3PE4A

Structure of human o-glcnac transferase and its complex with a peptide substrate
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
714
structure length
695
Chain Sequence
THADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human O-GlcNAc transferase and its complex with a peptide substrate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 275
structure length 695
sequence length 714
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pe4A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pe4A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 3pe4A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3pe4A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pe4A03
4W9RA 3T5TA 3FROA 2YQ8A 4GCOA 3C4VA 3D0RA 3RU0A 4JL0A 3RJVA 4XI0A 4A1SA 1XL1A 2VG8A 3PE3A 3LYAA 2F9FA 3NAZA 1QKJA 3VUFA 5BT1A 1P2DA 2FI7A 3RSCA 2G9RA 3ULQA 5I45A 3BCSA 3MSCA 4H7XA 4M83A 2FF5A 2PYDA 5EKQD 1WUTA 1XV5A 1KT1A 3QKWA 1FTWA 5FJYA 2AW3A 5FZQA 3ZCVA 3OKCA 3L7AA 2G9UA 4MI9A 5CCMA 4GA0A 4I1AA 4B94A 1RRVA 2GT1A 3EBOA 5DU2A 6GPBA 3URZA 3MBOA 3GZ2A 1NLMA 2IYAA 2QLMA 3MKRA 1IIRA 2VSNA 1ELWA 1C8LA 2PYIA 3DZCA 3RT1A 3SF4A 3GPBA 3BDAA 3MRXA 4NRHB 4N39A 1P2GA 4KQMA 4AMBA 3CK8A 4GYYA 2F3QA 3QOUA 4I2ZA 3QWVA 1P4JA 3S29A 3E3LA 1JIVA 4BFCA 1FS4A 2X6QA 2X0FA 5EX3A 1E96B 2E2EA 3ZHEA 1FA9A 3G2IA 4Z5XA 3UYKA 4H7YA 1LWNA 1RZUA 2XGMA 4U07A 5JTTA 3ZGQA 4J8DA 3L79A 4MICA 2IEIA 3NB0A 3CV0A 1WW2A 3Q5MA 2Y4UA 4G25A 3MTAA 1Y8ZA 1QQEA 3T7DA 2KC7A 4GPKA 1EM6A 1ZBPA 5KJNA 4YI5A 1XC7A 2IYFA 1YA6A 5ENZA 1NZNA 4F97A 2QN2A 1C50A 5JJTA 2GM9A 2LSUA 2QN9A 4MI6A 1GFZA 1QZ2A 4RIFA 3MV3B 5TMBA 4RG6A 3KD7A 1K06A 3RO3A 3QWWA 1JEJA 5G05C 3DDSA 4Y6WA 3BEOA 3EBPA 4ABNA 5LCWJ 4MRAA 2UWJG 2QN1A 2VYIA 5FZRA 1KLXA 5BW8C 2XGSA 4GZ3A 5G05J 5HQ8A 2AMVA 3L7CA 2GPAA 2I6HA 4NQ0A 3S7FA 3COPA 2HYZA 5AYWD 3TAXA 1FU8A 2QN7A 3OKAA 4EL5A 1UQUA 3RSZA 4BQEA 3S7DA 1XKXA 2IV3A 4CTNA 4WUYA 3PDNA 4LEIA 2ONDA 3WADA 1NOKA 3D0QA 3LY7A 5LCWC 1PSWA 3Q3EA 4F3VA 3ZCUA 3KS2A 3ZPJA 4MHSA 3OXFA 1FTYA 2C9ZA 2O6LA 5D0OD 3TG4A 1NZFA 2XCBA 3ZN3A 3S28A 3HBJA 4EJ2A 3CUYA 3HYMB 1RZVA 2R4TA 1B4DA 3L01A 3FP3A 4N3AA 4BQFA 4GA1A 3CEMA 1P4HA 2PQNA 1L5VA 1NOJA 4KQ2A 3ZFWA 5DIZA 4F96A 1EXVA 4NC9A 2FEZA 1K08A 4YNDA 3JYSA 3D1JA 3Q49B 3Q4AB 4AN4A 4I9CA 2PRIA 5IKOA 1WM5A 3ASDA 3MV2B 3SYRA 8GPBA 3O48A 2ZB2A 3SZ7A 3MRTA 1UZUA 3OXLA 1WW3A 3ZCSA 2VGXB 1GGNA 4UI9K 1L5WA 3DD1A 4MHOA 4N3CA 5M72A 3HBMA 3CEJA 4GCNA 1LWOA 1HLFA 2C1XA 1O6CA 2BUGA 4BT9A 4X7RA 4EKEA 5DBKA 1PNVA 2VGXA 2XEVA 3BD7A 1GPAA 3GZ1A 4AY6A 3CUVA 3VDNB 1Z6QA 3C4QA 4F9FA 2QRHA 3VTYA 2BFWA 3CVPA 2X0EA 1C3JA 1WV1A 7GPBA 1P4GA 4G1TA 2IEGA 5HI7A 3BEEA 1KTIA 5D01A 3CEQA 3BCUA 2P58C 1AHPA 3MEKA 3UPVA 1JIXA 1HZ4A 1QM5A 2XMPA 5JJ6A 1HXIA 3UQ3A 4U0SA 4J0UA 1E1YA 4CTOA 1OUVA 2PRJA 3UUXA 1IHGA 4BQIA 1Y6GA 4UI9J 3QWPA 3E4BA 1IYGA 3ASFA 2WPVA 2QNBA 3C48A 1SXQA 4GYWA 3CV3A 2KCLA 3OT5A 3BD8A 3Q15A 1ZU2A 4RELA 4HORA 1GPYA 2GPNA 3MTBA 1Z6PA 3OXGA 3CKBA 4GZ6A 4G24A 2JLBA 2ACVA 4NEQA 2GJ4A 2KCKA 4WADA 5HXAA 2VGYA 3MS2A 1NA3A 3SYMA 4UQXA 3ZHEB 4CTMA 3RO2A 2WTXA 4O6FA 2QRMA 1NOIA 3NCHA 1Y6FA 2P6PA 4REMA 1L5SA 5JTUA 1FU7A 4RENA 3HBNA 3ZCTA 4GA2A 1FC0A 3MA5A 5DXFA 1UQTA 1NVKA 2AZDA 3MS7A 4CGVA 4UQYA 3NPAA 3LPZA 4WNDA 2ASVA 2XPIA 3PE4A 1PYGA 5FTPA 2QRGA 2BISA 4J8FA 1L6IA 1P2BA 3T3GA 3S7BA 1YA0A 2Q6VA 5D0QD 3U4TA 2GEJA 3UYLA 5LQDA 2V5FA 3G2LA 2SKEA 2C1ZA 2FFRA 3E3NA 4BT8A 4RIIA 2R66A 3ZCPA 2XCCA 4RG9A 1WAO1 3QKYA 5GPBA 4U04A 2UY1B 4UI9C 4XI9A 2ECPA 3QHPA 2H1FA 1SXPA 3TOVA 4ME2A 3RIBA 1M5RA 1E4OA 3CKCA 4LDPA 2XA1A 3S0JA 2OFFA 3AS4A 3BCRA 1XOIA 4KYOB 5EX0A 1BX3A 2QLLA 4HLNA 4N2QA 3H4IA 3CK9A 4AM9A 4JA9A 2JJMA 5KJLA 2ACWA 3MT8A 2VCHA 2C0LA 3NP9A 3E3OA 4FKZA 3Q3HA 1GG8A 1JG6A 3LCAA 1V4VA 3TSAA 1NZDA 3ZCQA 2JZCA 1C8KA 2KATA 3NP7A 2LSVA 4BTBA 4HOUA 1H5UA 3FFLA 3OY2A 4AIFA 2OOEA 3CVNA 4M7PA 4WNFA 4Y6CA 4AMGA 5CHEE 3ZCRA 2QRPA 5ARFA 3T3HA 2F3PA 2GW1A 1Z62A 1TJCA 3LKUA 1L5QA 3HBFA 4GPBA 3H4TA 2VCEA 4WACA 3IEGA 3G2JA 3RKVA 4RIGA 4HOSA 2IF4A 2UY1A 2PL2A 4G26A 3G2NA 1HH8A 3G2HA 4CDRA 1JG7A 1WUYA 1IXYA 4XIFA 2F3UA 3WC4A 1AXRA 2ATIA 2YJNA 4EQFA 3OTGA 5CCLA 3T3IA 1B89A 2AVPA 9GPBA 1KT0A 2H1HA 2PQRA 1GZ5A 2KS6A 3TGOA 2PZIA 3AS5A 1L7XA 2MHKA 4RBNA 2QFCA 5KJMA 3MT9A 3IAAA 3GW4A 4W6QA 4N9WA 4X7MA 5DLDA 1A17A 2G9QA 3G2KA 3L7DA 2XCIA 4WHMA 3CK7A 2HO1A 2XA9A 4N3BA 4UQZA 2R4UA 3S27A 2G9VA 4HWGA 2KCVA 3Q47B 5G04J 1VGVA 2QN8A 4G2TA 2LNIA 1FTQA 2SKDA 3CEHA 2DBAA 3ASGA 4EL0A 5TMEA 5TVGA 2HY7A 3QDNA 4I9EA 3NF1A 3MTDA 3R9AB 4MI3A 5TMDA 3O3CA 4KQ1A 1Z8DA 4FZRA 4RIEA 2FF4A 5A6CA 5D00A 2GEKA 1PC2A 5A7DB 4BTAA 4WNEA 3CUUA 2VSYA 5FT9A 1ABBA 1XNFA 2XA2A 3Q3IA 2NC9A 3LY8A 3S2UA 4JA7A 1YGPA 2XCUA 3CVQA 4GYOA 4X7PA 2SKCA 3WXXA 1Y8MA 5FZSA 5G04C 3FWVA 4YUAA 2YHCA 4KXKB 3DDWA 2WQHA 3S7JA 3VTXA 4HOQA 3CUTA 1NA0A 3CX4A 4APOA 1L5RA 1F6DA 3AMVA 4GZ5A 4RIHA 3IA7A 1A8IA 2R68A 3VUEA 3CUWA 4YVOA 2QN3A 2X0DA 3ASHA 4N5CA 4IN3B 3OTIA 2BGUA 1GPBA 1FU4A 5IKPA 4U0UA 1JIUA 4AY5A 2PQ6A 3GUHA 4KBQA 1F0KA 2IFUA 3TG5A 4HOTA 3MS4A 4LEUA 1J39A 3T3EA 5JJ7A 2J9QA 3U3WA 4BWRA 2VQ2A 4U0ZA 3T3DA 4G2VA 3LY9A 4N2SA 2X6RA 2Q7FA 4PQGA 1ELRA 3VDMA 3GYZA 2C4MA 2IUYA 2BGTA 1W3BA 2HR2A 4L22A 1FCHA 2C2LA 3KAEA 2Y4TA 3CVLA 3K9IA 4I2WA 3RHZA 5ARGA 4CGWA 2C0MA 3ESKA 3MQFA 3MT7A 2QLNA 5C1DA 2F3SA 4J8EA 3NC4A 2FO7A 3OTHA 4YVQC 4EKYA 2FBNA 4QLBA 4I17A 2QRQA 1P5QA 2L6JA 2GPBA 1PN3A 3L7BA 4G23A 3BD6A 4M60A 4NESA 4X6LA 3AS8A 5KJKA 3OKPA 4YI3A 2R5SA 5BNWA 1WV0A 3OY7A 1P29A 2XGOA 3N71A 4WNGA 2IW1A 2AV6A 3WAGA 2IV7A 1XL0A 2QZSA 2FETA 3EDTB 2R60A 3MRVA 4JHRA
