3PE4A

Structure of human o-glcnac transferase and its complex with a peptide substrate
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
714
structure length
695
Chain Sequence
THADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human O-GlcNAc transferase and its complex with a peptide substrate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 275
structure length 695
sequence length 714
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pe4A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pe4A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 3pe4A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3pe4A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pe4A03
1QKJA 4BWRA 3CX4A 3HBNA 4QLBA 3D0RA 4I1AA 3QHPA 2KCLA 3MTBA 1XKXA 1AHPA 2IUYA 3CVQA 2VQ2A 2ASVA 3MT9A 4H7YA 3N71A 5CCLA 4UI9K 5BW8C 3TAXA 1ELWA 3ZFWA 2LNIA 1JIVA 3IA7A 4CGWA 1V4VA 2I6HA 4AIFA 1JEJA 1F6DA 2OOEA 3MTAA 1NA3A 2ACWA 4LDPA 2R68A 4G2TA 4KQ2A 2QRPA 4KQ1A 1ZU2A 5DU2A 1ABBA 4KQMA 4GYWA 2J9QA 1WW3A 4J0UA 3ZPJA 1P29A 3VDMA 3RU0A 2X0EA 4WNGA 3DDSA 1AXRA 1NLMA 4MHSA 3IEGA 2VCEA 2XCBA 3CV0A 1NOJA 3C48A 2F3UA 2WPVA 4I17A 3TG4A 3UQ3A 2P58C 4APOA 2X0FA 1C8LA 3BEEA 2QLLA 4U0SA 2C0MA 1Z8DA 2GT1A 4YVQC 7GPBA 4HLNA 1SXQA 3RIBA 1P4JA 3OY7A 3ASFA 2C0LA 1UZUA 4JHRA 2HY7A 4WUYA 3SYMA 4RIEA 4GA0A 4GCNA 3ZCSA 4N3AA 4F3VA 2R5SA 4WHMA 3T5TA 2ACVA 3NP9A 3CUUA 3G2LA 5G05C 4N3BA 2PL2A 1FC0A 1Z6QA 4XIFA 2V5FA 3MBOA 1JG6A 3BD8A 3CEHA 2C9ZA 3L7CA 4KYOB 3LYAA 1NZDA 5KJLA 4UI9J 3CEMA 4YNDA 5HXAA 4CTMA 1FA9A 1YGPA 2PRJA 3DZCA 4HOUA 2FETA 2F3QA 2OFFA 3OXGA 3KD7A 1YA0A 2QN8A 2G9RA 3C4VA 5JJTA 3ZCRA 1L5VA 5FZQA 5G05J 2GPBA 4HOTA 2QN1A 3ZHEB 3WAGA 3E3OA 3CK8A 1L5QA 5D01A 1FS4A 1PC2A 5FZRA 3OKPA 1FU7A 2VG8A 5D0QD 4CTOA 5AYWD 2QZSA 5BNWA 3C4QA 4NC9A 1HXIA 2BISA 5JJ7A 1GPAA 2AV6A 5IKPA 1WM5A 5IKOA 1PN3A 4MHOA 3ZCVA 4UI9C 1GZ5A 2KCKA 4I2ZA 2FO7A 3TG5A 3S7FA 4G23A 4MICA 3CK9A 2AW3A 5ARFA 1KLXA 4RBNA 4YI3A 4IN3B 4RG9A 1NZNA 1RZVA 3VTYA 3VUFA 4J8EA 3FWVA 1FTWA 2QN9A 2YQ8A 4B94A 2O6LA 1Y6GA 3MS2A 3NPAA 4W9RA 4N2SA 1FTYA 3RJVA 3CKCA 4F96A 3PE4A 1Z6PA 2IF4A 3CKBA 5EKQD 1GPBA 2G9VA 4G25A 2QN7A 3GW4A 2XGMA 3MV3B 3HBFA 4M60A 4RIFA 1EXVA 4AM9A 2FF4A 3WADA 1P4GA 1FU4A 2G9QA 1VGVA 5FTPA 2QNBA 5TMBA 2VYIA 2AMVA 4XI0A 3GZ2A 4M7PA 2SKCA 3D0QA 3T3HA 3WXXA 3LPZA 2X6QA 5LCWJ 5G04C 1P2DA 4X7MA 4F9FA 3G2HA 3NF1A 2NC9A 3U4TA 4YI5A 3D1JA 2IYAA 3S29A 2FFRA 3GUHA 3AS4A 2Y4TA 3VTXA 2X0DA 2GJ4A 3QDNA 3ASGA 2VGYA 3ESKA 4N39A 3Q47B 3OTGA 1L5WA 4BT8A 3OTHA 3TOVA 2DBAA 4Y6CA 2IEIA 4GA2A 3BDAA 4GA1A 3HYMB 2UY1A 1F0KA 3CVNA 3PDNA 2QN3A 3SF4A 4JA9A 1NZFA 2GM9A 2XEVA 1E1YA 4AN4A 2HYZA 5HI7A 1KT1A 3MTDA 4HORA 3BD7A 1GPYA 1SXPA 1L7XA 3S27A 2G9UA 3MEKA 1NOIA 3ZGQA 5DIZA 4EQFA 2ATIA 3RO2A 1FCHA 1P2BA 5EX0A 3GYZA 2PZIA 1IYGA 4GZ5A 4GYOA 4BTAA 1C8KA 5C1DA 3L7AA 4RIIA 4H7XA 3L7BA 2FBNA 4FZRA 4YVOA 2BGUA 3CUVA 2ECPA 3CV3A 3E3LA 2IYFA 3LY7A 2AVPA 1XL0A 3S28A 3GZ1A 2IFUA 3MA5A 2C2LA 3CEQA 3BCSA 2Y4UA 1UQTA 2MHKA 4GZ3A 3IAAA 3Q3IA 2QRHA 2IV3A 3TSAA 5TMDA 4CTNA 5LCWC 5G04J 4PQGA 2C1ZA 1QM5A 3URZA 1P4HA 4WNEA 1YA6A 1B4DA 2XGSA 4UQYA 1L5SA 2L6JA 1WUYA 5CCMA 2VSNA 2R66A 2XCCA 1L6IA 3BEOA 5FT9A 3Q3HA 5ARGA 1C50A 3QWWA 4RIGA 3CVPA 1TJCA 3H4TA 3CK7A 4G26A 2GEKA 3AS8A 3Q49B 3NP7A 2H1HA 4RENA 4ABNA 2KS6A 2GPAA 2WQHA 5DXFA 2VGXA 4G1TA 4AY6A 3G2KA 3CEJA 1UQUA 4U07A 3S7BA 1JIXA 1EM6A 3Q5MA 3QOUA 3H4IA 2HR2A 3MV2B 1L5RA 4NRHB 3RKVA 3QKYA 3BCRA 2C1XA 3TGOA 2X6RA 4X7PA 3MQFA 3SYRA 1XNFA 3OY2A 3U3WA 2YJNA 3BD6A 2QRGA 3NAZA 3EDTB 4N2QA 1LWOA 3MRTA 4ME2A 2GW1A 2VCHA 2E2EA 1HLFA 2SKEA 1O6CA 4RIHA 4WADA 2R60A 2XCUA 3L79A 2PQRA 1H5UA 2WTXA 3ZHEA 4GZ6A 4UQXA 3Q3EA 5M72A 3G2NA 2XA1A 2XPIA 1NVKA 5EX3A 3UYLA 3KS2A 4N5CA 4G24A 3ZCTA 1NOKA 5JJ6A 2FEZA 1PSWA 2QFCA 1IHGA 1LWNA 2KC7A 5GPBA 3R9AB 2JZCA 4I9CA 5JTUA 5JTTA 3ASDA 4AMBA 2XA9A 2ZB2A 3L7DA 1GG8A 4JA7A 1IXYA 3ZCPA 3VUEA 4EKEA 2FI7A 2F9FA 1Y8ZA 3BCUA 4GCOA 4I9EA 2IV7A 4BQEA 1KTIA 4Y6WA 1C3JA 3K9IA 2LSVA 3FROA 2PQNA 5DBKA 5A6CA 4AY5A 3O48A 4WNFA 3ASHA 1GFZA 2F3PA 9GPBA 5A7DB 3RO3A 1NA0A 3CUYA 1W3BA 2C4MA 3HBJA 4HOSA 3QKWA 3LKUA 4HOQA 1Y6FA 1P2GA 3OXLA 2QRMA 4BQIA 4MI6A 2BUGA 4EJ2A 2UWJG 3ZCUA 4U0UA 3COPA 4KBQA 2F3SA 3MRXA 4LEIA 3LCAA 2P6PA 3Q4AB 5LQDA 3NCHA 2GPNA 4JL0A 4J8FA 3UUXA 3OXFA 3DD1A 3RT1A 5I45A 2UY1B 1QZ2A 4N3CA 3CUTA 4EL0A 5KJMA 3T3IA 4MI3A 1WAO1 3MSCA 2XGOA 1M5RA 2JLBA 3NC4A 3QWVA 4F97A 2PRIA 3L01A 4X7RA 2IW1A 1B89A 3WC4A 1J39A 3CUWA 3RSZA 2FF5A 5CHEE 5KJKA 4BFCA 4BQFA 5FJYA 3MS4A 4CGVA 2PQ6A 5HQ8A 4KXKB 3E3NA 3S7JA 8GPBA 4GPKA 3MRVA 3MS7A 4BT9A 2AZDA 3S0JA 4J8DA 3AS5A 3OKCA 5TMEA 1ELRA 2R4UA 1GGNA 1RZUA 2Q6VA 3EBOA 4EKYA 2XCIA 3FP3A 1JIUA 2Q7FA 2IEGA 2ONDA 4WACA 1K06A 5TVGA 4G2VA 1KT0A 3LY9A 3QWPA 1FTQA 3ZN3A 3OT5A 3MKRA 2VGXB 3EBPA 4UQZA 3T3GA 2GEJA 1XV5A 3OKAA 1WV1A 3SZ7A 4XI9A 4W6QA 1PNVA 4U0ZA 5D00A 4BTBA 1HZ4A 3NB0A 4LEUA 4U04A 2HO1A 2JJMA 2XMPA 4NQ0A 2LSUA 3MT7A 6GPBA 2SKDA 1Z62A 1WV0A 1RRVA 2VSYA 3VDNB 2QN2A 1QQEA 2PYIA 4NEQA 5KJNA 1IIRA 1XL1A 3Q15A 3S7DA 1P5QA 4FKZA 2H1FA 4A1SA 1E96B 5FZSA 1HH8A 3DDWA 2PYDA 3G2IA 1BX3A 5DLDA 1E4OA 2R4TA 4GYYA 1Y8MA 1XC7A 4GPBA 2QRQA 3FFLA 4Z5XA 2KATA 4I2WA 3ULQA 2BGTA 4O6FA 4L22A 3G2JA 4HWGA 3T3EA 3AMVA 4X6LA 3E4BA 3S2UA 3T3DA 3RSCA 1WUTA 3UPVA 2QLMA 4N9WA 3KAEA 1ZBPA 3OTIA 4MRAA 3LY8A 1OUVA 4EL5A 3HBMA 2KCVA 4M83A 3GPBA 1FU8A 1WW2A 3PE3A 4CDRA 1JG7A 1XOIA 4REMA 4RELA 3UYKA 2QLNA 3JYSA 5ENZA 1A17A 2YHCA 4RG6A 3CVLA 2BFWA 1A8IA 3ZCQA 4MI9A 3O3CA 3RHZA 1K08A 1PYGA 2XA2A 4AMGA 5D0OD 5BT1A 3T7DA 4WNDA 4YUAA 3MT8A 4NESA
