1I2MA 1OAOA 1XDBA 4O2RA 4RZ3A 1JFVA 4X1YB 2PYDA 1FFWA 3WL4A 5KSWB 4DM4A 2XUZA 4YPFA 1GQQA 5IVHA 2VHTA 2FWIA 2XNDA 3M0EA 3NYIA 4NNPA 3RFUA 3RVQA 2UAGA 3DD5A 1BDMA 3HYTA 3LUJA 4ACLA 1UOEA 2DFVA 4IMPA 3CHMA 4RIHA 4U7HA 1ECCA 4Q3DA 3ZHQA 1W5EA 3Q5MA 3PPWA 5FR2A 1YL6A 5GONB 2CVZA 3S7BA 5ER9A 3F8SA 3C3PA 1H2XA 2PFKA 3WLEA 121PA 4UNRA 1A82A 1JHUA 1LH0A 3G2QA 3GVXA 4KWTA 3F71A 2F1OA 4TL8A 2FZLA 2YNMC 4MK4A 4WNGA 3PTZA 5EJFA 5EP2A 4BASA 3D59A 2GHQA 3DB1A 4G86A 4J0QA 4LJSA 4L2LA 4PANA 5CCXA 1ZU5A 3UT7A 3JQGB 4MR7B 4WH0A 4PG4A 3UMBA 2PZEA 1BD8A 1F3OA 4JBLA 4UQLA 3SFYA 4F46A 5JEEA 1BSVA 3A58B 3OMXA 4GMKA 1YIOA 1G18A 1Q15A 4DLPA 1T9DA 4RTSA 3Q3IA 2B1IA 2JGFA 4HZIA 4YP5A 3AKDA 4ME2A 3IUPA 4MEBA 3PTAA 1OZ0A 1QTIA 1NL3A 3OJXA 3UWDA 2HJSA 3QKSA 1L5YA 4U96D 3CRZA 3GCXA 3F49S 4FMDF 4KNWA 3PK0A 3S7TA 4BDTA 4Y9SA 2DLCX 3H5WA 1VI2A 2J1LA 4BO3A 3AWIA 4J0EA 5JASA 3WYGA 3IQXA 1MC5A 1TGVA 3F6BX 3OWHA 1T13A 1IUNA 5JVDF 1V43A 2PX0A 2PTGA 4ED9A 1V3QE 3WISA 4CTMA 1C3OB 3CRW1 1IHYA 2D0OB 3NWBA 1Y8QB 5AR1A 1YR3A 2BKGA 4K28A 4QBIA 1CZOA 3IHLA 1I7QB 3R5JA 2WXJA 2GNPA 2WTEA 3IT2A 4JYBA 1LPBB 3I6MA 1GL9B 2R8YA 2WU3A 3PD7A 4JA7A 1S2MA 3THWB 2QV0A 5JHGB 4ACBA 4C88A 1KAHA 2G08A 3GT4A 3PA6A 3DZBA 4RF2A 2LAIA 3GK3A 3UUFA 1IB0A 3K0CC 3P8ZA 2I8AA 3IEPA 3S3TA 1UZNA 3NC4A 4B8WA 3ZE2B 1E5TA 4EYKA 2QQ5A 1MRZA 2CL6X 5CFLA 3PKIA 1S02A 1LVGA 2HN9A 5JD5A 3W5CA 1N34B 4N3CA 4MVJF 1LKZA 4G1EB 1J6UA 5KWVA 2G82A 3DEJA 3ND8A 1LVUA 3WB1A 2L19A 4NYMQ 3FTXA 2B8EA 3B82A 3HYLA 1QNFA 3S2FA 1GTG1 3DFKA 3P7MA 2YCLA 4CTOA 1OXUA 1E2JA 1OE0A 4OQZA 4CM3A 4TSRA 4HDSA 1RADA 1DUVG 3N3AC 1U7DA 4PWZA 4R2LA 4QM6A 4FX2A 4HRXA 3LHDA 4PLFA 3ZE6A 3U0VA 1RYBA 1HSZA 2P4HX 4TMXA 3V8QA 3ENQA 3W1WA 1JQLB 1NN0A 4DZZA 1D9SA 4IS2A 4F91B 3TCXB 1E79D 3C8HA 4DVJA 3K9IA 5EIHA 4ZEWA 1IVSA 3GLGA 4AD8A 2OA0A 4J16C 2H9YA 4Y1RB 4EQ6B 4BFUA 5HHTA 1JB1A 2GS9A 3HO6A 3JD4A 1Z3YA 5ITZF 1AX9A 4IH4A 2OGSA 4Q4DA 5EHGA 3UIEA 4CG3A 1QH1B 5L6MB 1K7XB 1CUGA 1QNLA 3FBWA 3U7QB 3K92A 2NYRA 3EB9A 4BFXA 2BRUA 2XXAA 2Q46A 3T3IA 5KYTA 1IFXA 2BI7A 3FDHA 3QK0A 2OXRA 2XF2A 3WLQA 4LK3A 4HNSA 3M3DA 1R0RE 1EWKA 1G6HA 3VR6A 5B57C 1WXWA 1UBFA 4IH9A 4YX9A 5BW4A 2OM2A 2P4EA 1QYCA 2PQ0A 3G79A 3I32A 1HXHA 2RDMA 1GZVA 1PEDA 1O08A 3BWXA 2Q4OA 4M89A 1T26A 2WF8A 3D0RA 2OEVA 3SC6A 2PVSA 1M0SA 1JG2A 4FINA 5I5EA 3CVLA 4GTTA 3EZ2A 3WLTA 2GEUA 1EB9A 1JXMA 1NR1A 1YRLA 3EYWA 1PZFA 5ANRB 5HS6A 1GGMA 4EJ2A 2KE5A 5BW8A 2VQEB 2Y4UA 2NXWA 3R0JA 2UUBB 2CLKB 2WMOA 1RM4A 3A1TA 3G2LA 2IBTA 5CA1B 3JATA 2J0VA 3CX7A 1ISRA 3UUXA 5TF4A 2A6PA 2CHXA 2PL2A 5AIJA 1E2PA 1V6SA 2ENUA 1WDLA 2FWJA 4N40A 4F0JA 4BTVA 3AR4A 1YR1A 3R0IA 3UXEA 2R68A 5DW0A 5BR4A 1XZIA 4G4SP 5CMYA 3EPPA 3GFQA 4B2YA 1JAYA 2AOVA 3UT0A 1O5TA 1LWOA 3VYWA 4DBLC 1SIUA 2LUHA 3G8YA 4LWPA 4B8ZA 2LIVA 2GM5A 1L7OA 4N6NA 3UMRA 1LX6A 1N2CE 5EKSA 3ZXPA 1UBCA 5KVVA 4DDKA 4INJA 4KO3S 3UENA 1TW3A 3GRVA 4GKAA 1TO1E 1DJNA 2FR8C 4ZAGA 5P21A 3SKVA 4ZANA 4KI7A 2GILA 4L8WB 4ZU1X 4CEIB 