3PE4A

Structure of human o-glcnac transferase and its complex with a peptide substrate
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
714
structure length
695
Chain Sequence
THADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title Structure of human O-GlcNAc transferase and its complex with a peptide substrate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 275
structure length 695
sequence length 714
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pe4A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pe4A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 3pe4A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3pe4A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pe4A03
3C4VA 3ZHEB 2R4TA 2VGXB 1QZ2A 1NVKA 2QRQA 3CUWA 3WC4A 2BGUA 3MT7A 4APOA 4FKZA 1KLXA 3E3NA 3VUFA 4G23A 4H7XA 3OTIA 2UY1A 3MT9A 1WV1A 2O6LA 2FO7A 2XGOA 5BNWA 3VUEA 2XPIA 2H1HA 3OKPA 3SZ7A 2JJMA 3G2HA 4RBNA 1FCHA 3QWVA 2YQ8A 2ACWA 3CEQA 5BW8C 4O6FA 1Z8DA 1FC0A 2C9ZA 1P4GA 4WNEA 4I17A 4W6QA 3GUHA 1L7XA 1GPBA 1NZDA 3E3LA 3ESKA 4BQEA 2PL2A 3MKRA 1GGNA 2LSVA 4BQIA 5JTUA 3DD1A 4LDPA 1GPYA 3COPA 2PQRA 4M83A 4AN4A 1PNVA 4J0UA 4EL5A 3URZA 5GPBA 3Q4AB 1XNFA 4UI9J 4WUYA 1P5QA 4RG9A 1P2GA 2YJNA 3RJVA 3DDWA 3G2LA 2ATIA 3T5TA 2KC7A 1F0KA 1JIUA 1K08A 3EBOA 3ASHA 3KD7A 1HZ4A 5EKQD 3ZCUA 1Y6FA 1ZBPA 4I2WA 4YUAA 1RZUA 2IEGA 1XV5A 4G2VA 3RO2A 1FU4A 4X7RA 2E2EA 2QN8A 1PYGA 3GZ2A 2G9RA 2QNBA 2ECPA 3CEMA 3S28A 2QN1A 3HBMA 5D01A 4N3BA 5EX3A 4Z5XA 4A1SA 3VDNB 1M5RA 3Q5MA 1BX3A 3JYSA 4RG6A 5DU2A 4EKYA 3NCHA 2XMPA 2F9FA 3KS2A 2HR2A 4AIFA 5TVGA 3CVLA 2F3UA 4MI9A 1IHGA 2QLLA 2QRHA 2F3QA 4U0ZA 2X0DA 2VQ2A 1IIRA 3G2KA 2AVPA 3MT8A 3Q3IA 4QLBA 2VSNA 4NRHB 3UYLA 4GZ3A 5FZQA 1XL0A 3OTGA 1V4VA 1E96B 4L22A 1TJCA 4B94A 5HXAA 2I6HA 2GT1A 2IF4A 3NC4A 3WXXA 1Y8MA 1NA0A 3CEJA 3PE3A 2SKCA 2FF4A 2UY1B 3Q49B 4HOQA 1P2BA 3NP7A 3NF1A 3UYKA 4EQFA 3QDNA 2OOEA 3S27A 1GG8A 1JIVA 4RIGA 1NLMA 4MHOA 4ME2A 4G24A 1QM5A 3BCRA 4HWGA 1K06A 3LY7A 5JJ6A 4XI9A 2R66A 3MQFA 2VCEA 5DBKA 3OKAA 2IV3A 4LEUA 4GA2A 3S7JA 4BT9A 2FFRA 4JL0A 3DZCA 4GYOA 1NOIA 3TG5A 2Q7FA 3AS5A 3L7AA 3CK9A 1J39A 1EXVA 3ASGA 3Q3HA 1Y8ZA 1B4DA 3CK8A 4J8EA 5ARGA 4ABNA 2C0MA 3D0RA 4WHMA 1YA6A 4GYWA 2YHCA 4N3AA 2IFUA 3ZGQA 3MTDA 4BQFA 4BTBA 3QOUA 1NA3A 4JHRA 1WW3A 3EBPA 1P2DA 4BTAA 5I45A 1H5UA 1AHPA 4GYYA 1UZUA 5LQDA 3MRXA 3D1JA 3NAZA 2JLBA 3MTBA 3QHPA 3HYMB 3AMVA 3ZCRA 1FTQA 1L5WA 3AS4A 1L5SA 4F96A 3OTHA 3CVQA 4BWRA 3L79A 3IAAA 3BD8A 1C3JA 5ENZA 4KBQA 3LCAA 3UPVA 2PRIA 2F3SA 5TMBA 3PE4A 4KYOB 4RENA 4F9FA 3E3OA 2ACVA 3HBJA 4CGVA 4AM9A 2PRJA 3FROA 5A7DB 2R4UA 4F3VA 4M60A 2ASVA 1HXIA 2P58C 5ARFA 4I2ZA 3WADA 3TG4A 3RO3A 4G2TA 4YVOA 3BDAA 3LKUA 4G1TA 3DDSA 4LEIA 4CTNA 3S0JA 2L6JA 4UI9C 4GZ6A 3MRTA 3ZCQA 3T3GA 2KS6A 3CKBA 4WNFA 4NEQA 3L7DA 2QN3A 4X7MA 4NQ0A 1Z62A 3T3DA 1PN3A 3RSCA 3ASDA 5KJMA 4N2SA 1P4HA 2H1FA 3CUTA 1AXRA 3ZFWA 3Q15A 3S29A 4UQXA 2C1ZA 1GFZA 3CX4A 3EDTB 1PSWA 1WW2A 2QFCA 3OXGA 5FZRA 3RU0A 3NPAA 3L7CA 4G25A 7GPBA 3H4IA 4RIHA 2R60A 2BUGA 3MV2B 5FTPA 5KJKA 4J8FA 2PYIA 3MS4A 4WACA 4CGWA 5DXFA 1F6DA 5HI7A 3AS8A 3ZHEA 3GYZA 2QRGA 1XOIA 5G05J 3TAXA 2KCKA 2BISA 5D0OD 1OUVA 4GZ5A 5JJTA 5LCWC 1UQUA 5TMDA 2QZSA 5LCWJ 1RZVA 2KCLA 5IKPA 1JG6A 3C4QA 3MS2A 2IUYA 3S7FA 5D00A 3TOVA 2PQNA 4GA0A 1EM6A 1PC2A 3MA5A 3S7DA 2GPAA 2PYDA 4AMBA 1HH8A 8GPBA 2C0LA 4MICA 4N3CA 1P4JA 2GW1A 4WNDA 2XCIA 1Z6PA 4N2QA 4CTOA 2IW1A 4I9EA 3T7DA 4H7YA 1ABBA 1YA0A 2BGTA 3CKCA 4MI6A 1VGVA 3LPZA 4GPBA 3ZCVA 4RIIA 1KTIA 3FWVA 4NESA 3LYAA 4Y6WA 3C48A 2XGSA 3CUVA 2IYAA 1SXPA 1WAO1 2PZIA 2MHKA 2XCCA 3GW4A 1JG7A 3HBFA 2VCHA 5JTTA 3RHZA 3CV0A 3IA7A 3MBOA 4HOUA 4N5CA 2QN7A 4X6LA 1ZU2A 3R9AB 4CTMA 2V5FA 1WUYA 4KQ2A 3HBNA 5G04C 3CEHA 1B89A 3Q47B 5IKOA 3Q3EA 4GA1A 3BEOA 2FBNA 2SKDA 1O6CA 5G04J 4RIFA 3SYRA 4GCNA 2XCBA 2PQ6A 5FJYA 3U4TA 5KJLA 3UQ3A 4NC9A 4YI5A 2G9QA 2C2LA 2P6PA 4MHSA 4PQGA 1A17A 3IEGA 1XL1A 2Q6VA 3ASFA 2HY7A 1L5RA 2AZDA 4KQMA 5DIZA 3ZCSA 4AMGA 2GPBA 4EJ2A 3WAGA 3ZCPA 3S7BA 2SKEA 4JA7A 3O48A 2X6RA 1QQEA 1E1YA 3BD6A 3OT5A 2R5SA 4WADA 3OY2A 2IEIA 3LY9A 2J9QA 3CVNA 5CHEE 1L5VA 4U0SA 3RKVA 3NB0A 1W3BA 3RSZA 1A8IA 4CDRA 4WNGA 1GZ5A 4RELA 3FFLA 2GJ4A 2G9UA 2X0FA 2QN2A 1Z6QA 2KATA 1C8KA 1JIXA 3ZCTA 1FA9A 1NZFA 4YI3A 1JEJA 4IN3B 3CV3A 2GEKA 1LWNA 3ZPJA 2VG8A 1WM5A 4I1AA 3T3IA 5EX0A 3RT1A 4X7PA 3VTYA 4FZRA 2Y4TA 2WQHA 2LSUA 2GPNA 3QWPA 3QKWA 4UQZA 1RRVA 1NZNA 4U04A 4HLNA 1ELRA 3OKCA 6GPBA 1KT1A 2WTXA 1FTWA 4XIFA 1FS4A 3FP3A 3SF4A 5M72A 3OXFA 4N39A 1SXQA 3K9IA 1UQTA 5AYWD 2GEJA 2ONDA 4REMA 4KXKB 1GPAA 3MV3B 3ZN3A 1QKJA 3RIBA 2FEZA 2FF5A 5G05C 1P29A 2VGYA 5TMEA 1WV0A 2R68A 2JZCA 3MSCA 2VYIA 4UI9K 3BD7A 3T3HA 2VGXA 2Y4UA 1NOKA 2QRMA 1LWOA 5CCLA 4EKEA 3G2JA 4BFCA 3ULQA 5D0QD 5CCMA 1IYGA 3CK7A 1L5QA 1C50A 2F3PA 4Y6CA 4HOSA 4F97A 2DBAA 3QWWA 2XCUA 1YGPA 3BCUA 4GPKA 3CVPA 3QKYA 3PDNA 4U0UA 3CUUA 3TSAA 3LY8A 2XGMA 2X0EA 2GM9A 4U07A 2QLNA 4KQ1A 2HO1A 3H4TA 4W9RA 2UWJG 2WPVA 3OXLA 4HOTA 2BFWA 3G2NA 2AMVA 2XA1A 3T3EA 3MS7A 2LNIA 5A6CA 4M7PA 2HYZA 2QN9A 3NP9A 1NOJA 1WUTA 1FTYA 3GZ1A 1FU7A 2XA2A 4JA9A 4MI3A 3MTAA 4G26A 1E4OA 2G9VA 1ELWA 1KT0A 3MEKA 4AY6A 4HORA 2AW3A 3L01A 2FETA 3N71A 2OFFA 3G2IA 2AV6A 3TGOA 4BT8A 4I9CA 5HQ8A 5BT1A 3D0QA 5KJNA 2XEVA 9GPBA 4RIEA 2QLMA 2IV7A 2VSYA 5FT9A 1C8LA 1FU8A 3KAEA 1XKXA 3SYMA 1L6IA 3S2UA 3E4BA 3UUXA 3BCSA 3CUYA 2IYFA 1IXYA 5DLDA 4YVQC 4GCOA 5C1DA 3VDMA 3L7BA 4EL0A 2XA9A 3O3CA 2X6QA 4J8DA 4AY5A 1HLFA 2KCVA 3GPBA 2ZB2A 3VTXA 2C1XA 3MRVA 2C4MA 2NC9A 3BEEA 4YNDA 3U3WA 4UQYA 4XI0A 3OY7A 2FI7A 1XC7A 4N9WA 2QRPA 5FZSA 1Y6GA 5JJ7A 4MRAA
