3PE4A

Structure of human o-glcnac transferase and its complex with a peptide substrate
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
714
structure length
695
Chain Sequence
THADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title Structure of human O-GlcNAc transferase and its complex with a peptide substrate.
pubmed doi rcsb
source organism Homo sapiens
total genus 275
structure length 695
sequence length 714
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pe4A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pe4A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 3pe4A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3pe4A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pe4A03
3CVPA 4HWGA 3TG4A 4UQXA 5EX3A 3S7FA 1NVKA 1Z62A 4KYOB 3GPBA 4MI9A 1OUVA 4HLNA 1L7XA 1XC7A 5M72A 1NA3A 1E96B 3T3IA 3L7AA 4G24A 1FU8A 4RIGA 3LY9A 3ULQA 2NC9A 2FEZA 2PRIA 5FZQA 1NLMA 4F9FA 4QLBA 3ASGA 4YUAA 1EXVA 1EM6A 3H4IA 1J39A 1GPYA 1SXQA 5CCMA 5DXFA 3UYKA 1JIXA 2XGSA 2JJMA 3RT1A 4HOQA 1XL0A 2C2LA 3TSAA 3C4QA 4GA1A 3ESKA 3QWPA 4M7PA 2SKCA 7GPBA 2FETA 3RIBA 5FZSA 2C0LA 3LCAA 2V5FA 2QRQA 3HBNA 4HORA 4N9WA 5JJ7A 2KS6A 4FZRA 2QRGA 1P2GA 5LCWJ 4WNDA 2QRHA 2G9RA 2UY1A 3MKRA 1P29A 3NP7A 2F9FA 1FCHA 2R66A 2QN8A 5I45A 1JG6A 5DU2A 3ZCRA 3IEGA 4I2ZA 1P2DA 2XCUA 4MRAA 3KS2A 5LQDA 1K06A 2Q6VA 5ENZA 2XGOA 5TMBA 1XV5A 1L5WA 3Q49B 2JLBA 3MT8A 4JHRA 3S7BA 3CV3A 4YI3A 3MTAA 4BQEA 2ATIA 2VGXB 1RZVA 4UQZA 4G23A 3AS8A 1WM5A 4GA2A 4M60A 5FZRA 4J8FA 5A7DB 1AXRA 4PQGA 2XMPA 4I1AA 3VDMA 3Q3IA 2Y4TA 5BT1A 3MT9A 2XCIA 2Q7FA 3FFLA 4IN3B 1PYGA 5KJKA 2FF4A 2GPAA 2PYDA 2PRJA 2H1HA 3GYZA 4YNDA 2AZDA 2AVPA 3PDNA 2H1FA 4JL0A 2PQ6A 3FROA 2XA9A 3DDWA 1ELWA 3LY7A 1NA0A 4GA0A 4GPBA 5JJTA 3ZCQA 4XI0A 4EL0A 4EQFA 4WNGA 3ZCSA 2G9UA 3CVQA 3TGOA 3O48A 3LKUA 4GZ5A 4NEQA 3VTXA 3CEJA 5BNWA 1FS4A 3FWVA 2GEJA 2WPVA 4RENA 4Y6CA 1L6IA 2IEIA 3OTGA 4YVQC 3DDSA 5A6CA 4MI3A 2FO7A 3T3GA 1UZUA 4KQ2A 3MS7A 1PN3A 4YI5A 5JJ6A 4NESA 1TJCA 3CUTA 3NAZA 3NC4A 2P58C 2QFCA 2VGXA 3CKCA 1XOIA 3S7JA 3OY7A 3N71A 2UWJG 1GPBA 3QWWA 1SXPA 3MV3B 4LEUA 3EBOA 4GYYA 3TAXA 2PQNA 4CTMA 2YHCA 4EKYA 1P2BA 3Q3HA 3ZCVA 4NRHB 4N39A 1FTQA 5DBKA 3OY2A 3QHPA 4H7XA 3ASHA 3URZA 3GUHA 1IXYA 1C8KA 3WXXA 2C1XA 2R4TA 1IHGA 4I17A 3BDAA 4HOUA 4J8EA 5C1DA 4WACA 4F3VA 9GPBA 1NOIA 3LY8A 4JA7A 2LSVA 4U04A 4UI9C 3MA5A 3RKVA 5ARFA 4HOSA 5TMDA 2R5SA 2QN9A 1NZNA 3ZHEB 4CGWA 3RSZA 2QZSA 5BW8C 3C4VA 1L5RA 3H4TA 2O6LA 4WNFA 2G9QA 3HBJA 4UQYA 1WW3A 4KQ1A 4RIEA 1P4JA 2FF5A 5D0QD 2X0DA 3OXGA 4J8DA 4AM9A 3BEOA 3S7DA 1K08A 1NOJA 4B94A 2GEKA 2QN1A 3L7CA 4BTAA 2AW3A 3L01A 3MBOA 3BD8A 3UUXA 2QN2A 3G2LA 1UQUA 3BCSA 3WC4A 2ACVA 3ZFWA 3C48A 4RG9A 1GPAA 1GZ5A 3QWVA 2PQRA 3WADA 4AMGA 4CTNA 5G04C 1NOKA 3GW4A 2GJ4A 3UYLA 2VYIA 1KT1A 4GCNA 4RG6A 1L5SA 3KD7A 3G2JA 3MEKA 2XPIA 4XIFA 4BWRA 3RHZA 4A1SA 2I6HA 4Z5XA 5FJYA 5DLDA 4N3CA 3Q5MA 4L22A 2PZIA 4G1TA 4CDRA 4GYOA 3COPA 2KCKA 4Y6WA 4AY5A 1M5RA 2JZCA 3E4BA 3ZHEA 2LSUA 5G05J 3VTYA 2VCEA 3BCRA 1WAO1 4REMA 1ZU2A 1JEJA 1QM5A 4CTOA 2HYZA 4U0ZA 1E4OA 4X7RA 2VSNA 1WW2A 2IV7A 4GPKA 1VGVA 1IIRA 3MRXA 1NZDA 5HI7A 1GFZA 3S28A 3CVLA 1FTYA 3SZ7A 1PC2A 1H5UA 4HOTA 1JG7A 4MICA 2ECPA 1AHPA 3AS5A 4N3BA 1C50A 2C9ZA 2GPBA 3LYAA 4N2QA 1XKXA 1Z6PA 1Y8MA 2IF4A 2QN7A 4EKEA 2ZB2A 1C3JA 4UI9J 2BISA 1V4VA 2HY7A 4J0UA 2GM9A 3OXFA 2WQHA 3MS4A 2C0MA 2AMVA 1WUYA 1KTIA 5AYWD 3OKPA 4WNEA 2GT1A 3NB0A 4AN4A 4MI6A 3ZGQA 2FFRA 1YA0A 5D00A 3OT5A 3L7BA 4N2SA 3UPVA 5TVGA 2IEGA 3PE3A 1P4HA 1LWOA 4LEIA 2KCVA 1HH8A 3CEMA 5D0OD 2YJNA 1IYGA 3HBFA 4U07A 2YQ8A 3MSCA 4BQIA 3ZCTA 2ASVA 2GPNA 3AS4A 5KJMA 3KAEA 2WTXA 3G2NA 3ZCPA 1Z8DA 3BEEA 4GCOA 2PYIA 3AMVA 2VCHA 3U3WA 3SF4A 1B89A 4LDPA 4XI9A 1ABBA 4F96A 4AY6A 5TMEA 2QRMA 4U0UA 2SKEA 4MHSA 2KATA 4WUYA 3BCUA 3FP3A 2C1ZA 1B4DA 2QNBA 2X0FA 3TG5A 5JTUA 2BGTA 3ZN3A 3RO2A 3EBPA 5KJNA 4YVOA 3D1JA 3GZ2A 1E1YA 2R68A 3RSCA 4ME2A 4JA9A 2OOEA 3CEQA 4G2VA 2DBAA 5KJLA 1XNFA 2IYFA 1YA6A 3QKWA 3PE4A 3WAGA 4WADA 1HLFA 3D0QA 1KT0A 2C4MA 2VG8A 4X7PA 1RZUA 3CEHA 3CK9A 4N3AA 4APOA 3CVNA 3QKYA 4KXKB 1QKJA 2R4UA 4W9RA 3CUUA 4RIIA 8GPBA 2XEVA 3MTDA 1FU7A 1F6DA 4EL5A 1P4GA 2X6RA 3RU0A 3G2IA 4BT8A 1FC0A 2G9VA 1ELRA 2F3SA 2R60A 1YGPA 3IAAA 3OTIA 4UI9K 1JIVA 2QLNA 3T3HA 2QN3A 3TOVA 5EX0A 5EKQD 1F0KA 3CK7A 4W6QA 2AV6A 1BX3A 2PL2A 6GPBA 5D01A 3L79A 3NF1A 4KBQA 4M83A 3T5TA 4GZ3A 5IKPA 4U0SA 3T7DA 2IUYA 3CV0A 3BD6A 3GZ1A 3Q4AB 2L6JA 3DD1A 2F3QA 3S2UA 3RO3A 1FU4A 1L5VA 4RBNA 3OKCA 3OXLA 4X6LA 4BTBA 3Q47B 1W3BA 3LPZA 4H7YA 2FI7A 1L5QA 3SYMA 4NC9A 3Q3EA 5ARGA 2XA2A 3G2KA 4CGVA 3E3NA 2BUGA 3Q15A 3JYSA 4I2WA 4BQFA 1XL1A 4MHOA 3DZCA 2XCCA 3EDTB 1Y8ZA 1Y6FA 3D0RA 3S0JA 2ACWA 4EJ2A 2KC7A 3G2HA 1A8IA 3RJVA 3MRTA 2OFFA 5IKOA 2IFUA 2SKDA 2IV3A 3VUFA 2BGUA 3QDNA 4G2TA 1QZ2A 4KQMA 3SYRA 3E3LA 3CX4A 3E3OA 2E2EA 1Z6QA 2XA1A 4RIHA 1HZ4A 3IA7A 2VQ2A 4X7MA 4RIFA 2P6PA 4FKZA 5FTPA 2HR2A 3CK8A 3MS2A 3NCHA 1FTWA 3NP9A 1WUTA 4AMBA 2QRPA 2QLMA 3T3DA 5G04J 4GYWA 4O6FA 3MRVA 1PNVA 3MT7A 1LWNA 3ASDA 3T3EA 1ZBPA 4NQ0A 1NZFA 2VSYA 5JTTA 3CUVA 4BT9A 4G26A 1C8LA 3HBMA 2X0EA 3ZCUA 2IW1A 1A17A 1FA9A 2ONDA 2QLLA 4F97A 2XGMA 2FBNA 2KCLA 1WV0A 4I9CA 1PSWA 3CKBA 2HO1A 3OTHA 3MV2B 5LCWC 1KLXA 3U4TA 1WV1A 5FT9A 1UQTA 2J9QA 3NPAA 5GPBA 2VGYA 3QOUA 3S27A 4ABNA 3ASFA 4RELA 1P5QA 2F3PA 4AIFA 1GG8A 2F3UA 4N5CA 3MQFA 2GW1A 2MHKA 3K9IA 3BD7A 5G05C 3CUWA 3O3CA 1RRVA 4I9EA 3R9AB 4BFCA 2IYAA 2Y4UA 2BFWA 5DIZA 1QQEA 3S29A 3L7DA 5CHEE 2LNIA 2XCBA 4GZ6A 5HXAA 1Y6GA 1GGNA 1HXIA 3HYMB 1JIUA 5HQ8A 1O6CA 3MTBA 4WHMA 3OKAA 3ZPJA 3VDNB 3UQ3A 5CCLA 4G25A 3VUEA 3CUYA 2UY1B 2X6QA