5KJKA 4TT3D 2H4FA 1WUYA 3NBQA 3E2MA 3NH9A 4J75A 1G2QA 4UU0A 2QUJA 3RVOA 1RXVA 1BWQA 4E2WA 1H0HA 1O89A 1NDUA 1W35A 1Y4SA 3PHJA 5AI9A 5BOSB 5LWHA 2AN9A 1GCGA 3CYFA 1L9XA 1OCRE 1OXVA 2ZRQA 5HKKA 1GFSA 3APDA 2QBYB 1NSTA 4UQOA 3AIKA 3OCUA 4PTYA 2I03A 5FO1A 3UCEA 1MHTA 4UTXA 4LGVA 4P3PA 2B8WA 2ECPA 1NWCA 2L82A 4UI9K 3BIXA 4KITB 2V3VA 3JY6A 3O26A 3TWOA 1MC1A 5JJ6A 3R20A 4JC5A 3WGJA 1E1CB 3VC1A 5GTDA 1C8KA 3T3NA 2O3TA 5HS4A 2VQ6A 2FZGA 4Z3OA 5CB8A 3BMOB 3QNKA 4N2SA 1FX0B 1X1AA 1DC6A 3RUAA 1BKSB 4PX2A 1O54A 3Q7SA 1P0CA 3KTAB 3MTJA 1E3WB 2ECQA 4MP6A 4Y2GA 4R71A 4H7HA 1OB2A 1VIDA 5JAOA 1QXSA 2V1UA 1Z0DA 1XYYA 2WU8A 3OQVA 1G7CA 1XLWA 1ZD3A 2DJ5A 3ILHA 1L8XA 3KXKA 1MX2A 1HDXA 1RWNA 3QWVA 1C1YA 1EVYA 1VIAA 2EEZA 3COVA 3FWNA 3MTAA 4I8XA 4AKEA 3EW9A 4L76A 2EHJA 4WNDA 1DG9A 1H4TA 5JJ7A 3FETA 3UN1A 4J7UA 1F0NA 3ROKA 3TTTA 1OKKA 2JLRA 4AKXB 1R0SA 1XQ6A 2BSXA 2XKBA 3IILA 4IMIB 4WBSA 4F5EA 2XV1A 4BTLA 3QXCA 3ICPA 1QWOA 4KREA 2XBLA 1IL0A 2A9JA 3WO1A 1KY5A 3ETEA 2HLDA 2QSUA 4Y6QA 1L7QA 3I83A 1A7JA 1ZUNA 3OJFA 1RW4A 3LZCA 4K86A 4CMHA 3DTYA 1QUFA 2HWUA 1E64A 2GNOA 2OT3B 3JVVA 3PXUA 4R1NA 4LFCB 1AMOA 2ZXUA 3QSYA 3H4TA 2P9EA 2EBFX 3H3XA 3BXXA 1KEEB 4ZT7A 4RZSA 1USVA 3RTDA 3N8IA 3P71T 2CLIB 2AG8A 3QV2A 4KYTA 2WTXA 5FOXA 3DEYX 1EVEA 3GI1A 2DPLA 3W9GA 1QV6A 1M1YB 2ZXEA 3DHNA 3ROXA 4BMDA 5IG2A 4DV6B 2ZAIA 1NULA 3NHKA 4BUCA 2WPDD 2AW3A 3O75A 2XAAA 5JISA 3K0AA 1E7MA 1WCV1 2OHJA 4HG2A 5HVNA 4QODA 1O3YA 1TM4E 3OFVA 4MW7A 3WR5A 3KYCB 1IOLA 5EILA 1TJNA 4JA0A 4KBQA 1YOVA 4DQKA 3AUSA 5AM2A 3SQWA 3TJPA 2ZVQX 2Q29A 4PG5A 1FCHA 4IOJA 3O7WA 4V0LA 1C3OA 1QZXA 1Z5ZA 1YSCA 4JWKA 3RASA 4JL5A 2IW1A 3OAAA 4Q3BA 3OU6A 2FPGA 4EG4A 2F7SA 3L8CA 4L4SA 3IDZA 1V7QA 4QYIB 1WIWA 4GGPA 1JSRA 2F43A 2HRZA 4RE6A 3WLKX 4ZHQA 1JJAA 3R23A 2V6IA 1HR0B 3AF2A 4XRRA 4EMBA 2R84A 3I8OA 4MQLA 4TV8F 4F86A 3Q79A 1NUPA 1V5EA 4JHRA 1D5WA 1MV8A 4LJLA 4C43A 1BYIA 3SC2B 3DDZX 2E4UA 1VI5A 4NBNA 4ZOAA 2X1LA 4MDYA 2HA6A 4EG3A 4GA1A 3KR2A 3Q2IA 5J58A 2P9SG 3AERB 3ZVKA 3PCRB 4GL4A 4LNBA 3K6SB 5B1YA 2IYRA 2KBEA 3GD7A 3HN7A 1SHJA 3P9SA 3LX8A 4AJPA 4JYAB 2GXSA 3LT0A 3VR1A 1UN9A 3EWNA 5EUCA 3CU5A 3FGNA 2GX6A 2V7BA 2IDJA 5JSYA 5AVQA 5B3AA 3CLRC 4D43A 4BFTA 5C0OE 2BDTA 3AEKB 4D9BA 2B9EA 3AEYA 1DWOA 1G7TA 4DX6D 1J70A 1YAHA 2ZWAA 4BMSA 4DJJA 1ISGA 2RFAA 5LNK6 2LAHA 1V47A 1K1BA 4HYTA 3PQ4A 4L8VA 1RKBA 2PZMA 1EE9A 4A2PA 3AG1E 1AKVA 2NYAA 3HHPA 3BRWD 5IFLA 4AZ0A 3KHUA 1XN1A 4LCJA 4FLEA 4RF4A 2IT1A 4NJMB 4L4XA 4UTOA 5LYYA 4RTLA 1YRWA 1CJUC 1LLCA 3IP1A 5I45A 2VSXE 1IAQA 2E18A 2HSEA 2HHJA 4RS3A 3RSEG 4ER5A 4GZCA 1VMAA 2C7GA 1JALA 2HM7A 3GZ1A 4R2KA 5COQA 3UWKA 2KJZA 3EEOA 1QC5A 2YL2A 4OBWA 2MOKA 3M4JA 4QOFA 2ZBDA 3GRAA 5LD2B 2OEPA 1SC4A 1O97C 4JK3A 2C2KA 3S68A 1T2FA 1VPLA 1OUMA 4R0MA 2VYIA 1RAEA 1VPEA 3MTGA 1F51E 1WB5A 3FPHA 2BBTA 2RH8A 2AG5A 4F4CA 1YA0A 2BL4A 2GZ3A 3GNLA 3OOYA 5DN9A 2R60A 3E82A 4JJ7A 4LSGA 1XZNA 3KKLA 1SQFA 3DEOA 1A76A 1EXWA 1JI0A 1FUYB 1R5JA 1NW6A 2YZMA 2O5RA 3HJHA 