chains in the Genus database with same CATH superfamily
2R8OA 3ZHEB 2J0EA 1NUAA 2CVQA 1SHLA 3E3NA 1V7PC 5EWMB 3AESA 1YZHA 5C5DA 3SJCA 1K3TA 3PVLA 2NN3C 1Z8DA 1CJVC 2A0UA 4UHFA 1ZN9A 4TVOA 2KXPC 3EK2A 4K86A 2P9IG 1P5QA 5FUVA 1X2BA 4QQNA 4TSFD 3JQBA 2YZGA 4HEHA 5AKXA 2GF2A 5BPPA 1RXVA 1RZUA 3EN0A 1ZUWA 2PA3A 4OUKX 1CRPA 4LBWA 1GG5A 1ODIA 5ES4B 3CVYA 2VP4A 4II7A 1GZ7A 1SCAA 4NS4A 4AIFA 2BKGA 2YBDA 1D1PA 4OAPA 2PKYX 2XB2A 2WG1A 5CG1A 2L69A 5KTPA 1C14A 4QFMA 5HXAA 1QV7A 3WXXA 4ALNA 2RH5A 3PEFA 1V43A 2QJWA 4MKTA 4YY3B 1GPUA 1SXJA 1MAUA 3KQLA 5LP6F 1K06A 1NQTA 1HX7A 1N3LA 1RZRA 1V3VA 4LEUA 4UYKB 4BNFA 1I3KA 3TO5A 3DZHA 4YHHB 2OC4A 3FY4A 2NVWA 5ELLA 4WLNA 3H5OA 1E6CA 4QAQA 4I6GA 1SOMA 1EIWA 1TM7E 1OYWA 3F47A 1MOSA 2OENG 5AQ7A 4N5MA 1Z73A 4E88A 1ENPA 3K9NA 4NZOA 4ZI7F 1PO7A 5CK5A 1DS6A 3VU3A 4H6PA 3I5PA 1T2NA 3C1TA 1NNLA 4G1TA 2VLIA 4Y2PA 3NGMA 3QVUA 3M9LA 5ESWA 3MQ2A 5FEUA 5KHOC 3QB2A 4Q9JA 4EJMA 1ZSVA 3D6FA 3MN1A 2RFAA 2YN4A 4II2A 4TOIA 2CHQA 3DVAB 5EZYF 3LLMA 4IGFA 2BRUA 2YXEA 3NUZA 1LRJA 2NNWB 4G0QA 3HDYA 1BZYA 2X9QA 3UT0A 3L1IA 4OQZA 3MJRA 3KV3O 3KQMA 3R0ZA 1OR8A 4F4HA 2E6UX 1GRQA 1W0KA 3MGBA 3PUHA 5L40A 3ULKA 4IGEA 2PYDA 1TIBA 4AMBA 5AI6A 3UM1A 5F4ZA 1SUWA 3AIOA 3F6PA 4Y2SA 4UDYX 5KX5F 3IIEA 5A4KA 3TXNA 2H54A 3IESA 1JNZB 2A59A 1ZH6A 5IZ4A 4Z4HA 1O6BA 2V5FA 3RSGA 1B1AA 1ORTA 1I36A 5I9TA 3CLRD 1I24A 1O58A 4GR5A 5CK4A 2C2LA 5INTA 2XY4A 4D99A 3EXFA 5DOZA 1PFKA 3MIZA 1NE2A 4B8YA 1TM2A 2VYNA 1E1KA 1WCYA 4YRZA 5THKA 3LXMA 3PHIA 2WI8A 2AXVA 5C8DA 1E6UA 4LQCA 2JGDA 4D41A 4JMPA 4PYJA 3NKLA 2Q7DA 2GJSA 4ZRNA 1J4AA 2A4KA 2MRIA 4APFA 2H07A 4DIDA 3PKZA 1ULTA 2C7OA 4AIRA 1DBWA 3F90A 3HMKA 1IK4A 1J5PA 3FDZA 4DEYA 2FF5A 1D2CA 3OBBA 2X6IA 1M8KA 4BUJA 1X39A 2PH7A 4P86A 4QWMA 1VGQA 4BYGA 5GTDA 2AN3A 5E6RB 1ZEMA 5L9AA 3LHKA 3UJ7A 1EFKA 5CCMA 1H2RS 3JQ9A 1GLVA 4UMDA 1E62A 5FV7A 4TLAA 3LY8A 4JI6B 221PA 4GBJA 1KSJA 1KIAA 3CZPA 4J0HA 3HY3A 2RG8A 3Q1KA 3VR3A 1MEJA 2EJVA 4G0OA 1UBFA 4IVRA 1KAHA 2OFFA 2XQJA 3R4CA 1UIRA 1VSTA 4FOPA 3QXCA 1JLKA 2GN8A 1FP2A 3BEDA 1UJJA 4L8GA 4JVNA 3ZDRA 5CCXA 1NF3A 3OQHA 2I5PO 2XUDA 2F55A 2X7HA 3O31A 1ZISA 3C8MA 4AB1A 4MRPA 2X86A 4N5IX 5KYYB 4RD2A 4PZDA 4YXWA 1KP9A 3DV0B 4AKGA 5HRUA 5ALGA 4RF2A 1QZZA 3H11A 3EHMA 2Z43A 5A23A 5IKMA 2H1HA 4H0CA 1X42A 2VYFA 2NXEA 2W6OA 4YMVA 1A3CA 5FA5A 3EE6A 1U3CA 1GU1A 2GRPB 4E21A 1GPBA 2DBZA 4OAOA 2LTAA 2O06A 4F86A 5JR3A 2D0OB 3R6WA 4DJTA 1AS2A 4WFQA 2HPVA 4UCQA 2CL7X 4X7RA 2V7QD 3NORA 5FBZA 3SEFA 2H1WA 4IRMA 3ETGA 4Y98A 2W6MA 2EFGA 4JLJA 3AR7A 4QHSA 1IKND 2ECQA 1OTHA 5TB5A 3EEOA 2OA0A 2QD3A 3BRCA 4GO1A 5CTJA 3PZRA 1X87A 2CJWA 3OBIA 4FMCF 3FSGD 4K88A 2VJLA 3WGVA 1L4HA 5BSFA 3P2MA 2GCOB 4KR6A 8ATCA 1G60A 3L0CA 2VYVA 3CLSD 4GMFA 3AS5A 1Y3CE 3ZLTA 2O5RA 2O2HA 3HYTA 1GKIA 1ZIYA 3V2HA 4PSVA 3UK1A 3QK0A 5T4EA 4WBSA 1IBMB 3KOWA 5C8ZA 3NR2A 1NVWQ 3WHIA 1DKUA 3PHJA 4IQFA 4DJ5X 3EARA 1QGAA 4KP7A 1F2DA 3T1OA 1TB4A 4H7DA 5EEHA 1JU3A 1W4BA 1RACA 3FTYA 1OY3D 3Q5DA 4WOJA 4JP1A 4TT3D 3D2AA 3SXUB 2G6BA 3DUFA 2I9KA 3OP4A 4AN1A 1ECLA 1WD7A 4BC1A 1TGVA 3ZTTA 3TJRA 4JLMA 4RLQA 1O1YA 1WOMA 3AF0A 1E8YA 1EVQA 4D6PA 3AR2A 3VH4A 4Y7CA 4QRHA 1YDFA 1TYAE 1SA0A 3ZHEA 2LO6A 4KPUA 3DKRA 3JQPA 3UINC 3BH6A 4TUYF 4AN0A 2O7QA 4GGPA 3TRIA 5EWMA 3A25A 1E1MA 3UV3A 4PW0A 4XM1A 5JD5A 3HKDB 4H3HB 4TQ9A 1EG7A 1ZO8A 1UDWA 1SXJE 5J5CA 1EE2A 3GUZA 5DPMA 5DMHA 1MX9A 2VCHA 1YGYA 4D4MA 3CCBA 3W1EA 3DBIA 1NSYA 4KXLA 3H3XA 4WV3A 4LXYA 4KPYA 4D4GA 2C2HA 5HZMA 1MT0A 1G3QA 4J1TC 1H6PA 2DECA 2PFSA 5DE3A 4NACA 1K5PA 2Q5QA 3OMXA 3R7LA 4N5QA 1KK1A 4YDOA 3HKBB 1VHQA 4NJOA 1G38A 2YWHA 1NMEA 1OXKB 3RWOA 2NPOA 2QE6A 3DB2A 4R9SA 1OX6A 5U4XA 1FFSA 4JHLA 3L4BA 3Q98A 2EARA 1LBQA 3IBSA 2QYSA 3D43A 4XIFA 3KJFA 4GLBA 4EUFA 1ZN8A 4PZLA 1UFRA 1YR8A 3MV3B 1D1TA 3TSWA 2Z98A 1NM5A 2X15A 4S05A 1IYGA 2X77A 3L0ZA 5DTMA 4JI2B 1JQ5A 1E3EA 1E8WA 2OCKA 2PKXA 3COSA 3KYCB 4Z7JA 2PS0A 1DCKA 3DC2A 4KX3A 2QN9A 4TYWA 3GXOA 1X6VA 4IDHA 3WAJA 1JCRA 4R1QA 4HORA 4URVR 2OYSA 4Q02A 3FSRA 1S70B 4TMWA 3QKRA 1SUAA 1XJWA 3IOBA 4YV1A 1SC1A 3BXFA 4E6EA 2VJNA 5IT4A 2BEWA 1ORWA 1FRFS 1AK9A 1XYGA 2H5LA 1HM5A 3D9KA 1PDWA 3HG0D 3S2GA 3R6GA 3RC8A 5CDFA 3FU3A 3MRVA 2V7VA 1TW2A 5FZSA 3P45A 1G18A 4J9UE 2J0VA 4DM3A 1UFKA 2BCJQ 2YZKA 3WC4A 