chains in the Genus database with same CATH superfamily
2HMAA 4UREA 5L3VA 3CFYA 4IDAA 3OFND 3NEPX 4N82A 4ZALA 3KSLA 4GCOA 1O4WA 2GRJA 4YPOA 2VBCA 5BXUA 5CB4F 5C9ZA 2ODWA 4M2LA 1VG8A 3ZJ4A 4BP1A 3HTXA 3CY6A 3ME5A 5EWMA 3H5NA 3WISA 5JW6A 3ANLA 3MWJA 3HXTA 1G8YA 1NQ5A 1YI8A 5ALIA 2O3TA 3U0VA 1JWLA 1KYQA 4TMYA 4DQ0A 3PHHA 5B7GA 1OFUX 2OORC 2WJZB 4Q03A 3JZFA 3RSSA 1JCSA 4UASA 3M6IA 1T5IA 3OJFA 3QWIA 2P35A 1GN8A 2IYWA 1KE2A 5AUPB 4KXMA 2JAQA 1LLQA 4NHEA 1FQKA 4L8GA 4UEKA 3CX8A 4S1OA 4C1NA 3L82B 2P2SA 3X1KA 4LQDA 5HIAA 3S2IA 2BRUC 4P35A 5B64A 4WCFA 4XD2A 4IV8A 3OKCA 3ZCVA 5CLJA 3A2MA 4IIXA 1MABB 3GJRA 1CIJA 1IQ0A 1ULBA 2P9IG 3GA0A 3RSGA 1NXOA 4NDZA 3OMLA 1GGKA 1FP2A 4ND3A 4PW0A 3MGCA 5TRTA 1CNFA 1G7CA 3O8LA 3CRRA 3GA7A 3A4TA 3IPXA 3ZNOA 2JBWA 4PYLA 5EPUA 3TGWA 3BDVA 3VZBA 5CR9A 2BL4A 3UIPC 3IVGA 1G9TA 3GPBA 5HDQA 3U44A 4PGHA 1X7XB 3HVKA 5G53C 5JWRA 2BTOA 2UVDA 2IDZA 4PZZA 1ZD9A 3WGMA 4RLYA 2JF0A 1GKUB 3KPJA 3JQAD 1ONBA 2X8BA 2M98A 2WWRA 3GP3A 4I4TA 2VPYA 2ZIVB 4NBNA 1IXZA 3NX4A 1E9FA 4QASA 5JSUA 1EMDA 1NQAO 4OQFA 4Q24A 3CF4G 4KFUA 3WGKA 4DSTA 1RJWA 2QYUA 3T7AA 3HY3A 4A0FA 3JZDA 4RSGA 2CUNA 4BJ3A 1L4NA 5ISMA 4J1SA 5AXCA 5IC4A 2FPWA 3O4VA 4IVRA 4HO1X 5AJWA 2J8SD 1CC1S 4H7YA 1G0NA 3HI4A 4G5SA 3CSFA 3FLMA 1L1EA 5A9RA 4TTRA 2P5SA 5HS6A 2H1LA 5KB3A 1E99A 5KNCA 3OJLA 1XEWY 4I36A 5C1BA 2XXAA 4DJ5X 3ZYLA 2AB0A 4CUJA 3C70A 2PS1A 3VMFA 4O1IA 3VZSA 3PKZA 1TO2E 1ZIYA 3DF9A 1QWSA 4KL8S 3VJMA 4BTVA 3JUEA 3HKBB 3SJBA 2WPDA 1KDZA 4C4AA 1B8NA 5KSZA 2PBFA 5DNCA 1L7MA 4ZQCB 2FMKA 3V8MA 3OIDA 4XRGA 2Y1DA 1L1FA 1GO2A 1KVQA 3FHTA 4XAQA 3QKRB 1RRGA 1UEJA 1V43A 5CXSA 2XKJE 3UJ6A 4YRAA 2QTWB 5FUMA 2DT8A 2EU8A 4JOQA 3JASB 1K2WA 5A0TA 1CYEA 1AQYA 3V32A 5IY5E 2HBRA 4KXNA 2EZ4A 1WQ1R 1Q0ZA 1JSRA 2Y2UA 4ZQFA 1MHQA 4C0KA 2W9JA 2P9JA 1XCGB 1RC1A 3H87A 4MRAA 1M2EA 4BX8A 1V5WA 2UWJG 2QAJA 3CISA 3DLAA 4TLMB 2PU7A 1J09A 3LHKA 4WK6A 3RRUA 3DMHA 3L7CA 4C0SA 3EARA 3WKDA 1MX5A 3IA2A 4BZQA 4EHNA 5TF0A 4JU8A 1L9KA 3AR6A 4BSZB 2J87A 4CYMD 3PE6A 1XHLA 5LP0A 4HRNA 2OCDA 3ZHRA 1AKEA 1GCAA 2XUDA 3AEXA 3DOIA 4M3NA 2HF2A 2ETXA 4EI7A 2C4TA 4MB6A 2DC1A 4REQB 3T7CA 3V7UA 3JYNA 3MAGA 4GOMD 1IUPA 1MU0A 2ZUTA 1BOOA 2QY7A 4ZGWA 4Z4QA 1SIOA 4WNYA 3BTSA 3K2BA 4R1PA 4DLAA 2Y27A 2ZCJA 4YMHA 3WB0A 3OXFA 2O6LA 2AXVA 5D0OD 3OPQA 2ZXEA 4CI9A 1BE0A 1M34B 4C5AA 3EXAA 4B93B 2WYVA 1KNXA 1MJGM 2Z8XA 4Z54A 3K71B 4E03A 5DNWA 1E2BA 3AR2A 4FGKA 4RKYA 4ZO8A 3EPKA 2D0PB 3A31A 2ADFA 4N3AA 4CZ2A 4NCIA 1NQOA 3ESLA 3DVQX 4UVGA 4UCFA 2RCNA 1Y8RB 2WLTA 5DIZA 4HZIA 2ZRKA 3ZD7A 2FEZA 2FW0A 1ZONA 1RYEA 4S2EA 5EQTA 3JYSA 4PLYA 1QRTA 3NDJA 3PUIA 3RBAA 1I6KA 2J9XB 2P2GA 4AIIA 5T6MA 1XXHE 4KQFA 4FCVA 1Y4AE 3HB5X 4DB2A 4QGFA 1AUOA 1KQFA 4ITUA 1THGA 1CIVA 1A5ZA 1YQTA 1L5WA 1H2YA 1T4CB 2AI2A 2A0FA 2IE8A 1EGHA 3DD1A 1P1FA 3IUYA 1ZZEA 1F3LA 1QZXA 3AB3A 3RK1A 3LZDA 2OFOA 4JLBA 1E3QA 4GCNA 2ICAA 1W75A 2C1XA 4FULA 4X6YA 3ZWQA 3KNZA 3LJNA 4BT9A 3FIJA 5FUWA 1RPZA 2GN2A 3K9CA 4HH0A 1CZRA 1E8OB 1J0AA 2O0LA 3HZRA 4A1FA 4E6EA 2XT6A 3E3MA 3A05A 3HKCB 2I4MA 1WRBA 3QPUA 2ZJAA 2CSXA 4GKJB 4QFDA 2ERCA 3VTYA 1PFKA 2QZJA 4ZDKA 2KBXA 2X0KA 1X74A 1NUUA 3MYVA 4FYPA 3VPBA 1DQYA 1JEQB 1WDMA 5F5LA 3RVRA 4ARCA 3OT1A 2P9NG 4JEIA 3HDQA 1S2IA 3VJRA 3ZE7A 1EUCA 3EUEA 1AHPA 2L0XA 5KTYA 1RFLA 3MEKA 3GU3A 3PQ8A 1EUQA 2XMPA 1H69A 2QXTA 3ZDZB 2XB2A 2BTDA 4U8YD 1KPGA 3EIEA 3L0IB 5DT2A 4UEJA 2F48A 3MTEA 2WJYA 1S2NA 5EMMA 5JZBA 1IBKB 5BNZA 1JDBC 3CVVA 2EERA 3QXJA 4LXTA 3ELYA 1H1LA 5DF1A 3E4BA 3DMNA 2W6QA 3WLKX 5IX8A 4BGDA 4LGVA 5HRUA 2G70A 4GD3Q 2PL1A 3RU9A 2NN3C 3P0HA 1MVLA 1W0JA 3OICA 3V33A 1TCBA 4X5OA 2FPMA 4XUEA 2P1RA 2V59A 2IXDA 4F91B 2AFHB 1Y1PA 3LI2A 2IODA 2IYSA 1ODFA 4I3GA 4YR9A 4NY1A 4BB0A 4V0MA 1N4DA 2JLBA 3JRXA 3KUDA 4V0ME 2J59A 1X15A 4PAGA 5JZOA 5CB4B 3Q8MA 2JGLA 3MS2A 3AERA 1HE3A 2D00A 1N75A 2PX0A 3S44A 2XUAA 1NZJA 3O8NA 3AG6A 4M36A 4B5KA 4DG5A 2GM4A 1KYWA 4FKBA 3TM5A 3ESQA 1FMFA 3IH5A 2WV7A 2PH1A 3ANNA 1CEXA 2AMFA 5K6AA 2ZW9A 5DI9A 5JYEA 3IP9A 1WZEA 4MMXB 3L02A 5EYPF 3UV7A 1SU6A 3H3JA 1WULS 3BK7A 2XWPA 3HBNA 3M6VA 1Z16A 1UQTA 2R3SA 3AB7A 3F71A 1TEHA 3NXSA 2AZDA 2FQ1A 2VHJA 2ZSHA 4JWTA 4YH1A 1VKJA 2B5WA 2HJSA 4A0GA 3D0OA 1L5YA 2FOXA 1N5KA 2IS6A 2DZOA 4LXQA 2NO7A 1U6IA 4CHTA 4ZHQA 1CY4A 2QMZA 1ECGA 4C1BA 1FE8A 3QC1A 1OT5A 2H2DA 1YGYA 2IF2A 3G5AA 3UUWA 5AICA 4BT8A 3VKFA 1FYWA 2GOYA 3FLAA 3GGJA 4DR1B 4LHVA 4ER0A 1Q50A 1OOEA 4DM4A 1MO2A 1E6KA 5F7ZA 3WNZA 5IT0A 1C9KA 4TQUS 1OIVA 3M6MD 2HRRA 1IM2A 1KK0A 1ES9A 1Z3XA 1LX6A 2H1FA 2XD4A 4JJFA 1EI9A 1G2QA 3GQBA 1LTKA 4IILA 1MX4A 4J49A 3ZDQA 