chains in the Genus database with same CATH superfamily
2VHWA 1JSCA 5BQ5A 4EA8A 4COOA 4M8KA 5BSWA 3C6QA 1KHHA 2G82A 5FFFA 3VPSA 3IDOA 3B52X 3G5TA 1WDKA 3TXNA 2P78A 4F9FA 4ACAA 1NVVQ 3Q5DA 1G20A 3TSAA 3WA7A 3IDAA 3H5TA 2HWWA 5G55A 4X20B 3UXYA 1OW3B 3W9UA 3ZE1B 3ZZTA 4W1SA 2PK3A 4R1SA 1I1HA 1MVNA 2GAIA 2G72A 3T06B 5TGZA 1I32A 2CEKA 2IQ5A 3W4JA 2C4VA 2C3UA 4MV8A 1Z13A 4AMVA 3BZBA 1BNCA 3JTEA 2OBXA 4B3HA 3GNQA 3T99A 5BN4B 4X20A 3GEMA 1QJ4A 3MJDA 3NJ8A 1BXZA 1J8YF 4ME6A 4CMAA 1WKCA 1XEXA 4HAWA 3I0MA 4EUKA 3ENEA 5BNWA 4K9OA 4JI7B 4UOZA 2Q8NA 4BU1A 2W00A 1A8SA 5ALJA 4ZKDA 4IIBA 5JXGA 3FDFA 1CIJA 1PFQA 4R8RA 2IQIA 3LIIA 3RKRA 5EXSA 1ONBA 3Q8WA 5ENDA 1BD4A 4EIWA 5FQ7A 5BN4A 3U9SA 1TVEA 5I7UA 4BC1A 3KP1A 3S68A 3LQYA 5CB6A 1Z5GA 3TKAA 1YJBA 4KP7A 5B3JC 2JL1A 3MTQA 3BHJA 4RXTA 4UI9C 4BZWA 4XTCS 2QVBA 4Q9JA 5AW7A 2O6LA 4QDXA 3E5RA 5K8UA 1E8YA 1K9SA 1UPTA 3JD1A 4X92A 5J2TB 2HSDA 3ZVVA 1GZ5A 5HCIA 1AV6A 2QP4A 5G2OA 1EH5A 4WZZA 1EYHA 3EJWA 1QOPB 2X9GA 1GGKA 3TCKA 1RCUA 3DBIA 5ESRA 3HADA 4DCNA 2V3WA 5K0LA 3SM9A 1OAOC 5DRYA 1OXMA 3EVCA 2F9LA 1XQ6A 3BCRA 4C0MA 2I9CA 1KEZA 3DEJA 2XLCA 5HBGA 4H77A 1BO6A 2JF0A 1YR3A 3KQQA 4UUCA 4DDUA 3IX7A 3JVUA 3DMTC 3UTMA 2WK1A 3TZ6A 3K8QA 3DBHA 2GASA 5FQ4A 1ISJA 1KMHB 2QTLA 2FSSA 1QIGA 1DJLA 1ZJ5A 4MW0A 1G8KA 4BVAA 1N9ZA 4UQOA 2AX4A 1ZYUA 1WSBA 2B8JA 3N7UA 4HNSA 1NW3A 1RAAA 2WBLC 3GCXA 1SMKA 2JZOA 3VU1A 4IS3A 3MMNA 4FKMA 3K9NA 1M73E 4MGKR 2OV1A 1H6AA 5EZYB 2H2IA 5JAOA 3QEMB 3FUHA 3QTBA 1GTJ1 4UU7A 5HG0A 1A98A 3OCYA 1KMHA 4JR1A 4ZOLF 3RO2A 4KPUB 1L4LA 3HFGA 3ZIDA 2AH5A 3SIWA 1NP3A 4JYCA 5EGNA 1J9GA 3PREA 4UHHA 3I42A 3QLVC 3V4ZA 4E13A 2ORWA 3F5MA 4HL6A 2NX2A 5EZYA 2WTBA 3QEMA 1OVGA 3OHMA 3JAKB 3ZWWA 5AJHA 5EHQA 4HFNA 4KPUA 3EG5A 4HATA 1PEYA 1PX0A 3SZGA 4GIBA 1LVHA 1KORA 4ENSA 1Y7HA 1FUEA 4NCKA 2JDIA 5FHQA 4REOA 4TKUB 3HXBA 2IQCA 1C7FA 1XNJA 2AUNA 3AI7A 3N28A 4JVMA 4UEKA 5GJWC 3JAKA 1GYPA 4ZI2A 1KFEB 4EG8A 4A92A 4LN1A 3QDNA 3ENQA 1QTRA 3A3NA 4H3KB 5FORA 3DE1X 3ND9A 3L49A 4D9JA 4LV8B 3TX6A 3CLVA 2GHIA 2FUNB 2HGSA 3OEED 1DUSA 5E75A 4PZ0A 3DNFA 4NIMA 1L6RA 4TKUA 3A4TA 1B26A 4DX7D 1KPSB 2J1LA 2VBGA 1P5QA 5FUWA 2LXNA 1WRBA 1SZ9A 3L7DA 2YYZA 3PLNA 2VBFA 4Q1BA 1W4ZA 2LDXA 5K4HA 1SB8A 1YU9A 4RTSA 4NCAA 4AQDA 2CDNA 1J07A 2Z04A 1AQUA 3KOUA 5LOZA 3S1AB 4R7TA 3T3IA 3KEFA 3A6HA 1UPFA 4QXOA 2V9ZA 1MFPA 3TRHA 3U3RA 3SDSA 1L5ZA 2VRBA 3GLQA 4C6RA 3ZBQA 2Z2IA 3FWHA 4U2DA 1K8YB 1S3FA 1BWRA 4JJ4A 3UX4A 3M89A 4MR7B 1SUDA 3MHPA 3X1XA 1H9AA 5J4HA 2DKNA 3C6YA 4EP1A 3S1AA 3WISA 1WOMA 3MTAA 2VGXB 2D5BA 4WWPA 3TD2A 4D44A 4OI0A 2M2IA 3LC0A 1XP5A 1E3LA 3NGLA 1NG1A 4ZDIA 4RC9A 3WRYC 7MHTA 4RD2A 3I3SR 1EF1C 1UQRA 1PT7A 4MR7A 4DSAA 5JZVA 3ZXXA 3FWVA 4L76A 3ELWA 4PTLA 2C9YA 3OTGA 3D3KA 1WB9A 4K6HA 1ECCA 4S24A 2VGXA 1FX1A 1U2PA 4Z9XA 4X65B 3F74A 4QO8A 2XUZA 2BELA 1ORRA 3D81A 4TXMA 4A10A 5KC9A 5AIAA 1GQYA 1Y63A 5F23A 4YHBA 3FX2A 5TMDA 2NXEA 1Q92A 2QN9A 3M4YA 1FJXA 3HYRA 1XZNA 1FTSA 1AO3A 4RANA 1U6IA 3FGZA 3FCEA 1B7GO 4XCXA 5TPZD 1PL0A 4QULA 1UT8A 3DD5A 4L5CA 1QVWA 3DXZA 4BECA 1CZKA 2PO5A 3ITWA 1GQSA 2R5NA 1TQ8A 1E0JA 1JBQA 4QNMA 8OHMA 1YZUA 3AKZA 1NZDA 4JZYA 1D4ZA 3UFBA 4PQFA 1DC6A 5FOSA 3V31A 3H6GA 1U8CB 3UKUG 3SFTA 3QWHA 4WLFA 4ABTA 1A95A 5G40A 3FNGA 3WRVA 5B7GA 2AKYA 1G2OA 3HXLA 3FJ1A 4C1NA 2BMFA 2CZCA 2QY9A 1Z4QA 1PVVA 5ER6A 2JFWA 4NK4A 2FPRA 1KE1A 2QW0X 3CW9A 4CKWB 3GN1A 4KYTA 3LJ3A 3GPCA 4TVOA 3A7EA 2FKAA 2GRNB 3TU3B 5JMND 1LPMA 2X40A 5AW3A 1X8XA 4X9XA 3NM6B 1ZW6A 3I28A 2IT1A 3IUMA 2VDOB 1M0SA 4QQ8A 1KU6A 1LRJA 4YP9A 4CKWA 2P9TA 4I1RA 4MQ4A 5HIMA 2A5UA 2DPXA 3UGQA 1VHTA 1RU3A 5ALNA 3OECA 4UZEA 3QUQA 2JLAA 4JGIA 1CUIA 3DS8A 4R2KA 4U0SA 5GADl 5J5CA 1N3IA 3V1MA 2GERA 3KE8A 5I4BA 5KNCD 4BOYA 2BUBA 3NTQA 1K6XA 1BHQ1 4B47A 1NDQA 5B3SE 4YIKA 2HJGA 3KYJB 5ERXA 1Z3IX 2QJRA 1JYFA 1XT6A 1PL6A 4BWVA 4AUNA 2FXIA 1C1YA 3OCJA 1HBJA 1LI7A 3JQPA 3HJFA 3VKWA 1T36B 1IZYA 1IE3A 2O2DA 2QLMA 2VDUE 2ZJ6A 3H2ZA 3RQSA 2RONA 1T13A 1IJFA 2YHUA 5M2QA 4FBMA 1NNI1 2YWBA 5J47A 4HJRA 1NSFA 5AJTA 5LUBA 4YUZA 4RELA 2C5LA 2OYRA 3ND7A 4QOFA 3RJ9A 2Q3MA 2GROB 1A72A 1FXSA 4LOIA 3Q9NA 2NUAA 1T36A 1BS1A 4YT2A 1P7WA 1V4NA 2O7SA 4Q37A 1Z2CA 1LS1A 4TGLA 3DO8A 2R3SA 3OF5A 4X0EA 1GT91 1JBEA 1TLTA 2H52A 3AFMA 2NYAA 3BSYA 3EUWA 4WFIA 2VDNB 1KJ9A 5CG1A 2WG2A 3AV3A 5D3MB 5CX1B 5LKRA 1FTNA 1TK9A 2VP0A 3G1WA 3PQEA 3L6AA 1XL0A 3IEMA 3O4GA 4JBWA 2OCXA 3QVWA 5D7NA 5KUTA 1U2VG 1J0BA 2H4YA 4MRNA 4JLUA 2G17A 2FO1E 4A8TA 3OMXA 4GQIA 1OH7A 2ZYWX 3HO6A 4HWPA 4LJYA 1N77A 1NRXA 1Z82A 2XB2A 1NQXA 3M82A 2E6KA 3FAKA 3L0CA 