5ICFA 2ZXUA 3JARB 5EJ5A 3NALA 3K0AB 3HRHA 3QM1A 3QV2A 1KK0A 1NUUA 3QE2A 2C5LA 1ZY2A 4I4CA 3W8RA 3AVXA 1E1LA 4EYOA 5A5EA 2TMGA 2WW8A 3JRWA 4DLTA 3R6TA 3E32A 3TH5A 1P2GA 3WJ2A 2YJNA 3U80A 1VG8A 2HYIC 4P3YA 4J94A 1E90A 4L7VA 4BV8A 1P2VA 2V7PA 2BHLA 1FQWA 1VHDA 1KMNA 3T3PB 5ESRA 3DMHA 5E2AA 4KFUA 1F9EA 4UVGA 2PO7A 5U4QA 1W76A 1XDDA 3ZV4A 1F2TB 2WU0A 4JX9A 2FWJA 3LY5A 3OWHA 3WLRA 3IXLA 4IDFA 3UYLA 2W2KA 1TR4A 3HWX1 2P2SA 1AKTA 3HJFA 5G0TA 1TLTA 4YDHB 3R8CA 5CT6A 5WRFA 3BTVA 4BRUA 1Y6QA 4QVGA 5F5LA 4FNMA 4TYNA 1JNXX 4RDHA 2IQ5A 5FQOA 1MGOA 3LCVB 1LTHR 3R3UA 1V7QA 5C4IA 1M7GA 3T5MA 2R7MA 4PXSA 2E0IA 4I8DA 5E75A 1A98A 2ZE5A 4V0MA 1B7GO 3BMQB 2QENA 1XZNA 2J32A 1JLMA 1Y89A 4QUJA 5JRJA 4NG4A 3S2EA 4GG1A 4Q4JA 3QX7A 3MWLA 4B6SA 1U9JA 4YCSA 3L18A 3GNTA 3LUHA 1MP0A 2F64A 5EJ8A 5A6SB 4EF6A 1EFVB 3GHYA 4Z2AA 3C7DB 3W9BA 3FYUC 1KXJA 3I01A 4BO9A 3ZW9A 3DMNA 4P35A 3TNYA 1RYFA 1W87A 4IPTA 3GFVA 3ILVA 3U4MA 3G1UA 1KJIA 1J25A 2ZYUX 4ZOEA 1JSRA 3MINB 1Z2CA 5D6NA 1PJRA 5JJCA 2CFUA 1BKDR 3RJMA 1CS0A 4I66A 4GI3A 1QF7A 1XF9A 4MUYA 1JDSA 1GA6A 2WYVA 5I7RA 1T5BA 3GAFA 4KR9A 3LXUX 3L6RA 1X9IA 3R7BA 3UK7A 5AW6A 2PWPA 2RKKA 1DHTA 2PBFA 1HH4A 3GBVA 1W6RA 4HVTA 2V7BA 2I2FA 4CM3A 5CBPA 5FB3A 4I55A 3SNXA 3PQFA 4UKDA 4BZXA 2O4CA 2XD9A 4OXKA 4JBLA 2DUJA 1RQNA 2OT3B 4AP5A 4OYLA 1KWGA 3EZNA 3URKA 2FP4A 1DQYA 1IY8A 1JG4A 4JC8A 3HXEA 2WP0A 3FWYA 2ZB4A 5AW7A 3U60B 4X7PA 3D6VA 4FXPA 4QTYA 1RWKA 4Q9IA 1LBEA 4OOFA 1N32B 1T2DA 4HN9A 3HZRA 2Q6IA 1K1AA 3UT5B 5KYUA 2EFEB 1MZCA 2HB6A 1E2IA 1K9VF 1R37A 4S0ZA 2JCBA 3G2JA 1C7JA 3MWDB 4UHHA 2BHSA 3IUJA 1U6JA 3FCYA 4MUAA 2XUZA 1JALA 1E3DA 4E03A 1TPZA 4YQZA 1HUQA 1MPXA 4C08A 2B8TA 1SBHA 4TLEA 1A2KC 1RLOA 3PL5A 3H1EA 2AW3A 3T95A 2ZEJA 4R9VA 2FP3A 3AU8A 2PX6A 2OV2A 2A0KA 3D7LA 4GOXA 2I33A 3NM6B 1AA9A 2BJHA 4NZYA 2XHZA 3PX3A 4KIGA 3IO3A 1YS7A 4UBIA 4IHKA 4YVQC 5L51A 1DFHA 3O3CA 2J3IA 1HLFA 3PQ8A 3T4EA 5CT4A 3NOOA 4C88A 3B70A 5FNVA 1PD0A 2DH5A 3RKRA 1E6KA 2QVZX 3IT0A 4UM7A 3IEPA 3OLZA 6PFKA 4C0LA 1XTBA 3LKVA 1IBKB 2CBZA 3EIXA 3MMNA 4K05A 4IDNA 4OUDA 2OFWA 3LMKA 5BR4A 4I08A 3TEMA 3OECA 1XEAA 4XH9B 2Y6VA 3QKUA 3UM9A 1KSGA 5AJVB 1ACMA 2CMDA 2QMEA 5AQ1A 3HP1A 3DQQA 2FEAA 4B75A 2Z5LA 3G0CA 4QQRA 4J91A 4EY5A 3SC3A 2QN1A 5D01A 4B4OA 2QPLA 2YMQA 3K70B 1ZD5A 5BWNA 2JHPA 1QTQA 4IKOA 4MI1A 1PJTA 1WJGA 2XTAA 3ZHYA 1B3BA 2E4WA 1OWPA 2OGWA 2QMOA 3INYA 1ZVVA 4UDNA 4JB8A 2BE7A 4AJWA 4GEKA 2O2SA 4MV1A 3BCRA 2WXLA 3ZD7A 4YCNA 4A63B 1NXTA 3ZDCA 4C2BA 2WWIA 1BKYA 1BC5A 2GEBA 2IU4A 1SBQA 5B3JA 2ZVJA 4FI3C 5CDFE 4WZBB 1EHYA 1ZN2A 3QITA 1P81A 3WFIA 3WXBA 3F7NA 3GLIB 4K03A 1U0NA 2ORVA 2PBRA 3OZDA 4R4JA 4Q1CA 1JLLB 1JMYA 1NVAA 4NRDA 5DSTA 4R5HA 2YV4A 3CVXA 1OT5A 2XDQB 2Z5VA 4G8BA 4G1BA 2C4NA 4ITRC 1W5TA 4NH0A 2IKSA 5MF6A 3FR8A 4PG4A 1B0AA 2ES4A 3OQJA 3MJDA 2ID9A 3L04A 3V8NA 4PO3X 3ULYA 2XXJA 3EDTB 2IH5A 4IXNA 2BUGA 4BFLA 3A1WA 3NQPA 3KETA 4BP3A 4JT9A 2POCA 1RBMA 2J9FA 2EF1A 2R7LA 1IEWA 3DWFA 3KQUA 4LJ4A 3FOZA 2QRKA 3I32A 5L3QB 3KQPA 3NOXA 4OQYA 2VPTA 2ANCA 5DBIA 1P4JA 3VJMA 3ZE1B 4CTOA 5HFAA 1WXDA 1LDGA 1KR5A 3MBOA 3GMIA 1TNZA 3THYA 3DCYA 4YJFA 2VTBA 4GBMA 4V0ME 3QC1A 1DG1G 2MSCB 1VI2A 2GCEA 4EJ2A 2FZCA 1R0RE 5LOVB 3I09A 1RSZA 5AXCA 3ICVA 1IE3A 1VCHA 4M87A 1EVLA 2ZSUA 2J5BA 3S1AB 4L07A 3KJXA 2GFQA 2WAAA 4AS3A 1EE9A 1EUQA 4D8WA 2EC5A 4UYJB 3LKZA 2DK6A 4EGJA 5JVDB 1P6XA 3GRVA 2P62A 4WJKB 2IIBA 1P2SA 4UJ5A 2GBLC 1ZLYA 4RTRA 2JCVA 1KEEB 2NUPB 4UUAA 1ZXXA 2ZYSA 3G5MA 5LYJA 4GR4A 5BV8A 4E11A 3Q7FA 3G0HA 4EUEA 1N2OA 3PDIB 4KN5A 2M1ZA 3Q9NA 3HHPA 2ZIVB 1XTIA 3MWFA 2B9VA 4ZHQB 4JJ7A 1QLJA 1N2EA 1ND6A 1UMDA 1Z17A 1U8XX 3NP9A 4OI2A 4M1YA 5FINA 3PQDA 1WXWA 1EFVA 2F43A 1Y8RA 2W6IA 3IEKA 1Q2UA 1P77A 3L0BA 2DFVA 5A5FA 1IHUA 2IY9A 2QT9A 2ZYHA 2HMWA 4OHUA 6AT1A 3JD3A 5LMZA 3V1KA 3FHEA 2A8YA 1VZ3A 2ZXFA 3ROGA 3LHSA 3AF3A 2WDZA 3H6KA 3FOWA 4INJA 3I61A 1N5LA 5KYWB 1E89A 5FWDA 3HK2A 1KQGA 2ZSHA 4L78A 3MJTA 1JXMA 1A1VA 1GZVA 2RKBA 2H16A 1HV8A 4H15A 3LL4A 4JOQA 2OORC 4TPKA 4MIYA 4K9PA 2JF0A 3ZHXA 1OROA 1W93A 2R00C 1FP1D 1YTLA 1Z7YA 3OZWA 2IRWA 1IZYA 2MDTA 4MQ6A 4F5DA 4RABA 2Q4DA 1K08A 2HD4A 2QP3A 1D0SA 3KYJB 1U5AA 1UZNA 3UK0A 2JAHA 2M6RA 4F4FA 2WQZA 3ZY6A 3FLBA 4E94A 4Y9TA 5I9NA 5DU2A 2GRQB 3WWZA 3OMLA 1V9CA 3Q3GE 1Q2ZA 1DBVO 4J6IA 1SXHA 2VSNA 5JCXA 1RXSA 1BYUA 3D64A 4JHJA 3I30X 3QLVC 1XAIA 5J3JA 1FT1A 3A6EA 2BOVA 5AW0A 4FYIA 5J9FA 1UAYA 1LI5A 3TJMA 2GOYA 3T38A 2F1JA 3B82A 3CSUA 2EIJE 5BWMA 3STUA 1P8JA 4XKCA 2CWWA 2ZG6A 5J4KA 2G3YA 1RABA 3SBXA 2JHGA 2GS9A 2ZRFA 2R8YA 2Z56A 3MKQB 4BKPA 3REOA 1QE3A 3TZLA 1HDOA 2WB2A 5H0IA 2Q2WA 5AUOB 2X9NA 4RPKA 3GYBA 2JRLA 5I01A 4HEJA 1SUPA 5DNWA 2XNDD 4BBAA 3NIFB 3L7DA 1W4ZA 4NFLA 3QNMA 4MLDA 4CI0B 4EG4A 4IVNA 4UBKA 2V0PA 2PXCA 4NBKA 3O93A 4HTFB 2WQ7A 3I5MA 4PRKA 2J3DA 1Q84A 4YRIA 2WMOA 5IXSA 3WRWA 1L5KA 4PHCA 3I9FA 1Y5LA 2XBLA 5K51A 5EWJA 3VNSA 3B38A 3OJWA 4YPFA 2A5FA 2QRZA 1Z3YA 1TN8A 1DTEA 3F73A 1JJFA 4H7YA 4NFHA 2DYSE 