4DI3A 3RIBA 1Q19A 2QKYA 4HQOA 1T4DA 3M4YA 4MUIA 5LIRA 4LDRA 4MLPA 1QVVA 2AKYA 2Q3FA 2X4LA 4LV6A 5TR9A 3I37X 1EVQA 3RVJA 4U7DA 1F14A 2Y1LA 4QRIA 4DG9A 3EPLA 4B3HA 3LC0A 3DZGA 2I78A 3ZI4A 3BZBA 2E21A 5IM4A 1N7HA 3HI6A 1ZA1A 3CF4A 4IJKA 4LJYA 1TCAA 4UWGA 4LWQA 4P36A 2ACWA 4BO2A 2ZR9A 2OUIA 3GFTA 3SHOA 1ODCA 3NP9A 4F12A 5A5FA 3L1JA 1E0SA 2FK8A 2E4AA 4RF5A 4KQWA 3ZVKA 4I50F 3C74A 1ZRHA 3L7KA 4LY6A 2VJ8A 1JL3A 4CLDA 2Y3AA 1D6JA 2JZCA 2J48A 1JKJA 1RMTA 3HU1A 4BKUA 3OQPA 4B1FA 4MVJF 2LXNA 4RKWA 4F53A 3AVXA 5KTKA 4MLDA 4CM8B 2OK7A 3I0ZA 5JAMA 4M7PA 4OQPA 2JABA 2GJAA 4RTNA 1G66A 4AKSA 2AJTA 4OF4A 5IM5A 1MLDA 1WCIB 1YMVA 1JDSA 3EU5A 4RXUA 1UWLA 2RH9B 2O1XA 1F8FA 4ESOA 3LZ6A 1X7ZB 1ZGCA 4NZOA 5SYNA 2Z30A 1NBWB 1Z2CA 1U0EA 1S2MA 4CN8A 1SD5A 4RY9A 3GJTA 4RV9A 1LTQA 4DXHA 2XWJI 1K6XA 2QU7A 3ICWA 3OZBA 4ZI5A 4LISA 4AO8A 1T6BY 4HNGA 2PL2A 3D9PA 5DO9A 2HNBA 5GZ6A 4G26A 1JAYA 2QTTA 4ZVQA 4YV7A 3V7NA 1YQXA 1FS5A 1SK9A 3NBYC 5LYJA 3ONKA 3APDA 1ML3A 2XQFA 1LS6A 1XWWA 2ZYSA 5AI5A 4DQXA 3F98A 4GBED 4NBUA 1UBOS 3KWJA 4CMEA 4EFNA 3S7ZA 2DAPA 5JROA 1MPTA 2B4QA 3CF6R 1CRQA 1W581 4M46A 5A7GA 2H0RA 3CLHA 1I2ZA 1U0FA 3ET5A 4TL8A 1H2ZA 4JL8A 2ZPAA 4BZWA 1PY1A 3R7DA 5AK0A 2QD4A 3ZYMA 3ZLVA 1EM8B 2YYYA 1F2TB 3IXMA 3DZKA 4JYPA 1VJCA 3KFLA 3WL4A 4DA9A 1QIIA 3PFWO 1J00A 3T1HB 1NXTA 4FUQA 1HE4A 2ZS8A 3I76A 4DIMA 1IOWA 3PRJA 1G60A 4K9OA 3KJNA 3DOCA 3HO8A 3JPYA 4CR7A 5K9ZA 1Z9BA 3PYLA 5M7EA 2KCVA 3GAMA 4JMLA 3IJEB 1M9NA 4GRDA 3MPUA 4YEDA 5EHQA 2I9PA 3EIOA 1NNUA 3AF3A 4FEAA 5LXTB 2CJWB 4BY9E 2J07A 4LE2A 4LS3A 5TVGA 3RWMB 5JMPA 4DBLE 4N0PA 2OYCA 1T6NA 3AEZA 1D5CA 3C24A 1DKLA 4H7DA 3SGLA 2NP7A 3UM0A 2P7HA 3D2AA 2CHGA 3H9JA 3TNYA 4FADA 1ZOLA 4RIEA 2I76A 4JUBA 1NMYA 2WB4A 3ZJUA 2EX1A 2J5BA 4WNAA 1PV1A 4C4YA 3FUNA 1TPZA 1YDHA 3D81A 3CUUA 3C7AA 3VI3B 5J4VA 3N7AA 4Z3DA 2LVBA 1DRVA 2WUVA 1LPPA 4OH1A 5DBFA 3RYCB 2C7OA 1Y3HA 3UXHA 2HMUA 4RU1A 2BGJA 3D4OA 3UT8A 3DAGA 2HSZA 2RAPA 3ZXYA 3IQIX 1PBTA 3LRXA 1S89A 4Y9RA 4YJ3A 5B7QA 1TK2A 1OR8A 2XEEA 1GZ3A 1A98A 1ZYUA 2W83A 4OEHA 3SQLA 3THXA 3O4RA 1N0UA 5JNLA 3L04A 4MJLA 2J9RA 3RVPA 3ICQB 4MUKA 3OPMA 4UQPA 3RVBA 1M6VB 2FB9A 1IG3A 2P4UA 2PWBA 1MUUA 4D8XA 4GZ5A 2PM6A 1HKHA 4TVSA 1XT6A 3FUIA 3CNEA 3FFXA 4UDNA 4MZXA 4O1PA 4DY6A 1BH6A 3Q8LA 4XSGA 2ZFUA 5EZYB 3L7LA 3ABSB 4GPZA 3FTFA 3MNFA 1PEKE 2WHXA 4RVGA 1IZ0A 4GTPA 1Q7BA 4RTKA 3UM1A 2VJPA 1XAHA 2XMGA 4MTLA 5AJZA 3REGA 3TLBA 2B6NA 4HDKA 4OVUA 2BFFA 1LSSA 3V8VA 2IQCA 4ZCPA 5DX1A 5HZKA 4AY5A 4P5PA 3WNDA 4KBQA 4GR4A 2WUFA 2FV8A 4MW2A 3RVKA 5JEDA 5GVSA 1RHMA 3EF1A 3OIGA 4I9NA 2YYZA 3ZNPA 1SNYA 3AUKA 5DM60 2P65A 3G0CA 3QYJA 2IU0A 5JCXA 1QQ5A 4X1KA 3HKDA 4P34A 1WZNA 2RBEA 2AG0A 1Q21A 2QJOA 3IBFA 5JD3A 1YR1A 1LRKA 4GOXA 4WA7A 4EB0A 2IUYA 2C4MA 4DIUA 4JX8A 2OB1A 1QHIA 1NPTO 3WLLA 4RD4A 1GTL1 2IZ6A 2PNJA 4LJRA 3WYFA 4YAGA 4J1TC 3RRZA 5CMWA 3V42A 3FZEA 1H3EA 1ZKMA 3I4LA 2CFIA 5ALGA 3UMJA 3W2FA 3K9IA 4A8JB 1BCSA 2M1XA 4IMJB 4KJZA 4Q05A 5JVDF 1PL7A 2XCQA 3NOOA 3RH0A 4BBAA 3NC4A 3NALA 4KLAA 3RAUA 2GRPB 5ADUS 1P7ZA 2Q49A 3U7IA 1JR3D 4KAJA 1QZZA 3I8SA 5JH7B 1NW9B 4G23A 3DO8A 1Z74A 2GVNA 4C0MA 1NC3A 2ZQYA 4U0JA 1WV0A 3PL1A 4IYPA 1BI7B 4NYMR 4OBEA 3AM3A 2JAWA 4NYJQ 4UAVA 4ZU1X 2R6R1 1PV4A 4JJ7A 5K0BA 1ZG3A 1ZMXA 3AG2E 3T12A 3I8OA 3WJ7A 4EG8A 2UXDB 2I3BA 2PR2A 2XLBA 4ZV7A 3IEMA 1JKFA 4TTIA 3AI3A 1EK1A 4XEUA 1IYZA 1NNI1 3L7YA 4N7BA 3DB2A 1G8FA 4OHXA 3FOAA 3GEEA 3LOQA 3M1AA 5IKEA 4H1UA 4DQVA 3C45A 1U81A 3WBBA 3DAYA 3D7SA 3N2LA 3T7JA 5KIAA 1XD2B 3ND7A 3AINA 3KYIB 5M29A 4FZ3A 1YQGA 2GHTA 1A2BA 3STYA 3IV0A 1ND5A 2QORA 3HZHA 4UOQA 3UPDA 1BVHA 1GRRA 1E1DA 1F3OA 2BMWA 3EFOB 3FOCA 5EL0A 3LU1A 2FF5A 3R76A 5LOVA 4Z49A 4OA8A 5AK5A 2XT9A 3IDSA 3R9XB 3GQBB 1XV5A 3SG0A 2Z8YM 3I73A 2IBSA 1M2HA 4G9GA 1DZIA 1WBDA 3W7VA 4BERA 4TKLA 1USKA 4JCCA 3GXOA 5EHNA 3BRQA 4B17A 1TZJA 4WAUA 4PS7A 4KOEC 3RJ5A 5AVTA 1NMZA 2QWXA 3OF2A 3QE2A 4EQ6A 5IG2A 2ZYRA 3SE0A 3G5MA 1XE3A 2B4KA 3NIFB 4B9EA 5A7FA 4X93A 1RWPA 1K27A 2WU4A 3RUDA 3LAWA 5JFTA 3KP1A 2EJUA 2G9ZA 4HXYA 5K0NA 1DAHA 1NE7A 4EFMA 1X3LA 1K4KA 1ZN9A 4K8RB 4OSOA 5LZ2A 4FYHA 2RJOA 4WMLA 4ZCLA 1W0KD 2NV2B 5SZJA 4EM6A 5JZMA 2WM2A 1VPEA 4G37A 2Y0BG 5HF8A 3PZ4A 2GF2A 4DLWA 1JPNA 2FMUA 3EVAA 3FU3A 3EVGA 3G8DA 3P9NA 2X4DA 1OBVA 4FI3F 2XECA 4DT1A 3M3HA 1VL6A 3IO3A 3RK6A 4ZYYA 1P4RA 3ZV7A 1PDWA 3E3LA 2Z58A 1YIDA 1XRMA 1HKUA 3FSEA 3IHLA 5K3AA 4CE6A 3RAEC 2PJRA 2I9CA 2PH5A 4Q4DA 4C3VA 3NVAA 4OI4A 5BUSA 4WUVA 3FCOA 1FA9A 1GD1O 5ERYA 4EVSA 3G2IA 3OMWA 1W2WB 2VUSA 1IMOA 2VAVA 2W43A 1KJ9A 1YR8A 2O0HA 3C3CA 3HCDA 2GH1A 3ENNA 1RZUA 4G84A 1NN1A 4OL9A 5CW2A 1HQYE 4RZ2A 1TEVA 5JNSA 3JQRA 1E2JA 3T15A 1K6EA 2YJ3A 4U7TB 3ZN2A 4GMDA 4GSKA 1A7AA 3V7FA 5EJ4A 2D3TA 4B85A 2C97A 3UMCA 1ANKA 3ZHYA 5LUAA 3HDVA 4LUCA 3GJ8A 2OCYC 1G21A 2I4OA 1G21E 1VYHA 1QCZA 2GPTA 3BB4A 2WJPA 3QY9A 4NCJA 3NGXA 1ZUNA 1W2GA 1TK3A 3HRAA 3ONNA 3QE4A 5IABA 3HACA 1VHDA 5D5PA 5DNDA 2JFNA 4EGFA 1FSFA 4TLAA 3OJXA 2OB2A 1Y8QA 4J1QA 1UC9A 4H17A 4TRRA 3OQOA 2GCIA 3D9MA 2K5UA 3U4AA 5ESWA 1K8ZB 1CUUA 4K05A 5LUBA 1RR6A 1W0JD 3N8DA 3PYXA 1OZFA 4RFLA 