2XYHA 5CX1A 2Z1NA 1P1KA 2M1XA 1NDHA 4OUDB 1W5SA 2JIPA 2Q3FA 3LQ2A 2BMAA 5JSHA 2UYYA 5KNGA 3FWZA 3OT1A 3ZZMA 4NZYA 4EVIA 2ZVQX 3BDIA 1NQ5A 4NCHA 1B0UA 3M5CA 5DSXA 4E5SA 4Q3OA 1MRNA 2I91A 2WPVA 3G89A 1TJCA 2IU0A 4FT4A 1SCBA 4TRMA 4P5PA 1T26A 2WABA 4IDOA 2P2GA 2SBTA 2QX8A 4ZRDA 2QM0A 2HA6A 5I6DA 4OUDA 1MC8A 4LZAA 1T6ZA 3NCTA 5B6JA 1BHO1 3BIWA 2J67A 3U7GA 3TJPA 4KW7A 3BF8A 4XEUA 4MVJP 2VOEA 5HFJA 2XB4A 3OICA 4HN2A 3WWPA 4GL2A 3OQIB 2I1JA 2HTFA 2DT8A 1EIWA 2BTOA 3FPHA 1MO3A 3T9AA 2BCGY 4TYWA 4IIHA 2FWIA 1G6Q1 2FF5A 3O0DA 2QE7A 2ZWIA 1OI7A 2ACVA 1M0EA 1U7XA 1BMQA 2DT5A 1UBTS 4TV9F 4N5IX 2ZYDA 4QXAA 1IXVA 3WHKA 1F8XA 3OQIA 2XXAB 2H0QA 2KCKA 5TPWB 3QAQA 5AWFC 4LFCB 3CX3A 4DSUA 4DBZA 1RJGA 1L5OA 4FX2A 4B9AA 5KJCA 2FUCA 2VJBA 2Z4RA 3NT5A 4Z51A 3L6RA 2LP4Y 2OESA 4P33A 2ZISA 4D3XA 2GH1A 2EYQA 2XXAA 2XVMA 2DBRA 2XGJA 1JHMA 4DCVA 3BS4A 5TPWA 1E2NA 3ZU7B 2QW1A 4L0MA 4H0FA 5COAA 1ESNA 2YRWA 5C4GB 3CMMA 3P1JA 2Z0MA 2L0XA 3AR9A 3AVOA 1SIUA 3TM4A 4DB4A 2Y0DA 3KKNA 4TZTA 4LFAB 3DZKA 5AW5A 3SPXA 1S0UA 2PQ0A 2JBWA 4A63B 2X41A 4NDZA 2YVQA 2QU8A 4RFSB 3AEQB 3LGXA 3BBPA 1U0HC 1OC4A 3L5KA 4KNWA 4BMCA 4P3NA 3G6KA 4MYHA 1CRQA 3OJWA 1CEYA 4Q1EA 3A6GA 4O2BB 3OTIA 2IEZA 5K3AA 5GM2A 4C5BA 2VWGA 4WAFA 2HLPA 4RFSA 3AEQA 1IBRA 4WZAB 5FWNA 2YZGA 3OXLA 2NW6A 1T2VA 3BREA 5EVJA 2DUJA 1U0GA 4CFZA 3Q3EA 3TFQA 5F1YA 3N2ZB 4K6CA 2FJ0A 1EE9A 2CWWA 4O2BA 1D9ZA 1YTUA 1O08A 1TM7E 1CNEA 2GPWA 1X80B 4WZAA 4LYDA 2QRLA 1Y7TA 4UAUA 3GVIA 1XVLA 1LWNA 2H16A 2NACA 2Y76A 2Q2OA 3MWYW 2K4NA 3WDSA 2OP0A 1PG5A 4TWJA 2RI0A 2EW2A 1H94A 4KO8A 3C0KA 1QZXA 2DEUA 4EEXA 4AIFA 4NECA 3L4SO 2H1RA 5EJ9A 4GX0A 1X80A 1M1NB 3KD3A 1FLNA 2V45A 4MKXA 1MRSA 4C4OA 1P3DA 1ZZGA 3JWEA 2NV6A 3FHCB 1R4MB 4GI3A 3IMKA 4RZHA 1PL7A 4NPCA 4AZSA 4P54A 3OP4A 1OUVA 1MEEA 2H1WA 1M0TA 4QGGA 4Z4FA 3HSKA 1VBNA 4YUWA 2Q1YA 3OWOA 4EM6A 2RC5A 4DJDC 1M1NA 5E7MA 4HN4B 3U3KA 4JC0A 3OX3A 1P31A 3PKZA 2XZOA 4HQFA 2HF9A 2ETVA 3CGHA 2KS6A 4FZRA 3H1TA 2V55B 4FDUA 3VC7A 1R4MA 1P91A 3WB9A 1Y6JA 5FAXA 5FPHA 3MIZA 3IYLW 1GNPA 4R84A 1ENPA 4P4UA 1FTGA 1K7XB 3WIDA 3F4LA 4M0LA 1XRPA 4MYRA 5IMBA 1U0OC 3PDNA 1ELWA 1YCFA 3LY7A 3N5CA 2VH5R 2R6DA 2ONZA 3UWDA 1W44A 2HZ7A 1Z7WA 1UZUA 1BVHA 3BGSA 3A6LA 4RPJA 4U7TB 1TO6A 3OU6A 3RIMA 4WSOA 2IS4A 3B7WA 2PQNA 1BI7B 1P6UA 4F8YA 3HP7A 3D8BA 1RPAA 5DBKA 4NYIR 1ZJJA 1BDJA 2IP2A 4E3WA 4MQLA 1Q57A 5FCDA 2C03A 2GRPB 1JAXA 4NQRA 2BDEA 3PXXA 1JA1A 4CR8A 1A71A 4H7JA 2LE0A 1IY9A 1H2XA 1E4VA 1GQQA 4M86A 4AUKA 1N4AA 4L0CA 3UGJA 3ECCA 3P71T 1RKVA 3WLPA 1NYRA 2C42A 4L2IA 1WLYA 3GYXB 5KSYA 5E2BA 4REMA 2HPZA 4Z9BA 1CY4A 3T3OA 4EG5A 3CNBA 4C20A 3Q10A 4PZUA 4G37A 4KXNA 4BSXA 4B0ZA 1CS0B 3P96A 2HY7A 2G88A 1R3UA 1H19A 1E5XA 5AYWD 4FM9A 3NNDA 4ZDKA 3LT0A 3QU2A 4UHFA 2YZ7A 5K8TA 1OHHD 4EB6B 4DDHA 4LBVA 5ADUS 5C1BA 4H6WA 3GFBA 2X42A 1K4KA 1IVYA 4DBLE 3Q87B 2V0NA 3GT7A 6REQB 5LYJF 2XE4A 4RYLA 3D3QA 1CS0A 3U2QA 3Q9SA 1DAOA 2KSQA 1Q7BA 3HKCB 2Q5IA 2NQ8A 5EZ5A 3FI0A 3W2HA 1IOVA 4EY4A 1WQ4A 1Y9ZA 2E4XA 4RJKA 4BB5A 4EB6A 1MKYA 2B8NA 4MW1A 3OEHA 5I4KA 3OHSX 6REQA 1P0FA 4HC4A 4D82A 4YP1A 3ZJUA 3HKCA 3HFJA 1MH9A 2NXNA 3KXPA 5FI5A 1BJKA 4F3KA 3RTAA 2C8KA 4CMCA 4RHFA 1W2WB 1OR8A 1DVPA 4PRYA 4ZYYA 4YQYA 5EE0A 4R1TA 4N5LA 3FCCA 4HNUA 1VCIA 3VNSA 2YXBA 2GF9A 3ZLUA 3A9WA 3GPDG 2OXRA 5KWJA 4IDCA 4RJIA 3KVYA 3EBLA 1KEEA 2JEZA 2H6EA 4U39A 3LMKA 2BR4A 5BYBA 4PG6A 1JKFA 1AN0A 5G04J 1FYDA 3E7XA 2XT0A 2PGJA 1ODJA 5AIJA 2FSVC 1J33A 3K1ZA 2J9FA 2PSEA 5JJKA 1GTSA 3SDZA 4M0DA 2D1TA 1IM8A 3Q3CA 4MGEA 5KDLA 1Y1PA 3DLCA 4JJIA 4TYPA 4FMCB 1D6NA 4N7BA 4R0NA 3EEYA 3P0RA 2OCAA 4AU1A 1MAAA 1QTIA 2PX6A 4OHFA 4UPVA 4ZODA 1RM3A 2GXSA 2BKGA 1EVLA 3GNTA 3K72B 1H8ED 3U1TA 3R8CA 1BHSA 2WFMA 4CBVA 1RPJA 3SXJA 4RV4A 3R6WA 5I5GA 1E8MA 4C29A 1C7JA 1MZCA 1ZUNA 5HKBA 2EFYA 4DQLA 5FOVA 1Y3HA 4PRZA 3RIEA 1JDBC 1LK7A 4B3BA 3QHQA 2B83A 3HN2A 3ROXA 1Q0HA 3GRVA 4B3MB 4EQ6B 2QUIA 2MWMA 3O95A 3AP2A 4DLVA 1YZKA 3M7IA 2PEZA 4LHSA 4GWGA 1NVUQ 2ODQA 4MPPA 3EX7C 1NBHA 1NJ8A 4FZJA 2VHEA 1KJYA 1P5JA 2HMAA 2VSXA 4QWMA 4EDHA 3UINC 1W4RA 2RHHA 2PYDA 2ZBRA 3P5SA 3JQDA 2YMQA 2R751 3TWRA 3LFUA 3QPUA 4ZVRA 1JHDA 4EQ6A 1NBMD 2HNAA 2RSFA 5HS0A 3QWFA 4Y0AA 2EL9A 3JWJA 1QU2A 2HJHA 4V0ME 1DUIA 3RYHB 3KNZA 1YZYA 1OU4A 3S7JA 5BUCA 2CSUA 4EY8A 3Q3GE 3NV9A 3WRXC 2CNKA 4BLPA 4RSMA 4G01B 4EA7A 2EV9A 2FJBB 1VG0B 4UBMA 1H9BA 5KNHD 5JMOA 2VF4X 3REQB 3K9QO 4J7UA 3NXSA 5F7JA 4D74A 1XRJA 4KN5A 2L42A 4A73A 1PQ4A 5E1DA 3C4VA 1VPEA 4X1IB 5IHPA 4A5SA 3OIUA 4DAOA 2VYFA 3WV5A 4ZXFA 4GPEA 3C48A 3GAFA 5D6NA 4B40A 3QNUA 2HT1A 5K0EA 4ER3A 3ZYLA 3REQA 4PXSA 4K1LA 4GYOA 3ZBUA 1V5EA 1U31A 4FMPA 4I4CA 5K2MA 5LCXA 3OX4A 4X1IA 4U0ZA 4KFSA 3HHPA 4NFSA 1AKUA 2NT4A 2OP1A 2RD0A 1NYLA 2C2KA 1PC2A 2H6IA 1AHPA 3IP7A 2CZGA 1R4NB 1D1TA 1SVSA 1GQRA 3K9CA 3THSA 1HE1C 1UDXA 3PEEA 4RDXA 2X13A 2GM9A 3I09A 4LERA 3R40A 3G9ZA 4WEQA 3X1DA 4P98A 2ZGVA 3W6ZA 1JS1X 2P2ZA 4DX6D 4KYVA 2X38A 1T5TA 1T0IA 2DECA 5FI0B 2H9YA 1CRZA 4KIGA 1R4NA 1KDPA 2P4UA 3UQZA 1GRNA 4HRMB 4OATA 4Z6KA 5FI3A 3VCXA 4OJTA 4N54A 4DT1A 1QHEA 2WDPA 3ASYA 3KQVA 3GFVA 3FB1A 4H3HB 3QU5A 