chains in the Genus database with same CATH superfamily
1MRNA 1Q0LA 2TMDA 4UWHA 2BEUB 2I3DA 4Y98A 3SP1A 2JLXA 3B6MA 2F4NA 3WWDA 4AKTA 2VUHB 3AKEA 3RLIA 2FZEA 1SZJG 4QBIA 3L40A 4CN9A 1V41E 3CR3C 1EP2B 4UI9K 5BW8C 4FA6A 2FGKA 2ON6A 1NKTA 3TFWA 3PZ2A 3QITA 1JEJA 5IAOA 5SY6A 1AD2A 1YFZA 1ZVKA 2WSMA 3MB8A 4JAVC 4JB0A 4D3FA 3VX4A 3E34A 4D0SA 1X1EA 1XQVA 2R68A 4G2TA 1NIJA 4OHUA 4XDYA 1ZU2A 4EUHA 2A5DA 5J58A 4NJMB 3LO8A 3NW9A 5DT2A 2F1IA 5E9WA 1S2IA 1ACMA 4TMVA 2YL2A 2WQ6A 1TDJA 1DKOA 1R9NA 1T6ZA 3G13A 1DRUA 4IJMA 4JBXA 4YXWD 3H2KA 2O1XA 4MLZA 4OMCA 4DLNA 4WIAA 3PEWA 3ZWNA 4ZZIA 2OCKA 3D6HA 3TTUA 2ERCA 1DV1A 1PR9A 3L4BA 4MIEA 4C5BA 4J4TA 1U2DC 1JZQA 1VLZA 4TX1A 4ZVPA 5LQSA 5KU7A 1AUPA 1FYVA 5ADWA 1AO0A 1M2VB 1O6BA 1UKZA 2EQXA 3I6BA 3RUFA 3F9RA 2VDWA 1BJTA 4Q4CA 1KMIY 1Y4DE 2WYHA 5LJLA 3KAQA 5AKGA 1W34A 5CEDB 3WLPA 3G8BA 2FMKA 1UPXA 5AHOA 3GZSA 3HBAA 5CEJA 1EQAA 3P1JA 1W0KA 1XKQA 1PX2A 3H11B 3JSXA 7MDHA 1RC8A 4CCSA 1W52X 3BDIA 1P0MA 3Q88A 5KHLB 3RYHA 2YWBA 1H2YA 2PL3A 4DDWA 5BW6B 5JYBA 2J3IA 3G2UA 1LD7A 3W9SA 4BQQA 4CKXA 3KEFA 1TIPA 2GM3A 3HUFA 2HFJA 1V39A 1J97A 2IHUA 3EVFA 1OVMA 3DBRB 3AVXA 3L7OA 4QECA 4X54A 2LWIA 3NANA 2RH9B 1JA0A 2RHHA 4N3BA 2A5FA 5CGZA 1SQ6A 2XQGA 3HL4A 3JQBA 2Q6LA 3E7PA 1S8FA 1E59A 2YNMC 5J2TB 4CU5A 1IY0A 3SBOA 1T2VA 1Z4NA 2YNMA 3PGVA 4YONB 3O94A 4KLZA 3BTOA 1F0NA 1X77A 4P7FA 1JDBB 1YB5A 3VOTA 4BLPA 1WXEA 4XLLA 3HKCB 5CJPA 3UXHA 4IDQA 4J0CA 3LEWA 1ESMA 3FU0A 2IEBA 3CX8A 2VH2A 2IV2X 4JKYA 3N76A 2QX9A 1E7QA 2DFKB 1N1MA 1RLOA 1XHFA 3FWHA 4Q16A 4Y0VA 4HXIA 5E2BA 2BLNA 2BZ1A 3R6WA 1JV2B 3JAKB 1ODKA 4GR5A 4HDNA 4YMIA 2YYZA 3A8TA 5K51A 3TS1A 1CQJB 4CIVA 3OQOA 5DLYA 4O8ZA 4Q4HA 2X8WA 4I9NA 1L5QA 3ZI7A 1MUUA 4QG3A 4UFNA 5K3SA 1U3DA 4I55F 4L9AA 4PX2A 4PZUA 1ENYA 1RAIA 4G5QA 4TWJA 1I51A 4W4TA 1OXJA 1A2BA 1A4UA 2Y1FA 4QXRA 2AZTA 5ERYA 4D9CA 4C0EA 1GU1A 2OB2A 3CTMA 4DLZA 4UBLA 3ZWVA 2HMTA 2JGMA 4DPKA 4OCZA 5JAOA 2CV2A 3CLKA 1NQAO 3NG1A 4MH0R 5JY1A 2I3ZA 2IYEA 1ZSYA 2YJ6A 3HP7A 4FQ7A 2FPKA 4LNUB 3PX2A 3RIMA 3UHFA 4DWOA 3K1AB 5DHQA 1H6DA 1SZAA 4IIEA 2BFBB 2K7FA 1L3BA 2F9LA 4LY9A 2RIPA 2C7VA 4FINA 3RUEA 3SICE 4ZN6A 1X9IA 1M2JA 4GM1A 4CIWA 1R0ZA 3PB3A 1AG9A 1PD0A 4HBGA 3FZEA 1BFDA 2BRUA 3ID6C 2IIQA 4WKGA 2BFBA 3PFHA 4YFVA 1CERA 4CM3A 5JU6A 1Q3HA 3NPAA 4L4ZA 2FW1A 1FTYA 3RKRA 4F93B 5JNVA 2V3CC 3COWA 3ZLVA 5BV2P 3LO5A 4INZA 3IV0A 2IPAB 3FZNA 4A8JA 3P52A 3K1ZA 6REQA 3HDJA 4A2WA 3L1JA 1JFLA 2GAAA 3OIWA 5FWYA 3UK2A 2WXIA 1E6MA 1HNNA 1KYWA 1JQ5A 1N2BA 2P11A 4RU1A 1JPVA 5EGSA 1EXVA 4ZDIA 2A4ZA 2H7CA 2JI9A 3UJ9A 3WADA 5C3UA 2H2FA 1NVEA 2O2JA 1G5FA 1VGVA 3B53X 3L4BC 3MTJA 3LU1A 2ZYAA 1RWKA 4W5JA 3VZQA 2QMYA 1RYZA 3PTZA 1JDNA 4HDNB 2CW5A 5CLQA 4K9OA 3Q72A 2WUGA 1P5RA 4MIYA 3T0GA 2O2CA 4J0GA 4UU0A 5HMMA 4B0PA 5G04C 2P0AA 1DAPA 3DO6A 4X60A 1FUIA 2LPMA 2ZTUA 1FFXA 4FUQA 3RIYA 4BE9A 1GKLA 3DOUA 1X0VA 5LKRA 3I9V1 3PQFA 4FHFA 3W6ZA 4OD0A 1DTWB 2HA4A 3GZ4A 3MUNA 2OZEA 2ZBGA 5COAA 1L7MA 1LLCA 4OF4A 4E33A 3HB0A 4RY8A 3QDNA 2J9FA 4IKOA 2RD2A 1JH9A 2DETA 1DIRA 3GCDA 3DPDA 1A4RA 1KYYA 4RVNA 1KJYA 1EDOA 1KL7A 1XDZA 1Z33A 4UDXX 5JEEA 2QTGA 3WL6A 3PC2A 4BV2A 4XOUA 2ODPA 2V55B 4JVMA 1UDAA 1UXKA 1EUCA 3GDHA 2I9KA 2QD4A 1VYHA 2FULA 1IZ7A 1GQRA 4F8YA 1J99A 4KIJA 1CU1A 3FH0A 5F64A 4DR4B 2IC5A 1IRIA 2YZ2A 4EI2A 2QT9A 2EKQA 4Q9KA 1X4RA 4TMKA 5CJ2A 5CYGA 3TIXB 1LSOA 4IMPA 4ESVA 1F6BA 3HJHA 4YPOA 1R8JA 3B9BA 1DGQA 1X7DA 1X14A 1SOVA 2M6SA 2NX2A 1FS6A 1XVTA 2Y9PB 2O7QA 4P86A 2AW6A 4A73A 5I9NA 2V59A 4H31A 2AI3A 4BO7A 1A88A 3ZTYA 1TJFA 5BSGA 3V7YA 2YIVX 1BCRB 3AY7A 3B7GA 3EIJA 5EX0A 1N95A 1OSNA 2NIPA 1ITZA 3H3XA 5FTKA 4DA8A 4GZ5A 5AXAA 1KJ9A 5FUQA 1X7ZA 1XMOB 4I0WB 1QO0A 1FMJA 3CUVA 3I9FA 2VSXE 4XEHA 1YJBA 1Y80A 2VJ8A 3K70B 5EQFA 2ZUCA 3RFUA 2C42A 3OX2A 3KQTA 2YXNA 2R6JA 1SUPA 3P9ZA 3COJA 1GSAA 1LBIA 4E85A 5IF9A 4F4CA 3LRPA 3V8EA 3G68A 3L3BA 5AK5A 3UOGA 3WSVA 4L0QA 1DQSA 4WESA 2W0SA 2BGJA 2XUKA 2YZGA 2ZE7A 3A3PA 2GAJA 4V39A 2HHAA 4JDPA 2FJ0A 2K87A 4Q9JA 1VJCA 1ZONA 5G4KA 4UAJA 4F3TA 4ALJA 2IKQA 4C43A 2RHBA 1N0IA 1QFXA 1OXKB 4KI0A 1P4HA 2Z04A 2H18A 4WUTA 1XHEA 2FW0A 5AK6A 4EUNA 1O89A 4F6RA 3IGFA 5ALUA 3B7PA 1YRHA 1D5WA 4BLSA 5KSOA 3GH1A 3FULA 2VSNA 3UPDA 1ABEA 3WLLA 1DDGA 5C8DA 5FLEX 4E51A 1YU6A 3HGMA 4D3SA 3RC7A 1CQXA 4ZI5A 1IXKA 1ND6A 2GRAA 2J5RA 4FFNA 1Y42X 3SSNA 2OBYA 4YRFA 5FWDA 2VFAA 1M34B 4TS4A 3IE0A 4OAUC 4KXYA 3UAYA 1S7GA 2H1HA 5FCDA 2VQ3A 4KAFA 3V4FA 5K8LA 3ND7A 2APJA 3NAGA 4FHGA 4WWHA 4B3IA 2WHEA 2Y76A 4DB4A 4YJHA 4ANUA 1Q95A 3OOEA 2QBYB 2O0KA 1PCXA 1TB4A 2GLUA 3FXAA 3G2KA 3OHPA 4W1PA 1Y1LA 