2RGNC 4EMUA 2PXAA 4EQZA 5CEEA 4KV9A 5ADWA 5HG0A 2W9XA 2UUOA 1SUAA 3VZDA 5CDFA 1JZQA 1NXPA 5AJYA 5B1DA 1P77A 3DBOB 4CEIA 5FFMA 4GX1A 1PTKA 4Z99A 1LBSA 4RPIA 4YJ2F 5DJ5A 5BSTA 5IAOA 3NOCD 1SGWA 3HYCA 1UP4A 3ICOA 3SK1A 4LW8A 1UKCA 1DNPA 3LW8A 3VH4A 5JNTA 3VVCA 5EZYF 2QN7A 2O8BA 3EXFB 4U2FA 3DMFA 4HS2A 2F8TA 2JI4A 1PSDA 2ZJOA 5HDBB 4A0QA 3ER8A 2CEKA 2AOTA 4XGIA 2C5FA 4PZ9A 4ZDWA 1OH8A 4P81A 3ZDBA 3DEFA 2RGXA 4WKGA 1RXIA 3UJ9A 4DUGD 4FSHA 2CNLA 2Y1EA 1U2RA 5LVAA 4MARA 3MWFA 3QU5A 1KQOA 3TQRA 3DP9A 1Y4UA 3N9IA 4ZT5A 3SBSA 1J7KA 1OLXB 1YTUA 1AKUA 3NBMA 4MW5A 1L3CA 2YY6A 4MP3A 3BXEA 2PVSA 3IAM6 3FP3A 2H2IA 2IHVA 1OZAA 2F1IA 3THXB 1Z0KA 1E2FA 4ZOLA 5YASA 4E46A 1OH6A 1RCFA 4Q66C 1H4SA 4HV4A 1FNNA 3IVAA 2DIWA 4GC9A 1ZI8A 3G1TA 4JGBA 3TH5A 4N6NA 4RW0A 5I9BA 2RGAA 4BMPB 5EJ9A 1C1DA 1Q92A 1SZDA 4PLGA 4I5DA 2IC5A 3H97A 4LK2A 2VAWA 4RSRA 5EMNA 1GN9A 1OI7A 5BQOA 3EWIA 2J41A 5EHGA 3MLBA 3ANXA 3VHQA 4YCMA 1HLGA 4Y30A 1IFXA 2MYTA 4B0OA 3ZCSA 1E9SA 4JUAA 1XF1A 4L07A 1X1TA 4GMLA 4N3CA 3HV2A 3QB2A 5AM1A 5M72A 2FXVA 3HBMA 2NVBA 3CEJA 1QCDA 5EG5A 5JXIA 2ZRPA 4TZ0A 1OSNA 3QOWA 1BS9A 3F5QA 2R8ZA 4B40A 2O8DB 2FR8C 5KKAA 3UXYA 2B8EA 5CGZA 1A9OA 2V4UA 3LC7O 5D3KA 4Y6GB 4HNVA 4HFGA 3LBYA 2CL0X 4DLTA 1QS0B 1LBIA 1XHEA 5GM1A 2QZ4A 3GH1A 2BFWA 3DHEA 2WK1A 4X90A 4KSBA 3OZVA 2F43B 2VBIA 1OTYA 4JR0A 4Q19A 3FU5A 3KT3A 4UBKA 4AB1A 5EWLA 1GGJA 4KDCA 2YZ7A 4RKEA 5CA0A 5HKAA 3ONLA 1G16A 2FHSA 1DJOA 5TJ9A 4BV8A 1P7CA 2HMYB 3L9WA 5JS8A 1K92A 1YDGA 2GVDC 3DEAA 1PNRA 2GYWA 2ZE8A 3BUAA 4IQ0A 5FX2A 1AO3A 2BE9A 1IHGA 1EFKA 2LCFA 1QE3A 4LY0A 5GGXA 4LNGA 1KZPA 3QWPA 3BGIA 1JU9A 2XBUA 1UKYA 3HA2A 4TQGA 1Q1GA 5T8KA 2LAIA 4GYWA 1L7DA 1YS2X 3P94A 3OT5A 4CMJA 4US2R 3U3MA 2G5PA 3IEVA 1BS1A 1NNSA 2DWUA 3WB1A 3C6BA 4EY7A 4OLAA 2D4HA 3NIDB 4NBVA 3QLJA 3RANA 1P0MA 1XAIA 3WBJA 4JHLA 3RRXA 1LNSA 5ECWA 3V8PA 2JNWA 4JBWA 5D5QA 4JLKA 3TXMA 2I3AA 3A2LA 4R8RA 4ISCA 1VJDA 2WWHA 5EHXA 3ZHEB 3SI5A 5JJLA 5G40A 1DO8A 3K9WA 3P1UA 3AM5A 4BFSA 4C4ZA 3E3AA 1GPDG 5U4QA 2QX8A 5B1SA 3N0TA 4R84A 1XQ9A 1CUHA 3NHJA 3BTVA 1H23A 1N2EA 4PVCA 4UZEA 1FSGA 3H6KA 2MCFA 2E48A 5B1YA 2I7VA 2I66A 4JL6A 3QAQA 5J2UA 3DSTA 3RT7A 3SP1A 1H4QA 2PMBA 4L4ZA 5JS6A 4CGVA 3IKVA 1G59A 1JSLA 4GH5A 2FZCA 4GUDA 2DBQA 4ND2A 4W1SA 4N5QA 1S3GA 4M22A 3DWFA 2QRGA 2DQKA 3IUJA 2GBPA 3C3BA 1XSEA 2TMKA 1H0RA 3BOSA 3FPCA 3FUCA 3KKNA 3LS2A 3FBGA 2QHXA 3GH3A 3U4TA 4PG7A 4ZO6A 3UYLA 5LQAA 4Z86A 3FD8A 1QOPB 4P7KA 3K0HA 4JVOA 3LBNA 4PLWA 1HK7A 2YHUA 2XODA 2BZSA 3NRJA 3QENA 4TLBA 5DBGA 4QLAA 3OFNA 4XA8A 1EK0A 2OWDA 1UOPA 2PT5A 1XRSB 1UZMA 2WXGA 2PZFA 2EW1A 2VJBA 4N6OA 3KCNA 3JQGB 5BVGA 4U04A 4MQLA 2B25A 3EASA 3CJQA 1M2KA 2BR3A 2J9GA 2ZUSA 4F3KA 3SIWA 4MCJA 3HGTA 2ZSFA 5MN6A 3UHAA 4V3BA 1CU1A 1DAOA 1GAWA 2GRLA 1RHJA 1CZNA 3EZLA 5E6SA 3UBMA 1HQDA 3VR3D 3P20A 4E5PA 3PHBE 1OCCE 4XWTA 2ZLBA 4YB8A 3LQ4A 1U5BB 3L6RA 2RGWA 3RBVA 5LMCA 3F6SA 221PA 3GJSA 3W6PA 2I22A 3ZWXA 1TQ2A 721PA 3RV4A 3URKA 1A5TA 5EX0A 3EXEB 1QG0A 2I54A 4N49A 2PGAA 3B12A 3GW8A 1TJPB 2V7VA 1VFPA 3GHHA 4W4TA 1XTVA 1J5PA 1V5FA 4KE9A 4MDFA 3CHYA 4OJKA 5CPFA 5ES3A 2O7SA 3WK7A 3ZY3A 2JLQA 1GJRA 4FP9A 4P86A 1JWAB 3H5RA 5ALOA 5FPSA 4AM8A 1QH9A 3QEMB 2Z6AA 2O2GA 3NKFA 1IB6A 4IWXA 4GWGA 3SJUA 1KPHA 1OAOC 5C34B 3D8TA 4HPXB 5CFOA 3SXUB 1TB4A 2PLAA 3NHPA 3O93A 1TN6A 1O94C 4N18A 1CETA 3W5SA 1RPJA 3HA3A 4Y98A 3FUVA 2XWQA 3DCJA 3HDHA 4D8WA 3CVNA 3DS8A 4KN6A 1E20A 5E6UA 1IHXA 3ZHUA 4CMIA 3BYZA 4Q15A 1AQJA 3L6CA 1TTPB 3NYWA 4H1HA 3ZY5A 4CN9A 1RC8A 2B9EA 4NVRA 4G5OA 4HVBA 2IPMA 4KPUA 4NV1A 4O1HA 1H0AA 1TZBA 5EXTA 1EB9A 2PEZA 5E38A 5E6RB 3TW8A 2AFIE 3W5HA 3OHMA 4B4OA 1DL5A 2VXCA 5BWMA 3BAFA 4EG5A 2DUMA 2H65A 3DMDA 3KQUA 1L7OA 1M8KA 1O89A 2CXXA 4MUGA 4V1CB 4GI5A 4HF7A 3FU6A 2DLNA 2NUPB 3IILA 4QXPA 3TG8A 1RYDA 5AI0A 4BFXA 4BTEA 3ZDFA 5KQPA 4QGHA 1Y48E 1BQ4A 2B1QA 2KX7A 1AXRA 3D6FA 1QC5B 1TADA 4Y2SA 1R0BA 1JSXA 4AS1A 1D07A 4K6HA 1NVMB 3CLTC 3Q87B 3QVSA 5H3LA 3SHWA 1FRVA 2OKCA 1GZ5A 2KS6A 4MUBA 2IU4A 3TEFA 4CCYA 5JEEA 2PZIA 2VJCA 2WMNA 3TU3B 1L7XA 1NP3A 2BFEA 4TRJA 5CH5A 2PNNA 2XJ9A 5EP1A 5TY0A 4ENUA 2B4AA 4D79A 3KAPA 1ILWA 2W2NA 1GADO 1A9TA 1M1ZA 1MB9A 1EUDB 1DIHA 2UZ0A 4GXRA 4RPLA 3I9KA 2JEOA 1UEXC 3CK7A 2ZTVA 4GPD1 1O6GA 621PA 1FFXB 4KO2S 1ZM4A 3ZE8A 1VP3A 1RM5A 2HPHA 1OYOA 4LZAA 1R12A 5GY7A 2LNIA 2Q5HA 2RB4A 3RJZA 2H4ZA 4EL0A 3IIEA 1DRWA 1BU9A 4KAFA 3QDNA 3OLXA 3NF1A 2VK1A 4NJEB 3SFTA 4AXXA 4B6JA 4DL9A 5TEVA 3C3JA 3N53A 2J33A 3FCSB 4TOIA 3QVTA 5E3JA 1SCUA 1Z2DA 1XZCA 4HAOA 2EL9A 3IEPA 3OP4A 3TLGB 1S8FA 4KW7A 5KJEA 5B57C 4AOFA 5A7DB 2HUPA 2QUKA 5BMOA 4OHKA 3C87A 1N2SA 3KV1A 3LM8A 4CKWA 2CV1A 4DMLA 2PZEA 1EGAA 2XMQA 5IJAA 2ZUEA 4LFBB 1QFSA 1VCOA 1ADJA 4KR6A 5HS0A 2JHAA 3PNQA 1N2CE 4K6KA 3U2QA 1QU3A 4Q9HA 2YIDA 2FKAA 1S96A 4M54A 4G4JA 4ZCIA 4GYOA 3VXKA 1WZ2A 3WXXA 1CQWA 1CR6A 1VSUA 1TAQA 2Y0BA 4Y2RA 1V1RA 3PR1A 2CCGA 1F2UA 4RA6A 3K2EA 1JMYA 1H42A 4GZDA 2PZLA 5KQMA 2ZM6B 3M83A 3PEFA 3S7JA 1I13A 3MWEA 3ZIAA 4DHWA 1TW3A 4MJ3A 4YRSA 4JXTA 1EQUA 1ZGJA 3E7WA 4ML3A 1H5QA 1XQWA 3DDOA 1T6YA 3ZBTA 4B3RB 3ZYKA 2QA5A 3CUWA 3DBVO 