4JI5B 1Z0SA 1YA6A 4A8PA 3KUDA 1JPLA 2FWNA 5LQRA 2R4UA 5FD8A 4W9RA 4PG5A 2BFEB 4C6SA 3GGDA 3WGTA 1NQAO 3Q9UC 3RU3A 5EMNA 2DSNA 2WXQA 1UZLA 1D2MA 2OCGA 4MQBA 1RKQA 4N0QA 1M8PA 2EP8A 5KNDA 2FPWA 2NLOA 2L6JA 4QUDA 1U6KA 3Q47B 4D3FA 3C3BA 1MO6A 4Z8XA 3FLBA 2BFEA 1QYDA 2Q62A 1Y3CE 1TLFA 2O2GA 2K7FA 2X5KO 3OQVA 4O3FA 4YYZA 3U0VA 3WIOA 1WTCA 1YT5A 2X7XA 1NGSA 3IAM6 2V74B 4G5XA 1B8OA 1DBVO 4LOLA 5SICE 3ROMA 3ORHA 1W4LA 4B35A 4H4CA 3EUFA 1MOQA 4ND2A 3NCHA 3FCSB 4BU0A 4FMDB 4GWKA 2X0EA 5G4KB 4KYIB 1Z08A 4D42A 1P5ZB 4X97A 1DX9A 2XBLA 3H5VA 3OKFA 3EZ2A 4Y6OA 1KS2A 5A4MS 2ZE5A 1ECGA 2AHRA 5JJBA 2WSSD 3VA7A 5DNVA 1Z4JA 3L8FA 2GVNA 4OQMA 2XQJA 4JJEA 3T5DA 3S2GA 2FR8A 4IJQA 1WSWA 3MMPA 1NVVR 2R7NA 5G4KA 3E27A 4MMYB 4AX4A 3AEKB 4YRIA 3C5WP 3L54A 1WNTA 4ZGWA 4IIVA 7ADHA 3DF7A 4JAVC 5BXUA 4BO1A 4DEVA 4FR5A 3GMTA 1ZN2A 4G0WA 2XYRA 4KBYA 1MHPA 2SKCA 1RM5A 4TYNA 2C0LA 1IHYA 4U95D 1JVBA 4RHCA 1QB7A 2YHAA 3ETCA 4AJJA 4GTSA 2W6JA 1UC4B 1O1RA 2WU4A 1B8NA 5KJEA 1YD7A 2LNDA 4ANVA 2HL6A 1AXRA 1Y5RA 1DEOA 4HDSA 5CRVA 1GL7A 4JUDX 3V3TA 4JUAA 2IYUA 1Q77A 4CG3A 3ESXA 4HFRA 1OLXB 3UBMA 2VQ6A 4L0QA 3IXLA 1SB9A 3GUYA 4BWFB 3ZK8A 4JOQA 1C81A 1NBEA 1ZD1A 3P5BA 2YXLA 4XFKA 2JI4A 2ZYSA 2KLBA 1NT4A 5KTRA 1GRQA 2LTAA 4WT7A 4KVOA 4E6PA 4FHKA 2NTVA 1X13A 2EBFX 2H6HA 3UXEA 4LZJA 2QTGA 3E9NA 3ASHA 4UM9D 1QPGA 1OLXA 3K0HA 3FYUC 4AXXA 3NBZC 3ZHCA 1B74A 1KXZA 3MWLA 4JXXA 1DVRA 4O4IF 2J7PD 3AR7A 4OL9A 5AYVA 3ZV6A 5CTAA 3AVVA 2D2VA 3X43A 1RBMA 1Z5PA 1SR8A 1SCQA 3BXZA 2FN9A 3SFVA 3WP0A 4YCLA 4CLRB 5G04C 4B6PA 1TFRA 3E5HA 4ZAGA 4OHXA 3A1SA 1TF7A 3EAFA 2DSTA 4JA2A 3MD9A 4BFUA 5IDVA 3R6DA 1BKSB 3DDUA 1YE8A 2X9LA 4PQRA 2OHJA 4V1CB 1Z2EA 3RRJA 2EBHX 1ZD2P 1TAUA 2PZKA 1AZTA 4TMKA 4ND3A 4BV2A 4CLRA 1V9CA 1Y80A 2YWRA 2YYSA 2L0IA 3BJMA 4AKEA 4UI9J 2CLIB 1Y1TA 3NW9A 3TYXA 2AG1A 4C4RA 5B4UA 4I9UA 1Q2ZA 4PYOA 3ZGQA 4GKKB 1O94A 2LD4A 1UZMA 1FSFA 3AEZA 3ETLA 3IAM1 2J33A 3G9XA 2J85A 3ZQKA 3D4NA 4JI1B 3AAAC 1E3TA 4ANWA 3FDXA 3JVDA 5DB4A 1V6CA 1I80A 4FXOA 4EYSA 3QSYA 4XOIA 1WXHA 1NUAA 3OLXA 3QENA 3AWIA 1FNSA 3P7MA 4PLPA 2BVNA 2RI1A 4W5NA 1RQGA 3D0QA 3W3AA 5CPFA 3PDIB 5D66A 3EEFA 3GJ6A 4O1MA 1P9OA 3LBIA 2BKXA 4U2GA 2W0SA 1ZR4A 2JI8A 4JEMA 4Q66C 1JIVA 4J1TA 2A67A 2XDAA 4L9RA 2HU8A 4JI6B 4E2YA 5EVCA 1U8XX 1XALA 2JJ1A 3H75A 2WNHA 2AZMA 4TVSA 4KK4A 2X2FA 3OJFA 1N5IA 1L4GA 2UUAB 3RC8A 3FZYA 3EODA 1S1CA 3PDIA 4OFWA 2BF7A 2XCCA 5I51A 4JDPA 4BAUA 3IHKA 1ORDA 1U0LA 1Z38A 2YFYA 3MXTA 2FVYA 3QHAA 3W5BA 2W93A 5FPKA 4LC9A 1QZ2A 2IS6A 2H1SA 3CX4A 5ESXA 4GMJA 3GFPA 4IDHA 4BQPA 5F33A 1TNYA 5SZHB 1U28C 2ZWOA 3FGOA 3FCUB 4MKZA 3CUVA 1FY2A 4U63A 3FTUA 1DELA 3PRJA 5FP0A 1SU8A 4A0FA 3W1VA 1G42A 1XWWA 3C5RA 3N2GB 4KNVA 2FEXA 3JQ9A 4XB6B 2XNKA 4KWEA 3Q8KA 1BSVA 1XAHA 3GK3A 5L3QB 3G82C 2J30A 1P77A 4R40A 3IVRA 3OKAA 3UQ3A 4E11A 3KJZA 4ARBA 3DQQA 3ET4A 4BGVA 3UWOA 2OECA 2WUDA 5EZSA 2IITA 2PZMA 3AESA 3N2GA 3ELBA 5KKCA 1J49A 3IKTA 4ETIA 3ZPXA 2C9DA 1XF1A 4EB8A 2MMCA 4JA0A 5ALYA 2B2NA 3LCRA 4ARVA 5A7GA 5L3QA 4B3DA 4BO0A 3SS9X 3P0IA 2EYUA 3S2EA 4CT4B 5CT4A 4WGFA 2Y69E 1OYOA 3JWIA 2OILA 1X1CA 2ZROA 2IH2A 1TM1E 1ECJA 2JD2A 2HUPA 2W6CX 2UVQA 4XJXA 2NO1A 3OE7A 2HMYB 3G8BA 5E3IA 1FE8A 4HD8A 1I4DD 3Q6MA 2Q5FA 2P77A 4ZO8A 2QAGB 1ABEA 2AZDA 4DBVO 2C4KA 4GA0A 3NOGD 3DL7A 1JU3A 4W5WA 3CUEF 4DY4A 3ADDA 1O97D 4QT0A 4KPYA 1UAYA 2ROQA 3L82B 3DR5A 4AYWA 2W6IA 4DJJA 1TC2A 2ZAGA 2HJ9A 2V6JA 4ZARA 5KBAA 2BPOA 3QNKA 2QAGA 2VP6A 1N2EA 1AKQA 1Z8FA 1GZ6A 2X5JO 3ZQ6A 1TADA 4F3CA 5BO5A 3S70A 3M81A 4QATA 5CD1A 1JDVA 2IKQA 3QLJA 2XRMA 4F1JA 4LSGA 3L82A 3ZZUA 4OD0A 3PC7A 3EFHA 1KFCB 2GM5A 5TMPA 1V7QA 4YROA 1BZYA 2IBSA 3I9V6 2GZ3A 2GJKA 4OH7A 5DI9A 5CLJA 3RS5A 1GFSA 1Q15A 2AHOA 4ZFHA 1ZI9A 2J9GA 3LCJA 3BTSA 3C8MA 2BFDB 3DEHA 1A7UA 4UWGA 2F4VB 3O4IA 2XZTA 3M4ZA 1PD0A 3ZE9A 1GLGA 4PCUA 1E7WA 4F3YA 1O6FA 1T3LA 1VSBA 2X6FA 4K26A 3L4JA 3JZDA 2Q5CA 3IVMA 2FHSA 3CVXA 1QHIA 3N8IA 5LIRA 3N2NA 3EIQC 5I3ZA 1FBTA 2BFDA 3BXFA 4Y1FA 2NMVA 3GBPA 4AXHA 1PZXA 2H07A 3NTUA 1AX9A 4ZQBA 3T7IA 3VAYA 3T9BA 3DEYX 1XXHE 4B46A 3LKDA 3KFXA 4YJ3B 2H7XA 1CQPA 5E38A 5KYNA 3HACA 3FPGA 1FCJA 1B43A 2XQKA 4DCCA 2QENA 2CXSA 4DV3B 3ONVA 1G1AA 4BB6A 4FOSA 3V1UA 2O54A 3U1BA 3HTXA 4XR9A 1UXHA 4QVGA 3SCZA 4YJ3A 1C9JA 3H9BA 1KVUA 1O95A 2A0XA 4WJZA 3G68A 2X1VA 1GNVA 2J3HA 1I2AA 2QW8A 4BRUA 2ZULA 4LXIA 3IO5A 1GARA 4HYYA 5ALFA 3OKCA 2WAXA 4PXYA 1W3BA 4MDEA 4IG9A 5DNDA 2PA0A 3BFVA 4GYKA 1EP2B 3JWGA 3DCJA 3KUKA 1GUFA 4AZTA 3N2LA 1VMIA 2GN4A 1F8UA 1A8IA 1B0AA 2QYSA 1WDTA 4G2TA 4GOOD 4EZLA 3LH5A 5B6PA 3QX3A 3B8HA 1P17A 4PWYA 3CLTD 2QD4A 4IUYA 4DQVA 4HSEA 4MV4A 1ZNWA 1FLAA 1XYGA 3G2UA 3ED1A 4Z53A 1BCRB 3O8CA 2ONDA 1Y81A 4L7TA 3ZHQA 1QG4A 3ER9A 5TEVA 4PLVA 3F8SA 1Q50A 2PRZA 3USES 5HCNA 5EUBA 2ZGGA 3BXXA 2H9AA 3PYLA 2HIGA 4I9EA 4EJSC 3WLSA 1LTHR 4HFMA 3AF6A 3K5HA 2DZNA 4G1EB 1X7GA 4E1AA 5KMGB 2BH2A 3A6DA 3LDUA 1XD9A 3ETGA 1OVMA 4LGYA 5DN6D 1BCRA 3A58B 1LFDB 1CQXA 4ND5A 4HWTA 4JLMA 4A27A 3B7RL 2SNIE 1FU8A 4Y9SA 3Q72A 3T5PA 5CNJA 4PPYA 5HBRA 1YV9A 1V96A 1BU5A 1CBUA 5CNKA 2WU3A 5KMGA 2J8SD 3I9V1 1BN6A 3D3MA 3JR7A 