2VF4X 3U37A 1TMKA 4AJ9A 3Q5MA 4JFAA 1TT5A 4HK4A 1N8KA 4E09A 2WNSA 4AZWA 3HN2A 3LXUX 1DKPA 3HVIA 1V8FA 5A4MS 5BWBA 2RD0A 3IVGA 4BBPA 5AVRA 5KX5F 5LMCA 3ER9A 2ESRA 5AJTA 1PV1A 3TWRA 5HK9A 3ZE9A 3WJ1A 1SZCA 4KPUA 1F8YA 3ABKE 4EPZA 1E3LA 1XROA 2RARA 4BCBA 4DCTA 4HV4A 3PLNA 4KRYA 2A9KA 2G9ZA 3FPLA 4UWFA 2R8YA 4FGKA 5LZ5A 5LD2B 1JJAA 3PNLA 1R16A 5MFPA 3IYLW 5SY9A 2CXNA 3BHNA 4RIHA 5IBRA 2DH6A 2Z6QA 3E7WA 5ALSA 1B6TA 1DAFA 1UWVA 4CN8A 5L9AA 4HDOB 3D6MA 5FUWA 5JE8A 3W3AA 2FMUA 1LRJA 1F5SA 4JEIA 5TX7A 4KXNA 2E55A 2IHJA 2VHXA 2YMPA 3RFXA 3KS2A 1J90A 1NFFA 1O5OA 2VI5A 2V0PA 2R8PA 1O57A 4PM4A 3B85A 2AK2A 4EHAA 4R68A 4XUDA 3ZGNA 2PYZA 1M2GA 2BKXA 5HDQA 4LFCB 3EVDA 1CUZA 3GJZA 3RQSA 4Z3DA 1JILA 2X76A 4BRZA 1UBJS 4HT3B 1NXQA 4O2RA 4Y9RA 2HU5A 3GJXC 2G6BA 1BIFA 2RGNC 1SVXA 3ED5A 2ZIRA 4GQIA 3AFIA 3DL7A 4H59A 5JT1A 3ECCA 3FMPB 3GT7A 4JLJA 2OXIA 3K0AB 4B9AA 1CE8B 2AOUB 2D7DA 4U63A 5GAJA 2NMVA 1FQJA 5AVWA 1PJBA 1KSGA 3TB6A 4JA7A 3PTLA 2XS1A 4AZ3A 3ZX5A 3ZHTA 2O2IA 3BCUA 1YVPA 5HP4A 1DJPA 4F9TA 5LUBA 3H99A 3PRJA 2ZRMA 3D4PA 5K3DA 1N2CE 2BAGA 1QIEA 4LZLA 4PVCA 3R3JA 3CIFA 1QZXA 3E33A 1U5BB 5ED0A 1ZLXA 4DB2A 5IYZA 2CFSA 4XJTA 2PVPA 4R7GA 2E0IA 2C4MA 1D8DA 2V3WA 4JJZA 3DJFA 3W5DA 1RXCA 3C3CA 3AM5A 3V8VA 5I7RA 3GLIB 4AROA 3A25A 1FY2A 1Z63A 4ZO8A 3UANA 1GZDA 1XJ0A 1XQ6A 4EO9A 4PHHA 5GV7A 2UWJG 3BGDA 3HCEA 4LERA 2M63A 2AJ8A 4GTVA 1LPAB 1ZW1A 3R2JA 1E3EA 3FOZA 2HM7A 2PX2A 4F2GA 4YUZA 2R4QA 5ALZA 5TDHA 3HCBA 1T6NA 2IEYA 5FH9A 2X5HA 1NV8A 1O95C 4JX9A 4RFSB 4CF5A 1ISMA 3GF4A 4RPHA 3TRHA 4YMGA 4DEVA 4CMJA 1U3GA 5JV5A 2MYNA 2LP4Y 1ZD1A 2WA2A 3T4EA 3EFBA 1I3CA 3MD0A 4R6XA 3OQNA 4GBGA 4N5IX 3EISA 5JZBA 3U61B 3CVXA 3CUWA 4MP3A 1C7QA 4JMPA 3FCXA 4KFTA 2JZOA 2GN8A 4RVSA 1OI2A 4JT8A 1GN9A 1RKBA 5AKKA 1MDBA 1Q1QA 5CIYA 2I03A 5A9SA 4UTRA 4OMFG 2HRZA 1JEQA 3CA8A 4KNWA 4TL8A 4TS1A 3KKPA 3NJRA 4E12A 2V0CA 4TYYA 2AZDA 2EATA 3DSTA 2ECKA 4KAXA 4UHKA 1G4HA 3DDUA 4EQ6B 2VZ0A 3TFOA 1P1KA 4CT0A 1A95A 3ZIUA 3FMIA 2I2DA 4GF5A 2V7UA 1KAGA 1Y6JA 1JLSA 5JQGB 3FP3A 1C41A 4HD8A 4U7TB 5EHGA 4IJUA 1E2IA 4AWAA 3TW8A 2GZDA 2BH9A 5AI5A 1IZZA 1P1JA 1KT0A 2NZXA 2VHQA 3DHYA 5BWCA 3UAXA 4K87A 2VDUE 4EH1A 2EX0A 3OD1A 2WWTA 2BKLA 4YJFB 1D0VA 1T3ZA 3PV0A 1FPMA 1UJBA 3EPJA 4G5SA 2L0IA 4EY8A 3GNTA 5HTOA 1P18A 1U8EA 4BTBA 1HKHA 4CEJB 5F9HA 4KZ0A 3OFND 1KARA 4X1KA 3OPYB 5G41A 3PITA 1IHUA 2XQJA 1OOEA 1IJBA 1U3FA 3EG5A 3RK0A 2LSUA 3WXBA 8LDHA 4IP0A 1VC2A 4TRQA 3LW7A 3ZPXA 3HA2A 2CHWA 1C3EA 3MOGA 4JUIA 2A5UA 4WNYA 3W4KA 5HUJA 2WXOA 5JXHA 3IXMA 3OPMA 4DCPA 2XDQA 1AB5A 1TZ2A 3UA3A 1Q19A 2QOEA 4FIDA 4B44A 4ECEA 1U5BA 1R00A 1YS2X 4QO8A 3ZLJA 1CV2A 2QT1A 3F2VA 3L8DA 5I7SA 2P5UA 3MHPA 4D56A 4FFDA 1X1SA 2DULA 3X1XA 2PYDA 1AT1A 4RE5A 2WJWA 3DQZA 5HKLA 5THKA 4N40A 4GE0A 1N9GB 4IICA 3K5HA 1GU0A 2PKQP 2Q4DA 3TGWA 1PJSA 1BRTA 1QAQA 4QO7A 4TXJA 4C0AC 2C07A 1W8IA 3GNSA 5LFAA 3AJ8A 3G2JA 3ESQA 4PGGA 5FQOA 5A03A 2UZAA 1MEEA 3CWCA 4UVHA 1HYBA 1E7MA 4ENQA 3BA1A 4L8GA 4TVBA 1N6IA 3BGSA 1G63A 2WAMA 2WZDA 3A0UA 3CKKA 5BQOA 4CKWB 4YQFA 4W5HA 2Y6VA 4ZI2A 2CXPA 1ZCBA 3BB4A 4QDZA 2WMDA 1C29B 3DZ8A 3IUJA 4PINA 1QHSA 1P74A 1ZL2A 1XWWA 4X84A 1ZL0A 1Q7BA 3DGEC 4ESEA 3RJ5A 1UKEA 3CLVA 4MVWA 3CSTA 2MSLA 2YHSA 4R84A 3UK7A 4JJFA 3AVOA 2QLNA 4MKRA 4ZJZA 1K3FA 1DKQA 2PSSA 1FW8A 4U0KA 3SJBA 4P0PB 3RYTC 4PLZA 3ZZ0A 4UHBA 4BLUA 1G1AA 3IMCA 1I2AA 5D1HA 1Y1RA 4KH0A 4Y1RA 1UADA 1SKMA 3TWUA 2YNQA 3OZFA 1G21A 1H3NA 2OBFA 3CO0S 2RGYA 3DVAB 4BSZB 1NNUA 2I4RA 5AW3A 1F0YA 4CI0B 2HCBA 3TJMA 1EUZA 5EE9A 3M3PA 3UW1A 1APBA 4HY3A 1PNQA 3L16A 4MWSA 4UE6A 1YB7A 2EQ5A 4ND8A 4M38A 2BFCB 1DWUA 4CFSA 1YL7A 2ZISA 5BV7A 4C2TA 2W58A 2ZSUA 4YRIA 4U95D 1S7CA 4FYVA 5FPSA 1TVKA 1ELWA 2ZJ7A 3EQ7A 1KO1A 1RHRA 2WUFA 5AW7A 5JQWA 1YR1A 4NENA 1O5MA 3CWZA 4TRRA 4H35A 5FI1B 1WBDA 2Z98A 2OZPA 4QGSA 4XFKA 5IDVA 1A2OA 5AT1A 5BPPA 2EDCA 3NYWA 3P2OA 3WGHA 2C29D 2I4IA 2JAOA 2NUPA 3OEED 3EEFA 1X7YA 3KD2A 2Y69E 1VCNA 1NBIA 2ZT8A 4X62B 4RHEA 2BL4A 1YZHA 4Q6WA 5WRFA 4KNYA 4C2UA 5F12A 2AQHA 2QVBA 3QYAA 4ZO4A 3HI6A 2Z2KA 1BZYA 1TYCA 2YMLA 3CZ4A 4NV1A 3E2MA 4NCAA 3HPQA 3NVDA 4K3UA 3MW8A 4U4AA 2XUFA 1TO2E 3IIIA 4ETWA 5ANLA 3P0FA 1YCSB 1LNSA 4TSKA 4J0IA 2WABA 2X2PA 3M6LA 3W2GA 4OHOA 4QG7A 2XDAA 1MKYA 5LLSA 2JATA 2ZU6A 3P97A 4KRXA 5JLAA 2GRPB 4J8YA 3FOWA 4EYGA 5B4UA 4NS1A 5ENDA 4IXNA 4YVQC 3IA2A 4L4XA 2D1TA 3D0OA 3VNVA 3UGKA 4RANA 4E2WA 3Q7PA 4CZ2A 1KEZA 1IN6A 4UNIA 5E95A 3THYA 2C0LA 2YV5A 3JQRA 4XGIA 4Q19A 3UI2A 3ZZMA 1DL5A 3ZCSA 4DMMA 1GRCA 4EW1A 2HJ9A 3PX3A 4KOEC 1UANA 4KQWA 4BZQA 1X7XB 3AC0A 3TRFA 3F90A 3PUVA 2IXGA 4FYYA 1T9KA 5EIHA 1CY7A 5CRUA 3I92A 1HQYE 4AOFA 3HCCA 5HW0A 1QGED 1ECBA 2EX4A 1S3GA 1XUOA 2Q5HA 2X5OA 3GUCA 4HH3C 4MVJF 5CT9A 5FV7A 2NQTA 2WKPA 3BD8A 5K3OA 5GADl 1FVHA 2RMKA 3NBXX 1J22A 1U5AA 1UFVA 4KZPA 3ESYA 3U3KA 3ZJ5A 2AG1A 3BMCB 4QPZA 2YFKA 1AF7A 1NZDA 5HCUA 1KU0A 2WOOA 3D6AA 4PWYA 4YNDA 3RSCA 2O20A 4ID9A 1K6MA 2H29A 3AY0A 1YGPA 2PU7A 2PRJA 4JI2B 1NYLA 2B1GA 4HDMA 2F3QA 4DSAA 2PH5A 2P9GA 3IBYA 1O03A 3SNHA 3OLZA 5K9ZA 3OXGA 4TL9A 3L8FA 3OU7A 4BMOB 4X45A 4MCAA 2FK8A 4XEUA 