1DWUA 3Q7PA 4N0DA 4RNDB 3TL3A 3BWMA 4DLBA 4AROA 2HRDA 1FDSA 1IPEA 3OZIA 4QUJA 1XJCA 5KBYA 4KN8A 3PJFA 2I6SA 1ZK0A 2ZE5A 1GN9A 2YHUA 3DGFC 1P7YA 3L4EA 3LCRA 3PA8A 1YXMA 4BQQA 1XVVA 1QCDA 3CPEA 3FJ1A 4JJAA 1LX7A 1N0VC 1UM8A 2OWDA 4TKZA 4X90A 2G4LA 2QRJA 2PO5A 2V7QA 1XWIA 4UTRA 1OFHA 1R37A 1XZDA 4LOLA 3U4IA 4MWDA 3CV0A 3GN2A 1V9SA 2PZ8A 3C85A 4FHFA 4MVJH 5EE3A 3HVJA 3RU7A 1Z5OA 1UMDA 4GEGA 3LW7A 4GLJA 2V7PA 3DAOA 5K3DA 3AS4A 3DXKG 2H16A 2I6QA 3DKIA 1M2OA 4PO1A 4TL6A 3DULA 3T95A 2Q0SA 3IVXA 4DBLE 4U2GA 1X9GA 2QI9F 2QRKA 2W00A 4J8EA 1M67A 1P2GA 2WSLA 1V16B 4NESA 3VR4D 4U6NA 1P0PA 1CF2O 2GAIA 1MP0A 1RMQA 2KHZA 1G60A 1RR6A 3MWJA 4HDAA 3PITA 4HRYA 4LSZA 3TZLA 4F6LA 2FWMX 4CKZA 1ZH2A 4L74A 3CLUC 4N8DA 1CUSA 1K86A 2B4RO 4Q7KA 4FB5A 1XVLA 4X8HA 4KXNA 2VN8A 1Y5IA 4LXXA 2COEA 1QG4A 1RCUA 3K32A 2B1QA 4EFMA 5HRAA 1THZA 3QEAZ 3UXHA 2I9KA 2R6R1 3IHTA 1R10A 3M3HA 1VM6A 3DHWC 2IW3A 3A3KA 1THTA 3COPA 2AFIB 2XCLA 1N36B 3DZHA 2ONYA 4HORA 3DE3X 1Z4PX 3F3MA 2X58A 5H7XA 3THRA 3ZGNA 3GZNA 1ES9A 2P9UG 3TK1A 3O94A 1BZYA 4H35A 4BP3A 2D2VA 4EATA 3RK1A 2E48A 3CVVA 1SOWA 5H1YA 2PUGA 3C6ZA 4JVSB 3LDFA 1Z47A 1EDUA 5T8IA 1KXZA 2FUEA 2IYLD 5KJ1A 2JFQA 1JBQA 1I3KA 1I8TA 2AQ8A 2J5KA 4KUGA 2DGDA 5EJAA 2HEIA 3KBBA 4FX5A 5E6RB 2GJ8A 2ZZKA 4D9KA 5JH7F 4KQ6A 4JYZA 1X9IA 2Z5GA 3JSXA 1VL2A 3PJEA 1ZIPA 1AQ6A 4TTJA 4Z4IA 3CQCB 4BSZB 4UXHA 4U07A 4BN5A 1UXOA 3EXEB 4EPXA 3NUGA 1Z8FA 2FLKA 1G7SA 4R69A 2GPBA 2ZIVB 1C30A 3GGDA 4ZRDA 1G2OA 5KVSA 1UPTA 4MW4A 5K1ZA 1KDTA 1ATIA 1ADBA 1EUDB 3AFIA 4QPJC 3R3WA 5GJBA 3H97A 4C6TA 3FMOB 5A05A 2BFBB 4A1GA 2GN9A 3MAGA 2FSHA 3N7UA 3MFYA 1OT3A 4AYTA 1QQAA 1VHWA 1OY1A 2VHZA 2OYRA 3M8KA 3V6LA 3NGMA 4A0RA 3TRFA 4KR3A 3QXXA 3KEGA 3VU9B 2B98A 3PIDA 4R3WA 3DV2A 5IABA 4JI6B 1NMEA 3TBFA 3DNPA 5CEFA 2PFSA 5CLHA 4CXMA 1R2QA 2OZKA 2QU8A 5AKEA 1VHLA 1QBQA 1IN4A 3ZU7B 1U1CA 3PCXA 4NNOA 3Q7RA 4P29A 4M1MA 4BT9A 4O6VA 3HFJA 4GOOD 2O14A 2XUAA 4RC9A 5IJAA 3ZZ0A 1DX6A 5C8YA 3WGLA 2BFOA 3FYSA 3F2IA 2WVIA 1UXKA 1Z68A 1JYFA 2A9OA 1SG0A 2JAOA 3AI3A 4P4LA 4OH7A 3T7TA 1XDSA 4KBFA 4UWKA 3G0CA 4YMTA 4MW6A 3FUKA 3V8BA 4F11A 1CJMA 2CLCX 4GLFA 3RVKA 1LBHA 2NO0A 3IHKA 1I1OA 4XUCA 2GYUA 1P5FA 4EG8A 4KQJA 2HR1A 4FIDA 2AOUA 4YNBA 3U81A 5IN5A 3EVNA 1CUEA 2FK7A 4QHTA 4LGMA 3ZEFA 4WLVA 4YCDA 2OY0A 1JP7A 1ECGA 2OD7A 5ALYA 4KT6B 2FF4A 2OBXA 2TMYA 3ZV5A 3DLCA 1D1PA 4F9TA 2BE7A 3KZ1E 3QNUA 5DTQA 1NQ5A 1K97A 3AFGA 3E9YA 4DT1B 4AL4A 2JHFA 1SBHA 2XE8A 3FSGD 2G76A 2VAPA 4LOAA 4AZVA 2IOSA 4QOSA 3VU3A 2ZBGA 4FGSA 3I2HA 4ZEXA 4OCZA 3EG5A 1ZESA 2PR7A 4LX8A 2PH1A 3UKRG 1TI7A 4DLYA 3HJAA 3KKZA 3O4VA 3Q88A 3ZWDA 4CYMD 1Z35A 3HU2A 2K4NA 3G3EA 2B0JA 4I9CA 4U2DA 2VP6A 3HPRA 2Y1KA 5A7GA 1A98A 3AIOA 3SK1A 1CNMA 1ZVJA 2WFAA 4BMPB 3CIAA 1MJGM 2IEBA 2EYQA 2VSFA 3QH4A 4RVOA 3CT4A 5FRDA 1K63A 2MIIA 3JYHA 2IY9A 5EHZA 5KDDA 2AXZA 2CFTA 2VXBA 2X8LA 1TNZA 2WWGA 1S01A 5F7XA 3OZAA 4MA0A 5BSWA 3STUA 1PGOA 3KZCA 3EPJA 5DSZA 3FRHA 1KI6A 2YHIA 2H31A 1DFHA 1ZGCA 1T8SA 