1N95A 1OV4A 3E30A 4HN9A 1JP7A 4BNGA 2HYIC 2C95A 1HTTA 3CV3A 1FYWA 5ALQA 1JR6A 3H1PA 2GPTA 3SMVA 4HLUC 5J2TA 4BNWA 4QOGA 2I3DA 1NNUA 1TVCA 1UPAA 3DFKA 2PVCA 1SBZA 2JJQA 4B4DA 4DIUA 3K1JA 4JB8P 2ZAYA 3CPJB 3FNEA 2RGEA 2ZR0A 4GBMA 2VDVE 4OVVA 1QGOA 2A92A 3FW1A 4DLTA 3GDWA 1JF8A 1E1KA 4PO1A 2C7QA 3OQ1A 4K9KA 3IBEA 4I55F 1KBZA 4D4LA 2IDMA 4LDRA 3OCXA 4I1VA 5JWHA 4LG1A 5A6VA 1OTXA 4DWVA 3F5FA 4HOSA 4WN9B 1CJKC 1PJAA 3AL0C 5D0QD 1HI9A 1XZCA 3BPSA 4R6XA 2W2NA 2QN2A 2VPQA 3KQTA 2KB0A 3PXAA 4Q01A 1S2IA 2YMMA 4RLSA 4QM6A 5DLDA 2I3GA 3DYVA 4RETA 3HVUA 3T94A 2D8AA 3WK5A 1AUPA 5JT1A 4WN9A 3IQDB 2I29A 4HS9A 3WWDA 2EGGA 2YICA 1U04A 4GM4A 3NANA 2I4RA 4GPTA 2AFRA 2COUA 3RVOA 4TL8A 5IXJA 3QVOA 1BE0A 4JD5A 1H0AA 4C6TB 1NN3A 4WECA 1AF7A 3P9RA 1U4OA 3AB3A 4D8UA 3BGDA 4S1TA 2XBMA 2H1IA 1NUPA 4GOKA 1FSGA 3U31A 3QVMA 5HRCA 1CR6A 4P53A 2WF7A 2I2FA 2XB9A 1RCTE 3S2FA 4H9GA 3HVIA 1C4WA 4C6TA 2BGTA 3H8SA 1EAMA 1VI6A 3NIWA 3CZQA 1CJVC 1ZY2A 2GD2A 3UK2A 3V34A 5F77A 1Q83A 2FY8A 1W0JD 2B99A 1MX9A 2CK3D 2UUOA 1YQQA 1KZYC 4BETA 3CONA 1UN8A 4A8JB 2Z5GA 3M9XA 2OWDA 4M9QA 2HRZA 4HX2A 4WMLA 1OROA 3PGJA 4WK4B 2H3HA 4UHEA 2DU8A 5A9SB 3IV9A 4JB0A 1EFHA 1MC1A 4FQ5A 5AJYA 2BGGA 2XWSA 1XPJA 2GAJA 3T0IA 4A8JA 1ZK1A 2JLQA 2GWRA 2X1MA 4ILEA 3FIJA 4BMVA 2CG2A 1E1QD 1X7WB 1AE1A 4HWSA 1JFVA 3A1NA 3T9DA 4AWBA 2P7IA 4DYVA 1RI5A 4J2HA 3EVTA 5A9SA 4WKCA 1DKPA 2PXXA 4HH4A 1WY5A 2AN9A 4ZCSA 1RBYA 2D5IA 3RFUA 3H8VA 4DA0A 4TUYB 4UEWA 3UJHA 3M2PA 1W59A 3V1LA 4XLZA 2JJ2A 1EA7A 2UZIR 5H02A 2N46A 4I3FA 1X7WA 3CRW1 4XDYA 4CM9D 3KZCA 1C8VB 2EEZA 3MSXA 4G5RA 2Q5OA 2HSWA 3KKOA 3U4DA 3HCWA 3RG8A 3NBQA 1PL8A 2BEVB 4HMPA 3EZ7A 4Q69A 1IPHA 4FVTA 1WG0A 3RV4A 1NR7A 4NLLA 3I9LA 4BJ5A 1QF9A 5HGJA 4I4TF 3DZHA 3WWZA 3B2NA 1Z16A 5CBOA 4CIVA 2XNJA 4TUYA 1G2IA 2PPLA 3HWSA 1M1ZA 3TNYA 2QS9A 3H4IA 2DFKB 3ZH2A 2B25A 2P9LG 4YRSA 2PX5A 3QWAA 2BEVA 5C35A 3FHTA 1HDXA 3T15A 2QGZA 4RKQA 4QVKA 3Q4GA 2XYVA 3OZIA 3ZVLA 3FFAA 4QLOA 1SHJA 3QK0A 4OSOA 1A9XB 1MB4A 1IXZA 4PR3A 3E9MA 5AD1A 1KMMA 1T24A 3OPMA 2QVGA 2Z98A 4JP1A 3MELA 4OB8A 4GL4A 4JP5A 2HAEA 2NZ2A 2QXTA 2VDKB 5CT6A 3MEQA 1G38A 1PKEA 1Y9EA 4MNTA 2EKDA 1PN3A 3M9WA 1A9XA 5EUMA 4E5DA 4B7ZA 1FS6A 3AUSA 2LCFA 2WNIA 5JC8A 4OHVA 3UICA 1SU7A 4YHHB 1P2BA 3EGOA 5IBPA 4DREA 1YR7A 2ZQ5A 3GLIB 1KI3A 2HJVA 1MZPA 4ZCRA 2EW8A 2V1XA 2HLDA 5LQCA 4F3VA 1BU8A 2CKMA 4KVFA 2PUBA 2KM1A 1J5PA 4HUJA 5JO9A 1L4KA 4NBNA 1DTWB 1Z6TA 2YIMA 4N3NA 1W8DA 3UHPA 2CLLB 3AM1A 1SU6A 5JJLA 2OBNA 3GLIA 5TV2A 1ZA2A 1YBAA 3D2CA 2O52A 4JYAB 5T67A 1T4BA 3U7QB 2WMYA 4G0QA 3DT8A 1P0MA 1WAO1 3AB8A 1T8RA 2JFZA 3KHUA 2Q3JA 3WFZA 1DTWA 4EG1A 1QP4A 3RARA 3WLTA 4EOGA 4K8RB 4QGSA 1M5TA 1USKA 2QSUA 4HPJB 2HC9A 1Z88A 5JYEA 3QRWA 1K6IA 1PGNA 3M33A 1UEJA 2HLHA 1KZHA 2IO2C 1CF9A 4J7CA 1SIBE 4JNKA 3MS4A 1W73A 2XVZA 3WS7A 3P2YA 4FCCA 5GWXA 3STVA 6ADHA 2D5AA 2YUTA 1M6NA 3H83A 1Z7BA 2E21A 5LNK6 1PTJA 1YI0A 1LVGA 4WNYA 1RP7A 2AFIB 2MSLA 4X63A 3CH4B 4MSUA 4JVOA 1WOYA 3I6QA 4P9NA 3REGA 5B4VA 4MA5A 5K3OA 1X1EA 1AHHA 3KS9A 3TZQA 3PWZA 3ZN3A 4D3DA 3NVKI 2B0JA 1N78A 4XDGA 5A02A 2PEYA 1WCWA 5CA1F 3H5AA 1N5DA 4LJRA 2HQBA 4D1YA 4BLWA 5H59A 3DZIA 5C3MA 3OQBA 5DLPA 4O4HB 2F1JA 2AFIA 3P2MA 3VPBA 1IYZA 2IY7A 4PSVA 1U7TA 1SY7A 2Q2VA 2WKSA 2OXTA 5H3CA 1H4SA 1EJBA 3ZNOA 2NZYA 4M7RA 1POXA 4B3TB 1NKSA 1UF9A 4XWKA 1I1NA 1W76A 4QUBA 3M6VA 1X1DA 4U8HA 3V42A 4L8YA 2WU8A 3F6PA 4EY5A 2DWOA 4DJ5X 1N57A 3W7AA 3IULA 4OI1A 3K6JA 3I6ZA 4MVCA 3X1KA 4CF4A 1QFJA 3HXFA 4U6NA 2QB5A 1NXQA 3OEWA 4O33A 4O4HA 4LGVA 3CLHA 2AG6A 2AYZA 2FZVA 2C8JA 4JB3A 4BFXA 5FOWA 5D3MA 2Z43A 4D0RA 3ND6A 3R76A 4KQWA 2BJVA 4RM3A 3T5XA 1H9CA 1X7HA 4DV1B 1NQWA 3JD3A 1WABA 5HKPA 2D62A 3LWNA 4IF6A 1I10A 5EKSA 2PJZA 3WYEA 3LVRE 4Q7KA 5DLQC 3TDNA 3DM5A 4XGIA 2HIMA 4F4JA 1PS8A 2ZS9A 3H84A 1VM6A 4KR9A 2E2WA 1QIKA 1V2HE 2X0NA 4Y9RA 1V9LA 4M0PA 1QHNA 2FLWA 1VDMA 4B3JA 2RHCA 1EDEA 3B1FA 1BHJA 3V32A 2H7VA 1ZA1A 3ZDFA 1OILA 3FIUA 3AB7A 2GEDA 1CTQA 4BUJA 5C8ZA 2GCEA 2W5UA 1P5HA 3QPWA 3TMYA 4AF8A 1SCDA 3H1BA 4LNBA 2IBTA 3RC7A 2A35A 3DLPX 2RJNA 1AS0A 1P2UA 5IBRA 2KE5A 1Z06A 1GNSA 1NUTA 4CNBA 3AVYA 3JVVA 5D5PA 3UCEA 1KQ3A 4M8SA 2IIBA 2D00A 5IF9A 3KHKA 3E2MA 1EQAA 3UJ6A 2JFPA 3L06A 4P3OA 1VJCA 2X2PA 4KXQA 4FEEA 5F21A 3OIGA 3PPVA 4JQYA 5IANA 3KVRA 3U44B 1GPMA 2OGUA 4XI0A 1VI2A 3X3HA 4NEQA 5MFPA 3ZIMA 1XU9A 3O38A 4IZIA 3ZX5A 3NQPA 4CIYA 4AY4A 4MKRA 2NXPA 4DX1A 3P9IA 1V43A 3PC8C 4MAMA 4C7OB 1HLPA 2YHBA 5HRAA 4W5QA 2Z1DA 4CDNA 2HTEA 3E7PA 3OQOA 5G1NA 3U44A 3RSGA 4LNAA 4UASA 4X1OA 1G6KA 1R6DA 2PMWB 3F7NA 3EIXA 2G07A 2Y1FA 3WLOA 2H4ZA 3E9CA 4O29A 1ZGHA 4EBBA 1QQTA 1K89A 4DN6A 1NLYA 2IHNA 2QU7A 1H4QA 1P4JA 3G88A 4C7OA 3LF1A 4UAVA 1E7RA 3UM2A 1UJCA 4F45A 5KQPA 3DKPA 5CAEB 2WD9A 4XB1A 1JQLB 4I9NA 5EZQA 2VIIA 1IY1A 1CYEA 1JA0A 4H7DA 4G0YA 3R5XA 1I8TA 1HK7A 2PUJA 1K9VF 1CLUA 1DDOA 1GNRA 2IV7A 5G3ZA 5GJBA 3RIXA 1FLDA 1OI4A 1WDYA 1TMYA 3K6SB 1FRNA 2LXMA 5DVZA 4IIGA 5CAEA 3UMSA 1ULAA 4RK5A 2ZPTX 1Z7YA 1GL3A 2JJYA 3ANTA 4GDFA 2ID7A 4FN5A 2PUFA 2ZU6B 4MW4A 4KVMA 3NDJA 2IEGA 1P4HA 4F7WA 1AS3A 2C58A 3B6JA 4UXIA 4F4CA 4U7PB 