1G21B 1YE8A 2X0DA 2Q1WA 3VRHA 5LMZA 4BFRA 5ECYA 1L9XA 5K3CA 3ASHA 3TNLA 1NW7A 3CUKA 5B3LA 3BIXA 1GNSA 1W76A 1QS0A 1J2UA 1JEOA 1GPBA 1V4NA 3QBTA 4UD6A 1SXJB 2PU5A 5BQFA 4ZZ2A 2D62A 2PAFA 1JA0A 1ORHA 3MSXA 2GXAA 2ZT6A 3DLBA 1UJKA 2I2BA 4BFYA 3P9ZA 4BO0A 4EJ6A 4ZHSA 2X13A 1AK9A 3Q9SA 1O5IA 5DM4A 4JC0A 2W48A 2QLBA 3MJSA 1QCYA 4JP1A 2ZUUA 4II2A 4PCVA 3R7BA 5BSEA 2W4QA 3LHFA 4CXMA 4IDDA 1UL1X 1TF2A 2QD2A 4RF2A 3GLHB 2BBSA 4MVYA 4EEXA 1RW2A 1KI6A 4EZJA 2OCCE 2G7ZA 2N75A 3JAWB 1E5QA 3QJGA 4LG1A 4DNPA 4K9DA 4CKYA 3T5AA 1M54A 3W79A 1LH0A 1V5EA 2GRMA 1PF7E 1RQ2A 4LSGA 4WLEA 2CXPA 3F3KA 3ISJA 1NGSA 1SMKA 3ZLJA 1OBHA 3SVTA 3KS9A 1VPWA 2Y4TA 2QUAA 4CYMA 4Q7QA 3K0AA 4N0MA 3RHZA 2Z83A 3DE1X 1KY4A 2C2HA 3MQFA 1X92A 3OZRA 2O9JA 3ZVMA 3OTHA 4I55F 4EKGA 1Q7TA 4K9MA 2JFBA 5UKDA 1ZA2A 4Q16A 1BFDA 1R7RA 2AN5A 2P68A 4FYVA 2Y9PB 5F2OA 2AMYA 5BNWA 3ZWDA 2XGOA 2BJWA 3OIWA 2VDPB 4L0CA 4AURA 5ALHA 3NETA 1ECJA 3NTRA 5KS2A 4DDMA 4NP6A 1YNOA 4PDXA 2PT6A 5AESA 2MT9A 4HMPA 1VRVA 1VHTA 1YE3A 3T3PB 3SLRA 3ZDAA 1KDOA 1F51E 2OBBA 3NAMA 3VR4A 4D10C 3MCWA 4JV5B 2O4CA 4BC0A 3G7SA 1WOMA 1EE2A 3SMVA 1VB5A 4PZAA 1L7AA 2V45A 3IHYA 2CVQA 1IK4A 3PDCA 3RC1A 4YJDA 4DX7D 2P9CA 4HYEA 2MSLA 1GUZA 1WCXA 2GCPA 1XU7A 3UKRG 4IDOA 4UNSA 3TTVA 3MKQB 4ZAYA 4PC3A 4EYEA 4CLEA 1PFGA 3R3XA 4ENSA 5KYWB 3PE3A 1VL0A 2GAAA 3F4KA 1YUMA 5LYJF 3GC6A 4WCFB 2ZUFA 1U8ZA 2FI7A 1E66A 2O8DA 5A0VA 2O5CA 2C7RA 4ERNA 4CF4A 4HTFA 3D5TA 3I12A 3ZD9A 3MSCA 3ED5A 1FUKA 4H31A 4L27A 1GVHA 4UZFA 4XJTA 5EKQD 4K9KA 2WJ6A 3X1JA 1SCNE 4LBZA 1L7PA 3QA9A 3VYRB 3GIWA 2AOXA 4GLBA 4TT3A 1PFYA 3E5MA 4HNRA 4N12A 5B4VA 4S2UA 3N39C 1DTWB 1QZUA 2OUKA 3SHTA 4DSOA 2ZU6A 1Z13A 4MI9A 4B94A 1D4FA 1RRVA 4DC1A 2A9KA 1U04A 1PGOA 2V8OA 3I2IA 4CDNA 1OA1A 3EQ6A 3NHKA 3UPUA 3N86A 3PXEA 3Q3JB 4ZDIA 4WK2B 4D4IA 1X81A 1UK9A 1JHRA 3M4NA 5A3RA 1T2UA 4DR7B 3WP0A 4BE9A 2BLLA 2GLXA 1EK6A 1MAVA 2H17A 3ZWNA 1NLZA 4N5NA 4I6JA 2GD6A 1GA1A 2FEPA 4N39A 1ADGA 1XYVA 2LD4A 3GELA 1M8JA 3W3AD 2ZI4A 5ICCA 1MB3A 2F3QA 2O3RA 2DJ5A 4L73A 3RVLA 4DSNA 4TSFD 4I2ZA 1XDZA 1KWKA 4UARA 1TU0A 4EPXA 2H1OA 4MCIA 1H2TC 2KXPC 3CN9A 3CZ4A 3W90A 3W8NA 3REOA 1Z56C 3DE2X 2OXFA 1Z4NA 4RMIA 5D3ZA 3WL3A 3VOBA 4AMUA 4IGIA 1OX4A 2EZ9A 1LPMA 2Q3LA 1EF1C 3L13A 3NYQA 4X8LA 2ZS9A 2ALJA 4ANWA 2ORED 1KZ6A 1VGQA 1QRRA 2YWDA 3ZHEA 1NMSA 1RYNA 4A6EA 3FGZA 3QZUA 1XTBA 3R3SA 2DQSA 1WCIA 4QQNA 2XZLA 4XB2A 1K9SA 1Z5SC 3G7NA 4WVLA 4XDGA 1JTFA 4URVR 3AF4A 1GZSA 2XPCA 1M2JA 3IAFA 3V1NA 3HZZA 3JYHA 4MWTA 4OHYA 4HQNA 2Z2JA 4N0QA 4WDQA 1KDVA 4C7VA 1NI5A 4LJKA 1XTTA 2OPHA 2A7XA 1Y8ZA 2C3UA 3T7DA 3FYDA 3RUEA 2FWJA 4ZYWA 5C2JB 3QXSA 1EB8A 3IT0A 4NAVA 4URYR 5BSUA 1KP3A 4X71A 2H4JA 4R8LA 3HSYA 1GXSA 4QTYA 5HX7A 1US8B 4MS4B 2JI9A 3OX1A 4M53A 1Z0DA 2JVJA 1UBKS 2NX2A 3H2IA 3TI9A 4DG8A 4PZPA 5DVZA 5ITZA 4O6VA 1V9SA 1WF6A 4WI1A 1G3RA 1U8AA 4Y6PA 1N1GA 1YRBA 4YO8A 1SU4A 4D3DA 1PK9A 1NFIE 4S1WA 4QSHA 1NQVA 1U2GC 4ZT3A 1JHMA 2BI7A 2IL1A 2ZANA 2QSYA 1N4RA 3DCIA 4PYKA 1A76A 4BCCA 3OWXA 4EATA 2WZQA 3SYNA 6AT1A 4KXUA 3I6ZA 2A9RA 1YDWA 2ZJ6A 2JEYA 4WK0B 3NAQA 4PR3A 2GJ8A 3R4VA 1IJKA 3GGGA 4KR2A 3FFAA 5HQ8A 1A5EA 1L8XA 1OKKD 2DPGA 2W2VA 3PHGA 5B3SE 2WSYB 3L40A 5E6SB 4TXPA 4NQ0A 3S7FA 3E61A 2C82A 1JLRA 1PQYA 4PNHA 4LZPA 3UOAB 3C7DB 3SQOA 3WYEA 1AS0A 1I1OA 4AT1A 4NL4H 1BDMA 3LKVA 4MW9A 1KR5A 4PONA 1LLFA 3JZIA 4M7CA 4CUZA 5JBIA 1W49A 4WUYA 1YBMA 3WADA 3M3PA 4CQMD 5BXYA 1R3DA 3OX2A 4PZYA 2DCPA 2WXMA 4Z0PA 2C4VA 4ZMSA 4FWIB 1KBQA 1MC8A 5EE3A 1VBFA 3TIFA 5E8RA 3DE0X 4F3VA 5T4BA 4IDGA 3KS2A 3C6KA 3QMPA 1TGVA 5GOTA 3TDKA 3ISTA 2C9ZA 2DMRA 1IJBA 2L82A 3CLRD 4AWAA 1H2UA 2Q41A 1BA2A 3AWDA 3I6QA 4Q1EA 1AKTA 3ZY2A 3B8EA 2REQA 1CR1A 4KVZA 3KAKA 3LLUA 3BIJA 3QVJA 3S28A 2BUAA 4DCCA 4E7OA 4DDTA 2CUKA 1ESNA 1TIKA 2C5AA 1TVMA 2CF6A 4BV3A 1V1RB 5BWBA 4J8SA 2ZBGA 3MJ4A 3BQMB 1QHHB 4IGAA 4B80A 2VZLA 4QTUB 1K08A 1QTIA 2SCUA 2WVGA 5K3SA 4EG1A 5CTAA 3M5CA 1QKKA 2ZZKA 3AETA 3EGXA 2Y69E 3H2GA 3QF7A 5F2EA 5I8WA 3MV2B 4Y2XA 1PEYA 5AKLA 3TWWA 5ALVA 3HR8A 5HM8A 4GDMA 3OETA 2B83A 1LJUA 3GJXC 4N3NA 1ODIA 1GGNA 3NGLA 1L4UA 1ZAKA 2IEZA 4QREA 3CZMA 2VGEA 1T1GA 1VPTA 3L22A 3GJYA 4AMYA 1PJQA 3DE6X 1L8LA 2CMHA 3NVMB 4FXOA 3TIGA 4F06A 3DMTA 4B3TB 4MV4A 1HUQA 3AJDA 3WK5A 4TYWA 2I1LA 2GILA 2NZVG 4FB4A 4JJZA 3O9VA 3HP7A 2D3WA 2V54A 4MGZR 2FJEB 2C4NA 3IP3A 5LQNA 4F5DA 4QNRA 4K81B 4DRXB 4WD3A 5FKJA 1ZIOA 4TMTA 4F6RD 3T61A 3UIOC 2ZTMA 3K09C 1Y7IA 4A36A 1XJWA 3I1IA 2WA1A 1PVOA 3I83A 4FJZA 1HBJA 2BH2A 1K6JA 3LWNA 1XLUA 1NLYA 4IHJA 1CUWA 2Q3EA 4WECA 1GR1A 3SBEA 3Q78A 3V1LA 2QX7A 2R6DA 3BB3A 1TAGA 4EYQA 1KTIA 1MGOA 3ZNNA 1H1LB 3F6CA 1U4OA 3SJZA 1KVSA 1BDIA 1ISMA 3ICEA 5K0EA 2FW7A 5LD2B 4AAYA 1QGED 1QM5A 2GZHA 2PMKA 4RTMA 4MW7A 1J0BA 4UHHA 4UTOA 4DWWA 4UE3S 2ZWVA 4LF7B 4FEGA 4G0ZA 1LZLA 4BKMA 4Q4AB 2PRJA 1PQUA 3V2HA 5KOIA 4R1QA 1HO8A 3GLFA 2QR2A 5AXBA 5JVDA 1Z0FA 5KNGA 5IVIA 4LRUA 3JSAA 4Y1RB 3IELA 2C9OA 2C7GA 2H0AA 2EAUA 4X61A 1UJMA 3OM8A 1Q0SA 1IK6A 1YR9A 3DKKA 2I2DA 1IONA 3FYSA 1TU3A 3R5HA 1TRKA 4L4UA 3E0QA 4ZAGA 4MMYB 4NIKA 1AA6A 5LNK1 3FH5A 4WESB 1WETA 3NDIA 2HMSA 