2BTOA 3T0GA 5H70A 1VCOA 1D6MA 2HUNA 2E82A 3CXUA 2DBRA 2DZOA 3B2QA 4PSCA 1IAQA 5ALRA 3H8JA 5JHHB 3MCTA 3CR3A 1DT5A 4RZHA 3SM9A 1HDRA 3O84A 2Q99A 3ITNA 1YVRA 4CDRA 4BLSA 1K92A 4MKRA 3BE6A 4K3VA 2WT8A 3RAJA 2EERA 1QIEA 4NS1A 2FGJA 2EW2A 1E61A 3ZPJA 1KVSA 4B76A 3AB3A 5BNFA 5CVEA 4ZCPA 3GO4A 3LXXA 1QDEA 4YBZA 3VKFA 3TTWA 2MSWA 3QVXA 1OBOA 1XVIA 3MCUA 3WDKA 3LBHA 4MVYA 2PXAA 2UU9B 3A6KA 5AKYA 5JQGB 2PLWA 4A2PA 4LC1A 2WYHA 4QNRA 3T61A 4LAFA 5CPFA 3BICA 3TKYA 2XEHA 3PTLA 4P7BA 4EI2A 3M49A 1E7YA 1KA9H 4O5AA 2X76A 3RS3A 1P4RA 5JNSA 2VRBA 1S2GA 4Z3OA 2BLLA 3EVAA 5AKLA 3T4UA 1HG5A 3Q9UA 4OMUA 4FB4A 2CXOA 2VKTA 2C29D 4YRDA 9GPBA 3KEAA 4D57A 2PMWB 1D0IA 3B6MA 3T7EA 2A5JA 1T8UA 1Q2XA 4PWYA 1DDOA 4PQYA 2Q3DA 4WL0A 3SGLA 1UK7A 3DTNA 2QQFA 3I23A 2PUWA 3VCXA 3IVRA 3RRUA 1Z2NX 1CQWA 1NRXA 1RBQA 4G5SA 4ARCA 1CHDA 4E30A 2RGNC 1SZJG 1JFTA 3EVFA 2M98A 1VKRA 4IQ0A 4S2UA 2I71A 4KR2A 2QX9A 4QKQA 1JFVA 4KDCA 1L7XA 2DF8A 2W93A 3E1GA 2FMXA 2QRJA 3I4GA 2D00A 1O57A 4U2CA 2FXIA 1KU6A 3SS9X 2ZRPA 2BD0A 2KC7A 1QC5B 1ZBPA 5KSYA 4IG9A 2XOKA 3VR4D 2VRCA 3CEMA 3VU8A 2OEVA 4LJRA 4DYDA 2GAJA 3KT8A 5A3QA 3KT6A 3S1AA 1QVRA 3PLNA 5HM8A 4UM5A 1ZK2A 4CT0A 3HGMA 1UKAA 1XHFA 1GPMA 1R5BA 4G5GA 3P19A 5D51S 1TCUA 1Z37A 4IWXA 4HGYA 1JJ7A 1OX5A 1V4NA 3AESB 4X1OA 3HXTA 2PE5A 4X20A 4MVJM 1VE5A 1OGJA 1C4WA 1LLCA 1QFMA 2JI8A 1NOIA 2IP4A 3W1WA 3PTZA 4JBIA 1N34B 2ILRA 5IX8A 4JN6B 1YF3A 5KNDH 1AHPA 4IUCS 2WINI 3D9OA 4ZHQA 4B3XA 4QVIA 4KQHA 4HGOA 5CB8A 1X70A 2PH1A 3RK0A 4KREA 2G63A 4CHTA 4PFQA 5FFMA 4UAJA 4TXQA 1HURA 4FSDA 1O97C 1P7CA 2AH5A 1WO8A 1UWKA 1M33A 3GN1A 1JEOA 5T41A 2DQZA 1U6IA 4F92B 3F6RA 4KLZA 1Y7HA 1QLHA 3UUFA 1SXJB 3ED5A 3D6HA 3PGLA 4RH3A 5I7SA 3HXKA 4MVJG 2O54A 1OGIA 1J0CA 1AZLA 5AFSA 1DEKA 4N0DA 5TIIA 4OXIA 1QG0A 4LOIA 1V9SA 4DMMA 3P9YA 4RZIA 3U3ZA 4XM0A 5IJ9B 1NJ2A 1REQA 2Z2JA 4PSDA 5SYNA 1BQ4A 2R47A 5IBQA 4D5EA 2ZJ0A 4KFRA 4F3TA 4HO1X 4YV2A 1JDUA 1ZYUA 3PR3A 3H2GA 1FJGB 4PZ0A 2GEDA 1C2TA 1J1UA 2V03A 5J4HA 2AC4A 3DFZA 2H0QA 4JLSA 4JWKA 4CR8A 1GNRA 5DTIA 4IIXA 4GSLA 5K8TA 1WMBA 2AW5A 2HDHA 2G36A 4MQBA 3IDFA 3PUYA 1SXJD 4K3UA 4AMGA 2FZKA 1HE8A 1CNFA 2R5SA 3LY9A 3IPXA 4IXWA 3S2SA 2IPMA 4CETA 5FLKA 3BK2A 3V4RA 1OA0A 1JHQA 1ZOIA 2VTEA 3SC6A 3BSFA 4A3SA 2ZKLA 3N2LA 4MLZA 4FSXA 3HCWA 2YV5A 3CIAA 1V6AA 1HF3A 4GZLA 1H0SA 2UYYA 1RTKA 4BX9A 1U2QA 2CFSA 1JIKA 5J4YA 3SLGA 1T3TA 5THQA 3KLBA 4XJXA 3UTDA 2WJ3A 5EE9A 3W9YA 2JZCA 3JPYA 4JJAA 5IULC 5TXGA 3GV0A 2AWIA 4LMPA 4FYVA 2UUAB 2W6NA 2ZK7A 2L18A 3PXXA 3ZHOA 1ZJJA 3P0RA 2QE7A 3TIIA 1KZGB 2YNMD 4NU6A 1M2FA 3ROFA 1A8QA 3SFTA 1I2MA 3H5LA 2PH5A 3A70A 2P0YA 1G2OA 1X1CA 1E6LA 2AIRA 4K1LA 4R51A 3ADPA 3OI7A 5E3HA 3G8CA 2JGDB 4V0NA 1QK3A 4RJJA 4HTFA 1FU8A 2FOIA 4P4TA 3RYTC 3OZIA 4CUKA 4KHPB 3UOGA 4L5AA 2Y1OA 2GWRA 4BTEA 1VB3A 3FDZB 4Z4QA 1XWWA 5CB6A 2DPMA 3V4OA 5CB4F 1JT9A 4HBGA 3U9LA 3QSGA 4DLKA 4ZV4A 3G0OA 2R5WA 3BQOA 2V3CC 2VYND 1OLSA 3C5EA 4BJHB 2GRRB 2V7WA 1GPYA 3ZUVB 1JIUA 2WT4A 4M53A 4CLOA 2Y1DA 3N0VA 4DPRA 4R7GA 2VAPA 4AWAA 3OIVA 4JLNA 4AV7A 4Z5XA 3FOEC 3ML9A 3PGVA 4QATA 4DILA 2VUIB 3FUEA 4MKIA 2YNQA 3KS2A 1CTQA 3E34A 3CUEF 3O1IC 2QLLA 3WJ7A 4NZPA 2VQ2A 1N4RA 3Q7PA 1QFXA 1D5CA 4LYGA 2HMAA 2ZCUA 3MPUA 2AJ8A 2E1PA 1R8SA 3KEOA 3EDCA 2IXEA 3H11B 3NIDB 4N7MA 4JLUA 1E2KA 4F4CA 5GZ6A 4Q9NA 3W06A 4P5EA 2ORYA 2J7PA 4YCBA 1PFUA 3K8OE 2P65A 1LF8A 2KX7A 3NFYA 1DKRA 2WAXA 3FOAA 4XWKA 1JTVA 3MRXA 4P4NA 4RHUA 3QOWA 1CRQA 3K1JA 1QGYA 3ZW7A 4H16A 3RG8A 1U2GC 4UD6A 5AI8A 4NDAA 3PQCA 2VP2A 1A04A 1EE1A 4DZZA 4DPMA 4YXWD 2Q8QA 4HFGA 1DWPA 2AJCA 2VEOA 4E7PA 2CJWB 3T3DA 4DIOA 2C03A 3PHLA 2UZ0A 2FFBA 4AKEA 4YA6A 1BOOA 2FMHA 4TV9F 9MHTA 1RYYA 3FHJA 1KQNA 2A58A 1TEXA 3ZH9B 1Y80A 4HGQA 1LK5A 2V4HC 4RAOA 1EPUA 4UTRA 3AF6A 2W98A 4ND8A 3RFXA 2PUEA 1HX8A 2ANBA 4L8FA 2FJUA 3IB6A 4KMOA 1MO2A 1G4AE 5AM2A 1ACJA 2BGTA 3SJAA 2Y8EA 4F84A 3VR6D 1W30A 1FDUA 5JH7F 4LF7B 1I33A 1HO3A 4AXXA 5E38A 4MDHA 4NMLA 3J81k 4JITA 5KC8A 4JQSA 3UJ6A 1TN6A 3DUFB 3VNQA 4YP7A 3B1XA 4ZT6A 3RTAA 3HU2A 3W5AA 5I5GA 1TAUA 3NT2A 4GPEA 4UXJA 3SU8A 2BTDA 3KHKA 3JVVA 2VYVD 4MYHA 3FUXA 2OBNA 3EGXA 2PKQP 1SA0B 4KPUB 5BQFA 3EHDA 4A2CA 3L0DA 4BEBA 4UOQA 5HCNA 1XPJA 1VYVA 3E35A 5JANA 4CLRB 1N9ZA 3EDYA 4X3PA 3E27A 3FNRA 4YP1A 4AMUA 2I1KA 3V7YA 4GWGA 4JU8A 2F17A 1Z5SC 3SHFA 6GPBA 4M9UA 1RVDA 2PSSA 2EKDA 2Y1KA 2B5VA 3LX4A 2P6NA 4QARA 1P29A 5SYMA 2WYUA 2VQSA 2FW7A 1L5LA 3LO5A 4U4AA 5JARA 4B6RA 4D9FA 2Y3IA 2H48A 2H6HA 4GPKA 2A6PA 2GM4A 1UKYA 3RSHA 1I80A 2C83A 3N2KA 2LNIA 2V54A 3GZ4A 4D7AA 5ESXA 2GD6A 4MPRA 4BBJA 3OZCA 3KQKA 4FULA 1Z8HA 3ZXYA 3C3WA 4J2HA 3PWTA 4UVEA 3KK0A 3QU9A 2GUWA 3WZMA 1IXYA 5H3CA 3WLFA 4RTNA 4GVLA 2DRIA 2UXDB 5IJ9A 3GYXB 1RC1A 1NMQA 5AD1A 2BGJA 1WY7A 3O0DA 5J47A 4PG6A 2VK2A 4QFCA 2NVOA 3RR2A 3MCZA 2YY7A 5EE0A 5KYGA 3TRFA 1MO3A 4I17A 1P19A 4IV8A 5ANLA 1SEPA 2EYQA 5JAIA 3WIVA 3VZQA 3A1CA 2YVLA 5DHFA 1WZNA 2QUJA 1JG3A 3L5OA 3QKRB 4LFBB 4OCZA 1KI8A 3S8YA 1KR2A 