3WSTA 4KO3S 4WOKA 1ODLA 3BE5A 2JFGA 3CMCO 1IK6A 2OHVA 2NM0A 5A2GA 4XKJA 2O5CA 3ICWA 1EFRA 2VHVA 2DTXA 4G8DA 5HP4A 5EWLB 4C43A 2ZU6A 5KJLA 2G25A 1N34B 1ZIPA 2VG8A 5JSKA 1N3BA 4MRSA 3FH0A 4F8JA 1M6YA 1JDUA 3P45A 4LDAA 1FC0A 3G5AA 1ELRA 2ANCA 2K5UA 2WXLA 4CU5A 1IPEA 1XPOA 3IKLA 1WD7A 3V1NA 1FLVA 5EWLA 3IEXA 1NL4A 1TA4A 4MB0A 3JPWA 2LR0A 2H2AA 1C29B 2O23A 5CHYA 5KVCA 1F8FA 5IFKA 1ST3A 3EQ2A 1FT2A 3ZHUA 2O4CA 1ZR2A 5A05A 1N33B 4M1YA 3P2KA 1914A 5AI6A 3M34A 2VT6A 1QQ7A 4KDFA 2PT9A 4YAEA 1OSNA 3S7ZA 3G9TA 3TCNA 4XA8A 3CURA 2OYCA 5JTTA 5AVTA 1YR8A 2AJBA 4EKIA 3PX3A 2XCSB 3CNHA 4UULA 3U4TA 1VC2A 4UARA 4HOYA 5AUPB 1G21E 2AFHE 2P8JA 4M1ZA 4HBGA 5KYWB 1KFKB 1L7AA 4HY3A 3U81A 2EJBA 5F3WB 1S2NA 1XWIA 4YECA 1SOWA 2O0LA 4OH1A 4YBZA 2COEA 4LZLA 3TE6A 4YP5A 1P7PA 4PGMA 3JSXA 2PV7A 2REXB 4HADA 1QGYA 5K03A 4GLLA 3QFSA 3KVNA 3CVOA 3HXDA 2C4WA 2HWKA 1P18A 5AUQA 5C5DA 1J8FA 5KYWA 1VHWA 4BP1A 1IAVA 4K9DA 2P65A 3PQCA 5AHRA 4RK7A 5G0SA 3PQ2A 4ZYWA 2GK4A 2EFGA 5K0CA 4POAA 1J90A 3EQZA 1JKJB 4R01A 2CJPA 1U0TA 3GWZA 3TSCA 4RX1A 1DIRA 1CJCA 3UT0A 2YS6A 3DTVD 3LFHA 3AS8A 7ABPA 5JARA 4UEQA 2Y4TA 3VHXB 3QXGA 4FNGA 5ECWA 2FQYA 1XZEA 1SXIA 3EDQA 4OP1A 4L1BA 3M3HA 1JKJA 4MQ6A 1EVYA 2WY2D 3IQFA 3ZJTA 1DTSA 3W2TA 4DA6A 1CEXA 2LO6A 3D8SA 3VHXA 1A9OA 4U96D 5BMVB 3M83A 2FPPB 4O25A 5K0JA 3ASOE 3OJ0A 5CDGA 3D7NA 1U6JA 1IXYA 5KI6A 5IC5A 5EYPF 3ZY5A 2C5GA 4HX5A 4ZOAA 4EA6A 4XYLA 1NZNA 4N03A 1CNMA 3MNFA 2E87A 2OAEA 5BNIA 5TC4A 3IHLA 5AW4A 2B6NA 3FCYA 1ZVJA 3B5JA 1KJ8A 5BMVA 2FPPA 2BMEA 1VKNA 4CYMA 3CB2A 1DUVG 4HXIA 3HWWA 4E5UA 4HVAA 3FBWA 2X8AA 3QTLA 4JU9A 1E79A 3B9RA 3MUEA 3SWWA 4L07A 1IM5A 1KNXA 4OL0A 3SGHA 2IA5A 2NSHA 4FTWA 5IZCC 2P5YA 4G07A 3K1YA 4LOHA 4NU5A 5JYBA 1HEIA 3A2LA 2A84A 4FLFA 2GSDA 4YK7A 1J97A 4WKBA 1YJ8A 4BKPA 4MGHA 3BQOA 3AR6A 5IP5A 3MJVA 3BGOS 5JNWA 3LOPA 1YZGA 4LZWA 1DBPA 4M99A 5M34A 1BOFA 1UKAA 1VGRA 3AOGA 2VNIA 5KOHB 3PHIA 4WUYA 1YU6A 4D9HA 3DVLA 5INTA 2CVHA 2P1ZA 5GONB 1T2CA 1PHRA 4OXIA 4BEPA 2C4MA 4F06A 1PWEA 3QK7A 1ZMBA 1R8XA 5FOUA 5JD5A 1OZHA 1JNXX 2BKUA 3IAHA 5F98A 4BMSA 1IN5A 1JH8A 4P29A 2CFIA 5L3SB 4WKNA 1YH3A 2R8ZA 2PUGA 5GZ1A 5KOHA 2FWMX 4L9WA 4QU5A 5CK5A 1DRWA 3TLCA 4Q9KA 5HNKA 5GONA 4A8HA 3JXJA 2ZITA 5IULC 4KBQA 3VO2A 5EDSA 4DMGA 2IWHA 1USWA 2YVUA 2P9HA 1HYHA 3WLMA 1H2VC 2A7XA 4PSUA 4BQFA 3EPJA 4EFLA 5L3SA 3GGGA 2C9CA 5DP1A 4N7JA 1XCOA 1CIVA 1HPLA 2RFMA 1H1LB 1EXWA 2WYWA 4B09A 2O0JA 3ZLTA 4CG0A 2R44A 3UJPA 4DPRA 4AKGA 1SN7A 1QCCA 2PN1A 4Q5IA 4Z1OA 4CMJA 3AIOA 4TKMA 4BHTA 2OV4A 3NORA 3LLUA 1P44A 1ILWA 4JSTA 3ZKJA 3RU2A 1JDPA 3JQFC 4KPEC 2OXFA 3T4PA 3UMCA 1Q0LA 4JITA 3P9QA 4JL5A 1PBNA 4CTKA 5F5XA 1YE5A 3LX8A 2P2DA 4NHOA 1SRRA 3FZEA 2OLEA 2G5CA 3RYHA 3FWKA 3D6MA 3DEAA 2VYQA 4G24A 3H18A 3MPUA 1PZNA 4NAVA 3KLNA 2VJAA 1V1JA 1JKMA 4OPMA 1JAZA 4KU4A 4DJAA 4RTQA 5JS7A 2WWHA 1PP4A 2PL3A 1JG6A 2EGHA 2I2AA 3EAGA 5LMUB 4G4GA 2FULA 2GO1A 3BA6A 4JVLA 3NRJA 2Q28A 2OVFA 1C4KA 3WBFA 5CDTA 1DT3A 2J0QA 2H2FA 1X39A 4XM2A 3RIGA 2NZXA 4MPTA 5L4LA 4P5EA 4ZYUA 1OXTA 4LYAA 3MPOA 3VOAA 1VKJA 4OHBA 2HGZA 4ZZ2A 1CETA 3MAJA 2W2PA 2ZJ3A 3AXSA 3MINB 1UKVY 2FZKA 3SBTB 4LJLA 3IP1A 1Z75A 4EW2A 3I37X 4QUEA 3PLAE 2XMRA 1ONNA 2VSFA 1V41E 1LV8A 3S2ZA 5BR4A 4OJMX 1TGVA 3IIJA 3ZZ0A 5GY7A 3NWOA 3WYDA 1JEYB 2J08A 3MMZA 2UKDA 3EJNA 3QE4A 1ZC4A 4RPCA 3D4OA 2HA2A 1U8UA 3LGAA 5C8DA 3MINA 4PNZA 5BVGB 1ZL2A 1EVKA 4JI2B 5J1SB 5EJ6A 5EKDA 1P0PA 3WWYA 4LHYA 4DARA 2PHZA 2RGCA 5BORA 4XGRA 1NAIA 1RJEA 4GD3Q 5KTYA 1JN0A 1JEYA 4FZ5A 4HMQA 2W98A 1DKQA 5HJ2A 3CVLA 4BNFA 2JH9A 3A3KA 4GNRA 3RREA 4Q15A 5BVGA 3IGFA 4BTVA 2WJPA 2Q6OA 4D9CA 5LL6P 3LUCA 4CFYA 1Z33A 4V0RA 1R18A 4LRWA 2PNFA 4QU0A 3MLAA 2NU7B 4HB5A 3JYNA 4KLNA 3U26A 2W0MA 3CIOA 3EIFA 5TT1A 2BRUC 4KUHA 4F5WA 4GEGA 2GN9A 4TKZA 4JEUA 2P3SA 4XI9A 3KOOA 2I8CA 2CHVA 3PGXA 1QYMA 4UD6A 4GRAA 3ROZA 1KYXA 2FUKA 4AKIA 4NMLA 5KHAA 2AYYA 2EIHA 2JGKA 2NU7A 4MIOA 3K0CC 3GOHA 1XRLA 3T9CA 1T1RA 3BA1A 4FGKA 4GF5A 4KR0A 4ZOLB 3ET5A 3MLBA 1UINA 3R6GA 3W2GA 1XDUA 4WKOA 4M89A 5JMTA 4ZV7A 1ADBA 3L1HA 5E8RA 3WX0A 3S2UA 3J80A 1TA9A 1E92A 3W2IA 1COWA 3G1TA 4ZOLA 4M53A 1RLTA 1KMCA 2B94A 4BPRA 4P0QB 3LGSA 3AEKA 4KLZA 1CFJA 1TJ3A 4MARA 3E3OA 5H7XA 3TM5A 5J1TB 1FUKA 2A3NA 2XMDA 4YDHB 4UFOA 1H6CA 5LU9A 3GD5A 5BYKA 3TTTA 1X1QA 1T15A 4GG1A 2A5DA 4ZANA 4Q1FA 3FMOB 1Z4LA 2VEOA 2ZANA 1QWSA 3NVAA 2KCLA 2BFPA 1HYGA 3DE2X 2ODWA 1F1JA 3D9NA 1D8AA 4BNVA 4KR2A 1A5ZA 1GG8A 2WWXA 1KSHA 4MRPA 4KSYA 1Y6RA 2Z30A 2LNIA 1G5TA 1YHYA 3DEKA 5E4TA 3O26A 4EECA 1MB0A 1D2GA 1HH4A 3PGVA 3W9GA 5JJIA 3CVPA 2PJUA 3RASA 2AN3A 3TL5A 3LCMA 2Q8QA 2YWDA 4PSCA 3I76A 3ZIAA 4QE3A 1YRBA 4UCQA 4LZZA 4WASA 3PI7A 2NSDA 2EHDA 4TWZA 4HOQA 3V4LA 2ZYUX 3OZWA 3WA6A 3T4EA 2A0KA 4B7CA 1ZP6A 1YGYA 3GFGA 1WP9A 4QO7A 3HSYA 4Z4HA 2FPXA 4TXJA 2ZRLA 3Q49B 2RHRA 4AY3A 4KVGA 5C9ZA 3LIPA 4JMPA 3RS3A 1NP6A 2A1IA 1E7VA 1P8JA 2H1FA 1DJPA 1HYBA 2Y1WA 4MPDA 3HZOA 4CG1A 1NR5A 2G9UA 4ZPJA 3ZCSA 1SO8A 3HFSA 1J5XA 3ICEA 4A1FA 1FFXB 2ZCJA 3IQXA 4V1CA 1OX6A 4M7OA 2ZBEA 1ISFA 4PAQA 3SX4A 1EQ2A 2GBFA 4YXWA 2EINE 1YOVB 3KU1A 1JGTA 3WIUA 1DWPA 4Y6GB 