5BW5A 1BPOA 3H2SA 4JB3A 3B13B 4UQXA 3LYUA 3KEZA 3NYRA 1EYZA 3TNFA 1NJ8A 1KEEB 3BF8A 2DUJA 2UVQA 4QQIA 3DTYA 4PRKA 4LDJA 3JQ0A 4IV5A 2VKQA 3VR3A 3WP1B 4J43A 4I99A 3Q40A 4HGNA 2P6PA 2Y0DA 2CDCA 3CPJB 3NEJA 1VE3A 4MA0A 1Z6AA 1QHYA 3EQ2A 1A1SA 3E53A 3VCXA 4XTCS 4V3CA 3DMTC 4JB8A 4ACBA 3B7TA 5F3WB 5L3SB 4HPWA 3MS7A 1TL7C 4OXRA 4XR4A 5TGTA 4AG6A 2DY0A 5ENRD 2ASVA 5HOEA 3VH2A 4I4CA 4BQSA 3Q85A 4WCFC 2BISA 5HYVA 3ZW3A 1AUXA 3H8JA 4Y0AA 1EXWA 1SOMA 5EUQB 1NQUA 1K63A 4DK5A 2BBTA 5AM0A 3SFXA 3RSFA 1FRZA 1S4QA 4IXWA 1X7DA 1UBTS 2DT5A 1UM8A 3AL2A 4C48B 3WK4A 3E3NA 1DDIA 5COBA 2NV6A 2FJAB 1CRWG 2WE8A 3HQ4O 3QVOA 2EZ8A 2LNDA 3A4MA 3HY4A 1QGZA 2BGIA 2CDBA 3GEGA 4ND8B 3NOVA 1T9KA 3CTMA 4RWEA 3Q8XB 5AVXA 2EFHB 5JAZA 3CE6A 2YS6A 4XB6B 1J4AA 3LTNC 1A27A 5K3DA 3BM5A 5C7IO 3WWOA 4K3VA 1VZ3A 2CHQA 1EP3B 2J0SA 3I04A 4G63A 4MKRA 1D9XA 2C2KA 1YZNA 1JR6A 3RSLA 4WXHA 3KQWA 4E88A 3MX3A 5DT9A 5KVSA 1QH8A 2Z2XA 4D46A 5U9CA 3O2JA 4OLBA 4FPXA 4OYLA 3LQRA 3NRBA 2ZRCA 3H4IA 4QDKA 4XR9A 5TF4A 1CUJA 4CL3A 4HGYA 3GYBA 2XZTA 4ZODA 2VXOA 1CQXA 1QPZA 4IWNA 5HUQA 2G8LA 4WGFA 4R51A 2IQ5A 3X1ZA 4C06A 1WL8A 2QR3A 3ITKA 5EJGA 4EFDA 1Y3DE 5DV9A 3L1HA 1L8OA 4KE7A 5LP1A 5EIEA 2IKSA 4IQ8A 1W36B 3PPXA 3V79K 1FY2A 4RQIA 4HWRA 4OAOA 4RD3A 2WWFA 5DX8A 4OHUA 3W5VA 4DOMA 1Z2PX 4CLRB 1N92A 2WXLA 1C7RA 5AVSA 4BO1A 3JRWA 1OVGA 4ARAA 3K0SA 2P9SG 2OOEA 1PJ4A 2WW8A 2QTHA 3N8GA 2DR0A 3Q3GE 4B74A 1GV0A 5J9FA 4OY3A 1RW4A 2VT3A 3AL3A 3CQCB 5KDLA 3S68A 4ZI7B 1FPMA 1DKOA 2P91A 1FIUA 4LZWA 4DPLA 2VLIA 4DPMA 5KYGA 3ANSA 3H16A 3QWFA 2K2QB 2GO1A 4G8KA 1NWCA 4J4TA 4RMHA 4FT2A 3Q7AA 3FZYA 4UCQA 5TPWA 4CR8A 3LKUA 4U63A 2KE5A 3BGVA 1BXGA 1ZWLA 3LFTA 3M81A 3WWPA 1NVEA 2CBGA 5FAKA 3HVIA 1HETA 1K7XB 4Y2JA 3G2JA 4V0NA 2OHFA 3RKVA 3H9EO 3HKEB 5GVRA 3H2KA 4RIGA 3AQIA 1U9ZA 4FDAA 1VJ5A 3MQ4A 3N0XA 2H7YA 4M7OA 4X65B 2HPAA 4GFDA 5LD2C 3LP5A 3K30A 4JODA 2F3RA 1GGVA 1JQ5A 5AKEA 3UATA 2CXHA 1VGRA 3A25A 2ATIA 2B34A 3CR3A 1EAMA 1KYIA 3OTGA 3VVLA 3SF0A 2I6SA 1B89A 4ERXA 2KLBA 4UUMA 4IXNA 2JH9A 3AUUA 2PGOA 3KQPA 4H1VA 4C7XA 1G4AE 4R1SA 4RCZA 2FMIA 2KWIA 3TCNA 5HKOA 1BEEA 2G1AA 1WKCA 3W1VA 5KU1A 1EESA 3IHWA 4YCSA 4BEPA 1YXMA 2HK7A 1QIKA 1H4VB 1HO3A 2JD1A 3GW4A 2ZU6B 2OM6A 1XZJA 5K5EA 4RQUA 1SCKA 4EI2A 5G1NA 5C7LO 4Y6RA 5D6OA 2FSFA 2VDKB 4QDXA 3CSDA 4MVJA 4RZQA 3LBFA 2Z43A 4Y0NA 4CEHB 2QQ5A 3EF0A 3CX7A 1GNQA 4GLJA 4WY2A 4BAGA 4DDHA 1DUVG 1H93A 1VGVA 4LBVA 4UM5A 3LS8A 1P91A 5AQ1A 4I4TF 5F1KA 5FV4A 1AE1A 2CZGA 2FN9A 3SKXA 3OZFA 4UJ3A 3ZCXA 3IBTA 1MIOA 4MV6A 5EIAA 5FTLA 1SHUX 1DBPA 1OCOE 1QMGA 1MQ8B 2RBGA 1CFJA 2HRQA 4HDRB 4QOEA 4TROA 5EIHA 2AN4A 3FTWA 5A6CA 2D0IA 2GEBA 4KR0A 1OLSA 2RIRA 3D54D 3AI1A 3ZHBA 3RS8A 5CFLA 4B5LA 2OP0A 5FT9A 2AC7A 3VQTA 1NPYA 5JMND 5REQA 4IIJF 3BHMA 1X19A 2JLWA 2XBLA 4EPVA 3LY8A 1D2MA 1HEIA 1AT1A 5TC4A 5C5DA 2IHBA 4NE7A 3FJOA 3W2TA 1QAOA 1VCNA 5T4YA 2GKOA 2SKCA 3EHNA 3FSGD 3PGJA 4IMPA 3QE0A 5G04C 4L7QA 3NFYA 3LZCA 3W2EA 3WL8A 3GFBA 3PX3A 1MB4A 2FFAA 2HQ1A 2ECOA 2OBMA 3N2GA 1GRCA 4NENA 3TD2A 3MIIA 2FN3A 3GWZA 2EINE 1J0EA 4B47A 5LJIA 1Z6YA 2Q29A 5D7NA 2Q07A 4QOJA 4BNXA 3QNMA 1E2MA 3QKSB 5KYTA 1WLYA 3BH7A 4BNZA 4CT4A 4UBNA 1SKMA 2XTNA 3I2FA 2ORVA 1Y7TA 3GRUA 1SAYA 1EIWA 2A86A 4IFBA 4DYVA 5KWVA 3GPCA 1QOZA 3MUNA 3I42A 1M0EA 4GM0A 1SVUA 4P4SB 3QTTA 3WTBA 1Q77A 4AUEA 1FNCA 1AURA 3A9VA 4R7GA 5M3BA 3USCS 1XAJA 4S05A 2NGRA 1RPNA 3JU3A 1VI5A 3TWRA 1VE6A 1IQRA 1DBVO 4B6PA 2O2IA 2EKDA 3JVVA 4IRUB 2VJNA 4RVNA 3U48A 3A1FA 5BV8A 4L8WB 4MRUA 2WFLB 4QT0A 1W30A 3BMCB 2HSEA 5DXAA 3U7QB 2C2BA 4R41A 1RAFA 5K0LA 1SUIA 4AIRA 4GGMX 1AZTA 4PS1A 4CMAA 4HYTA 2D7JA 3TM4A 2I4RA 3O9ZA 3K0CC 2PFSA 3UGKA 1SA0A 1W2HA 1XGKA 2G06A 2FE1A 4FKMA 1T9ZA 1NUPA 1J07A 1QB7A 1Z33A 2JRCA 3CCFA 3KLMX 5AXAA 4FE3A 5TJHA 3ZV4A 4EHHA 2JANA 1FX0B 3KT8A 1E3TA 1NRXA 1QQ7A 2X1HA 4JVMA 2Z1MA 1N5LA 2HHCA 2VDLB 2Z8YA 4AECA 1D0IA 3EIXA 2C2LA 4RTLA 2Q3JA 2ZZNA 2P5UA 3BQNB 3PEWA 3Q2OA 3WL7A 3JQ7A 3EPJA 1BC5A 4NCAA 3AVUA 4CHGA 2CVPA 4KO3S 2B0OE 1QANA 1BN7A 4FNMA 4BNMA 1DAEA 1OPRA 1PNOA 1U98A 2UZ1B 4FVTA 4QXQA 1BOFA 1K5PA 1P0CA 2QK4A 1P7WA 2WD7B 3PC8C 1U7PA 2F3SA 4JJAA 4EFKA 1YR2A 3G23A 3B9BA 3VU3A 4XIIA 1XYGA 3TR6A 2DFVA 2B4YA 2AFRA 2QRQA 5JBQA 1TA4A 4UXJA 4ZCMA 3EDQA 4AU1A 1O6ZA 2PN1A 3GMTA 1B3RA 3RQIA 5GM2A 1I4DD 2X2EA 3OKPA 4ZIRA 4P33A 3WKBA 3EXG1 2ETAA 5TARA 4B81A 4WNGA 3PCTA 4OGKA 3UJCA 4EG0A 3GLQA 1EFPB 2VQFB 4C0WA 4M21A 1I7QB 3BSYA 4MCHA 3EDTB 1BDJA 2QDKA 4JUDX 4PO8A 2ZIWB 1IXSB 3RCBA 1QKIA 5FHRA 1MH1A 5CT8A 1JJBA 4W9RA 2QRNA 3UM2A 3DBRA 3X2FA 1PUJA 5AW2A 1GCGA 4IDEA 3ZEAA 1KFEB 2FRXA 3W3ZB 3DP7A 3FPKA 3IBCA 2HWKA 4U2GA 5GAJA 3ZWCA 1C81A 5FNVA 1ZMBA 4MA4A 5GZ3A 2N46A 1WD7A 2K7FA 2QRZA 5JJCA 2XS8A 2K4MA 3C8MA 4RHCA 3BMNA 3LC2O 3NJRA 4QEZA 4WINA 2GCNA 2B8WA 3C8HA 3EZ7A 4QU0A 3VUFA 3WSVA 1T0JB 1FQJA 2H5EA 2DGDA 2PKEA 1CUEA 4UTXA 3RS7A 1JEQA 2CB0A 3R23A 4CNBA 3OT1B 3BMOA 3U4IA 2J9ZB 4NSNA 2YXLA 4OP2A 4YRRA 1UADA 2WVIA 4GAEA 4A2PA 5DYWA 1MTOA 4KEAA 1B8VA 3QTLA 1DKMA 3KT0A 1ODJA 2XH8A 3BTUA 3NJ8A 4IGKA 4OI2A 1C0PA 2GWHA 1QNLA 2DWPA 4XLLA 5K1ZA 1ZCAA 1JJAA 2Z56A 