1TNOA 2B5WA 1WMDA 1HE8A 4QFVA 2XVZA 1MOPA 1EDBA 5LQRA 2JABA 2AXVA 4D26A 1BG6A 3OECA 4FMCB 3Q3CA 3Q7AA 5LP6F 4WCFB 2AD5A 4YO8A 3OUZA 4J16A 3O8BA 5EI5A 4EZLA 3HH8A 3L9XA 1N4AA 3KJQA 3VGJA 4FWTA 1BMQA 1G8HA 5L6MB 1QPZA 2DXIA 3ABME 1KAHA 3PLAE 1MBZA 1NBMD 2PZGA 4OHZA 4TV8F 1PK9A 1XZJA 4FS3A 3KQQA 4IHJF 1FX0A 1ISJA 4N5MA 5TQ0B 5K8CA 1BVYF 1M1NA 3ADCA 1DU4A 2GCIA 1D6JA 3ZVNA 4CNQA 4FXPA 1KLXA 2FG6C 1SCBA 3GVCA 3MFQA 4YS6A 4DPLA 4FM9A 3QK0A 1U11A 1LI5A 2J3HA 4RG9A 1P39A 1TZKA 3UAZA 3WB1A 1E79A 4G5XA 4OSOA 4YCJA 4EP1A 3O1HB 4O4LA 5IM4A 1EESA 2WM2A 2ZAOA 4F2WA 2FZ5A 2ATEA 4K6FA 3PGKA 4F6LA 2AZMA 1DRWA 4IPTA 2C31A 2IKSA 4NZMA 1PR4A 1XBTA 5THQA 3T7RA 2WKSA 3AVYA 1O4VA 3FUFA 4Q96A 3K9WA 4B87A 1VDYA 1GL9B 4NPCA 1DI0A 4B3FX 3DHWC 3AEQA 4PN7A 4CGZA 3AESB 4BGEA 5F5XA 3K15A 1H1DA 3PI7A 5FA6A 4EMUA 5EKQD 5HKAA 4CCAA 3AEXA 1I01A 2G0TA 4KXUA 1M76A 5BN3A 5BSVA 5ENQD 2CMDA 4ZDKA 5KNGA 1DSSG 4JVOA 4BGIA 1U9JA 1UPFA 4JC0A 5HF8A 3BFXA 3C41J 4LJYA 4A8JB 1Z73A 1JE1A 1TCVA 2X6TA 3B2QA 3SQVA 2ZREA 2HXSA 1G8SA 4F06A 1H4QA 2AMVA 1MW9X 2IDMA 4IKEA 4UOZA 3JVEA 3SHVA 3T3HA 1SA4A 2V3VA 3CPEA 2Z30A 4JELA 5K3FB 2RK3A 4DR6B 1TF7A 2WU8A 2ZI6A 4IRXA 4W6ZA 3BMOB 4CQMD 4D7AA 3LHKA 2OE2A 3SF8A 2JLCA 1TTQB 1H6PA 2IXBA 4WD3A 1J2EA 4C4ZA 1L9XA 2Z8YA 4X41A 2PJDA 1CZKA 5JHGB 4BVHA 1K2VN 1D9SA 1X38A 2IYAA 1ZA2A 3GT4A 8OHMA 2A9OA 2VT2A 1VHLA 2GJ4A 3ORHA 5BR7A 1RXUA 4MGZR 4UD6A 1XO1A 1MCZA 1JBEA 5JFOA 3NM5A 5BQPA 2PUTA 4BBJA 3NBZC 2EEPA 4LZWA 4O5AA 3AOEC 1G4AE 3T1QA 1WHTB 3GEEA 2QJFA 4OXYA 1EI9A 1RKXA 4ZVKA 3WGVA 4A6PA 4EX7A 5C4IA 4HQKA 2OMEA 4BX0A 2G04A 1NYRA 3ZEIA 4HNAD 3EGWA 3S2IA 2PMFA 3CF2A 1RXEA 3WYFA 1UDBA 2V7VA 3NTLA 4EATA 1UFQA 1QOZA 1GQ2A 3R0XA 1EFPB 3T7AA 3UJCA 4LX8A 1C9NA 2QN3A 2B1RA 4C7MA 5BUQA 1RBQA 3GLFE 3GUZA 5KYXA 3SQXA 1V96A 1XCOA 1Y3DE 2OR3A 4KWCA 4WLOA 1XJCA 1E1YA 2ZRBA 1WLYA 1WZ2A 4OIMA 4DKXA 2IRWA 3CNNA 2I2AA 3TI7A 4BO4A 2XIJA 3QXXA 2AG0A 5KYXB 1X8KA 3KE9A 3O7MA 4U2KA 3I62A 3NRJA 3TTSA 4O3FA 2LCFA 3PZ3A 5H80A 5G55A 1XQ9A 1FDUA 4URYR 4CBVA 4Z6KA 3L43A 1MIOB 5IBCA 3R9KA 1T4GA 3HUUA 4H7HA 1XZBA 1VKZA 5DB4A 4DV0B 3BK7A 1YOBA 2QJTA 2PZFA 1RDFA 3NWJA 2BM9A 5ELLA 3HB9A 3O73A 4EHLA 5CK4A 3JYQA 1BE8A 3DL4A 3DPUA 1G8FA 4MRNA 4AMVA 5D5PA 2W6PA 1QRSA 5HQTA 3SDBA 5JSFA 2LTAA 1UK7A 5D86A 1F4VA 2C2LA 1WEKA 1W49A 2BEJA 4YAOA 3UBMA 3VH3A 2ZAMA 5LQAA 4P4SB 1RBZA 1P91A 5KWVA 2ZGVA 1HG5A 1EK1A 1V1MA 3LC7O 1LJ8A 3HWWA 3I9LA 3PC7A 4RPIA 3TEMA 4RPKA 3TLCA 1DTWA 3KBBA 5J4VA 3OLWA 4LX0A 1KZYC 2ENWA 2ZIXB 1YDHA 4DWJA 1GA6A 1Z9BA 2E5LB 3M33A 1H6KA 1FP4B 3G17A 4D6XA 3UO8B 1H5NA 1U9ZA 4IXMA 3FETA 1OXBB 4Y1RB 1UOPA 4QUJA 4EHBA 4QTZA 2LCQA 3VOBA 4BS9A 1HDGO 4P4NA 5KB3A 1BW9A 2DIWA 1WUYA 3ZQ4A 3ZHRA 3PIDA 1H6BA 5A4KA 5JH7B 2JLSA 2J8SD 3VJMA 1JE0A 1MNQA 1QS0A 4YHBA 1FCJA 5JC8A 1YCDA 1LNZA 1UZLA 1FQKA 2ATVA 2PV7A 1X87A 2H6FA 2IDZA 3LK7A 4KAJA 5LYYA 5BMVB 1DKLA 5F76A 3Q8KA 2AZXA 2Q7OE 4CM4B 3VCXA 1INLA 1RYYA 2QUKA 2UDPA 2ZYSA 2ZTLA 1AHHA 1YUBA 3HP4A 3AG1E 2F2TA 1UMBA 4O25A 1ZXLA 4CKCB 3KD3A 2VGXA 3VC1A 1QNFA 4BIIA 3KOOA 4DEXA 5CB4F 2MSDB 1FFHA 3LHFA 4MVJA 4N3NA 2PUVA 4WN9B 1E94E 1Z4QA 2HXYA 4RSMA 2O8FB 3K53A 4FLFA 5EP3A 4EY4A 3U56A 2X9QA 1T24A 1PZGA 3LA6A 2FFQA 1HDCA 2HF8A 3TGOA 3GGGA 4JPSA 2Q4EA 2Y1KA 2WSBA 4ZXFA 1XJQA 1N7GA 3VZDA 1P9NA 2Z5LA 1MB9A 2QRGA 3EDTB 4AWXA 1S2MA 4DN6A 2I6FA 4OI1A 2FKAA 3HVEA 2YQ4A 5FWQA 2F1HA 3HJFA 2D00A 1C4XA 2Y1WA 5AOBA 1FRNA 4EJFA 1ZRHA 1ECLA 4JT4A 4PAQA 1KGSA 1PW5A 4PLCA 2CSXA 4X1IA 1W2WB 3LT0A 1GSHA 4L5CA 5FPHA 3UVEA 5BYAA 1CS4C 1NI5A 2ZQYA 2H4FA 4YDSA 3WGZA 4V3IA 5IS2A 2V6GA 2VTBA 3I2HA 3AHFA 3ABLE 4RL4A 5EX3A 3UYLA 5JWHA 4N1AA 2B61A 4PZYA 2AF3C 2CUTA 4ZCQA 1JHOA 1ZFNA 4IXTA 3ZS9A 2R8BA 4C7OA 2RSLA 1BW9B 1G9TA 3QLTA 4NOMA 3UUFA 1C9DB 1V8BA 4DYDA 2GF2A 1HGXA 3MIIA 2IE0A 2JGNA 1EE2A 3BFKA 5E6SB 1IBKB 1ZM2A 1ZG3A 2FZ4A 2CVFA 3NIFB 3QLVC 3SFTA 4D4GA 5K4GA 5KSWB 2XXAB 3KKMA 2J3EA 2ZUTA 1ZKMA 3OZBA 4LGYA 3DMGA 3RAPR 4I9CA 2ZIVB 4Y6PA 3MNFA 4DM7A 4Z7OB 4AQYB 4G4JA 4TLLB 3WMWA 3SHWA 1E5DA 1Z0AA 3RF6A 1KE1A 1OFIA 1BJKA 2D1SA 3EEOA 1YTLA 4MAAA 2WTNA 4JGGA 4NFSA 2FVYA 4X8HA 1S8NA 2OMKA 4RTKA 2OK7A 4E3WA 5JZVA 4U5XA 3K9IA 2N1BA 2DSNA 3DOEA 2VP4A 4WXRA 2NO4A 1KI7A 2FO1E 1TVMA 5FNZA 2BMDA 2O2EA 1RBMA 3A4TA 3LSYA 2EP7A 3VYTB 4GICA 1W59A 1CUXA 3JARA 3L6EA 4GPIB 4N54A 3UJ3X 2O0MA 2P27A 1P2GA 4KSCA 4PHFA 3J5PA 4P9NA 1PF7E 2J9FB 1SR8A 1JLLB 3R0JA 4GLJA 2WHYA 3IVRA 1XNHA 2XAAA 5I7UA 3OZRA 4QZVA 3EIHA 1Y9DA 1SA0B 4MQMA 4BWGA 4FZ5A 3UAWA 5JQGF 1QZ2A 1DEOA 5KPJA 3BWVA 4HRNA 3UXYA 4DX6D 1UBHS 1BOFA 2VXYA 2QS9A 1C30A 3E9EA 3LPNA 4I36A 4JXTA 4E11A 1PGNA 1Y8QA 2P2NA 4F56A 3VKGA 1RHKA 2Z8ZA 3C7AA 3L01A 3JVUA 2C9BA 4UCWA 4M46A 4L5JA 3GLHB 1KRWA 3WMFA 4ITUA 1L5ZA 5A3JA 3ANXA 4NBSA 3EQ6A 5E1OA 1UBEA 3NOCD 5FJYA 5LQNA 5BUZA 1I80A 1OUMA 1GQSA 3RVSA 3LUHA 3ZU4A 1T3HA 1Q1NA 5IZ4A 1DC4A 4F6RD 1SH7A 1T9CA 2C9DA 3E7FA 2BTQA 4TWZA 2XZDG 2F8XK 1J06A 3EUVA 2NXJA 1COWA 1JGTA 1BPOA 1ELRA 3CBQA 4BB9A 5AVQA 5TGDA 2WVHA 4J6EA 1N11A 1I4TD 1B00A 1MORA 3MT0A 4IFIA 4DABA 2IEGA 4LF8B 1HX8A 1K6JA 2AQKA 4GZDA 4LNUD 