5A4DA 1W19A 3Q41A 2V65A 3EXEA 3BEOA 2Y1GA 1BE0A 3UG7A 2XGJA 1I24A 1BGXT 4H1UA 2FEZA 2WT8A 2HIAA 3RBVA 3I9KA 3GLVA 1EM8A 1QOPB 3E33A 3U7GA 1V7ZA 5D0OD 3B1JA 2D0DA 3DMTC 4DJAA 3DMDA 3QI2A 3KLBA 2ZJ1A 4ALMA 2CF5A 1S6YA 2H4WA 3EFOB 2DHQA 3K0EA 2FK8A 4LZLA 4DIEA 2YXDA 3D0KA 2JJYA 2CF6A 3DLTA 4LBYA 4O4HF 3B1VA 1H8HD 5KNBH 4YMUA 2IWHA 2FP3A 1JIXA 2JFHA 4NBSA 3W5UA 3WB9A 1TTTA 1XUOA 1N0UA 4BZZA 5EZ6B 1J2EA 5CEAA 3D8UA 3ONWA 3W77A 4CU2A 1QV9A 2AYXA 3BE6A 2IYUA 4IG9A 3FOCA 1T6ZA 3GIDA 2DXIA 2VDRB 1J09A 3JQ7A 3ZHUA 2QRUA 4V38A 1HNZB 1DO2A 5ILOA 2YXPX 1GUFA 2MU1A 4IWYA 3R7WB 2W2QA 1KRXA 4HUQA 3ML9A 1AJEA 3OA0A 3G88A 3RRYA 3PEUA 3N2GB 1YVRA 4NBTA 1WSAA 3DAHA 4JQSA 4M1TA 5L7YA 3U80A 4F4IA 2XZLA 3FJYA 3OJEA 3QVGB 1H1TA 1AGPA 1DIGA 2RCYA 3E0XA 3R9AB 1KPIA 4HAVA 4K6HA 2PVPA 4U00A 5SY4A 3ONLA 1P1HA 2XCUA 4UREA 3TG5A 3HUUA 1IRIA 2AL7A 3PSHA 5EMHA 3OP4A 1D2CA 1AZLA 3EA4A 1WG0A 2KJQA 4OHXA 4A2WA 2FULA 4GYWA 3CUUA 2ZR0A 3U1VA 1IOWA 1B0UA 3CVUA 2BEWB 4E6EA 4HDQB 2W98A 1NF2A 1OAOC 3V2OA 4MV9A 1A9QA 4UARA 1YA8A 1GQRA 3SEAA 1RQGA 1M1ZA 4HDSB 5ALLA 4EZEA 1KPSB 2PDAA 4UM9D 2RE8A 4I46A 3QTBA 2G28A 3PUKA 2ZYAA 3D2LA 5DOVA 3H9BA 1WB6A 3UAWA 1A9XA 2O2IA 4X0EA 2JEZA 3RVJA 3RSZA 4P0PB 4RVFA 1IZ7A 4R0NA 1T2VA 3EQ2A 3K9HA 4H18A 1E9FA 1T6BY 1PWXA 4JT8A 3VHLB 5C8DA 2PRYA 2PEZA 2OBLA 3ZOZA 1UPCA 4GAAA 4X9XA 4U0SA 2Y9PB 2YZNA 3IQDB 1ZR2A 2AKEA 4DT1A 3N0XA 4K9DA 1J24A 4OHCA 4O4HB 4WNFA 3Q7FA 1YCHA 3BQ9A 3C7DB 4JU8A 4LI3X 2O0MA 1IJFA 4ZN6A 4QM7A 3P9QA 4DY4A 3GMTA 3WOHA 3DKRA 1IB6A 4II3A 3CEHA 4L5IA 2AZXA 3Q7QA 5IN4A 1DS6A 3GEMA 2ZDHA 3KFXA 1MAAA 2B0CA 2ZUUA 3DT8A 5D1NA 1H6AA 1WSBA 2LWIA 1V11B 5G4LA 3B38A 1U2TA 1YDMA 2XEHA 1XLTA 3RSFA 4YI3A 1J8VA 2J3JA 3F73A 5BXOA 4G0MA 5KTKA 3R5KA 1PGQA 3QVLA 2R1UA 4AM8A 1AQUA 1I0ZA 3U64A 3H5RA 4F2DA 2VLIA 5BSFA 1HWYA 4J0UA 1IHDA 1KI4A 2A1TR 2B5VA 3PGLA 3NKVA 1NN5A 1E3DA 2RI0A 4MV8A 4PGAA 3ZUGA 4AQDA 5M34A 1PVVA 3OF5A 3VJRA 1H6BA 3EFOA 1CSEE 2CXPA 4BO6A 1PLLA 2GHTA 2EL7A 2WWHA 2FMXA 1PR9A 2X5JO 4W9NC 2C3OA 1XKLA 4Q9KA 1MQSA 3MJHA 4CM8A 2YZKA 2WF9A 2NSYA 1WXXA 1JE0A 1Z3XA 1XJ5A 5L4NA 4RH0A 2WQ7A 4Q7EA 4DUGA 2GAFA 1C3XA 2CK3A 4PFSA 3S70A 1GSHA 1NBMD 4OP2A 3MWFA 4P84A 4I6JA 1GPLA 9GPBA 4W5RA 3ESKA 1VSQA 2OWEA 5B6IA 4JBNA 2D1TA 2W37A 3LPCA 4OOFA 5BY2A 1SURA 3I1FA 4YJHB 1QTRA 2EVWX 3OOEA 4TN1A 1RM0A 2QL6A 1X7GA 2OVBA 4OVVA 1S5PA 2JLCA 5JCZA 3FH7A 1IOVA 1D6JA 3T3MB 2GN8A 1A27A 2PS9A 3WXBA 5LZ4A 2HJVA 3CSTA 3OPVA 5EP4A 2BF7A 3KUDA 1DAEA 1BXKA 3DPUA 1SIOA 2YWEA 5DBOA 4PX3A 4YRPA 3SO8A 1FSZA 3ZKJA 2XZDG 3CVWA 1NVKA 3WL7A 2MDTA 2GN0A 2QVZX 1BQ4A 1EPUA 1U98A 3CG0A 3MK31 1HS6A 1TCBA 2UZ3A 4YJ3F 2NNWB 3Q3GE 3UA4A 4YQFA 5A4KA 2NTJA 3RU0A 3QX7A 3ZGXA 5DDIP 2VZ9A 4G2VA 1FNBA 2BTQB 4TSFA 5IDQA 2GEJA 5EYLA 3LOPA 1ZMBA 5U4XA 5CD1A 1HYGA 1UP4A 1N2HA 2ZE8A 2X7JA 2X4DA 3A04A 3HCDA 3T5TA 1K7FB 3CX6A 2CE7A 4CNQA 3NJ4A 2G63A 3BT3A 2GZ2A 2JD0A 2C1XA 2K7ZA 4CF6A 4EOGA 2BJVA 3KAKA 3HWWA 3O8NA 2ACVA 1WZNA 4MRPA 1UXGA 