2BEWB 5K45A 2GSWA 5TPZA 4N3BA 3ABZA 4ZQEA 5B2FA 1Y8CA 4IAOA 4H31A 2IYTA 2F9FA 5COBA 2CXQA 5K8CA 3RS5A 5AVOA 4MWOA 3BTUA 4R5MA 1JSZA 3KU4A 3O3MB 1VA5A 3QY0A 1Y1PA 2N75A 5M2QA 4X64B 4KN8A 1OQAA 3PE3A 3PUZA 2EZTA 3LFTA 3U4QA 3FPFA 1ZICA 3HVRA 1GG9A 1NY6A 2ATXA 2PMDA 3HR7A 1EFAA 2V0NA 3X2FA 3QXXA 3KD2A 4NYMR 3IPAA 4WJLA 4M0EA 1HNXB 1EESA 3B53X 3RUEA 3WICA 1XD2B 3D4IA 1T2EA 1NTOA 1T6BY 1HS6A 4NJEB 2JARA 5EG5A 2Q29A 1EEXB 1E99A 4P81A 4URXR 1ADYA 3DEOA 4XGIA 2PGAA 1MG5A 4OSPA 4QPNA 3DW1X 3HUDA 4DLQA 2GGFA 1HXIA 4LY9A 2V1UA 3CU5A 1CUBA 3SKXA 3WGTA 2W2KB 5F98A 2R6ZA 1O95A 2KS6A 1IZ0A 3JYLA 3EGVA 4ZQGA 3K5IA 5K3CA 1T8RA 3LUDA 3N3BC 1LRKA 4IQ8A 1JRLA 4FHZA 1II8A 2QKYA 1E6EA 3CE9A 3FOCA 1P7PA 1ECCA 1K7EB 4F46A 2E37A 3T5DA 1F6DA 1F8FA 3AS8A 1SVXA 4FFMA 1JHDA 3HB1A 1UQUA 1I32A 3CUKA 1KZYC 3PDJA 1FMFA 1A5EA 1Q21A 4Q4DA 1MC1A 3S7FA 4L0MA 2QT0A 1PC2A 3S8MA 1DBSA 4O4JA 3L8GA 2AYYA 1GQFA 5JJIA 5BRJA 4ANXA 5KINB 3FGZA 1BDMA 4K81B 5DWVA 4Q4JB 2P1DA 4FHJA 1KARA 4RACA 3RIMA 1QFSA 1Q16A 1XQ1A 5JWRA 2KJQA 4N0EA 1B89A 3WI7A 3SYRA 3D6AA 2CDBA 1FFAA 1NLZA 4LDNA 3N75A 4RF3A 3BORA 3LDZA 2IEIA 1ZIPA 4TMVA 3H86A 4LSWA 5KQGA 2YXDA 3HADA 4TS1A 1DX4A 4KPGA 3LGXA 1MO6A 5FYDA 1CS0B 4MUKA 1N0WA 5G3YA 2LSUA 3D3EA 1WBBA 4Z4GA 1XN1A 4V0QA 4EMSA 4RTOA 3GGJA 3I72A 2X14A 2Z4TA 4MW0A 3QW2A 4EHIA 2PUCA 2VPIA 2H85A 1TQ2A 2K7FA 4UXIA 4Q94A 5CBPB 4I55B 4UNQA 1BNCA 2CCJA 4B73A 2N1BA 2F1OA 4KGDA 2PS9A 4P3XA 1THTA 3IVXA 4DCGA 3JRNA 4EYQA 2P5YA 4ZDJA 1NFQA 1OXXK 2NUAA 1Y3AA 1IHXA 2D0PB 2HEGA 1ORDA 1DTSA 2XZDG 2XQFA 2FP4B 4BECA 4OY3A 5CFOA 1GSIA 4CTKA 2HCBA 3TGOA 3D8SA 2XYVA 1CUDA 4YRRA 1J90A 1DKQA 1V95A 3PC6A 3EMVA 4Z0HO 4UNRA 4LK3A 2RG1A 4I1SA 4OV6B 3PFFA 5I8WA 5EZSA 2J5XA 5KYUB 1ADBA 4DFDA 1TO6A 4B7XA 1Y1LA 3A14A 4N18A 4P83A 2WJ4A 1XZAA 2ZS7A 1T9AA 1TF7A 5KNDA 2HOQA 2PNJA 2XMRA 2Y2VA 5AM5A 2OHOA 1H05A 3UJ3X 1I4DD 1OFIA 2ZXWE 4WKOA 4XOIA 1XMSA 3AINA 3F3YA 4RGVA 5KTYA 1G6Q1 4P4GA 4IIYA 1FS6A 4Q96A 3FIUA 4ZREA 2CLKB 2J0UB 3Q4GA 1ILEA 3CHYA 1F0KA 4NLLA 4LGYA 2RB5A 3CFYA 1ZOLA 3DNPA 4DV5B 2XZOA 2FWMX 3DWLG 4KE8A 4MQFB 4IJVA 1OLUB 4GVPA 4IH4A 4U0ZA 5A6VA 2Y6UA 5FNVB 4KNYA 4OI1A 5JQWA 4C5BA 4DNFA 4CLRA 4XUEA 1S7CA 1ZIDA 3JD2A 4D44A 4ROTA 4GTPA 3C5RA 3FFAA 2E48A 1KZOA 1EWKA 4YAFA 4OUDB 5F9HA 4P8RA 2C3OA 4GTSA 4HZGA 4K9NA 3S7JA 3DZCA 3ZGVA 1H3FA 1TYBE 4BP1A 5ARGA 1GPH1 4PVCA 3LC1O 3R3JA 2C98A 4YXFA 1XLWA 1VMKA 3CNLA 5F51A 3V2XA 2W11A 2WDPA 5ALIA 3UMJA 1IWBB 5GVRA 4E6PA 3PE4A 3GRPA 2LP4Y 5MFZA 1VSUA 3OZGA 4DF3A 2O7SA 2QHXA 3I6QA 4W5RA 3PYLA 3ANYB 4RHTA 4W1PA 2WHEA 1LFAA 2H1SA 1P18A 4HVCA 3DDZX 5KJMA 4CM6A 1BJTA 4IQ4A 2AN9A 3FTPA 3OD1A 4IX9A 2VC2B 4QEKA 4Q9DA 3MS4A 2B2CA 4WACA 4PIMA 1QH8A 3WB0A 3KOUA 1QYXA 3PIDA 4KXYA 3S2FA 2GKSA 1BI7B 1ETHA 1EM6A 1J70A 4DCOA 1CHNA 3CBGA 2QYHA 3P9RA 2VQ6A 4ZMBA 2GYUA 3UM0A 4WNCA 2WPNA 1UBNA 3C16C 1W5AA 3KZKA 4HVLA 2HNBA 4U9HS 2XZDA 3ZC3A 2FKAA 2XE4A 4LUCA 4N6NA 5L95A 4AUEA 5IZCC 1OCEA 1WXIA 2VP0A 5DIZA 1M75A 4EH1A 2YICA 1HBJA 3QVMA 2X6RA 1W85A 3TOXA 1R0XA 2OCLA 5DNAA 1MCZA 1PJAA 4I5EA 2GRJA 2J9FB 4B4DA 1M6NA 4EJSC 5LJLA 5HILA 1QIGA 3HVUA 5ANRA 1A5TA 3GD7A 3PUKA 3WP0A 4I1AA 5FXMA 2WWVD 3RG2A 4R69A 5KDDA 4TM7A 1E7VA 3BWXA 2AB0A 2YQZA 2DX7A 3OKCA 2ODTX 4E4YA 5T8IA 2QM8A 1RWMA 3UWOA 4JR0A 2Q9UA 2XCTB 3GJTA 1XD2A 4R2KA 5EJGA 4RSGA 1LBTA 4TX1A 3V7UA 5ITZA 4NJEA 3D1LA 4IJQA 3K0SA 3THYB 3KKOA 1ZRMA 2ACKA 4YJFB 2VTBB 4I81A 3K94A 1WQ4A 3OCVA 1SG6A 3GFPA 1Y1KE 4PLVA 5T8KA 5A3VA 4P5PA 1UH5A 2G28A 2OAQ1 5EIAA 2FWPA 4RM2A 1VE6A 1LK7A 3KWFA 3KR0A 3VYWA 5BXOA 4LV5B 4JQYA 3NCTA 3OFVA 2P9EA 1E9DA 4P22A 3W5IA 3CR7A 5IHXA 1JZSA 4PPQA 3NBAA 1EU1A 3QH4A 1JWBB 4AKHA 1C7FA 1I51A 2Q49A 1H6DA 2YWBA 2HPZA 4AY3A 3KO8A 4OVUA 4BRSA 4GCOA 2AXUA 4HQFA 4RW0A 3IPCA 3DSRA 5HUQA 4N8DA 4DAOA 5LYJB 4HVBA 1A8HA 1BHO1 1U0BB 4KH1A 4YLGA 1H2XA 3PTAA 3OJXA 5G4LA 3BIJA 2XGOA 3CX3A 2AQHA 2PLFA 1Y3FE 2C9ZA 4AL4A 2PQ0A 1UMDB 3DXZA 2I7VA 3BB3A 2LSVA 3ZJ4A 1XMPA 1D9ZA 2F43B 1Y8RB 1S01A 3U56A 1SBIA 3GRRA 2ZS8A 1XV5A 1LU9A 3K2IA 1MNAA 4J2TA 2QL6A 3HBMA 3TWSA 4KGVA 5AYVA 5KYTA 3FYSA 3EVBA 4ZAFA 1KPGA 1SZCA 2P75A 4URHA 3AI7A 2QRHA 2RC6A 1ESNA 2ZYDA 1E60A 3H9UA 4L22A 1F3LA 4F5WA 4PYIA 2V7XA 3C3KA 5EIDA 4IL5A 3BIXA 1D8EA 1UEJA 5D8DA 4JWTA 2YRWA 1YS6A 4D74A 4D6YA 4JGIA 1R50A 1VRCA 2Q7FA 3IR7A 4ZT2A 4AXHA 2WZCA 3CK8A 5CT5A 3MMXA 4UUOA 3MT0A 2W6ID 1YR6A 4XGQA 2B7BA 4NBLA 3FLAA 3OESA 1QE5A 4OGLA 3AVYA 1ELOA 2OAEA 4DT1A 1RQ7A 1HKUA 4NYIQ 1H0HA 4DYHA 5A5GA 5HIMA 2AI1A 3M3DA 1MIOB 4HQ6A 1FVOA 2HH9A 2YIMA 5IC6A 3E8XA 3ZYCA 3IIJA 1JEYA 4X97A 3F78A 1RAFA 4ID3A 3QXGA 3CEPB 2IOQA 2OV1A 5LQKA 2C1ZA 4PZZA 2LIVA 3LIIA 4B3DA 1T1EA 3INNA 5ENQD 1Y9AA 4V0SA 2HMYB 2J9ZB 5B1AE 4BJ5A 4Y0NA 2CHUA 2PSEA 4I50B 3NHBA 2X5OA 1XJQA 1NVTA 2QI9F 1GHTA 4BEJA 1R0KA 1FNSA 1O89A 2YZNA 4QYIA 1WUJS 2RK3A 2J0UA 3PJEA 1JB9A 3ECAA 5TARA 1DJOA 5KTTA 4AM8A 4CTMA 3R44A 4YYEA 4XR4A 1W6UA 2E5WA 2XZTG 5CVVA 1E94E 3AVTA 