3GMSA 3WL8A 1J5XA 3ZN3A 5DVZA 1QK3A 4GEGA 4NCBA 1ORVA 2O5EA 5KINB 3O8LA 3C6BA 5EYPB 2BMWA 2ZYHA 3IPYA 1ZCJA 3SZ7A 4I6GA 3IURA 1KEEA 4UAUA 4XI9A 4DSNA 4NZPA 1FRZA 4FSDA 4L27A 4W6QA 2Z6AA 4RDIA 3EHNA 4U0ZA 2JH3A 3Q4GA 4RHXA 4UCXA 4WK4B 5KYGA 3JW8A 3NOOA 1KBZA 2J5QA 4J0FA 5KI6A 3U4CA 3AUAA 1Z2CA 2IU0A 5DM4A 2WM9A 3QA9A 5E6RB 2J0VA 5DOVA 1MV8A 3W2TA 1JAHA 1Z7WA 5HKOA 1IFXA 4LHVA 5JLJA 3DEPA 1EJ6A 3BQNB 1YK0A 3ZY6A 1SU4A 1XEWY 1TK3A 3TWXA 1HE2A 2OL4A 4FFOA 1NPDA 3WL7A 3RYCB 1PL7A 1VMAA 2L6BA 1Q20A 4UNPA 5GONB 1IIRA 1MXFA 2B4YA 2M2IA 3FVWA 3KKKA 4DI3A 4G8BA 3PK0A 4DR1B 1AOXA 2YXPX 4CIBA 1F2DA 1PT9A 1XDGA 1T0BA 3B1YA 2JFBA 3QG5A 5EWMA 1HH8A 5AQ9A 1KO7A 4Y2QA 4BJHB 3V1KA 3CVYA 2AFVA 5JMOA 4EITA 2BZGA 4GYYA 4C89A 1Y8MA 3K6RA 4K9SA 4TYWA 4QJ5A 5F2OA 4FT4A 4DDHA 2ZITA 2IOHA 1M34E 2LBPA 4J7XA 4D9JA 2DTEA 2RK6A 3RT7A 3T1OA 1XQYA 2IL1A 3KEAA 3E4BA 2UU9B 4KR7A 1U4NA 4OGFA 3VNQA 3U3XA 1H2UA 3SI5A 2OG1A 2DGDA 2N47A 3AETB 3TU3B 4RKYA 2CDCA 3W8EA 3TKYA 4PZLA 2X38A 2OO3A 1KO4A 1XLTA 4PPGA 1WW2A 5JDIA 3PE3A 2YWFA 1TUIA 4JUCA 1XSEA 4CDRA 1KEWA 4ZQFA 3MKQA 3CH7A 4W9NC 1TXGA 1E7UA 3ZDEA 4K2HA 4D4JA 2AZ4A 2YHCA 1X1CA 3NWEA 2OCPA 1CHNA 1PJ8A 3C6XA 3M1AA 3I8OA 2HBRA 3F6CA 3F46A 1GDHA 1F20A 4IQFA 4NCIA 4ODIA 4QU8A 1A8IA 4G8LA 4B71A 4QELA 1INZA 1I4WA 1JLHA 1QF9A 4FC7A 1M6EX 3KUCA 3L1VA 3ZY3A 3KHTA 1V5GA 4QEDA 4RADA 3ZC3A 1D0SA 1AF4A 2HQOA 1I8TA 4Z8YA 1XRNA 1V1MB 1YQQA 3HB7A 4BLOA 5CLHA 5H7PA 1R0KA 1Z7GA 4Y18A 5EN4A 5K0GA 1M6NA 4E32A 4OYLA 1ZC3A 4MV7A 3I1IA 2GAOA 2J8ZA 4H7YA 3OZCA 4PG7A 3AU4A 1PRYA 3A3OA 2XNDD 3I5MA 3VHRA 1N33B 4C0MA 1O1YA 4O5OA 2EXXA 3FTZA 2VHVA 1G2QA 4AN1A 3BXGA 3GRKA 3GROA 3TQIA 1PWEA 2ZRDA 4XX5A 4AXBA 2H2IA 4TMFA 2VA8A 3TZ6A 4CKEA 3TW0A 1ODIA 2G1JA 2Z4TA 2A0UA 2PSHA 2QRPA 1M7HA 2WM9B 4Q7KA 3WLAA 3RHFA 3ZOKA 6AT1A 1GXSA 1LDNA 4UBNA 3RFCA 8ADHA 1U2QA 2NN3C 4R8KA 1LY1A 4ZAWA 3PC4A 2QP9X 4LZJA 5A62A 2X0EA 1KIFA 2JFNA 3LCRA 2FX5A 1LF0A 2B9VA 2I22A 2YUTA 5K3AA 5EIEA 1T6XA 4E1AA 3T9FA 3VH1A 1XZGA 2VCEA 3EGOA 3S2ZA 1UBTS 2DVMA 4KPGA 2J33A 4YDWA 1XEAA 1ZUIA 2OBNA 3EXIB 3R7DA 1S4QA 1V3UA 4DNPA 2QYSA 4PNHA 4NOKA 4ZPJA 1XCMA 4HX2A 2HDNB 2NO0A 3ML8A 1NFIE 3L0SA 4LTMA 5IJAA 4OGKA 1J7JA 1TYZA 1MB0A 2JB9A 4HLNA 2KZTA 2BGLA 1IDOA 1IDN1 3W9YA 2IY9A 3CVVA 5ALNA 3SYKA 3X1DA 1SO8A 2AJCA 3FR7A 3LQ4A 3OY7A 4M9ZA 1UEXC 4RLSA 3RADC 1HFEL 2A9QA 1YCHA 4BN4A 3JCKC 2WM3A 3NZEA 5IC6A 1PJ2A 1O9BA 1Z08A 1B2RA 3O9ZA 1X80A 5EXEA 2NOAA 1E6WA 3T5TA 4IR7A 4JA0A 3Q1KA 2HIHA 1F4LA 4K26A 4KQCA 4OREX 5G05C 3IP3A 4WKNA 2MYOA 1EUDA 3UMGA 3MUOA 1C3XA 3I5PA 2BF4A 2ORVA 2BEWB 4L02A 2AFIB 5L95A 2Y4OA 4FE4A 4O4IA 1IZYA 3PHBE 4REOA 1M8GA 3V2HA 2F48A 3WVNA 2VK2A 4U3JA 1E2PA 2ANBA 2C5SA 2GRUA 1ZM3A 3FBTA 1RAAA 3L7CA 2IPMA 2BHSA 3J5QB 1SUAA 3MLAA 5JCXA 3H5IA 4MJ3A 1MHTA 4KFCA 4DA7A 4JI8B 5CCXA 3HVJA 3VVLA 1SXJC 4EPRA 3V31A 3LWZA 3OO0A 4UUQA 4XSVA 1RMQA 2GZ2A 4JB3A 4IL5A 3R75A 3IQGX 2YHUA 3K20A 1EA7A 1E1QD 1A50B 1DT5A 3FVTA 1EFKA 2D2FA 3LW8A 5A7HA 1ZRSA 3R4CA 4CLOA 1R0CA 1ZLYA 3RRYA 5IRCD 4X65B 3QBDA 4QE3A 4R9UC 4GXRA 1MQ9A 1W0KD 4WNCA 3OEEA 3RC9A 3QYPA 1JA9A 4K5AB 1L5FA 2OENG 3DE6X 5G3YA 5BRJA 5HZMA 3R4VA 1BTOA 2VQDA 3O8RA 4PO8A 3L4EA 5DM0A 1RW2A 1WXDA 4QUEA 3S1AA 2A5LA 3FLEA 4NFYA 7AT1A 1WM5A 1SU7A 1ZH8A 4M0FA 2YZMA 1PN3A 2Z2YA 3N6VA 3T1NA 1T5BA 1ZMOA 4KDCA 1RADA 3WLNA 1ENOA 2EWWA 3D7MA 3DZHA 1ID1A 2FYTA 3F5MA 4F72A 1FTSA 3IUSA 2EGGA 4I2ZA 2DTXA 3IQIX 4XJSA 3PQ8A 1KI6A 1DAMA 1CWUA 4GIBA 1G8AA 3HDYA 4NQRA 1UWLA 4EBBA 3PEUA 4V03A 3V1TC 2YBDA 3NKFA 4G5FA 1FNNA 5CBNA 1Q1GA 1XZPA 3HJAA 2I91A 3FMVA 1JZTA 1H2BA 5DWDA 3GDFA 4YX9A 2IQCA 3M7IA 5HKBA 2MWMA 4PE5B 5C81A 4NJEA 2WFZA 2O6LA 1V54E 3A06A 3MS2A 2AFRA 4RS4A 1VL0A 1YIOA 2YYYA 4DJTA 4GP6A 2QW1A 4XM2A 3HB1A 4HEJA 1N4QA 4H3KB 2ZGGA 3PE4A 2JLRA 2X15A 1RABA 2ZRHA 3TINA 4PN3A 5A4IS 2HSGA 1PK7A 3SKYA 2VJCA 2QN7A 1DCMA 4GWGA 3IUBA 2CLIB 1SC9A 3I34X 2H6EA 4XIGS 4G0WA 4N8DA 4AM9A 5EIAA 2FW7A 1QIJA 2PS9A 4ICIA 4LZNA 4DDMA 2ECQA 1Z3XA 3WGLA 2JD2A 1JSXA 1XDUA 1C8BA 1E9VA 1JKJA 2HI0A 3IPCA 4HEA6 3U3OA 2X40A 2AX4A 4DNFA 3DCIA 5EEGA 3HG0D 1LC0A 2JGRA 3LBHA 3COSA 1RI1A 5DWQA 3UHPA 4U3JB 1G8KA 3GO4A 4U8GA 2XRZA 5LKAA 2W6QA 4QODA 3TL5A 4PX3A 5C34B 5TLSA 3SGHA 3TNYA 4X97A 1Q1BA 3LUCA 3GBVA 4YI5A 2P3LA 4EB6A 1OILA 3EASA 1ZAYA 1J49A 4IO0A 2WP8J 4WBXC 1TA0A 3DE0X 3I04M 4MW1A 2GTPA 3L6CA 5DASA 1ATIA 2WI8A 4GPMA 1JR3A 3PE6A 1X1AA 4XRGA 3K92A 3ASGA 3SVLA 1XNQB 1WXXA 3ESKA 4ND1A 4AZSA 5FQ6A 1SXGA 1KEEB 2C4VA 4FNOA 4H17A 4NWIA 5E7IA 1LBQA 3H5AA 4MKIA 1NSYA 1A27A 2V54A 4B8YA 4ZVSA 2RH4A 1Z5NA 5D66A 2X8BA 3B5IA 1TRKA 4WK0B 1BJRE 3DNFA 3ROQA 3B36A 1OMOA 4QA9A 5DHTA 4A2PA 4C01A 4U2CA 4AYTA 3DZDA 3WV4A 1U7TA 1IUOA 1PBNA 4IDAA 4YCCA 1N2SA 2X7XA 4RD1A 1P9WA 4C0SA 2G0AA 3CZRA 3NGMA 2JAUA 1QE5A 3EGEA 4GR9A 4LMBA 1MVNA 3BUSA 1JG3A 4MB2A 3ZGVA 2HWXA 3TR5A 1CB7A 5K0CA 3LBNA 2H0AA 4WY2A 2ZBEA 3GP8A 1C3LA 3IPLA 3C4JA 1S0PA 1YD7A 4UWGA 4Y2SA 3VVBA 4HORA 1FRVA 5AI9A 2I1QA 1XZKA 2D8MA 1SPBS 4MR8B 1GPDG 3S4YA 3ZEFA 1E96A 3S1SA 3EMVA 3UT4A 2WJ4A 3MTQA 3X1MA 5BNTA 1BWQA 3KPVA 4FU0A 1ULBA 