4MKHA 4TVKA 1WZ2A 1J49A 1K5GA 1EFVB 1AY0A 1GKKA 3K0BA 5F21A 4A26A 4QBHA 1QMGA 1S4QA 1ZJ5A 2JJ2D 4GX1A 4LJ8A 5JV5A 3QVSA 1DAPA 4LZNA 2IH2A 1CY2A 2CFRA 2GPWA 4MPPA 2I4MA 3KSAC 3D9NA 1IWPB 2ZETA 2Z58A 3G2SA 3I3OA 1TB4A 3F47A 1W88A 9ABPA 4Z3DA 4ENUA 3N76A 4JI4B 2HK7A 3HG7A 1W0JA 3QV1A 4QRDA 2C0QA 1GZUA 1G3UA 2UYYA 4I5GA 4KQCA 4BGEA 1NJSA 4D9CA 1K9SA 1VZ2A 1JQDA 3HCCA 4FDUA 4JYMA 3I5PA 4ZMRA 3TWRA 1E92A 4X93A 1KERA 1ISJA 3MRVA 3A3OA 3BGIA 1P2VA 5TIIA 5A9SA 5KOYA 4BC1A 1P5JA 4O33A 4PZDA 1N54A 4X54A 4XIJA 3NF1A 5ARFA 2FF5A 4BSXA 1KI2A 1ITZA 2G71A 2OGUA 5DBKA 5AO9A 5MN5A 3GJSA 4DV0B 2X13A 3ZN3A 2PLRA 3PEWA 3OFSA 1OYWA 2QENA 2GPTA 4C0LA 1EP1B 1H2FA 1FP4A 1PL8A 2JGDA 3C3JA 2DWUA 3KQQA 5FBHA 3PUZA 2FUG1 5B3SE 4UMVA 2DQKA 2QPAA 3NDRA 4FLFA 1E4EA 4HPJB 4NAVA 5BV1A 1CUFA 5FJYA 2DUUA 2GF0A 2PS1A 2XMCA 4OJNA 4ALJA 4AXBA 4ARIA 1V11A 1YRYE 2D2EA 1NVFA 2VHVA 1Z62A 2XMRA 3IBTA 5EA2A 2AD5A 3TNDA 3MEKA 3WE7A 2FHSA 4B7ZA 4JY7A 4S3MA 1KFKB 4IFTA 4BATA 2C3YA 2VKQA 3LPMA 4JLPA 4MYRA 4NZOA 4PNZA 2FWNA 4J3JA 4DZTA 4R7LA 4ZO4A 3M6FA 4WBNB 3ZY2A 1NXXA 1TKAA 4Y2YA 1N2CB 7MHTA 2IU3A 1NBEA 3OX1A 4RKRA 3GO4A 1R0LA 1E4VA 3TW8B 8ATCA 1FDRA 1C8VB 5H5JA 4CGVA 3TO5A 5BUQA 1GLNA 4B3FX 1M8FA 4UQXA 2BBSA 4KX3A 5B1IA 4FNMA 2OFXA 4GVPA 1ONPA 3JQEA 3EA5A 5I9NA 4XZ4A 2R5SA 4KPYA 1YS7A 1K0UA 1Y7LA 3CX3A 3H2SA 3P2KA 4DV1B 1SQ5A 4MKZA 4ZCTA 3OLVA 2R1ZA 4MS6A 4KPUB 4EHLA 2QTVB 4Z3KA 3EC7A 1E4YA 3T8KA 5BVGB 3MIIA 4CKWA 1AS3A 1JAZA 4LF7B 3DSTA 1DKNA 1QCCA 3QVGA 4LISA 5EHNA 4AMGA 3V8VA 1BOOA 5I3ZA 4H6VA 1E6LA 1QAMA 3D8BA 3IQEA 1R7RA 4KZCA 1Y37A 3OTHA 4DANA 1YDWA 5JZVA 4NBUA 2P6PA 3NDPA 1A97A 2EARA 2GRNB 3GOQA 2XMZA 1J9GA 3HDHA 1JA1A 2BMWA 4GZLA 1DOHA 1OZFA 1QP8A 4R2HA 3VI3B 1ZD9A 4F56A 4XYMA 3TLCA 1C3JA 1P8AA 2I6UA 3O8OA 4H9GA 4ANVA 4Z8XA 1XZJA 3IKLA 4OHVA 2QQFA 5FD8A 3TEFA 2DBYA 4QBGB 2JCVA 5K03A 1D7OA 4GP6A 4DYDA 4PNPA 1FRQA 2QB5A 4RGYA 1V96A 3UVEA 3VR5D 1B1CA 3AB3A 5ABPA 4BE4A 3KQKA 5BRAA 4CQLA 4C0MA 1GCIA 3AI2A 1MHQA 1C30B 2O7QA 3ESZA 3ZWXA 4Q3OA 2OLKA 3BBLA 2WXOA 3F67A 3M5DA 3LAWA 1HFAA 3GGGA 2RHGB 2F55A 3OTNA 4YXWD 4JSRA 1OI2A 3V31A 1PS0A 2BISA 2CEAA 1R9MA 3MWLA 3GT3A 1FVXA 1QLJA 1WOMA 1RPAA 2FG6C 2I76A 1SOVA 2IIVA 4A0SA 1XIVA 1J39A 4P3KA 3RVSA 5KI6A 4BO7A 4ZEMA 5HQ3A 2DUJA 1XK6A 2P6OA 2TMDA 5HIJA 1UR5A 2G3YA 1TZKA 2P4QA 1GCUA 3S28A 3PRHA 2JCXA 2ZBFA 3NBKA 1TC1A 2F3PA 4EARA 3F7OA 3ZD9A 1Z2EA 2CXNA 1MBZA 4PHTA 1H2RS 2O8VA 1ZOSA 1SVNA 4EB3A 5IXYA 1L1EA 4YRTA 1NAHA 2FN9A 5D7NA 2FSSA 1TR4A 1N9GA 1UBUS 4C03A 5J5CA 1OFUA 1NP6A 1CR0A 1GPWB 1N1MA 2G77B 4OHWA 4WEOA 4Y9RA 4AZTA 5LD2C 4K6GA 4DLOA 1TTQB 1KORA 2VJQA 3JARA 3LKBA 3M5PA 1G2PA 5HM8A 4CZ2A 4F8YA 3D8NA 1N94A 1KJ8A 3DSUA 1N2ZA 1LU9A 1ND5A 4KFUA 4MWBA 2WJJA 4PXYA 2JGDB 2CNBA 3UJ7A 3U09A 3NALA 2IDKA 2ZGGA 1DBVO 4JW1A 4LPSA 3E81A 2VAMA 3TCKA 1KY2A 1GAXA 4JUDX 1YFZA 2R5NA 3R09A 1XYGA 2D00A 2GO1A 1TVMA 3HFGA 5LYJA 3T7EA 3CBGA 4DDTA 3OPXA 2CEKA 3PS9A 1X86B 1DFIA 1OW3B 3TRJA 2IHYA 2UDPA 1NW7A 