1I2ZA 1L5RA 1V96A 4MQFA 1AKVA 2ECFA 1OLUA 4PAGA 1CR1A 2H11A 2IF2A 2PSDA 2CC2A 4YO7A 1E2BA 2WMOB 1GFSA 2YFKA 4ZARA 1VLJA 2FDCA 1H3EA 1DXQA 2D1YA 1R0CA 4J0KA 1DMSA 4L4SA 1ID1A 2C4HA 3I3NA 5EWJB 4ZODA 1PLLA 2ZJ8A 1QO0D 3G7SA 3I9V1 4XLTA 1KEZA 1JKFA 1ZMOA 1H1LA 2XQIA 3R77A 3NZUA 4KUHA 3MJWA 1VYHA 1P60A 4FQ7A 4RD4A 1XZGA 4H27A 3RIXA 4BNLA 4D9MA 2Q62A 2VK1A 4MX8A 3KD3A 1U99A 2O57A 4OB8A 1QTNA 1C50A 3DOUA 1HK7A 2WWYA 1RKVA 1PFVA 3D2CA 5REQA 2LKCA 4PANA 3UAXA 3OXLA 4K6HA 5GJCA 2CLEB 1GVNB 2EJCA 4C5AA 4HJXA 3IVCA 4ZICA 3SP1A 2A90A 3LW8A 3RHSA 2QTZA 3OLVA 1P61B 4KQFA 4IMIB 2Y66A 3IXQA 3KYBA 4C2AA 2FSUA 1E0KA 2C1XA 2F8LA 1A4XA 3AM5A 3VH2A 1B15A 2IHTA 2ODBA 1E4EA 2NXNA 3GCZA 4JB0A 3K70D 3LSTA 4WKNA 3G68A 3DEIA 2CYBA 3CEQA 3OQMA 3ONEA 4JIGA 2AVDA 2RHGB 1PD1A 5LB4A 2WWFA 1JT2A 2P79A 5G0UA 4UI9J 1R18A 2YQ5A 2SICE 3L08A 1YZUA 4JDUA 1LD7A 2JB9A 1IONA 3G2TA 2YIVX 3QYPA 2HR2A 3AH8A 4JD5A 1N6LA 4H4DA 2GN2A 3ZU5A 3BB4A 1T2FA 4G4GA 1KFBB 3W8DA 4XPZA 5DASA 1EFRD 5KOJB 3EYWA 2I6FA 2WRZA 3ZY5A 2JGLA 3OX4A 2X3MA 4G37A 2IXTA 1OWNA 4Q3LA 2ZSFA 2JFUA 2ZSAA 1FVXA 2YIDA 2V5UA 5IS2A 1ZZEA 1J39A 1U4NA 3T9EA 4ISCA 4J8EA 1ZK0A 2ODPA 3USCS 3QEJA 2FSPA 4R0NA 1W4AA 2WWHA 3N59A 2JIPA 1E6WA 4WTOA 4KLAA 1EDDA 3EPHA 3JCKC 1SKUA 1OFGA 4KNWA 1XNQB 2BF0X 4LBVA 5HZKA 1Q95A 2XWPA 3Q7TA 2ZJBA 3HXMA 3U7QA 5GIPE 2OE2A 1N1MA 5HNKA 4UPVA 2XS8A 2E5FA 3NHZA 4LE0A 2VDJA 4X20B 5AQ9A 1DZ3A 4KR7A 3C85A 4AP2A 4CE6A 3WWCA 4FK8A 5A3RA 2A5GA 1ZGAA 3NVMB 3ZDFA 3NHJA 2D59A 1S3FA 4B3FX 1XAGA 1RI2A 1R5JA 2XOKD 5B7QA 1WY5A 2V7UA 4WXEA 4WLFA 5JZMA 1H2VC 3A6FA 4JLPA 4EBAG 1KE2A 3DZFA 1IJKA 4ZU3A 3LYAA 3AHIA 3IL2A 3HZOA 4EW1A 5JYBA 4H59A 2CUKA 4HMOA 2R9VA 2YWCA 5DHTA 3UAOA 4HNQA 5K0NA 3K31A 2PQ6A 1H5NA 4LXXA 4EW3A 4F1SA 3CVVA 4YI5A 3TMYA 4PQGA 3OCYA 2WXQA 2W9JA 1RWXA 2ODWA 1R88A 4NNOA 5J4LA 4S1VA 2PKEA 1M8JA 5DCLA 1E3SA 2H9YA 4GXNA 4I1MA 5EMHA 5HEKA 3RLIA 2W83A 4QGAA 1RT9A 3IGFA 5K8JB 1REQB 2JLSA 1JR4A 2AX4A 2ZJZA 1YR3A 3CB4A 2ZSDA 2C31A 3IPLA 4E09A 1XDBA 2FK7A 2WXNA 3A1EA 3Q9LA 1V6CA 2QIOA 2XJ9A 4NFYA 5EKDA 1NVGA 5LMCA 4O4LB 1SHTX 3TQTA 1HG2A 1XQYA 3SHVA 4I9GA 2CL0X 2QY7A 1VMIA 3N74A 2OKCA 1UADA 1SUIA 2B4AA 2W58A 1A97A 2OQVA 3T9BA 4PX9A 4R8SA 4J4HA 2BBOA 3FVVA 1V1RA 2ZIXA 5K0EA 1HE8B 1MIOA 3L17A 5A9RA 3MS7A 3ZX5A 2RFMA 3OZUA 3R0JA 2ZYGA 3HU3A 5HDQA 1RI3A 2PVCA 1XXHA 1PAQA 2Q5JA 3ZY4A 3S4YA 4D56A 1X1TA 3N0XA 3QGMA 4AURA 3LBFA 4C4AA 4NH4A 2VNJA 4P36A 1BS1A 3H9BA 2IYFA 3KWLA 4O1OA 4EF4A 1ZSYA 4F8JA 1RR6A 4L72A 2C97A 5JI2E 2FPRA 1VJGA 3CA8A 4LNUA 1G4UR 2G40A 2WR8A 3OY7A 5K6AA 4I50A 2IOFA 3HY6A 2PGIA 1SZ9A 1P0IA 1UJRA 2PZJA 3OKPA 1CUIA 3UKRG 3G2HA 3N8KA 4ZQFA 1IZ8A 3I8SA 2VHYA 2C58A 1H23A 4U8YD 4B9EA 3K9HA 1JMKC 3E70C 2VDOB 1R6DA 5ARCA 1OYVA 4S1WA 4FHFA 3C6KA 4K6OA 3FNEA 2I8CA 2J9YB 2ZSJA 1CDEA 4YROA 3FVWA 4R1UA 4DJAA 3IJ5A 1FCJA 9ABPA 3X44A 3WRVA 2O3QA 4RTKA 1IPFA 4LQLA 4O4IA 5ALVA 2ZPUA 1NA5A 4HY3A 4NRHB 4GI1A 1U2ZA 5AT1A 5ITVA 3WNZA 4V24A 3S2IA 2D13A 2FR8C 1Q1NA 2X9VA 1T4MA 2EEPA 5KTKA 1BE6A 1RQGA 3UC9A 1WU7A 1E0SA 1Y8QB 4WZ6A 3I2KA 4DHEA 2IV3A 4B35A 1ZC4A 4P54A 5BUSA 2WHXA 1OLSB 1C9EA 4PBTA 2XUOA 4ARUA 4EBAA 1NIJA 1LPPA 1N5MA 4EDHA 4D82A 5BYJA 4OKIA 2JEZA 4CLOB 2RHTA 1A2QA 2GPTA 4W5JA 3ZWXA 4DKXA 1UBLS 4Y6GB 3EQ7A 4HD8A 4HRVA 4Z3DA 2QD2A 3ZNOA 5JZVA 4DV7B 5AVRA 3BDVA 4YUXA 2RH9B 4K0KB 3EAQA 5FTNA 5LNK6 4Y30A 2CJXA 5FI5A 4HH0A 1G3NB 3FGOA 5JFTA 1TECE 4WXMA 3ZQUA 1GAJA 3WG9A 5B3KA 1X7XA 1U0SY 2I66A 5JAZA 1JQAA 2VO1A 4NNPA 4Q82A 2ZVDA 4DLPA 3WYDA 1W73A 3GJ5A 3Q73A 3UB4A 9LDBA 1R0ZA 3IBTA 5FBLB 5GINE 1YB6A 1YZNA 5AMXA 2IXBA 3V8RA 1CQPA 2IUYA 2IBMA 4KV7A 3IAS6 9LDTA 3EWAA 4R6WA 4KWCA 3GT3A 3CHQA 1BVUA 2QSJA 1IN4A 2PX3A 1YA0A 5CJJA 1GILA 3RC2A 3R7DA 2HYDA 3G0DA 1XA4A 4JMLA 1H93A 4F2HA 1TADA 2PG3A 3JSAA 4JL8A 2PUFA 2NU8A 1U7UA 2O50A 3W5SA 4J0QA 1XZDA 3P4YA 3B6ZA 4G3XA 3K9WA 3X1ZA 1W96A 3EMKA 4TXRA 3MAJA 3M34A 4HB4A 4GTRA 1QV9A 1HYGA 3CSTA 2J7PD 3EBLA 4Q3KA 3ZJTA 3LC7O 3BU8A 3QXJA 2R6HA 1NURA 5EP1A 3JQ8B 4FD3A 3TPFA 3MFQA 3L84A 1IJEA 3FVTA 2O8EA 3IQDB 4JAVC 3I8OA 3ZHZA 5KOJA 2ZZMA 1X2EA 3L9XA 1WD5A 1EX1A 3CX6A 2DHEA 2ETVA 4ND8B 3IV0A 5JZOA 2CLLB 3T7RA 2DUWA 3KJEA 1YFZA 4KSCA 4HN2A 1QQ6A 5M3BA 1J42A 2OOKA 4DG5A 2BGLA 3G7UA 3AUYA 3OAWA 1RCUA 3GEHA 1NKVA 5E7MA 2CV1A 4L0DA 4L4XA 3OEYA 5DDIP 1QS0A 3V4ZA 3OSZA 2OCXA 1UBHS 2DT5A 4JV5B 4KLNA 3AY7A 3EGXB 2O2IA 3SNHA 4PYNA 1DJNA 3ILYA 2QQEA 4DSNA 2LXNA 2H7CA 4RKFA 4QRIA 5B30A 4QM7A 1ATIA 4FD2A 4HSEA 3DYIA 3K20A 1DIAA 4KGXA 3C3MA 1Q3TA 2ODEA 4ENUA 4R1MA 3W2HA 3E9MA 3DP9A 3SDZA 3N2GB 3R3HA 5GGYA 3IHKA 1SPBS 3C3YA 2YV3A 4D42A 4FHCA 5EXSA 4XA8A 5BSWA 2YUIA 2V8OA 1UJ6A 1U2EA 3N8NA 5BWLA 2VFAA 1RKXA 4MRMA 1V1JA 3GIWA 5JUWA 1PHPA 2VDUE 4W6QA 3PEWA 1G55A 3T9KA 3N2KB 5PNTA 1CERA 3OOSA 3BFXA 3F9RA 1NBAA 4AN4A 4EL5A 3QVKA 1GRCA 5ECDA 5TR9A 4EY6A 2ORED 4LIPD 1YRLA 3IS3A 2B2XA 2QN8A 1MFPA 5T4HA 1LA2A 3EC1A 1MHPA 3QEAZ 3WLAA 2ZP1A 1HLPA 5U1PA 3DE1X 