3E82A 3QJGA 4Z9YA 3WBKA 1WSBA 5DTRA 4AP5A 4DSOA 4ARZA 1CVLA 3RRXA 1NWCA 5D3KA 3L7BA 3CHYA 4L74A 4LJKA 3DFZA 2QM7A 4QFCA 5EJMA 5AWFC 1CHDA 1AQJA 2YS7A 2VSOE 3BSSA 1K98A 2ZWMA 1YQGA 2PAFA 4U8VD 2HL6A 2O7SA 1Z4MA 1AVTA 1KYTA 3EIOA 3H8WA 3GDGA 1PJRA 5K0JA 1O1RA 3PSAA 4J0QA 1YBHA 3CEQA 3A3NA 4HZUB 3B3JA 4G4GA 1UQTA 4EOGA 3BQOA 4M7RA 1EVLA 3TSAA 1Z0KA 1NRJB 2A3NA 2JH8A 3NEAA 4YR9A 5LWHA 2UZ0A 3W5HA 4ZZ3A 5CEEA 2AFHE 4ETMA 1GPLA 3B2NA 3RC1A 2GJ8A 4IJ5A 4HQFA 4P33A 3C45A 3UK1A 4OV6B 1QJ4A 1XTKA 4G84A 3QB2A 3DBLB 1N36B 1EP3B 3PGJA 1AP7A 4GOOD 3IEUA 4JXKA 1NJFA 5E7JA 3IO3A 3J7TA 1HE8B 2EQBA 2WQ7A 4HXYA 4X20A 2HHCA 1JFFB 3Q15C 4FSHA 2J6CA 2DG2A 1YIDA 3KSLA 5FV4A 5DCUA 2H9IA 4H77A 1L7OA 1DJOA 2FNAA 3CZ5A 1WTCA 4MQFA 4NBRA 4WZAB 4TKUA 521PA 1GZ3A 5IAGA 2EFDB 5J9FA 3RRZA 1Z34A 1UZMA 5FWXA 3HXFA 2Q46A 4GE3A 3HY3A 4IFTA 4UVGA 2PGJA 1H4SA 4O1PA 4WGFA 4AEZC 2GOYA 2HRRA 3EF3A 1E9RA 4DG5A 4YRSA 5IKEA 3HYCA 3RSHA 4D4KA 2QYHA 5JS2A 5HFJA 2WFLA 4JXXA 2FLKA 5BN5A 3BAFA 4V3CA 3GLGA 3R3SA 3BBPA 1U3CA 5IFLA 5DHFA 4Y2VA 2WUWE 5I9SA 1NY6A 1OKKA 2Q8QA 5GTDA 3CQ9A 4LXIA 5F2KA 3O3MB 4LQLA 1QHEA 2FMIA 2OKGA 4RCVA 2A84A 1MHQA 3ECSA 2NLOA 2AH5A 2HF9A 3D2CA 1ZOOA 2YJNA 4P3KA 4Y3UA 3V4OA 1M2VA 5H81A 1XYGA 2OO5A 4QPNA 4OXQA 4QDJA 1YZQA 4H6PA 3CNEA 4WXMA 5JZSA 3OC0A 2A0YA 3IUNA 1LPMA 4IS2A 3WRWA 2H1SA 5FTMA 5FWYB 1FLAA 1SHZA 3VYSB 3FYTA 1U8FO 3E8XA 4EG5A 4LCTA 2GA8A 2QR3A 4HWTA 3CVUA 4GAAA 1KDRA 5J4LA 2W9JA 4PQYA 3EQ8A 2Y05A 4AXXA 3AI1A 1ADYA 4BB0A 3VPSA 4IMRA 2FJEB 2I6UA 4TYMA 3JXIA 1IULA 3GDWA 2EQAA 4AM8A 2JNWA 6ADHA 1B23P 2BI8A 4BCCA 4YLYA 1FNCA 4XVQA 1FQOA 1OD6A 1UP4A 1WHSA 3KR1A 4PPYA 4D80A 5K4HA 1ZIYA 3ZQ6A 3CH5A 3QYFA 3IOCA 1J25A 1NPYA 1OY1A 4X3CA 5ERXA 2JJ1A 4WRRA 3I4RB 1E7VA 2BKAA 1UR5A 3OQ1A 1EG7A 2WB2A 3OZVA 4X1YA 1O9GA 2ZUDA 2O52A 3R77A 2P40A 4G0MA 2ZYIA 4QDOA 4NBWA 4ZGWA 1R6DA 2XUIA 1LDBA 4O63O 1A9PA 4HLQB 4KO3S 5D2MC 3MSXA 4U9HS 3IHVA 3F6RA 3F5DA 4M9CA 4XCXA 3W78A 1P8AA 2AXPA 1E77A 2IYXA 3FPAA 5GJVC 3INTA 2QMQA 4BQEA 4D9HA 2OXTA 1SRRA 2J45A 1PJAA 2HK6A 3U13A 4U9UA 4F84A 1H2HA 1E3IA 5M29A 1QHNA 2V9ZA 2RBKA 4R2KA 4OXRA 4RD0A 3T7JA 2OT3B 2GXQA 3EVBA 3I9V6 3QKWA 2C94A 2P4EA 4QL3A 4XFDA 1E8YA 1FFAA 1QF7A 2VEDA 4LF6B 4OYSA 2AUNA 1CUDA 1EM8B 4MS1A 3GFVA 5FA8A 1DAGA 2HIAA 1NRIA 2F1OA 4GKAA 4ZWNA 3ZHQA 3LCAA 2X2FA 3F7MA 1ZUNB 2G7ZA 3BL8A 3CSUA 3NDIA 3RRJA 3T9DA 3R6LA 4ARSA 3VPXA 1NN3A 3DD1A 3O91A 5DFAA 3RT1A 4UU8A 1XZ8A 3D9QX 2W6CX 4FFBB 4L5AA 4E31A 1T4CB 1RD4A 3DKVA 3DM5A 3T3IA 4B3GA 2QVLA 4PC7A 4GU5A 3IOMA 5TARA 2JLBA 3KUDA 4HAYA 4WZ6A 4DHWA 1QUFA 5CX1A 1Y8CA 1XD2A 2HAEA 4C88A 1J39A 3A9VA 1NNI1 1DT3A 1P19A 4NR0A 4BVFA 1YXMA 3GLFB 2PXCA 4M0PA 5HILA 3U09A 1JDVA 1PAUA 2WHXA 1U0EA 2GN2A 4CGVA 2I55A 3CZAA 5HQ8A 1Q77A 4KXKB 2A0FA 3S55A 2Z3WA 1XMPA 5DISB 5F4ZA 4RM3A 4QVGA 4UM9D 3B13A 4JB2A 3SX0A 1GTZA 3SQDA 2W93A 2IYQA 4U8HA 2EJWA 4QKQA 2VWHA 1GYQA 1SQMA 2M98A 2FJPA 1FDVA 3SIRA 3IX7A 2XCIA 3BFVA 2V7TA 2YWRA 3KEZA 4AN0A 3QPVA 3ZWMA 1QHGA 2VPZA 3C8ZA 2HKIA 4TMWA 4OO3A 4G8CA 5JADA 3FF4A 4DXAA 3A70A 3DWFA 2BONA 4MQ5A 1JSRA 3EMDA 4F4HA 3OEHA 4Q12A 3KUKA 3EWSA 2WWRA 3QI2A 3QX8A 2X4GA 3KQHA 4N8EA 2CVPA 2ZETA 2BFMA 5SYMA 1KAEA 3KM0A 4V0MA 5LMZA 3M82A 1O4WA 3QJZA 3P9NA 4RSYA 3IIKA 1OY3D 3HCOA 4UVDA 5D00A 4CLDA 5CBPB 4LEUA 4X8QA 2OUIA 1GM5A 2H08A 3KPYA 2V97A 3UPTA 2C5GA 2WK1A 4EPVA 4YJ3B 4BKRA 3A6FA 4D02A 5A9RA 4G4IA 3OM1A 4M9XA 4A2QA 3A1NA 1HLDA 3QF7A 1XU4A 2JBHA 2H85A 4IGFA 5AM0A 3SR0A 2N46A 1H9AA 3BE4A 8MHTA 2QPOA 2YRWA 1RJGA 1XL1A 3M6IA 2NXCA 1X8XA 2PBLA 1TT5B 1I4DD 1Q2UA 1GCGA 2VDWB 3JYNA 821PA 1DJLA 3NIWA 5ES4B 1ZI8A 3SZGA 5KCZA 4GDMA 2Y3IA 4F21A 4ZTBA 1NVGA 2H17A 3UA4A 4AQ7A 1RAHA 4OQDA 2VDPB 2P9NG 3KK0A 3A6KA 2BGTA 4S3MA 2IBSA 2VZLA 2FTKE 1TVEA 1MRZA 1TNBA 3FWPA 4BNWA 1QLJA 4HYQA 1GLVA 3P71T 2XT0A 3KQLA 1EBBA 1GP2A 4D3DA 4MRAA 1XGWA 3NOQA 4RDHA 4UPDA 1NFRA 4EA8A 5A0VA 4X6YA 3WMEA 1OAOA 4MBGA 3KALA 3C5HA 5KQGA 2ZJBA 2WXJA 3NHBA 5E0OA 3CRNA 1KP2A 3P2IA 5KWSA 1CJSA 4EVIA 4PGFA 2OG2A 4EFLA 1H19A 1BHSA 1DRVA 1MVOA 3ELUA 2MDTA 3QVMA 4RG6A 1L9KA 5FOWA 5F5NA 3EXAA 1XMIA 3QFFA 1MFZA 1OA0A 2PAAA 2PJZA 1TQ6A 3A2MA 3DEHA 3LL4A 2XVAA 4K7JA 5E6SA 4WFIA 1CW2B 4GI7A 2C5HA 5ALHA 2XDYA 2GN1A 2OFWA 4IQ0A 4TTQA 3L7YA 4HB0A 2VXCA 2V5VA 3PXCX 4V0ME 4YCAA 5FXMA 2NP6A 1EWQA 4JQCA 4CUKA 4NYIQ 3MMZA 1X74A 2H6HA 1GVNB 4Q1EA 2H2HA 3BL5A 3FPFA 3JV7A 3QQ5A 4I9HA 4TTVA 3VR2A 4BYGA 5DNYB 4RTJA 3QUSA 3ND6A 4P58A 4Q01A 2ZWIA 4DANA 2X42A 2X22A 2ZIUB 1I32A 1I2DA 4BAZA 1EXDA 4TUUA 1KY4A 4DLBA 1I30A 3AHIA 2ZIWB 1XPRA 2EKZA 1Q0TA 2C58A 3AUTA 2O5RA 1NUAA 2B1QA 3KSMA 4QGFA 3WDSA 1LC3A 3O83A 4HVLA 4ZI7F 3EUAA 3I37X 5PGMA 4DWWA 5A3QA 2AUTA 4WK6A 2NZ2A 3O8QA 4JJAA 1H0KA 2XV1A 2WNHA 4OBXA 2DLNA 3ONNA 1E0JA 4FXOA 2Q3FA 1HDYA 1QR2A 4IO1A 1VHTA 4A9AA 5BSMA 3J7AC 1IHDA 3KEMA 3QFTA 5SYNA 3K9CA 5DNEA 5KCMA 4ZFHA 2XVYA 1QQ7A 2XYHA 3DC7A 2NO9A 2F3UA 3KSQA 4JP2A 3AM1A 1VXOA 3AI2A 1NVMB 3RNLA 4XX1A 5MF6A 3E0XA 2NU7A 1BROA 2H16A 3FD8A 4R1NA 5CPFA 3QXGA 1TLLA 5JCPA 5JQGA 2GK3A 1EXMA 1JQKA 1JHZA 1KJJA 3A28A 3EIQA 1KSJA 3EXHA 3GD5A 