2HMWA 1AKMA 1UW4B 3VDQA 2PRYA 4A2WA 4WWOA 3ILVA 4JLAA 3DVAA 3DM9B 4YFYA 3E58A 3KL2A 1IRIA 3D3NA 1IY2A 3U9WA 1UZNA 4O4IF 2WQ6A 1L2TA 2F9MA 3OD5A 3SF4A 3GOHA 5A4AA 1NF9A 4IQGA 2MIIA 5I9TA 3O0TA 1NURA 4TQAA 4MQEA 2LRHA 5KYKA 5JDIC 3SLGA 5A4MS 3PNBA 3S8MA 2JGDB 1BD8A 4FHGA 4CKBA 1DIAA 4QOGA 3ZBPA 3CSTA 2VF7A 1D2RA 1AF4A 3IVCA 2WJVA 3V80A 1ZITA 3ECCA 5I7RA 5EX3A 3R0QA 3VLFA 5G02A 1WMEA 2GD0A 2CY0A 1QBKC 5CH3A 3IP6A 4JBHA 1WO8A 2D1QA 2R44A 2B8JA 4RLHA 4UBOA 4PYOA 2XGMA 3PBKA 4QG7A 3NKLA 1VI6A 4PSDA 5B3JA 3EEOA 5C8YB 3SZOA 2QC9A 2A0KA 2KZTA 1W34A 2YNMD 4EJSC 3VI4B 2FUCA 3G6KA 4WSOA 4GPKA 5KJNA 4RPHA 1H2FA 4CODB 4ER6A 3EGEA 1ENZA 1FFDA 1NVTA 1SPBS 4DLOA 1ORWA 4YIKA 3X1XA 1A7UA 5FQ6A 2HQRA 1EAYA 4ASUA 1VG0B 4XJXA 5DGDA 5L95A 1S1MA 4FFPA 4HR7A 4AO6A 2E6UX 3RRNA 1UPFA 1U3WA 3LRTA 1FDVA 3NKVA 4WZBE 2M6LA 2Q3HA 4PYMA 2A0XA 2PQ0A 1YD7A 4KQXA 2QGNA 2C04A 2WDZA 3ECSA 3JY6A 4R4JA 5DCWA 1JEJA 2PLNA 4YXFA 4WJLA 2Z6VA 2WFMA 1A88A 2O8BB 3CSSA 5LSAA 3PDWA 1MQAA 1V26A 2IYPA 3H4VA 3KQTA 4QIHA 5CGQB 5K7SA 2FRDC 1X7XA 1OI3A 1Y81A 3R5XA 1T5BA 4C4OA 4M3OA 1LI4A 3KB2A 3MUOA 4J0DA 4B4DA 4H4CA 4EELA 2A92A 3N6XA 1LS1A 3COPA 3KZCA 3OA2A 4BFUA 1UBMS 1XRRA 2R96A 2CFZA 2XVYA 2IEJA 3BERA 3MJHA 2IHTA 2YQ5A 1D5WA 1HPLA 4NU0A 4WKPA 1TA0A 3UAYA 2B1JA 3QYPA 5SZIA 2Q28A 2BKLA 3H11B 2DPHA 5DOVA 1T9GR 1G9XA 4O4LF 3LCUA 3UJHA 5EIWA 3T3MB 4WBNA 5KTRA 2Z3ZA 4AJ2A 1JPLA 1L7QA 1W4AA 3GNLA 1EIZA 2BMFA 3FETA 3H75A 1CRLA 2FMHA 3ORHA 1J42A 3EEYA 3LDUA 4C0XA 4RVUA 1VQ1A 3ZWKA 4DA0A 3ZN3A 2PMWB 2XD9A 4Q9LA 1IL0A 3TS1A 3RU2A 1LPOA 3E22B 1T2FA 1M2GA 1F5SA 1R18A 2X41A 2UU9B 5E2BA 2OCKA 1COWD 3KLNA 5B3JC 3OJWA 3CWCA 5JSHA 1XRQA 3DHVA 4L16A 2Q1XA 3OOYA 1UANA 5ESDA 1VIDA 3VGPA 4TM7A 4IQFA 1S3SA 3IEUA 4HS9A 3D6NB 1E90A 2V9PA 3KFXA 1V3UA 1XTZA 1JQ3A 2H4FA 3PNVA 3VOTA 3ZQ6A 4BNWA 5FWXB 2UUBB 8GPBA 3WIUA 2CK3D 4TTJA 1XXHA 3FUWA 3QFCA 4HPJB 3SSAA 5K6RA 1GP2A 2QG9A 3P97A 3TIXB 2R2AA 3W5UA 5LR6A 4N9QA 5CX1B 3DFKA 3DHWC 4Q01A 4TS1A 4R81A 4BUJA 3HWRA 2QM7A 3CZ9A 3EJWA 1XD8A 3N2YA 2FLVA 3CSUA 2ZSKA 3FH0A 2X5XA 5ALDA 4ETMA 2W5UA 1IRXA 4JUCA 3UOGA 4PNEA 1GQOA 2DR2A 3R40A 1TGYA 1ORVA 2WFZA 3I2KA 4HNAA 4O1OA 1M1UA 5DBKA 3TOXA 3QVLA 2KMLA 2V58A 3VDNB 3TPCA 3ABRB 1OCZE 1F4VA 4WLFA 4FD3A 2VNJA 2HV8A 1XZMA 1CF2O 2F62A 4I1RA 4O5OA 1K8RA 1P4GA 3ELBA 2GK4A 3KXIA 4G1TA 3KYCA 3VH3A 4YP5A 1V47A 4R2WA 3DBLB 1CPYA 1LPNA 3HG7A 3NEAA 4I1SA 4X1OA 4B3FX 2OVBA 2C2MA 5AW3A 3B7GA 3V48A 2BJVA 3DXXA 5DN6D 5KMGA 2IYEA 5IK2A 1VCIA 5FEUA 4GECA 5F1PA 4YRGA 3V4PB 1ISFA 2O2YA 3FTDA 3LDAA 4J03A 3CGWA 2W42A 3H8WA 3OP1A 4HFNA 1ZGHA 2F59A 1ZNQO 3CNHA 4MVCA 2ZI3A 4MS1B 4OQQA 3UJPA 1HX8A 1S9DA 4KTTE 4QYIB 1U3GA 3LXXA 4ILKA 2PUDA 4FS8A 2QJRA 2VSFA 3LD9A 3C48A 4RZ3A 4YCBA 1C0LA 1IHUA 1V9LA 2Y6UA 3K35A 3K5PA 1NI4B 2VJKA 3KR0A 2Z57A 4WKNA 3ROZA 3VZRA 4OAQA 5HJEA 3PGLA 2PZGA 3SFZA 3A28A 5A7HA 4RD6A 1QAQA 4K9PA 1SJ9A 1Z6PA 1D4AA 2IIBA 2QV0A 3QOYA 3T7RA 4ZIRB 5KOJA 3B7WA 2WTNA 5DYTA 1C9DB 5JV5A 4TYMA 3PUYA 1CDDA 2V96A 3H9CA 3M5DA 3D64A 3RVMA 1ZH0A 4AP6A 1R0XA 4LHZA 3F6QA 5JXHA 5JLAA 4D0NA 1VBNA 4J6IA 4MVJI 4XIGS 4XFKA 4ZV9A 4BNDB 1H8HD 2W8BB 2HJHA 4X94A 2KYRA 3IUBA 1OTHA 4KC0A 4O02B 4YASA 1U94A 4UKDA 5AH0A 3ZGNA 1XLTA 3LVRE 2I2WA 2YWXA 3DXYA 2X38A 4PYRA 3URMA 1N4AA 3LHIA 1A1VA 4OV6B 2H1IA 2BBOA 3P2KA 3MKQA 3MJVA 1HT1E 3O38A 4MW1A 4KZPA 5EMLA 5J5CA 3SM3A 3VNQA 1TQDA 2YVAA 5A6SB 2WXNA 4CIVA 2FPSA 5I6DA 3Q41A 2CC2A 1EYHA 3CLRC 2QT9A 4Q6WA 3A37A 1YQUA 4WXPA 3ROGA 2I5PO 2VF2A 3FNHA 4D9EA 1YA0A 1A5SB 2AUMA 3DOHA 2C78A 4FQ7A 5LQDA 2V6GA 4Y2GA 3KZVA 2DLDA 4PPNA 4DQUA 1J5EB 2NZ8A 1U28C 5KJCA 3KKEA 4YHHB 2OXRA 1U2SA 2BM9A 2CZCA 5FYDA 4QPJC 4ZC8A 3UENA 2QW0X 4H59A 3ESYA 2BMVA 2FRVA 1DTWA 3LXMA 1M72A 1MP0A 4D8TA 4WASA 3I3NA 2JCBA 1V5IA 2CFUA 1G8GA 1HV8A 1TQ8A 1YIOA 2XI4A 3ZZTA 2IEBA 4F3YA 3GPLA 2SNIE 1BCRA 2P27A 3RC2A 3Q1LA 5BYBA 5HSGA 4EHAA 8OHMA 2AFHA 2XUOA 3QU7A 5D7BA 5JQWA 3OQMA 3FCXA 3PQ2A 5AIBA 1SOWA 2P1DA 1BGXT 3UMVA 2HDHA 3R0JA 5I9NA 5K8IA 5B30A 2AX4A 3SXUA 1KRHA 1G3UA 3EIFA 5FUXA 1KKLA 1XKQA 3BF7A 3BZWA 3IOBA 3L17A 4YP1A 4J0JA 1RYBA 5IXJA 4FR0A 1E1MA 5KJLA 1L7VC 2ODBA 3LHDA 5CRUA 3LO5A 1JLSA 3UMGA 3E3OA 3TTYA 5FUYA 3VV2A 2X42A 4DXDA 3EXHA 5JMWA 4PHCA 1JG6A 5BN4B 4U3JB 3SC2A 2AXEA 3WBFA 1KI9A 2Q2VA 3PEEA 4V39A 4K8OA 4R1NA 3L4SO 4CIBA 1JQAA 1JYEA 4BDSA 4LXYA 3FFLA 4PG8A 5KDDA 1N5MA 1MZPA 5B6IA 5JQGA 1D6NA 5DTJA 3QPDA 1OXTA 4G0OA 4ZAWA 5CB6A 3T7TA 1Y5NA 1PZXA 1CJVC 1WZIA 1VYTA 3GLIE 3IXQA 3GBVA 5ED0A 2D6FA 3B52X 2GZ3A 3QJYA 2X1VA 3D6HA 1XVTA 1BTOA 2CHEA 3FPEA 4FA6A 4IPTA 3SEAA 5CFMA 4UW9A 1P1JA 1GTMA 3OLWA 3U4DA 2DTDA 4GI2A 2WC1A 2OGZA 3CH4B 3M2TA 1HQKA 4LCBA 4LYFA 4P2GA 1JUQA 5C31A 3IPRA 1NBOA 5E2AA 4CV3A 3NC1C 4NYJR 3G2HA 3P7MA 4RHFA 4EHBA 3PD1A 2P9QA 3A6DA 3G1WA 1T9BA 5F2KA 4AZ0B 1NC1A 4URKA 3EUFA 5BO5A 3QFTA 3TWQA 2PL5A 3PEVA 3RIXA 2HLDA 3LTEA 4GICA 2XZOA 2WF9A 2P9KG 3CPSA 1OGJA 1RDFA 1XZKA 4E21A 2WIKA 4OK3A 4GKBA 3I39X 2RDMA 2QMHA 4J7WA 2HRDA 1PAQA 1E2EA 5LL6P 3F67A 2BUBA 1CQZA 4H3HB 3QYAA 4ZQEA 3QFHA 1P4SA 4LNAA 2WP0A 2IXFA 3FUDA 1ZGBA 1DQNA 