1FXSA 1Z7BA 4R05A 3INRA 2W43A 4MH0R 1R9GA 2VH2A 1E9AA 1ECPA 4FYKA 1XD9A 3ABKE 2OXRA 1XXHE 3TTTA 2W6JA 4MARA 3RT7A 3DO5A 2ZE8A 3AJ8A 4FT2A 2HR1A 2X1MA 2JLVA 4QULA 4R3NA 1F8YA 5LQSA 3D02A 2NSHA 4O4LA 4J0JA 4FE7A 3IT3A 4LZAA 5EE1A 4RK7A 2FX2A 2HKIA 4JHRA 5BO5A 3EBPA 4UE2A 4AC9A 2IHKA 3MIIA 3RYIA 2EHDA 4CLXA 1RZRD 3GJYA 2Q07A 1CRZA 1NKTA 3B3JA 1SK9A 2HTFA 3LPAA 3FROA 2C9CA 4GBGA 4LY6A 1J21A 4DBLE 1TQDA 4ZOBA 5BMOA 2AXQA 3LQFA 2CFCA 5LL6P 4K6CA 3EMDA 2ZT6A 3U4QB 5HJ5A 3OIWA 4RD0A 5H3LA 1RHQA 1NMZA 3EHQA 4A0GA 1FX0A 5BVHA 7GPBA 1VXOA 2BY4A 3MC1A 1ZC3A 1G6KA 1T5SA 2B69A 4LXIA 2VJDA 3ENZA 4UQLA 1NX6A 1VCIA 4GI5A 2KCLA 3L13A 1AUXA 4AWBA 1WB6A 4WWOA 3ZWBA 4QQIA 3RFFA 3HPQA 1TJ3A 5TJ9A 3TZHA 1JU9A 4NESA 4X54A 5J2TA 4W7HA 5HCIA 4YRJA 1ABFA 5DTQA 2GAIA 3B6KA 3DTTA 2I9PA 2WG0A 1ZRNA 5DFAA 5EJ9A 4J8YA 1JKJB 1W0KD 1N7IA 2Y93A 4RXMA 2I80A 2IQIA 1GD1O 2C2KA 1II8B 4QAJA 1OWMA 3G9XA 3B3AA 3BE5A 3GJSA 1RIIA 3ORFA 3KEFA 3M4XA 2W00A 3EC2A 1CZNA 3ECCA 1XZQA 3TFQA 1TMYA 1W88A 1Q6YA 1FA9A 421PA 4H1UA 1E9CA 5EJIA 2FX5A 2P3QA 2QLTA 4EM6A 3K3PA 1CFZA 3OKFA 1R6UA 1Y8QA 4O4JB 2Z8YA 3EA4A 2GXUA 5AKIA 3GNQA 2R2GA 4K26A 5CR9A 2C3MA 1FTWA 3KUXA 1U7PA 3PQ6A 2ZAMA 3I1JA 1QGZA 5LOVF 1WVGA 1QP0A 4R7ZA 5CGQB 5T6BA 4A3VA 4ZJPA 5AKEA 5B55A 3QUQA 2FDRA 4QQKA 2FSFA 3WS7A 2GF9A 1YK1A 4ZDWA 4OVVA 1JDJA 3ZQKA 4IJKA 3TZEA 1RHKA 3SX2A 3BCHA 5JVDF 1YONA 2I6UA 1H2FA 4M7PA 4MVJA 4AUKA 1PLKA 2JJQA 3D4OA 3A9SA 4EHHA 2XB6A 2IXGA 4ATNA 1G1MA 1SQ0A 1TN7A 2IVZA 3LZDA 3RK1A 4BIMA 2FN7A 3RBVA 4K9SA 3L4EA 3F3SA 2AK3A 3IOYA 5F76A 5C1IA 3AV3A 5JBQA 3FWKA 1I0IA 2G7MC 2HIAA 1SXGA 2H6FA 4ZHQF 5JCPA 3TW8B 1Z38A 3LP5A 3VR3D 5ALQA 3U4CA 2UZ1B 1C0KA 2I6GA 5B1SA 5ALMA 2A57A 4F4DA 4QGSA 2YWDA 1S2NA 5DGDA 3GEPA 2NUAB 3K0FA 2GBFA 4MQUA 3EVZA 4YAKA 1G9XA 4GFDA 1VIVA 4D4JA 2QP4A 2X13A 4I43A 1XRLA 5JSFA 5D6OA 1U8FO 3OZVA 4J1TA 3ZE6A 5IPFA 1S3SA 2IO3C 1OBHA 5IVDA 5ARDA 4RH1A 2QA5A 2ODQA 1UXHA 3Q5MA 2IZ1A 3B60A 5AJWA 2DBYA 2O3SA 3JQ8A 1A5SB 3NBXX 4WNYA 4RLHA 3CRMA 5LDDC 2F3UA 4DEVA 5ALYA 1TJNA 7REQA 3J80A 1E63A 3I2GA 2BR5A 2HBQA 1KBOA 1D2NA 5HJ7A 4RD1A 3JVEA 3KQYA 3FMIA 3KHUA 4J1QA 3IIKA 4ZHSA 2OOEA 4HFJA 2EINE 4G09A 1QRAA 4YPOA 5SICE 4AZVA 4JXXA 1D8TA 1YU6A 4OIMA 4IIUA 4Y2UA 1R0SA 4BN0A 1ZBQA 4PUCA 5IH3A 4WFKA 1G3RA 3W4KA 3ZHTA 3ZD6A 1UZUA 2EJUA 1CUAA 4BN5A 1EWVA 3KCNA 5EAIA 1CIVA 4J7WA 3DL4A 2KLBA 4Q18A 4ND7A 1I1QB 5I7VA 3U9WA 3W6PA 4RHEA 3QI7A 2GBPA 5BN3B 1K0FA 5KNDD 2JI9A 4JEUA 4NBUA 3ZIUA 4ZT5A 4PHHA 5P8WA 2E4AA 3ZIMA 3A58B 2CSUA 4WBXC 2Q4BA 2ZJOA 5BSUA 5IBCA 3GLHA 2EBHX 3SX4A 1I14A 1GNQA 4R3WA 4S3MA 3N2GA 5DW0A 4W8HA 1R3UA 2H1VA 1S1MA 1Z6AA 4UC0A 4PFSA 1CU1A 4HS4A 3PHBE 2EFCB 4QREA 1JP7A 4A92A 4Y6QA 4G1VA 2QW1A 3J7TA 2GPAA 5EKXA 3GCGA 3SK1A 3R3XA 4QNMA 4B2PA 1WM1A 2EP7A 5EHQA 4Q03A 1OIXA 2PJUA 3ORYA 3SVZA 3PG5A 2OC9A 1YQUA 3FE2A 3V80A 4K5QA 4GPAA 1MX5A 4AOFA 4P0TA 3BHIA 3USES 5CCEA 1K8KG 3WNDA 1F7UA 4LZLA 3QNKA 2P9QA 3RKVA 1ZONA 1ZR2A 1QH8B 3CG4A 1QHFA 4TN1A 5JS8A 1YFLA 3DBVO 5L3SA 1GL6A 5I6DA 3ZV3A 4L50A 2P35A 5KNHD 1N0UA 5K3BA 4EVIA 1P3Y1 1J2RA 3OE7A 2F37A 4YN3A 4OX9Y 3K9IA 1UQTA 2UVPB 1FPQA 2Y3AA 1HL7A 2VYIA 5TT0A 3VHLB 3H04A 2CLFB 2YJ3A 4LZOA 3FCSB 4EA8A 3IEMA 2FKNA 5DM4A 5CEDB 4QEDA 1UDBA 4G36A 2EKPA 4JVOA 2QSZA 5HKBA 3A4YA 1ZMRA 1J00A 1W85B 4Z0NA 3V1MA 4RQTA 3K35A 1JTFA 1N92A 2ODNA 3L5KA 3E3MA 2QX7A 3T7CA 3FYUA 4EG8A 3JAMA 4LXGA 2GNAA 5ANRB 1NWCA 4LRTB 4LF9B 2C3UA 5TJHA 3I52A 4MR9A 4XGKA 1ZR4A 2IEDA 2QJOA 1M8FA 5JQGF 4Y0VA 4JJKA 1ZZGA 2B7CA 1HETA 1L6IA 2H4XA 1NQVA 1K68A 1WKBA 3ZQ4A 1NVUQ 4UQYA 5JJ7A 2NM0A 5BP7A 5ITZB 1EYHA 1R0BA 2OHJA 1TU3A 2MYTA 3RS4A 4DSUA 2QL7A 2ISSD 4M0DA 3H83A 2X4LA 2JFNA 2ZROA 5DEOA 4LBZA 1OILA 2ZGVA 2B8NA 1RPAA 2QG6A 5JXIA 4G9BA 3DULA 3GZNB 5EPOA 4WNAA 1JKJA 4ER6A 4MW2A 4RG9A 1GKKA 5NULA 4ZC8A 2ATIA 1QGED 1FFHA 4JBNA 1K2WA 2MSKA 2C5HA 2ZWIA 1GV0A 2HQRA 2KB0A 5FYQA 4OBWA 3B8HA 3O0TA 2H4JA 3AQ4A 3NCHA 4D02A 1G9SA 4MVJE 1OZHA 5HIIA 3LQ1A 1W5FA 1M74A 1N7GA 4YRNA 5JXHA 4GZ3A 5FZQA 4ODIA 1U1FA 1LDMA 1B6SA 5IAJA 1JV2B 2GO1A 3V1NA 1NLMA 3ZGXA 3HP7A 4Z0TA 1KYWA 4IIVA 4RY8A 3GFRA 4L0CA 4U6SA 1DUSA 2WIFA 2KE5A 2I6QA 3M4NA 4F2PA 5LP0A 1UEIA 5GONA 3DEKA 3WL6A 3AUAA 1R0WA 4I9FA 4GQBA 1Z6GA 1MDBA 3P8ZA 3MLAA 3ZZUA 3DDCA 2DKNA 5DGIA 2BFCA 3DFIA 2QYTA 3D8NA 4PC2A 5ALZA 1AO3A 3QE0A 3L43A 3QG5A 3G6WA 3EZXA 4QTUB 2XXBA 4EQZA 3APCA 3FTNA 4LTNA 1NNEA 2QZ9A 1P45A 5FTJA 4G0UA 1GTSA 1TVCA 4NEQA 1YKGA 2LPMA 1UJNA 5FJJA 4Q3DA 2YHIA 4D0SA 1QFJA 5FIOA 2QXUA 3TW8A 4C0MA 1J8YF 1OCOE 5A5DA 3DWIA 2RAVA 2UZ1A 7YASA 1HYBA 3UJDA 2VDRB 1EFPA 4BMXA 4OYHA 4Q1AA 3Q10A 4IG4A 3D6TB 3MS2A 4IUYA 1KYZA 1NUTA 4Z49A 4DT1B 4FYMA 2X23A 4XAQA 1EQ2A 4Q19A 4CCYB 2WKSA 3LDUA 3CKCA 3KL2A 4FVTA 2G1UA 4ZVVA 2PZKA 3IAM6 5CFPA 3AG3E 4RO0A 2A88A 3VYRB 3VU9A 2QNRA 4F7WA 1OD6A 2D1QA 1CUSA 4ZZ1A 1E98A 1JEYB 4U9IS 1HWYA 1VBNA 2MHCA 3ZCPA 1VDMA 1DKPA 4UVIA 3TPZA 1PTJC 2DFKB 3NB0A 3COJA 4GKVA 3VJKA 