1OLUA 1J0BA 2WXGA 2I1JA 3EXG2 4Z0PA 3S2SA 2QKYA 1KZ6A 3GNTA 2ST1A 3ZNQA 1OC4A 2B2CA 2VT3A 4LNHA 4DEXA 5E2BA 5FLEX 1XTSA 1BQ3A 1ESDA 3K2BA 2MRIA 1YAJA 4Z4HA 3DE1X 4B93B 4OSPA 1CDDA 3A14A 2WSSD 2J6HA 1OBFO 3C7CB 2IDMA 2NXEA 5B1AE 3HGMA 3Q1KA 4HGOA 3JZFA 3VV2A 4FYKA 1I2BA 4N0MA 4ND5A 3LT4A 4N6GA 1Z2OX 1RWPA 1II8A 1SZ9A 2J59A 2VPPA 2F8YA 3H87A 3MD0A 5C80A 1UKZA 1ZNXA 1N1EA 4J49A 3DXFA 2P30A 1RQ2A 2HB6A 3DXXA 4R05A 1Y0BA 3D4BA 3DZ8A 4G67A 4UHJA 5DNCA 1WLSA 3MTEA 1PQYA 1QQ7A 4HB3A 1NIPA 3IP9A 3MCZA 3FUDA 2IYOA 2QZJA 2VVTA 4X20B 3UG6A 2KMLA 5LR6A 1XGKA 3P0EA 4NJEA 3ZDXB 5JSHA 2IEAA 3ASUA 3L0YA 1JH9A 5EMJA 5KB3A 2QAJA 4JOSA 5LSAA 1C8BA 2BFBA 1X1CA 1WVIA 5ARGA 3NTQA 1PEKE 3FSRA 4MUFA 1L3IA 3TKLA 1NI4A 1QGED 3UKDA 5AM0A 1J9EA 2VT2A 4LX0A 4HAOA 4MNTA 1G38A 3UM9A 3DAYA 3OEHD 4XM2A 2BFAA 5EZYF 5G3ZA 3D9JA 4OHOA 4B71A 3R5TA 4YDSA 1D2RA 4Z0HO 2OCXA 1KPGA 5EZSA 4PS8A 4H1WA 4NG4A 1BO6A 2PQMA 3UPDA 4ZC1A 3TJRA 1FTWA 5CIYA 4ZOLB 1WW8A 3I5XA 3RRJA 4HNAD 1H6PA 4NCBA 4YMWA 3V7YA 3K94A 2JGIA 3OLZA 2F48A 4NH4A 4A23A 5LOVA 4KHPB 1B43A 1B8VA 1EDDA 1R6XA 2ZULA 3EISA 4AVXA 3R2JA 4HDRB 4B0PA 4CTKA 1YRAA 1V1JA 1UJKA 3DNMA 1WPGA 3ZVLA 4HQDA 1JR3A 1W75A 3JAWB 4LRUA 4C2BA 3EEQA 2XUDA 2PIDA 1K8RA 2FB9A 2HWYA 4JODA 4WZ6A 3TTVA 1HOTA 3ZCXA 4EJFA 4BBZA 4Z4CA 3B8HA 1S2NA 1DKRA 1ZOPA 2R2AA 1S8OA 3MMZA 3PL1A 4HXFB 4RA6A 1EXVA 3L8FA 3HMKA 2ATVA 2C54A 3BMQB 3R3YA 4BY6A 4PS7A 1LV8A 2Q7FA 2N75A 3FVWA 4QQFA 4WOCA 4GTRA 2A5JA 2C9DA 5AKXA 3TI9A 4Q7QA 4NJOA 3UJ9A 4CTNA 3NHAA 3CR3A 5AT1A 1SUPA 3BPSA 2HNAA 3ZYZA 5CA0F 3SI5A 1YBAA 3EZYA 5FLKA 4YTEA 3AP1A 4U39A 4G2NA 4CN9A 2CXOA 4HJRA 1XRJA 3LQKA 2YHSA 5AFSA 4AS3A 4MQ6A 2JK0A 4YACA 3OD1A 3PVSA 5LP1A 3ZQKA 2QWXA 1T24A 1JYSA 2MHCA 3BX1A 3JTEA 1VGRA 5C53B 4Z4GA 3GZ4A 4LERA 4QXAA 1NA0A 1U3WA 1YZKA 4LNUA 4C29A 3ER8A 4ZV9A 4MB0A 5CJ2A 4CIYA 3DTVA 4QHSA 2OOKA 1E5VA 5H82A 1KO5A 3BC1A 1ZSNA 1JF8A 1SOAA 1LRKA 3ASYA 4XWOA 2RSFA 1GFZA 2FW6A 5EC8A 1E8OA 2OK7A 2X5KO 3RIEA 1T9ZA 4HQRA 4A5OA 5HUQA 4X66B 1YT5A 2QROA 2EKQA 4N5CA 4BO8A 2E1RA 4X8MA 2C7RA 2NSJA 3DWEX 3JQFC 2VYFA 4N01A 4OGLA 3VKVA 1BN6A 3K3PA 2WM9B 3DCJA 4FMBB 3HB7A 3M6IA 1YE3A 2M6KA 3T5MA 4YGXB 1MO6A 1SA0A 2QP4A 4GI3A 3SKXA 1YZNA 5J4VA 4FFWA 1KIMA 1LWNA 1ZMTA 5KQGA 1WCIA 2MT9A 3ZBUA 4IX9A 1O94D 2W6PA 4RIEA 3NR2A 3FDJA 4I1AA 1XOIA 3IX7A 4D3SA 1LI7A 4WRRA 2RKBA 4YB8A 2LCQA 2G40A 2ODWA 4K6FA 4GCOA 3L18A 1YK0A 5LQUA 3QKUA 2PMDA 3LT2A 3NKLA 4AQ7A 1EGAA 1JQ5A 2YFYA 4AMZA 1DP4A 4KACA 1UH5A 1RJ9B 2DH6A 2ZRBA 3DO6A 2BKUA 4R5HA 4BAGA 5LP6A 3PPXA 4P1ZA 3U31A 3BXEA 1GGKA 4AEZC 1W4RA 3CO0S 3DF9A 3DP9A 2VC2B 5AKHA 4DSAA 3ZJUA 1BIFA 1NKTA 1JCQA 1N9KA 3BL6A 2AMVA 3MERA 4AN4A 5BNTA 3MXTA 3W4IA 3V1LA 2P9ZA 3E4BA 1X9HA 1NOIA 2QN8A 4O0LA 2C3UA 5ED4A 4DV4B 2QR5A 2C42A 1BEEA 2NW6A 4H27A 4J3NA 3GYZA 3JQ0A 1NVBA 2O7SA 4QL3A 3TFWA 1EXMA 4O4JA 2EKZA 1QB8A 2O5VA 2YASA 3HH8A 2JGLA 1M9NA 4P83A 2GROB 4UJ3A 3SHTA 1Z5PA 4LCEA 4ARSA 4BQIA 2J7KA 1XEXB 2OQ2A 3LHKA 4Y9DA 