4I8XA 4WZBB 3L41A 4DJFC 4UNRA 5KS2A 3LDAA 1T5HX 1Z56C 2GAIA 4PYQA 5I3CA 4YEDA 2J3QA 4Q7JB 1VIYA 3SYMA 4D81A 3FDXA 3CVOA 1BGXT 4I1SA 3RREA 2WYUA 4KE6A 2PZLA 4FFSA 5AUQA 4FTWA 4GPTA 4UE3S 4DV4B 3B1ZA 1FYEA 1GARA 1OHHD 2V7QD 1XEWX 3FPGA 3DV0A 5K6AA 4B6SA 2CHFA 3TLEA 5LA6A 2D13A 5IYZF 5A05A 4KVMA 1W75A 2GSWA 2VWPA 3IXLA 4EFMA 1T2DA 2O06A 3A4MA 2WTMA 1JU9A 1IBCA 5B2FA 4QULA 4BMNA 4ZO6A 4DLVA 1U3UA 5JANA 4HYEA 4Y2JA 2CJWA 5LA6B 3KOMA 3H9QA 3DOFA 2B8JA 3DE1X 3HABA 3RUAA 5K8TA 3QH4A 5GQSA 2WPNA 4PPNA 1G3QA 4HNRA 1C7JA 1V26A 4TTRA 2Q7DA 5DNDA 5G1PA 3AL2A 3EA0A 2HOQA 3RJTA 4FYPA 1I7SB 3AUSA 1IB6A 4HB3A 2I4NA 2ZPTX 4EELA 2F67A 3FHEA 3EHMA 2J9GA 4Q3KA 4P0QB 1DP4A 1HURA 2G3YA 1YVDA 2R44A 4NKRA 2GPBA 1UZAA 1S96A 3ZCRA 3ZNGA 5IVHA 2ZXUA 1P1BA 3ZHEB 1CR4A 1KP9A 1FFDA 5CLIA 3A9RA 5JCOA 1UJRA 4V24A 1LJLA 3ZGOA 4CT4B 5HYVA 3THWA 4CTOA 3R7WA 4BC0A 4ZQIA 5KNBD 2EV9A 3I83A 5JVDA 3UINC 1OT3A 4NC9A 3V8NA 1IVYA 4JLSA 3FU3A 2GZHA 4Y6OA 5FUBA 3UJ6A 2B7BA 4LV8B 4IIJA 1CK4A 5L3ZA 5SZJA 1JMVA 4QXMA 2QORA 4Y8VA 2GPWA 3DZGA 3CLTC 1HLGA 1UMBB 5FEMA 4H7FA 4RPCA 1N2IA 5G40A 3VH4A 1RLMA 5JNWA 2YZNA 1T9GS 1QBGA 1H22A 4MGYR 3CK9A 4MICA 4R2IA 3ROFA 5B4VA 1JHXA 2FR0A 1XDSA 3Q7RA 1C0KA 4YI3A 1F8XA 3SFYA 1JDBC 1ZHHA 2JKZA 1SKYE 2XODA 3VPCA 2UZIR 4KHZA 2CUNA 2R02A 1JBKA 1TKCA 2QLTA 2ZUBA 4S1NA 2GPYA 4NYIR 5FKJA 3AWDA 1QU3A 3BTUA 4KO2S 5B37A 4OHWA 4BNVA 1W48A 5JVDF 1QYVA 3DAYA 2R8OA 1S64A 1P72A 1SXJD 1XQ1A 2FN4A 2LV8A 4XVUA 1A9ZA 1G5RA 4Q82A 2QSUA 1D6MA 5EZYF 5AM1A 5CRIA 2OV6A 3KAPA 3PL1A 4WBNF 1DC8A 1DXYA 4MWZA 1NW9B 4X61A 4RQTA 1LPNA 3PJEA 4ZJUA 2VHZA 5FBHA 2C5FA 3MJVA 3STYA 3AEUA 1KQPA 1N2JA 1WTAA 1YR9A 2IHTA 3L84A 1XMSA 2ZSKA 2JKVA 5T4FA 2OXCA 3HV2A 3FCAA 1GGFA 4JJ6A 4XQEA 1JWBB 3HXPA 3KZNA 3S8MA 5ADUS 5EVCA 1E1RD 2HWYA 4B4OA 3T99A 3CCCA 4UTOA 3SC4A 4ER3A 1SOAA 4BERA 2PM7A 3VVCA 4BO9A 4RZIA 4UQPA 4RY2A 2R6AA 2QPTA 5T8KC 2QGNA 4PSCA 5H5JA 4YB8A 5C1OA 3FCSB 3OTWA 2PDAA 4GTOA 3LX8A 3EN0A 1TMGE 2DHEA 2PRSA 2YN2A 1E1KA 2ILRA 1L5HA 1JW9B 1R4MA 3OEYA 3SYNA 4X1OA 2BY4A 2EFCB 4TMYA 5EESA 2X0DA 5SZKB 1XZNA 4OQZA 4Q24A 3IALA 3T9CA 5KO2A 3II6X 3S40A 2VGYA 1GV1A 2HV8A 1N6LA 3TUJC 1L5WA 2EGHA 2XBLA 2H4JA 5KC9A 2O8CB 3TOVA 1E8OB 2X8LA 3OCVA 4D8YA 1KAMA 1TM5E 2EJBA 2IOFA 4K86A 4BNNA 1YBFA 5CXXA 2ZM6B 3ZK8A 1KH1A 1FMCA 4JCCA 4ALNA 3QHQA 2PLNA 3DM9B 2ZT7A 3RROA 3EUWA 3KAKA 3NHKA 1MX4A 3SF4A 1ISFA 3DDCA 1Y5LA 5BW8A 1YZFA 2COEA 3HR4A 2DF8A 2WFMA 1DZ3A 1T3GA 1V7ZA 4ZV7A 3R5SA 1NMXA 1P1CA 2XUGA 2ZRCA 1MC1A 3MTDA 4C0QC 1SXPA 2B69A 2NU9A 2FWMX 3ZI0A 4NIKA 3AJAA 3AKZA 1X1TA 1J0XO 4ALLA 1M74A 2YIJA 3WIEA 3AZQA 1GQOA 1KJZA 3LDFA 3WWYA 1B41A 1DJQA 4BESA 1OKKD 2EERA 1PQUA 3GP5A 2Y4NA 5EAIA 4R9NA 4F1JA 3CF4G 5JHBA 3DEIA 4E5DA 3BMNA 5CM9C 4FW8A 4J3JA 4F85A 3ABQB 3L7AA 1R4NB 2FBNA 2O3SA 1P2FA 3AF4A 5I7EA 3KHSA 5FBLB 4A6XA 2JFUA 3S6JA 3ZG6A 2NQ2C 3CV3A 3E3LA 3B8HA 2GGFA 5DE3A 2OWDA 3FHOA 1HQKA 4NOLA 3VAAA 1H66A 4AU1A 1RM3A 4WBSA 1RE1A 1JEEA 2O4CA 3E9QA 4FHZA 1LTHR 5ALYA 4UEWA 4EJ0A 4YCMA 4YECA 3RQIA 3WYDA 5MDHA 1NN1A 1R27A 3BFPA 1IJFA 2P6OA 1EZ1A 5JMTA 1OVGA 1Z8FA 2QI9C 3BVPA 3DXYA 4EG0A 5G04J 2J59A 5LXTB 2DLDA 1RYFA 2V6IA 5ES3A 2O8CA 2C1ZA 2YQZA 1U0FA 3F7TA 3CU5A 2ODQA 4KXFB 4I6JA 4AJJA 2H2GA 1E8ZA 3JQ9C 5K6AC 2FWIA 3SBDA 1TAHA 1NXWA 3M0EA 3R5KA 4OFXA 3A1WA 5ICEA 3PLRA 3R44A 2WJGA 4DQDA 3IAM1 4G01B 3QNMA 3RBXA 3BQ9A 1TZJA 4S2UA 4AL4A 3NJ8A 3AHEA 3ENKA 3WIVA 3U1BA 4CYMD 2PSFA 1VECA 3UICA 1RM5A 3ZHCA 3LZCA 3KDAA 3HSKA 4TL6A 2G72A 4TSRA 1BD8A 1QXSA 2NU6A 2WV9A 3CSDA 3H1AA 4WMLA 3IH5A 3QVUA 1TJ3A 3MQ2A 5EIOA 4UUNA 1W5FA 5J59A 1F2UA 2NVOA 3O4ZA 3BMNB 1PGJA 5KOJB 4LSZE 1QYDA 2OYCA 1WDMA 1U2PA 1G8JA 2WJVA 1J00A 3ST7A 1NVAA 1DHTA 1QHXA 3TMAA 4JJ4A 2E5WA 1AY0A 1L5RA 2HA5A 3CHPA 3MQFA 4LPKA 2IP1A 1VDMA 1J0EA 3A2NA 2Y68A 1Q57A 2R751 2XKKA 4PFJA 4PZZA 4R2XA 4FE3A 4NV3A 2VBIA 3TQHA 4HNAB 3NEYA 4RORA 1PG5A 2NAFA 3VTZA 4ME2A 1IWPB 1TKRA 3DB1A 3A26A 1PV2A 3QU2A 2CCKA 1D4OA 1USUA 4MPDA 4J49A 1O6CA 1OC4A 3FFXA 1OCEA 3HXLA 1ST3A 3AHDA 4RXMA 4F4FA 4I19A 2JLUA 1BQ4A 3DKRA 3QFRA 3EPHA 2AQ8A 1JH8A 1H5UA 3LRXA 1I7NA 4IJKA 3AR7A 3EVZA 1E1DA 3TRJA 1J8QA 2MR6A 1M1YA 2GVNA 1NVKA 1P0CA 2QVCA 4RA9B 3ZQKA 4COKA 4G24A 3K94A 4TKZA 3KZVA 5B7PA 5JSZB 2VAWA 3WGKA 1LTQA 5HBRA 1IHGA 3V4VB 2VATA 5HJEA 1SKQA 5HM6A 1WB4A 3L1HA 1Z83A 1ZH0A 1C14A 4KMRA 1HYHA 1Y98A 3CLRD 4OQPA 1B8VA 2XBUA 2EFEB 2FMHA 3WK9A 5ALTA 4JD5A 4P29A 4KWIA 3LH5A 2DWCA 3VNUA 3ASDA 5AN8A 1DKMA 4ZGGA 1YAHA 4NBNA 1XNRB 3ZCPA 2Z8XA 5CCDA 4RTSA 3BXZA 1EFVA 2R6R1 2X6IA 2VHWA 1ENZA 3Q6IA 4NP6A 3OUUA 3X2FA 3ZU2A 4RHUA 5I4KA 4JLDA 2ERYA 1JWAB 1UXJA 4R0MA 4TWAA 1S9DA 1ZITA 1FYWA 3SHTA 2JIBA 4HX5A 1GL6A 2VAXA 3FROA 1BX0A 4N03A 4QOGA 2PQNA 3K5IA 1Q0PA 2VPWA 1E6EA 1WZCA 4S0ZA 4F1KA 4ZV9A 1XVLA 1QBKC 3BK1A 3LX5A 3P32A 1ZY2A 2O50A 3Q3VA 4ZAVA 1V6SA 1IBRA 3TAHA 4CCYB 1EHCA 1Z38A 5T3YA 5C35A 3H2IA 4KXVA 2B4AA 4NZ9A 4L5IA 3V1NA 4RQIA 4MUYA 4MI6A 4UFOA 5BWOA 2Y1LA 3P96A 4PQRA 2R1UA 1MC8A 1WY5A 2ZBUA 3TR0A 3U7JA 4QU5A 1EVKA 2GH1A 1H8HA 3I23A 1UFKA 1WVGA 2QZ9A 1KRHA 3D3KA 3GQBA 3JQ8A 3OI7A 