2C3OA 2C61A 1J0CA 4NAUA 5H7XA 4ALIA 1SPXA 1SCUB 4DLVA 5H3CA 4AO7A 5B1AE 1NT2A 2GRAA 2Z1NA 5EOVA 5IAKA 3AF6A 3B8HA 1DX6A 3ZV5A 2I2CA 3L8GA 4DVGA 3NXKA 5CM8B 1Z4KA 3VAYA 3N2ZB 8AT1A 3WG9A 4QDJA 2R6AA 3A58B 2RAFA 4XIYA 4BOYA 2AC4A 1O3YA 4DPRA 1EHIA 4FR5A 3G2MA 2FQWA 5AI6A 1N2IA 5FA8A 2P3SA 3KUUA 2GZ2A 4ZYVA 2OAQ1 2RCYA 5D00A 3R9KA 4XZ4A 1URPA 3PQ6A 5JG7A 4D26A 3DLCA 3C39A 3V55A 1TMYA 3H7AA 3WK8A 1SH7A 2FW9A 2QVCA 4I9GA 1P0QA 1W7AA 1M2NA 4KQEA 4MLZA 3CPEA 3HN7A 4IXMA 4JS0A 3D6TB 1WKBA 4RFSB 3SZUA 3X43A 4ZTUB 3MF4A 4D44A 1LY1A 1EQ2A 1U7ZA 4X3OA 2NU7A 2QAIA 4AC9A 1XZ8A 1BXKA 4OYYA 2IPLA 1MOSA 1N3BA 4NYIR 4OMFG 2WQHA 1CUCA 5TXGA 3H18A 1P72A 4BVAA 3KETA 1NA0A 1B6SA 3KX2A 3VO2A 2W2LA 1C7EA 2OBXA 2OEWA 1QIMA 4PLFA 1ZUD1 1SZCA 4FMCF 5K4AA 4XWKA 2ID9A 1M5UA 2YCBA 3HUEA 4HNAB 4BMOB 5E3HA 1E8NA 3S1SA 3BK1A 4AKGA 4CZ2D 2DFNA 3CHRA 2ZQ5A 2V0GA 2R59A 4FFSA 1BD4A 1G8HA 4XOUA 3ZR4B 2GBCA 4JQSA 1OH7A 1BXRA 1HEYA 3FMIA 4XVHA 3VU9B 1WDWB 2IONA 3R5KA 5IP5A 4EX6A 3BORA 3SGHA 2OO7A 1GVNB 3TSYA 1J2RA 2I4LA 2FUG6 3QVMA 4PAQA 1K89A 2Q8PA 3GUHA 3PS9A 1AXGA 2W93A 3RS2A 3TG5A 1OU4A 5TIIA 3PX7A 1MMFB 1ZU4A 3OLQA 4RH0A 4DCGA 2C7QA 3GUUA 4YJGA 4LVOA 3LX8A 3GLGA 2ROQA 4XZ3A 1JI3A 3BT7A 5LQRA 5DGHA 1C0EA 4FLFA 4U2EA 1ESEA 3KL4A 4PY2A 4R71A 1YHZA 4M49A 4RSYA 3FRJA 2YV4A 4H2DA 2HQBA 4Q94A 1L4GA 2XKAA 4QNNA 3RYCA 3G2WA 3HXFA 1DIBA 3W8DA 1PL8A 2VUHB 3QELA 2ZXFA 4BP3A 1XRLA 3E8SA 1UIMA 4YJ3B 4RVBA 3TE6A 1DPGA 1EX1A 2IK8A 4QUGA 4UFPA 2QTLA 3OQ1A 3FDFA 3AF2A 1X2BA 4M0UA 3QU4A 3F73A 2FO7A 1ARZA 2QYTA 2LUHA 1A5AB 3HYLA 1BE6A 4NQZA 4WJZA 2NUAB 2VATA 3SAJA 2WKPA 3U3JA 2WWWA 1O97C 4M9UA 4JI0B 1D03A 2FSVA 3L7BA 4KQJA 4LYAA 3L05A 2J3MA 3FDJA 4P3PA 3B5EA 5CMLA 3BMQA 1JVNA 1TUBB 3F7TA 3OY7A 4YQFA 2IW1A 4Z1MD 4NJOA 3W1WA 5BV1A 3HZOA 1UBSB 3LA8A 2PGIA 3ABOB 2IPNA 4EGSA 3HXQA 1AU9A 2ZM5A 4LF4B 3WGJA 2ILRA 1A2KC 1ZOIA 1U31A 4EGJA 3M9XA 2ETCA 3P0FA 2BTEA 3ED1A 4JSTA 4GZMA 3FTNA 3UANA 4TV9A 5IU6A 5FLKA 3GCWA 4AUKA 1XU4A 3D1VA 3DL2A 3NM4A 1GNPA 1Z4IA 4L6CA 2HTEA 3D9QX 3F6YA 3PB3A 3UB2A 1TMGE 3EXIB 4OK5A 1KAOA 3PZBA 4GVXA 3D4PA 2J4BA 2NU8A 2V7WA 1PR0A 3RIGA 2G5CA 5A9SA 4W9NA 3HKCA 1CYDA 4AUNA 1USGA 4ZZ0A 2I1QA 1F20A 3PZ2A 4RTJA 5C2YA 3C3WA 4DREA 4JOBA 3TMYA 2W6CX 1M6YA 5I7HA 3FPAA 5LDDC 3W6OA 3TTWA 1C2YA 2JJ8A 3FWNA 4UEWA 5LDHA 1K1AA 1XZNA 3REFA 5H68A 3I34X 4DVJA 3ZLUA 1BCRB 4JUIA 4CIDA 4ZTZB 5JYDA 4BNHA 1GKKA 1FTWA 1LW6E 4M6WB 2GZMA 3DNMA 4LY9A 5B2EA 1N77A 2OLJA 1MFPA 4BLQA 1VL2A 2VWGA 1I3CA 2JFQA 4GA0A 4I1AA 1JN0A 1E9DA 3DJYA 3JWGA 3L5OA 1GUBA 3HFSA 2YRWA 1XIVA 3IMFA 1Z6TA 4I7EA 3RTBA 4YUXA 5INTA 4DZTA 4RSMA 2NQTA 1NLMA 3LJKA 5H16A 4YRMA 5C8VA 4F11A 1PKEA 2H85A 1HORA 4DJEC 1RKQA 1D2HA 3EY9A 2HWXA 3O1JC 1DC4A 2XE7A 4MRVA 1UM9A 1C8LA 2ATXA 5I7VA 2BM8A 5DE3A 3UHFA 3L0PA 1C0KA 4E15A 2C9MA 3UHOA 4ZFNA 1IHYA 1WABA 3B6ZA 3MVEA 1K1BA 1LK7A 1U6KA 4GZLA 4X63A 3TWSA 3HYNA 5DWVA 2Q4DA 5CEFA 4C4XA 3EMVA 4D5EA 1CHDA 1YL5A 2AXNA 2DQZA 2XYVA 2Y4NA 4L8VA 1P4JA 1RP1A 2P3QA 2Z9DA 1U1DA 3DFZA 4I5EA 3DR3A 3UWSA 5BRJA 2XCTB 4M7WA 2ZJ4A 3DGFC 2JIQA 3HUDA 1J2JA 2XCRB 4W99A 2CLIB 1F8YA 4G9BA 4KPEC 4N8SA 2B8NA 3GUZA 5HTOA 2WKRA 4BX0A 2FAXA 4HLDA 4ZI7A 3OM9A 4OFWA 2MSDB 3IULA 4L9WA 3C5VA 3GGPA 4NF2A 4Z4HA 4K1LA 4WERA 5CLGA 3DDNA 2J0UA 4HDMA 3R3HA 2FWRA 4MICA 1C2TA 3AOGA 5C8YF 2IEIA 4MGHA 1L1RA 4WKBA 4B83A 2Y4UA 1JI0A 1WEKA 2H3EA 1BHQ1 2PZJA 2WFAA 3DDZX 4QPZA 1BS2A 2AE1A 1YDFA 2BI4A 4BGUA 1YB4A 4BNIA 3R3JA 3T5PA 3R3ZA 2J3HA 1JR3A 4CIAA 2R1TA 2C5SA 5KYNA 4J16A 2XMDA 4XCVA 3ORRA 4HLUA 5HF9A 4C2AA 2GCOA 3CRZA 4NI5A 1Z3YA 2G0AA 3ZU7B 2QVYX 4WA8A 1JKXA 4Y2HA 4X1YA 2O2DA 3L4KA 2PE5A 1EFAA 3K0FB 4DMCA 2IVFA 1YVPA 4QUHA 3INGA 1EA5A 3BDIA 3GAFA 3T9KA 3A1SA 3O2QB 4EB6A 3UT5A 1ZB1A 1ESZA 2QMQA 1I10A 3ZEIA 3Q6NA 1COWA 5FOTA 4D9BA 1F7UA 2C8KA 2NO6A 1U5BA 4D0SA 4JIGA 3AUTA 3C85A 3IE1A 1ZUWA 3I72A 4FMCB 1HH4A 3PWSA 3ESXA 4LJSA 2ZOSA 1M34A 4MYSA 4QHYA 3SYLA 3OFKA 3TUJC 4A9AA 4QVKA 4ALMA 5IASA 4KUHA 3NBNB 3MILA 4LRQA 2IZOA 4OB8A 3QHQA 4J94A 3BGDA 1TD1A 1K88A 3QLTA 4O5AA 3GBPA 2IS1A 2D1FA 5D66A 5EY5B 1XKXA 4OQMA 2HYDA 3QEKA 1TLTA 1VIAA 2HA7A 4GE0A 4LYEA 2Q1SA 4CTNA 5ALXA 4ZZIA 2A88A 3RK4A 1OBCA 2QMYA 2HSDA 5LYYA 4DRZA 1AMUA 3LY7A 2REBA 4RKFA 3KXLA 4BLPA 2K4NA 3PFKA 4JI1B 1RRCA 1ZMTA 4O0LA 4F1WA 4YPVA 1PSWA 2V7GA 1NW3A 5BSWA 1N8KA 4NTZA 1BJRE 4AICA 5BWNA 4OHRA 4JFAA 3ERCA 3TG4A 1EP2B 4IDFA 4BQQA 4CMIB 3WMXA 2AOVA 3NIGB 1Y4DE 4CLXA 1JSZA 1X80B 3CINA 3V00A 4F4DA 4KREA 5I51A 1BE8A 2R4TA 4A26A 1E98A 1UR5A 1RHQA 1J9EA 5D8DA 5JIBA 2NVUB 3ZU6A 1FPQA 2QTVA 2CYAA 3SIXA 3GMDA 2YCLA 1BJTA 2BHRA 5JNUA 2BEUA 1R4NB 1NKVA 1HZJA 1VG9B 4CDMA 2OV4A 4RVOA 1N3YA 3NHWA 4WLUA 4ZV4A 3EIUA 2R47A 2R6GA 4JYZA 3OQ6A 1QO9A 3QEOA 2VQ6A 1OA0A 3SBXA 5B7NA 4BP8A 1KGSA 4HGRA 1ESDA 3GEPA 3BIWA 2X6JA 1ISRA 4UI9K 4UMDA 3EGIA 4LWZA 3KBBA 4M9SA 4FX2A 2XPZA 5T3UA 4DIKA 1YB6A 1DCTA 2YN0A 3M7IA 4XQ0A 1CP2A 3MMPA 4WOPA 2YFKA 2GHIA 1HZZC 5BNIA 1VE1A 4NBKA 5HCUA 2PPVA 1FQOA 5ELXA 4GYJA 2Y1LE 3Q98A 4ND7A 7REQB 5LKRA 4MO2A 3ESBA 4YA6A 3WRVA 2FMTA 3AFMA 3FUTA 4HTAA 3EXFA 1GPAA 4G8BA