1BMQA 2J4CA 5GOZA 1QWSA 3G9UA 3TWXA 1VJ1A 3GXBA 1IXSB 4TLEA 5TEWA 5ALPA 3IAHA 1T9GR 2EG9A 1PZXA 4Q4LA 3VU0A 5J43A 2P9GA 3OXLA 3REOA 4N5IX 3TGOA 3MRTA 3P0FA 3PXDA 2CXUA 3PI7A 1LTKA 2IU6A 3JR7A 5EFOA 2AZ4A 4GRDA 2H1FA 3H2IA 1BWRA 1L4FA 4CDRA 1PTJA 3DOOA 3N05A 3WOVA 2WJAA 5AIBA 3ASDA 3F8TA 3HXEA 1Q2XA 3SX2A 1MQ9A 2FN3A 5FBKA 2FCRA 4MCAA 4UEKA 3DQZA 2GZAA 3ETNA 4C3OB 3G5TA 1A5AB 1DBSA 4Y1GA 5HCIA 1TF5A 3UTDA 5FV4A 1XWWA 4FYMA 3D5QA 4JJKA 3RUEA 1T3LA 3WNDA 4EG7A 2ZVJA 1ZD8A 2WHRA 2VTKA 4H4CA 4MUNA 2A94A 1O0BA 2VPIA 4KVAA 4XASA 5IRCD 3HM9A 2JJ1D 5IBPA 5JW6A 2ZRHA 1DEAA 2R7MA 5HSGA 2ALJA 2UV8A 2FQQA 1REQB 4GZ5A 2HFKA 2X6JA 1G0OA 4IJ6A 1V41E 1W85B 2I3GA 4NY1A 2REBA 3RNLA 5GPBA 10MHA 3ZK7A 4GMFA 1FP2A 2AA3A 3VH2A 2ABWA 3DOUA 4TSKA 5T8KC 3ML8A 1JDVA 3VFDA 4A92A 4DYVA 1EAMA 1YYHA 6GPBA 1EX1A 5KSPA 2FXIA 1JSZA 2OV4A 5E4FA 3G2TA 1Y3BE 4HY3A 5KC9A 5A0TA 3PKZA 1EWTA 4Q19A 1JBKA 2NQTA 1NNEA 2J30A 4US1R 1HTTA 1QC5B 3IODA 4J1QA 1O1SA 1CETA 2A4MA 3OAWA 3DHVA 1VXRA 2GFIA 2EGHA 1H8EA 3A3YA 3DTVB 4ZA2A 2EBHX 2GHRA 5TPZD 3D9LA 4CLEA 5IY5E 1FFHA 4QAQA 5GJCA 5C1BA 3GIWA 4RBNA 4RACA 4A15A 2CXTA 3OFJA 5CBPA 1U7OA 4DSNA 1WNFA 3IPLA 1ENOA 1GGNA 2I78A 3NS7A 1UBRS 4P5EA 5DYWA 1CP3A 1NBIA 1O9BA 1D1TA 1E2KA 1FXWF 2H7YA 3HCRA 3NOOA 1RU3A 2ZSJA 2QN2A 4IJ5A 4HNAB 2IRWA 1VL6A 4FHEA 4P7KA 3CGGA 3MIZA 2DRIA 4GQAA 1JWAB 2A5UA 4OXYA 2PJUA 3TSZA 4M6WB 4Q05A 3HUFA 1U8YA 3ZHEA 2C9CA 1QYIA 4F4UA 4F93B 1HDGO 3W5VA 2P0AA 4HQFA 5EXXA 1GW6A 3RNOA 3G1WA 3IIMA 4BNNA 1UPFA 5FFNA 4F6RA 2JHAA 2B3TA 1MJ0A 1JIVA 1A8IA 4G8DA 5KNDH 1E1QD 2AC7A 3M9WA 4BLQA 4BL5A 1XPOA 4PYKA 1B6SA 1PD1A 1L7VC 4AJLA 4OFXA 2BGMA 3NBAA 3FTWA 1H69A 3TQHA 1H2WA 1VPDA 2RBKA 3KUUA 2BHRA 4CL8A 4OLHA 1GGFA 3BD6A 1Y3HA 1L3BA 3IKVA 4R9VA 4I14A 3FYHA 4B17A 3B60A 2JLBA 3M2PA 4QA9A 2PQ2A 1H05A 2ADMA 4N0PA 3GLKA 4LG6A 2JIRA 3O84A 4F9GA 1DVPA 3VPAA 7REQB 3IOYA 2XUHA 2O19A 5IW8A 3AB8A 1WU8A 4KMSA 3RJ5A 1U5BA 2BP7B 4RVUA 3LUBA 1B74A 1KJZA 1L7DA 1N0HA 4MVJE 2OBNA 1V54E 1E9SA 2EQBA 2V6GA 3D3NA 1U2RA 2WD9A 4Q96A 1ZS9A 3P0JA 4WVLA 2FX3A 2R5FA 3F74A 4ZMBA 3R9XB 2RONA 4Q01A 1CZNA 2H4JA 4XYGA 5ENSD 5EHXA 1F3LA 3BICA 2DK6A 1ZAKA 1NSYA 3MMXA 2VUIB 1E66A 1GNQA 2C2BA 3NOQA 4WPGA 2CC2A 3STWA 1VQ1A 1EH5A 1Y81A 2R4UA 1JPVA 1K7EB 3GA5A 5AHKA 2JFOA 1H1LA 1D1QA 3T9KA 1KAOA 3KFVA 4HQLA 5BR7A 5AOBA 2XCTB 1IPHA 5KYYB 3PWTA 2V9PA 3K70B 2JFWA 2OCBA 2PZKA 2UZ1A 3FNQA 4CMEA 5J90A 4X1IA 4IJVA 3B85A 1P2UA 3CJTA 4YALA 4EP1A 5JAIA 3KXLA 2P9TA 1XV5A 2CHEA 1AZSC 4OATA 5L51A 1T0UA 4MWZA 1Z2PX 2XITA 3F4BA 3MXOA 1Q21A 1JSLA 3A1VA 4LE0A 3SVZA 2FLVA 3RTCA 1GUDA 1KDPA 5BO5A 1XZEA 4QQIA 1Z6QA 2EFYA 4I6EA 2I29A 2IV2X 1DCTA 4GA2A 2ODTX 2Y0DA 3JQ9A 3OT4A 4KE7A 2CHFA 3VVMA 1TQ6A 5K0EA 4FLBA 1OQAA 4I1PA 5JMND 2FPOA 1V1MB 2JIOA 3VR5H 3RRXA 3AUKA 5FH9A 5KOJA 1PUJA 3SICE 2WWFA 2XQ0A 2G09A 2F8SA 1TMGE 1KMNA 4M2LA 3PQCA 4GMDA 2CMDA 2MINB 5LIRA 5GV7A 1WHTA 5B12A 3G17A 4JJ4A 1P4GA 5GGYA 3SJ7A 5A3VA 5BP7A 3DBRA 4ZV7A 3WBBA 