4I43A 1XD2B 4RZHA 3LTEA 2X8AA 2ILTA 4ZHQF 4MIOA 1XPJA 3U7RA 3PTAA 3SXPA 1EP1B 2ZWOA 4Q4LA 1IONA 2B7LA 3DBHA 3GGDA 2H65A 4URZR 3RW9A 5ARCA 3A37A 1HNZB 3IQEA 3IIEA 4IHAA 4B85A 3NC4A 4IIVA 4NZYA 1N6RA 1U0HC 2I4OA 3M4JA 2BKUA 4CODB 4DBLE 5GZ1A 3QEAZ 4EYQA 4IBOA 2B4RO 3RUHA 1CLEA 3KQUA 1DE0A 1P7CA 2CG3A 2ZQ5A 4LHYA 4CEIA 4YRPA 4HQOA 3RC2A 4C6TB 1G60A 2V7QA 4PRZA 3KT0A 1R9JA 3AJDA 2WXPA 2NXEA 4DMGA 3NAWA 2XNCA 2XOEA 1GKUB 1W5TA 3FHJA 3QLEA 1QQBA 3FTFA 1JZSA 3PEYA 1V16B 2JC3A 1MA3A 1OZ0A 3C3YA 3ICPA 3WZLA 1C4WA 2ORED 1Z4KA 1RZUA 4LOJA 3EBOA 6CHYA 2O2YA 2GO1A 2C9YA 1EGAA 3LFUA 3KKQA 3KYCB 3PR1A 4ML3A 4QXPA 3SE0A 1WD7A 1UWKA 1NMQA 5CAEA 1UJMA 1KFEB 1VB5A 4MEAA 4H15A 3WYAA 5JCJD 1O9HA 3VBCA 4TN5A 1EJ0A 1K3TA 3H3FA 3C1AA 4YT5A 5HKKA 2NGRA 4FFMA 4C0BA 4OX9Y 4JHLA 2WF9A 3JD1A 5C7LO 4HI9A 4P3PA 1FT2A 5G0VA 4EW6A 5C7YA 3FTNA 4OPMA 4OHRA 1CP2A 2H57A 3IMEA 4HJRA 5IDXA 3OIVA 4JROA 1J0CA 1ZAKA 2CXQA 2HQRA 4FX2A 1HZ4A 1Z6GA 2GDJA 4LI0A 2JAXA 3IRVA 5D1NA 5BR4A 1BWSA 1KO8A 1HT0A 2GFQA 1IBSA 3BXHA 1GG5A 1SBTA 3G8YA 5B1HA 3NC1C 1P6UA 2VJOA 4C6RA 3A1FA 4F7DA 1QWOA 4WECA 3PXEA 4MVJG 4MW6A 2FWAA 4L3OA 5JAZA 3PGA1 4RETA 5DX1A 3RYIB 4NMMA 3ZWQA 2XD9A 1AM4D 4H6VA 3U5ZB 1QQEA 1E8NA 1M1ZA 1DUSA 2YCBA 3L77A 3ICQB 4WOPA 1Q0ZA 2WUDA 3GLRA 3BDVA 2DC1A 1M9NA 4QYIB 4OLAA 4B6RA 1RVV1 2IJGX 1P6QA 3TXAA 4H1TA 4EEKA 3IHTA 3ODPA 2O8FA 3CX6A 4S24A 1KAOA 3DOOA 1XVIA 3ON5A 3PVSA 4PV7A 4QNMA 4ERNA 16PKA 1XGKA 3PGMA 5FWXB 5DGDA 1JEQB 3PHCA 1JSLA 1WNTA 3CLSD 4KYIB 4DBVO 3QX3A 4KK3A 3FFLA 1C81A 1MX5A 2Q2NA 3KQWA 2COUA 4IX9A 4PXSA 1RKQA 5AW5A 2CMFA 4D41A 3K7EA 3D2AA 3BH0A 3UMCA 4GLOA 3T3EA 3A04A 1AKVA 1VL2A 3LBIA 3OCXA 3EDMA 2I7XA 3ESXA 4M0UA 5ALDA 1QVAA 2IU1A 1YR3A 1W36C 4ZRDA 4GI1A 3N75A 3G2PA 3LYLA 4Y2YA 2XBMA 5IK2A 1TKAA 1GL3A 2EVWX 3PCRB 2IONA 2RSFA 2CLMB 4MQ6A 2QDXA 2V58A 2W2KA 5JARA 1J6UA 3NUZA 1KQFA 4HUTA 4P22A 3BJEA 1YF3A 4O4JB 3FNQA 4ZANA 1RLTA 2FUEA 3MX3A 4M7OA 4MMYB 5EIFA 2PWPA 1NVFA 2CXRA 4UOEA 5JJCA 4UCFA 3CR8A 3D4NA 3ZCQA 1U9IA 4HC4A 2XEEA 4I46A 2RAPA 2QHXA 4AMGA 4ND3A 3B6KA 4R2LA 4RZQA 3T7DA 2VQFB 2OOKA 3HUTA 3PQDA 4HDCA 4XVRA 4UMDA 3LS8A 4MP6A 1L4GA 5IN4A 3QMPA 1Z3IX 1WD5A 4QQKA 4ZGBA 5KIAA 3WSWA 2QUAA 3LL7A 2J85A 1WE2A 2CBXA 3UKUG 5I3ZA 1ZZGA 1XAHA 4RTRA 1SG9A 1OWMA 3WDMA 1CYDA 5A0TA 1IEVA 1VHWA 1OGIA 2ASVA 3JAKA 3NBQA 3KQOA 5L7WA 2VKQA 2FR8C 4DJEC 4P0TA 3A9TA 5DOZA 4LVUA 4AIFA 1FVOA 1LTKA 2E82A 5DYGA 2JLQA 1EU1A 3I01M 3OLXA 4Q05A 3H97A 5E4JA 1J56A 2WB4A 4Q66C 4IDHA 2XE7A 3QFHA 4PS1A 4LJRA 2DP4E 3ZQUA 3NDBB 5H4GA 3O4RA 3BIJA 1ML4A 2Z6VA 3NFRA 3KQPA 5CYFA 1NBME 2X9VA 2HA2A 3U0BA 3DMFA 1H1TA 2AYZA 2H1RA 3C3PA 4NCJA 1JLLA 1TL7C 5FTJA 3U9LA 1GGVA 4R40A 4R9SA 4L3WA 3VTKA 5K0SA 5IKXA 3H4VA 3MYVA 3QYJA 4HPJB 2AEFA 1NLMA 4QRDA 3GFGA 3CG4A 4HDRB 3HA7A 3NC0C 4YASA 4EDHA 1JI3A 3N39C 3IEGA 3E18A 5HWSA 4RO0A 3VXKA 3RTAA 4GDFA 4KHPB 3G9XA 1FUUA 4IOKA 4ND6A 3R6TA 2GI4A 3CX7A 4L9WA 3UQ3A 3IIMA 3LLCA 2GXAA 3V48A 5KTTA 4C9BB 1GSIA 3ADOA 5KVCA 1TJYA 1Z2PX 4W82A 5ANRA 2GN9A 3QI7A 3VR0A 2W7TA 3EFEA 2CD7A 3FLBA 3IBGA 3R1IA 2VN8A 4BKQA 2ORYA 2FJBB 3UOWA 1JHAA 4L9PA 2H9AA 5CNMA 1M8KA 4M9QA 4AZ3B 3PD7A 3OSUA 4WUYA 2VNJA 4BO2A 1HO3A 1NRXA 1A1VA 4EYSA 1DS6A 1K5DA 4OQFA 4FEAA 2OHHA 3GJ6A 2DHRA 2ACVA 1AQUA 1T9DA 4R6WA 5JI3E 2PJUA 2PMBA 2ZT6A 5D8DA 4FP7A 1H2VC 4M0DA 3IV6A 4POAA 1JAXA 1L7PA 4K9KA 4LYEA 4JS0A 1IPEA 2PLAA 1W46A 1RJ9B 4A36A 1BH6A 3MK31 3PVCA 3HFJA 3RS7A 1EX7A 3LBYA 4LPSA 1RP1A 4PG6A 1W85B 4P7BA 4QPCA 1UDCA 3RK1A 4XSHA 8ATCA 3ZE7A 4EYOA 2B6NA 3H5RA 2JCYA 1YA4A 2Z3VA 3ZNOA 1AUXA 1T36B 2CFRA 1HPLA 4TRNA 4ZHSA 3OEHD 1XHLA 4JYPA 4XDHA 2DKNA 2RAFA 5JISA 4TQUS 2Q9BA 3LHDA 1ECCA 3W9BA 1UC5B 2QZPA 2PFSA 1YA0A 4I3HA 1GCOA 4YCLA 4YY3B 4I9GA 2Z2JA 2OLEA 1RU3A 3JQFA 4ZYUA 4FKMA 3T7TA 4CM1A 4W8OA 1YS7A 1X1BA 3UT5B 4KE7A 4DIOA 1U7HA 4NBKA 5LSAA 1H9BA 1WMEA 2P9HA 1YJ8A 1LEHA 3DSRA 3LJNA 2GD6A 3RSLA 1YTUA 5LOVB 3C85A 1IH8A 4P98A 4V0LA 3T5BA 1DBSA 2M32A 3G0OA 1EX6A 2NUTB 2AL7A 3M3DA 2Q1WA 4GG1A 3AR4A 4YAJA 4UI9C 2XITA 3NKVA 4XKCA 4D2IA 3B7SA 3A05A 1EFAA 3WYEA 3FY4A 4G23A 2A5YB 5I8WA 1DPGA 1CJVC 1XZFA 5FLXA 1SC6A 2QX6A 5DBEX 3RRFA 1CTQA 4CLXA 2NYJA 4PGMA 1NZNA 1CG6A 3VTYA 1ZQ9A 2VP0A 1PP4A 2ZRPA 3C15C 5IXYA 1O87A 1SMKA 4FK8A 3PHGA 5HF5A 2HBQA 4BVJA 3FJOA 3WYGA 3WWEA 1ZUNA 1JVSA 1F7UA 2CNWA 3ORYA 2ZAGA 3L46A 1T1SA 1YMUA 4MQ4A 1HLPA 1RWXA 4JB8A 4NCHA 4EA6A 4TVKA 4B3XA 3F73A 4ARIA 3ZWCA 5LJIA 3TZEA 3ZXXA 5U4XA 3W9FA 2REOA 4JHKA 1RRPA 2VNIA 3H2GA 4RLFA 1OPRA 3OOJA 4HDMB 4LOHA 1T8RA 4M60A 4NS4A 4PLPA 3TTVA 4RIFA 4XCQA 4HVCA 2JCVA 4FE7A 3R5HA 4Z9AA 4DDVA 5ICGA 1TM7E 2EILE 1TCCA 4R2MA 1NBHA 2R5NA 4LJSA 1F48A 4OGLA 3TZHA 3QPUA 4BLVA 5CB0A 2J7KA 3TI9A 1TLFA 4G8DA 3DQQA 3H0CA 1NVDA 4TGLA 3DGFC 5EKXA 3F98A 3ET4A 3WNCA 4V1CA 1WKVA 1T6BY 1RW4A 2SCUA 2XADA 2YC2C 3B1KA 2OFOA 3DAHA 3GJ0A 4DMFA 3JQ0A 4QJ4A 3QQPA 1V8OA 3U6BA 1GT6A 3AR5A 4MV3A 4F9FA 2GEDA 2SHKA 4HQ6A 1JJFA 2OYSA 3Q5DA 2KBEA 3JQAD 4PTLA 3T61A 5ALVA 3I0ZA 5GJWC 2UUPA 3DHEA 1PFQA 5LDGA 1YUMA 3CB2A 2OHFA 2BBSA 4M86A 4QWMA 2DYRE 1MH1A 2PCLA 3VU8A 1NF2A 1CQIB