5JNLA 4XQGA 2I1KA 3BL6A 3RTBA 1R0YA 2Z3WA 4AJKA 3PF9A 3CVVA 1SOAA 1FFXA 2V58A 3NKLA 1QRAA 5M29A 3MZ0A 5A7FA 1HZZC 1E1DA 3SAJA 1YMQA 1JKXA 3DMYA 3Q6IA 1YOVA 1BU9A 3CZAA 4XDHA 5JMPA 4Q00A 5CM9C 2YQZA 1SVIA 3MEKA 3VPGA 3LLSA 3WP1B 2AB0A 2X4IA 2CW5A 1DCEA 3FUWA 3H2GA 1OBOA 4ZD6A 5CDFA 3PZBA 1XHEA 2ZJ0A 3PVCA 4HNRA 3R7FA 2VI5A 3P9NA 3ZJYA 1MLDA 3MVEA 1B73A 4IZHA 4P7BA 5CFMA 4YPOA 4PZAA 1Q74A 4QIHA 4XIIA 2AJTA 4EI9A 4P5DA 3WYCA 1FNBA 1O97C 5T3YA 1J8DA 1M6VB 3NB0A 3PEYA 3JQCA 2Z09A 1ECFA 4JI4B 4BVJA 2VJLA 3DOUA 5E0OA 2OBYA 5LLSA 3EC7A 1ZVKA 5TQ0B 1O4VA 2VPZA 1T2AA 2ZSBA 1RWMA 2I6SA 3G2SA 2IHZA 1NUHA 2R6GA 3DBRB 221PA 5JATA 5CJPA 4GE3A 3U3OA 1M6VA 4INAA 1YFJA 3K0EA 1XTUA 3TOZA 5LP1A 4IHQA 4NU0A 3GLFE 3MG9A 1WHSB 5IJ0B 3B5IA 5TQ0A 3N39C 4RH1A 2QUJA 5CNMA 1YGPA 4FT2A 1W9HA 3P9KA 1NLFA 5DMHA 2CKDA 3DBRA 5JPIA 3VOSA 2GETA 4G5SA 2DPGA 3A4MA 4NE7A 3ITDA 4AJHA 3QMVA 2GMWA 5LX8A 3BF7A 3HU3A 4UDYX 1BXRB 4OEHA 3FB4A 3G0CA 2OAP1 3R1IA 2NUBA 3ZI7A 1TE2A 1EX1A 3SQOA 5IJ0A 1WHSA 3WR5A 4WDRA 4MQFB 3AEUB 4ED9A 4GHWA 2QXUA 4H7IA 4JR2A 3I5AA 3STXA 3JALB 3RRNB 2PX8A 2DHDA 4YMVA 4ZI5A 2VHJA 1JUQA 3NIBA 4P7JA 4JGBA 4OHZA 1D2EA 1T0HB 1BXRA 1ESZA 1YASA 1C14A 1RBQA 2XZDG 1PWHA 4WRRA 1GNQA 3E81A 3I2HA 3NP9A 4OSEA 4K2AA 1C9MA 4MQFA 4CT4A 3AEUA 3UF0A 2RGXA 3SQVA 3P0EA 2D7JA 4F97A 1ZD4A 3PX2A 3JALA 3RRNA 1QBGA 5A3VA 2P3OA 4LX8A 1L4EA 1CQWA 1LTKA 2CGEA 1JPUA 1ZAYA 2YWHA 2VP3A 5GPBA 3OJXA 3IUNA 3WKCA 4RKEA 3L07A 4D9EA 2WJZB 4TTSA 2XD4A 1K63A 1QMGA 2OO5C 1ZAKA 1MA3A 1FDRA 3TOCA 5K5EA 4RE6A 5HJ5A 2IF2A 5JD4A 3CWZA 4RFVA 4LSZE 1I3OA 3ISMC 5KJ1A 4CEHB 1TEXA 1V1MB 4RDIA 4B33A 4DYHA 1ZEJA 4M0EA 4TTQA 4WWOA 1NLUA 1IWPB 4Q7MB 1MIHA 2Q4OA 1Q2XA 2VQDA 3NUQA 5LZ4A 5A06A 1FMJA 5H7PA 4JBGA 4CEHA 1OWNA 5D6OA 3PWTA 1GGVA 2WXHA 2B5WA 3GVXA 2DFTA 1EFTA 1H0HA 4AICA 3CLTC 5A7DB 3A1DA 3PXBA 5AFSA 4YV2A 3FFLA 1KAMA 3JD2A 2J3KA 2F1KA 1NPDA 3D3EA 5HTOA 1RAEA 4U3JB 3QKIA 2AVPA 1C0IA 1PGPA 2DY0A 2DJ5A 3UV6A 3IKMB 3KKPA 3WGJA 2OQ2A 3C3RA 3OPXA 3FMGA 2EWMA 4IXWA 3NUZA 4PZYA 2HFJA 4AV7A 1KY4A 3NJRA 5KSZA 5ALEA 2QQEA 2XCLA 3OM1A 4BNUA 1OB2A 3BRQA 3JXEA 1KZOA 2FJAB 1MTOA 4QHYA 3VZSA 1C8KA 5CEFA 3TKYA 3TLZA 1T0PA 1OA0A 1FIUA 3QP9A 1V8DA 3ZS8A 3DTNA 3S44A 3O4RA 4GTRA 3WTCA 3APDA 1ZD8A 5ENOD 5BRAA 2WZBA 2AW3A 3D9KA 2HQRA 5AMXA 4HH3C 1CWUA 3QWVA 5KINB 3LP6A 1E2FA 3UYLA 1PJTA 5J63A 3KD7A 3G2JA 1V8BA 1Y7LA 1UC8A 3DKRA 3OX1A 3H9UA 4X62B 5LDDC 4TV9B 3K09A 2ZAMA 4YMGA 4K28A 4OIFA 3FUJA 1S3IA 2NO5A 4WD3A 3RLIA 1ONSA 3PJGA 4EUNA 1W0KA 2GD1O 4TRRA 2DQKA 2R9VA 3C24A 3U7JA 2KJQA 3NOVA 1OY3D 4TV9A 4WNEA 2O3TA 1UBSB 2IZ0A 4K5QA 2B35A 3CEMA 4M1EA 2GPNA 3V2UA 3E61A 1RE1A 4OX9Y 1K68A 4ZVUA 4NJMB 5AAOA 1WQ1R 2A6PA 4IQFA 4E15A 3CN7A 1LK0A 1V16B 1UBFA 4DQXA 1SWVA 4YLYA 3EWIA 1P74A 1UJMA 5DBIA 2RKWA 2QN6A 3VISA 1UDBA 4TYQA 5EE9A 4OXRA 3ZXSA 3GIWA 3GU3A 2A5FA 2H2HA 1L7DA 1ZK2A 3EEOA 3IPAA 4NJMA 1LBIA 1XNRB 2ZZKA 5JCJA 5KNCH 1V16A 4IKPA 5FA5A 4FYMA 3LDZA 1U81A 2SECE 3C14C 1PJCA 5HIJA 3DSWA 3CHQA 2DVWA 3BU8A 1XEWY 2O4UX 4GRIA 2EJVA 3QUCA 1TJNA 5A0FA 4OLFA 2C29D 4OQXA 3LYUA 2ZRFA 3UHJA 5KWDA 2ZSDA 4WL0A 3CM0A 1G9TA 1T5IA 3D2BA 2MU1A 4HGZA 3E7DA 2FPUA 3F5SA 4K6FA 1RKXA 2ID4A 3I2KA 3FBTA 1ECPA 3RAPR 1WV0A 3C6ZA 4CLHA 1U1IA 4NZMA 3MYRA 3GG2A 1SHKA 3ZLBA 2PJDA 1OXBB 4XWAA 1GRRA 4WOPA 4D4KA 3KR2A 3O3MB 2V4MA 2BKAA 3DFZA 4QYIB 3EJ6A 2ATCA 2W9XA 1ZMTA 1Z0KA 2EBUA 5HRUA 3OCCA 5JCOC 4DLRA 4HNTA 1NXXA 1VIDA 1NRIA 5G2NA 4KXLA 4DRYA 1W1WA 2B37A 3RRFA 3VO1A 3ZRHA 2YUIA 4WW0A 2FWRA 3CB4A 5I7FA 5L8VA 4QYIA 2I4OA 3QX7A 1KJIA 3DKIA 5HE8A 2FFHA 4HRVA 4QDOA 1KJQA 3FDJA 3OF3A 1VE5A 4I46A 1VJDA 4X71A 1MH1A 4PCAA 1Q7RA 3JQ6A 3IBFA 4PHGA 3G2QA 1PYGA 5KJKA 3D8NA 3T9EA 5HFNA 3MERA 4YO8A 1DPFA 3F5DA 3ANMA 5DBHX 1TN7A 2O2SA 2GZ1A 3RF7A 1OBFO 1EE2A 1VA4A 5IMSA 3NM4A 2O07A 2J87A 3MGAA 1DIAA 4QUIA 2FW0A 1Q44A 3N71A 3JQAD 3MB8A 3GAMA 4AB1A 3HR8A 1JHAA 1N5OX 1DRKA 3EPPA 1UBEA 1TZBA 2I2XB 4IXMA 2QVYX 2WYVA 4ZK6A 3AC0A 1NOIA 3HUDA 5LMCA 3PBKA 5ARFA 1X14A 1BDHA 4PXAA 3DZDA 1L5YA 5CCBA 3ZNNA 1AUVA 1P4SA 2V4UA 4JT9A 3UO8B 3QEAZ 1PJ3A 1EUZA 1GPAA 4EYKA 1LZKA 2FAXA 2HM7A 1L5SA 4I2NA 3PU6A 5HKOA 4A1SA 4KG7A 1RP1A 1LZLA 1EK6A 3OAAA 3MILA 4DPMA 1W29A 4OQLA 1PGJA 4RPHA 1DPGA 1Y1LA 1UFRA 5JROA 5K6TA 3I0ZA 2QL9A 1ZK3A 4Y2XA 3QI2A 4FEGA 1CQIB 1H3NA 3FDZB 3UB2A 1NM5C 3HMKA 2ZB2A 3T8YA 4ZVOA 4ANXA 3HB4X 3ZHTA 3AHEA 1F51E 2GN6A 2M9MA 4Q9AA 2Z5VA 4YDQA 4WCFC 4ISBA 2FOIA 3NXKA 1U2DA 1M1YB 1LWOA 4NNOA 3EK2A 1GSIA 3GB9A 3DDZX 1EFPB 2P91A 1T9AA 3WOHA 2BM9A 4QHTA 1CQIA 1CUHA 3FDZA 1QORA 3DHEA 4YCMA 3EQ8A 4RY8A 1OCOE 4CMIB 2GKOA 2GRQB 2OK8A 2AJDA 1ZVMA 2WP8J 3G13A 3R75A 5LYJB 4P7GA 4PCVA 1M1YA 3W9BA 4U9UA 2D7CA 1Z2AA 5FRDA 4XLLA 4GZCA 1EFPA 5AK6A 4CLOB 2XEVA 3C6MA 4MLPA 4G0XA 1DIGA 3HV2A 2GXUA 3BT3A 4CMIA 1JHRA 1JR3A 1KEKA 1QP8A 5CH8A 3H9EO 1BX3A 3AERB 1RRKA 1W19A 3T7DA 5LYJA 4P2BA 4BX9A 3GRUA 4JI0B 1YBFA 2NZ8A 3TSZA 4B7UA 4CLOA 3O84A 3L3BA 1NRWA 5IT9A 1QYIA 3F8TA 3EDTB 2WD7B 3IAUA 5BSMA 5CNIA 1TIKA 4J75A 2HSGA 3G2HA 2EIME 4RMIA 4Q3DA 4GTTA 2YTZA 4S1OA 5LMNB 1T2DA 3AERA 4OK5A 2WZDA 