1BQEA 5FA5A 1WBJB 3FVVA 3QMVA 4UPVA 1D0VA 4FU0A 4RADA 3S2UA 2WA2A 2LXMA 2EF0A 2ZLBA 3A6EA 3JQQA 3QITA 4JVLA 2SCUA 3STVA 2AXQA 2F90A 4JZKA 3MZ0A 4PZ0A 2JJQA 3HDYA 4JL8A 5JR3A 4WLNA 5M5BA 3FPAA 1GPKA 2QG4A 1IHUA 3SFXA 2P4SA 3V8NA 1U2GA 3EOAI 3WSVA 6ABPA 4D99A 4E85A 1SR8A 3ZCUA 4DCSA 1QDUA 1WW2A 3ETCA 3U13A 1WDKA 4Q9JA 3L08A 5ES4B 1DT3A 1VBKA 2W90A 4W9NA 3IP5A 3GLFA 4W7HA 3Q73A 1VLJA 2XYRA 3M5WA 4BNUA 1EHCA 3PIRA 2V9CA 4PM4A 3PNPA 1VDMA 3R40A 1JVNA 4NV0A 2J9GA 1NKVA 2Q2OA 3LD9A 2PCJA 5JAMA 5LXTB 3TW8A 1VA5A 1VRCA 4TMTA 2H29A 4M6WA 3E3OA 4X84A 4ABNA 1DDIA 3QKRB 3GH1A 1VGQA 3L16A 4D9FA 2G7ZA 1PJAA 4YAIA 3SM9A 5FWNA 5I6DA 4CGWA 1ZL2A 1AWCB 4OXKA 3GFBA 1SM4A 3OQ6A 1WBDA 5IZCA 1YVDA 5JCPA 6CHYA 5JS6A 4PQFA 1KA9H 4IG4A 1TAHA 2R7NA 2RB5A 3B5IA 1IXRC 2V6BA 1I0LA 4RTMA 2VT7A 3FNEA 2ZT5A 3K1ZA 3ELBA 1NVWQ 2HD4A 1QHEA 4XI9A 2J9ZB 3DEIA 4O5AA 1EYZA 1H65A 4B6SA 2B21A 1P31A 4IGIA 4L7VA 4QOJA 1FFAA 1MA0A 1YL5A 4OI2A 1EDBA 4HAUA 2G9UA 1Z6PA 4JC0A 2N46A 3ZZNA 1KEWA 4ZIRB 4UBJA 4TVOA 5MF6A 4HH4A 4I1SA 1RHMA 2DLDA 5JU6A 1ISMA 3DDNA 4Q18A 5K0BA 3OM0A 1KLXA 1QE3A 1G8AA 2BKVA 2ORED 3ESXA 3K6KA 2UXDB 5HRYA 3C3RA 4BYGA 2P5SA 2W9XA 5DGDA 3GEEA 2JZNA 1FT1A 1YB2A 1Q77A 2OP1A 3L46A 4NXMB 1HKUA 1U7XA 3U6BA 5H0IA 4AG3A 4NRHB 2C9YA 4QD3A 4WXRA 1NR5A 1TPZA 4OQNA 1B8NA 4FHDA 2J9YB 3HZOA 1F2DA 3DWGA 3L0CA 4NABA 4XA8A 5CB4F 1SG6A 3TW0A 2Y3IA 3UB3A 1E6MA 1L4EA 1UT6A 4M8IA 1E5DA 1V5IA 1X7XA 2X7XA 1F8GA 1T25A 1XCMA 2QRNA 4B9EA 4ZARA 1DTWB 5I7FA 1GRCA 3Q4AB 1MF7A 1KEZA 2FZKA 2XUIA 2ZJ6A 4HEA6 3FKSA 5DRYA 3EPHA 3M6AA 5KQSA 2ZE6A 5EWJB 5BQ3A 5HJEA 2PN1A 4UULA 3U44B 4KXVA 4TLCA 4F12A 3THSA 4RHUA 4C2TA 4D3ZA 1PNRA 1LY1A 4GBMA 4CIVA 1E2GA 4O4IB 5FADA 4L2IB 1RJFA 2FOLA 1L5KA 4CMIA 3AVXA 3VO9A 2Q3LA 1US8A 5ITWA 1Q1EA 1TUBA 2FV8A 3IA7A 4LQ4A 5AJWA 1YS9A 3V4SA 4GC9A 3H65A 2YQ8A 2QPLA 4IKOA 4TKMA 5TSDA 3CJRA 5HM6A 1I6MA 3DOCA 3S8MA 1D0IA 2N47A 1RQNA 2EJTA 4DCCA 2CG2A 3ZRHA 2FW8A 3E61A 3P26A 1XROA 4I9UA 4JI0B 2WQ6A 1TYBE 2ZIGA 2GCOA 3NBFA 3ILXA 2E5FA 2VBFA 4C76A 4MULA 2HYIC 3VNSA 5T4YA 3M4XA 3V55A 1MH9A 2H1OA 3V4LA 2PH5A 3FWZA 2XRZA 4S1PA 3R1IA 3SYTA 1Q91A 4GSLA 4BAZA 4ENTA 4J8DA 5G2NA 1LI4A 3WXMA 3YASA 5B1EA 2VNIA 5TX7A 1F9AA 1R5OA 1L1QA 3E18A 1XO1A 3APCA 1EWYA 3MT0A 1EZ1A 5SV2A 2Q3DA 1COZA 1G9XA 3VPCA 1V37A 1OLUB 3U7JA 3W5JA 5T4BA 3IBFA 2FFQA 1PX0A 3R9MA 3PQ7A 3SZ3A 3SJBA 2DEUA 1FDOA 1ODTC 4B79A 4GGOA 3RRBA 2FPRA 2NTNA 3CXUA 1QRTA 5IS2A 3RRMA 3Q10A 1ENZA 2HLDD 5EP3A 2DFLA 1V71A 1VJTA 2ZATA 1LJUA 1SCBA 4FGJA 4D1YA 1F14A 3DLPX 4X1YA 1DC3A 1MXFA 2HF7A 4QOHA 1ML4A 1FMTA 4BV3A 1DXYA 2PL1A 4LZOA 5K9ZA 3II6X 3M4YA 5G40A 5HTOA 3H0CA 3LRTA 4HUTA 4A03A 4RD6A 3CHQA 2JAHA 3GPCA 1Q16A 1R27A 2GJ9A 4D8UA 2PX6A 3WX0A 2JFXA 1TO6A 3WGIA 1T5TA 4B3HA 3OZRA 3O1JC 3N6VA 1XXLA 1U6KA 2QQEA 5L7WA 1M66A 2AX4A 3TLEA 2XVZA 5KYYA 1O95D 3QOFA 4M60A 3JQGA 3KB2A 4ECEA 3AOEA 1XFAA 2R1TB 2CVQA 3NZEA 2BEVB 2IP1A 1R50A 2PVCA 2OPHA 1Y82A 3JWHA 4YRDA 1S9HA 2Z1DA 2ZQZA 1J90A