3RVJA 4C7BA 2FGKA 4PX2A 1DAGA 2Y05A 3RVNA 2FEKA 5K6RA 5I9BA 3AG1E 3G79A 4EZIA 4AMBA 2Z5FA 1RHJA 1M2FA 3T3EA 3TLXA 2YNMA 1GZ7A 1DXQA 4DCUA 1IZ7A 1J0DA 2WD7A 5G0VA 4KWIA 1NJFA 3JUIA 3V4PB 4AY2A 1WV1A 2CV1A 4AG3A 4QJ4A 3UJ8A 3TQSA 4X91A 5EC8A 1G2PA 1M67A 1NVAA 2MHKA 3L0DA 2QSZA 1R16A 3DL2A 1T1SA 4NAUA 1DX6A 3OZBA 1C0LA 3OP1A 4E09A 3AUJB 3VBCA 1BD3A 2B0CA 4DCPA 2HDHA 4YRGA 3I58A 4I19A 5CFZA 1C80A 4KI0A 4GWLA 1KBQA 4D43A 1FNMA 3WOVA 3F6BX 4XUGB 4HLLA 2ZJAA 2QGFA 1RXUA 1UDRA 2YJ5A 4HDRB 4RD1A 5BSVA 3KB2A 5DXFA 2JJMA 3G0IA 1PY1A 1SC6A 2PZBA 4J0CA 3C3YA 2BHRA 1WQ3A 3VKUA 3QPBA 4IUDS 2XYGA 2R66A 3WLLA 2JIZA 3DLHA 5FIUA 3RC1A 2N3ZA 2GTHA 2F64A 1ZLXA 3JRXA 1XMPA 1KZ9A 4HDRA 2O14A 2WTEA 3ILSA 1E9DA 1N0IA 4YRLA 5CLFA 5B37A 3LRPA 3RD5A 2R62A 4PFKA 1KJNA 3UW3A 3SC3A 5EILA 2PBZA 3G2OA 3PRKE 4J3FA 3QPDA 4NOLA 3TGOA 3O8RA 3UMYA 2OHOA 3U7QA 3UB4A 1PSZA 5ALSA 3FVQA 4QSHA 2PPVA 4G8LA 2QD2A 2PQMA 1XDSA 1GYQA 2C2WA 1INLA 2NV2B 1YDWA 1BWSA 3C3KA 2ICAA 4JENA 1N5KA 1GCOA 5J2UF 5EXEA 5FLXA 1JHQA 1V7ZA 1VA5A 1FNCA 5AVXA 1A0OA 1CSEE 4KUEA 4YDSA 4U04A 4TTIA 1CUUA 5HGXA 1WULS 1BWPA 3IERA 4YQEA 1U94A 5I8ZA 4H16A 3RANA 1OCZE 3CH7A 4XCQA 3HJRA 3G2LA 1HRKA 5T4EA 1QVAA 1CUAA 1WVMA 1F9AA 4S1VA 4NU6A 2VYIA 4CM3A 2QT0A 3I4CA 3QVTA 3BWBA 3T3PB 1M2WA 3BWMA 1TJPB 3SHWA 3QE2A 1Q0QA 2VOJA 2BKEA 5B1IA 1Y3DE 4ZYVA 1TGYA 4HK4A 2OB2A 2A0WA 4EY7A 1KMNA 3FUEA 3IBGA 3D9IA 1XQVA 4MW2A 1DB3A 3USCS 5LJIA 3D7MA 1OPXA 5IVDA 4TXRA 3GLUA 4KQGA 1TEVA 2NU8B 2UZ1B 2AI2A 4J0UA 1E8XA 1T9HA 3TPFA 2IOQA 4U00A 4JUBA 1LBQA 1R27A 4PG7A 3RHFA 4Q94A 1LVUA 5D00A 4FHJA 3PFGA 3KG2A 3UPVA 3CTPA 3H7AA 1TF5A 1ZITA 3HBAA 4Z68A 3PC3A 3VV2A 5F7OA 2O8NA 3GRKA 3GVPA 1GZUA 2J45A 2ZBGA 2XQGA 3K8OE 2NU8A 2D2FA 2UZ1A 2WKQA 1GN8A 4A6PA 3K9GA 5KU1A 4L6CA 5T8KC 4YONB 3K30A 4G2VA 4AT1A 4I4NA 4B2PA 2WXGA 3NTRA 5T4YA 3HP4A 1VL1A 2DQZA 2H31A 5J4VA 4UU1A 3ZOKA 1RZRD 2GBPA 2WJGA 3B1YA 3IDZA 1XTIA 3QJZA 4HLCA 3KT6A 4HG2A 4ATZD 2I8LA 4WK2B 2NVBA 4W99A 1EDBA 3OO1A 2W2TA 6CHYA 1OX4B 4LDQA 3TRJA 4XRGA 4MROA 5DPMA 4S2UA 3BAZA 2AEJA 1GAXA 3CQ9A 1UOQA 4AROA 2Q1SA 5T4BA 3N53A 4MXDA 3Q15A 4O4LF 2OHIA 3WLNA 2PU7A 4AKHA 1NF2A 3T1QA 3UJ3X 2GYYA 4DTCA 3UPUA 4PYQA 3RHSA 4NX2A 1ONOA 3N8KA 3JQGB 4FYHA 3PIRA 4C87A 3EA5A 4U02A 1YZHA 1OX4A 5IUNC 1UANA 4NE2A 4QC2A 4PNEA 2PMBA 5JNTA 5DTQA 4HP8A 3PCRB 1NIJA 2Q5JA 2B1IA 3K8YA 5DASA 3JQGA 3W34A 4IWXA 3TGWA 4C03A 3LUFA 1ZOPA 4RZXA 2LIVA 2PD4A 4YCBA 1BG6A 4BFCA 3CE9A 2Q2WA 3KOZA 2JEOA 1HG0A 2V6MA 5FV4A 3N2EA 5GVRA 5LNK1 8ADHA 1RC1A 4ZAZA 2HRRA 2GVDC 1IFXA 3JTMA 2B2XA 3KXIA 4ZC1A 2WJYA 3MCWA 2WR8A 4N48A 1XZGA 4EG3A 5MN5A 4X44A 5JXWA 4QFCA 3IPRA 3UW1A 1RYYA 4FIZA 1UBCA 1FRVA 3PFFA 3GT0A 5FZSA 2BUCA 2WP0A 4E85A 2J6HA 2RSLA 3GROA 3IBYA 3COVA 2DFDA 4RH0A 1A97A 3UWMA 3V4SA 5FAKA 1UFKA 4LE1A 4KO1S 1DNPA 1MJGA 2OC4A 3DVSX 1XPRA 3WGUA 1M72A 4PZPA 4PFSA 2IU3A 3COWA 1WS6A 1N4RA 5KNBD 5ARCA 2R79A 1OB5A 2GZRA 1WXWA 3WWOA 4DCGA 3I9FA 4MYUA 2JLZA 2CJXA 5JY1A 1JWAB 3JQ8B 4QG3A 3V7NA 3FH8A 2VHZA 2F8XK 3K6SA 4C0EA 1AQLA 5CYPA 5AW8A 4ZQIA 4A0SA 3ABME 3EHQA 4QOJA 1E6UA 1ISGA 3ZHXA 2CC2A 3R7SA 3EISA 1G20E 2AT1A 3CW2A 1AVTA 4MVJF 2QC9A 3DLAA 4HXGA 4ARSA 4HEHA 1T1GA 4XIGS 2ZI7A 3R3JA 4FJ2A 4NSNA 1P1IA 2V3VA 3B7PA 3QEBZ 4O4IB 2OAQ1 3WC4A 3GFFA 2J0UB 4AMGA 1E59A 1QSGA 1BVUA 4GMLA 3TR5A 4XIFA 2IEYA 1TIPA 4BGUA 4UTNA 1N1EA 2Q8PA 3F6SA 1WA5A 3QBTA 3ZYMA 2XB6A 1RRFA 4N0DA 3VJLA 3F7MA 3WBJA 2GXQA 3BQ9A 3RI3A 4C0AC 3CR8A 4R7LA 2VRNA 4O4IA 1H5UA 1KVRA 5FA6A 4LHXA 3GDHA 2QY7A 2DPMA 2RFLA 2ZBDA 1ECBA 2HA4A 4GNKA 4K9PA 3LPCA 4DEYA 2E85A 1N5JA 1XZAA 3SHVA 4HAIA 3D9PA 5HKAA 1GD1O 2ACEA 3HBFA 1MAHA 4MJXA 1GHTA 1B14A 3DTYA 2QUZA 2XVAA 3WNCA 4MP6A 4ND8B 4B7AA 2J3IA 1ABBA 3LQ1A 3A10A 2LRHA 1FYVA 3D1VA 3IO3A 2EQ5A 3SXUB 2FDRA 4BBJA 3RS2A 1KAOA 3FZGA 4PAMA 3HWX1 1XNFA 1DQNA 2JANA 2FZLA 4PRLA 4MUBA 4CL3A 3UV7A 3N05A 1NC3A 5F5NA 4TLLB 5F2OA 4R1NA 2YN4A 1YI1A 1QGDA 1HE2A 2O8VA 3A6JA 4EBAG 1V8PA 5FUVA 1N2XA 1PDWA 1PWXA 1YDFA 3IBTA 3H3FA 1AKWA 3SXUA 1N6RA 2JH3A 1OA1A 4QQIA 4D10C 2CXRA 1KERA 3A4IA 4IF4A 4HVCA 2I03A 3PDJA 2W37A 1T4CB 4PICA 2OCYC 1IB6A 2XENA 3MWJA 2J9XB 1K75A 4QQNA 3AEXA 4ER0A 2BGUA 5IDWA 4XAQA 5IPFA 3CLUD 5LZ8A 3PNOA 4IQ4A 2HK7A 5KX5F 1QYXA 1KSGA 2XEEA 4FFBB 2QXYA 3TBKA 4B6QA 3WL7A 3PUVA 3W5SA 3BTVA 4AJ1A 3GGPA 4PSDA 1NF8A 3CKBA 5LCWC 1OBCA 4LC0A 4EI2A 4NBUA 4FGZA 2H63A 2QM8A 1RYHA 1BFUA 4WLEA 4F86A 1SD2A 4MIKA 3O83A 3H2KA 4JWTA 2UXDB 4Q9DA 3MA0A 5HXAA 5JAMA 1EU1A 1U8YA 1X1TA 4U5QA 2QE6A 3OZTA 4FFBA 1PF7E 1F3OA 4CM7A 3UIEA 2FP3A 3RJ5A 1AZLA 3RUHA 4YRPA 4BWGA 1IHDA 4ZT2A 2FQ1A 3FPSA 4NICA 2IZZA 2PRIA 1R0BA 4GOND 3O9ZA 4BFYA 4L4YA 3VC1A 2QOEA 4YH1A 5IJAA 3EEQA 1MDBA 5K3DA 1EEXB 4M3NA 3VLFA 1JPNA 2CLDX 2V9PA 2VJKA 3DT6A 4M7PA 3Q5GA 1NSYA 4TM7A 4HH1A 3ZGZA 3CUSA 5DV9A 1NXVA 2XTAA 1SXJB 5CT5A 3LWDA 2WTUA 1QZ3A 4GUDA 1J4AA 1T2EA 2V3CC 3NGMA 4ZEMA 4MX8A 3V8BA 2XCUA 1K06A 4DR7B 4A6DA 2OD2A 4JHRA 3OOHA 2ZWMA 3SK0A 5C4IA 2ECOA 3MTJA 4ZVQA 2P6RA 5F9MA 1T29A 1H6OA 1UPXA 4AL4A 4HEA6 3I1JA 2DLDA 4JUIA 1GO2A 5JHAA 2W2KB 3FMIA 3QIVA 5JJTA 2XTMA 1RLMA