3WGJA 1ZGHA 1D4FA 5FTWA 2AOVA 1RLUA 3DKKA 3DAOA 5JU6A 2VZ9A 4MGHA 1NGSA 2A0FA 2IU1A 3PC2A 3GLTA 3GLHE 2AZTA 4QYIB 4UAVA 5BYBA 2DSTA 3L6DA 3R7AA 3WP1B 2GNOA 2XT9A 3WRXC 1CETA 2R5FA 3LX5A 5L7YA 3UAWA 1NV8A 2P0EA 3B5JA 1NOKA 2HLHA 4NBNA 3G5UA 4RUKA 3CRVA 3IMCA 3PUIA 1PKEA 4BGIA 1VDZA 3RF7A 2B35A 1KGSA 1A9RA 1WPXA 4KAFA 2IH2A 4KQJA 1RRGA 3MTAA 1VDYA 1X7ZA 5BN3A 4XFDA 2XE8A 4PSUA 4FHEA 1SOAA 2PMFA 3TIFA 3TR6A 1Z5PA 1ADFA 3WMWA 3T7AA 1H1LB 1IN1A 4PF1A 4BLRA 3K7EA 5SZHB 3IR6A 3NAQA 3VTXA 2C4MA 4YECA 1KAEA 1QZ2A 4LYHA 4RCZA 2YJ6A 5F78A 1WHTA 4R31A 3O7MA 2GYWA 4DJDC 4YAWA 3FYHA 3TMAA 4YT4A 1D8AA 2NNLD 5REQB 3RVNA 1ZNWA 2ZWPA 3VR5H 1QGOA 4KB5A 4WY5A 4KRYA 4IJ5A 1KO8A 1IOVA 4HEA1 1KZ6A 4URZR 1D2RA 1AMOA 2Y9MB 3T5TA 2IXDA 1HDZA 1Z6ZA 3FFXA 4UBLA 5AW5A 5JD4A 3MD0A 3OCXA 3HXQA 4GH5A 1DFIA 3N6XA 1E77A 2QLJA 5CMYA 4LNHA 3WNQA 2C8VA 4CDNA 2GZSA 1QV6A 3VSCA 3NNSA 1S5PA 2VHVA 1E4EB 3R3YA 3HO1A 3I2HA 2PSJA 1U7WA 2GBLA 4CKCB 3RE1A 1W8DA 1P62B 4W82A 3DR5A 3MHPA 3E6AA 3ITEA 4ILEA 2UVPA 4WECA 5LZ5A 3NWBA 4N6GA 5A1JA 2IF0A 5GWXA 1CX9B 3ZU4A 1B0UA 1ZK1A 2Z6UA 2Z04A 2VHTA 5F5NA 1N1EA 1K6EA 3RWMB 5EMKA 3WQSB 3OPVA 2ZBDA 5FPYA 2OG1A 1U2RA 5EXPA 2QMQA 2ACVA 2PRJA 3KZOA 1Q1AA 4XWYA 4I2ZA 1EVIA 2CXXA 2E4ZA 2PEZA 5FPHA 3PNBA 2XUHA 5E9WA 2PNFA 2E2WA 4CXMA 2GI4A 3D9MA 1Z26A 1SOWA 4M1ZA 5CEJA 4IJWA 5DP1A 3HJCA 3A1TA 2AYXA 3SF8A 3W1VA 1WS6A 4C0KA 3Q8KA 3NOQA 3UMGA 5CVDA 4B8ZA 5LOZA 1E3IA 1DIOB 3LOQA 3U40A 2KMLA 1Z2AA 2OORA 2WIKA 1ST3A 2OO5C 1RDFA 2Q3BA 1W0CA 3E7WA 1BTOA 2R00A 4BLOA 1Z4OA 3LPZA 1LQUA 3GZNA 3SQOA 2BHNA 3R4VA 2XNHA 3IMFA 3NXKA 1LH0A 1QPZA 3IAXA 3U7QB 2P6PA 5IT9A 2Q6VA 3DCNA 1GLNA 4OMDA 4BFRA 3TW4A 3LRTA 1DELA 5CEFA 3OQPA 1JHZA 3ACBA 4BJ3A 3OIFA 2JHCA 2I62A 2BV3A 1ORVA 1G5TA 4RVGA 3R20A 3TTSA 3QLVA 1O6ZA 1SG9A 3T8MA 2X1LA 3LCCA 5EY5B 3KTFA 2I1VB 4ZVLA 1HT0A 3UKOA 3P9QA 4JR2A 1G0NA 3KZXA 3KNZA 1UANA 1J22A 2VNKA 2C2MA 2XTNA 4EZEA 3W3ZB 4AW9A 4UTNA 2AK2A 3ZIAA 4YAGA 1RWPA 1LPOA 5IXYA 4JP2A 4EUKA 5KEIA 3L7NA 1Q14A 3WWPA 4Y1EA 1V37A 1UIMA 4OK3A 1XR3A 3PWZA 4BZWA 1DCFA 1UOHA 1I10A 5C81A 3HKEA 3ISTA 3AKEA 4QGBA 3ENWA 4TXMA 3D9QX 1QZ3A 4D5GA 4MI3A 5ETJA 3ADKA 1F51E 4J16C 1KZ7B 4IDBA 3T5XA 2H2HA 2WSBA 3K0BA 2ESRA 4MRSA 4H6VA 2WIAA 2WJIA 1SCDA 5JG7A 2I1QA 1B00A 1M0SA 4MDEA 5JWOA 3BBLA 2FHPA 3KCQA 5FWNA 1EJ0A 3I62A 1C9MA 4TUMA 4TTRA 4PNEA 3N28A 3PR1A 5ALJA 2PA0A 4XDHA 1DPGA 4IRXA 5A05A 3CLTD 5HIKA 1AQUA 1AQNA 1YZQA 2XHEA 3OTIA 4HLUC 2IUEA 2FMUA 4CCYA 4BXOA 4I1OA 4GLOA 3AEZA 4JSTA 1V1RB 2ZIXB 4OA5A 3HA2A 1CJCA 3AGPA 2HDNB 5DULA 1K3UB 3MKRA 5CFRA 3SZ3A 2IJGX 1ZBDA 1EXWA 1UOOA 4CNQA 1AKUA 2HWKA 1CJUC 5TGTA 1XXHB 3STHA 5B57C 1RJFA 1OZ0A 3TVYA 4J0CA 4AROA 1OZGA 1C3VA 3VVMA 2ZIEA 1UF9A 1QKIA 1MPTA 2Z83A 1N4AA 1JLHA 2HXGA 3IAUA 4W7IA 3VJRA 3ZNQA 1JJIA 1VLVA 3E1KA 4FN5A 4LNUB 5EJMA 1XTSA 1WDMA 3A4VA 2FOLA 5EJ6A 4CV2A 4M49A 1Z0JA 3TI9A 2SKCA 5AK3A 2E3JA 4OF4A 2R66A 1XVVA 3TCKA 2PSHA 4DNPA 1J7KA 1FNNA 1VL6A 4N1AA 3LL7A 1X1RA 1B4DA 1XZBA 3VPDA 4M8LA 3CHPA 3EGOA 3KJQA 4FDUA 5ALPA 3A36A 1IRIA 1UQRA 3P0EA 4FBMA 1NW6A 4LJKA 3LP6A 4W9NA 3HJGA 4YS6A 5CXQA 4O4IB 2FPPA 3M9XA 4QXQA 3ZUGA 4B7UA 1VIMA 4AM9A 1FYEA 2IYSA 1GP2A 1QLWA 4LNUD 3AVWA 4FXOA 4G1CA 2ZZNA 3OFNA 2FEOA 4M46A 4ALJA 4WK2B 3KSQA 4PGFA 4X8HA 1EQAA 3I28A 4FE3A 4HBDA 4HDCA 2OZPA 5EKTA 4IIJA 1O9HA 1GYQA 5AKHA 4N5LA 1BXZA 1NBEA 4MEBA 4AQDA 3AONB 3AG2E 1F38A 4TT8A 2HU8A 2RGNA 3KPYA 4L2IA 3QU4A 3VPCA 1IZ9A 2ORWA 4M4SA 2B0OE 4PHGA 2VT7A 4S1NA 1W5BA 3ILHA 1D2MA 3FUWA 2DAPA 4Y6WA 2V6JA 3FPCA 3AEYA 4DCPA 3LX6A 2Q4TA 3HI6A 5KVAA 4OXYA 1PZEA 4FDVA 2PFGA 3VOSA 2ETAA 1FDOA 2DQKA 5GV7A 2OQIA 1ZSNA 1KFEB 4R2JA 5K0CA 1HA3A 2QAJA 3ENKA 4AJPA 1X7XB 1MVLA 2J5RA 1JYSA 3WAGA 3OZXA 3VOBA 3S1SA 2VAMA 4EPVA 2TECE 5E9JA 1IVYA 5A3SA 4ALMA 1KY5A 2ZJ3A 4B46A 2WOJA 3KELA 4TWBA 1GZ6A 4LRYA 2H7VA 4CKCA 1K4MA 1ZQ1A 3NV9A 3ONNA 4XQGA 3FZQA 1CUXA 4N3GA 2ZM5A 1PZMA 3UT4A 4RHCA 1KSHA 3X2QE 4GP9A 4QBHA 3RUHA 4Q7KA 4DA9A 2PUDA 3UFXA 2ZI6A 2AMJA 4MEJA 1S2MA 4B80A 3ZJUA 1XKTA 2QRMA 1ZD4A 2VHWA 4MNTA 2NU8B 3L0OA 5IT0A 1QCDA 1QRRA 1I3CA 2H17A 4TTPA 4FKBA 3QVWA 4MVJH 3KPJA 1V54E 2WAOA 4FW9A 4U07A 3E2MA 2AG5A 4RTMA 2HO1A 4N5NA 2ZIAA 2BH2A 2Y1FA 4UBNA 3DHYA 1W36C 4YCCA 2O8EB 2X8LA 3SDBA 4G1EB 3OLYA 3OSUA 3G8AA 1GZHB 5BT1A 1B6GA 3QFFA 3CF6R 3WIDA 4ND3A 4BMOB 1X1AA 2W2NA 5FT9A 4WERA 4QGFA 5IF9A 1U11A 3PSHA 1FXUA 5IKEA 3EJ6A 4I55F 4UOEA 2ZSKA 5C2JB 2OCPA 4XEIG 1IEQA 1MX4A 2IUSA 1EX6A 1UKZA 4HL6A 4N9WA 2FI7A 4K9LA 5CXXA 2QU7A 4YMGA 3QPDA 4GOOD 1A76A 1C7EA 3W4IA 5LQMA 2XMCA 4JHKA 5H4HA 1QS0B 2GH1A 3GBSA 3RUPA 2FN9A 4TV8A 3MB5A 1Z2DA 2XZTA 2K7ZA 4JXKA 4NONA 4FNOA 3OLXA 4YRKA 4TLBA 4WWNA 3COPA 5IEBA 3L0SA 3RJVA 5CECB 4J7XA 5LZ9A 4DARA 4QYWA 1QUFA 2XRZA 4UULA 3WAKA 3O2JA 4EZBA 4CL0A 2DYRE 1M5RA 2AT1A 2QZJA 4BX0A 3DE2X 2BKKB 4H0NA 5KU1A 5TVGA 1KOFA 2OUKA 4K6KA 4R0MA 2R8RA 3LFHA 4QOIA 2VRCD 3EX7C 4KRXA 1T36A 1KDRA 4TTIA 1CRWG 4M7RA 2G1KA 3D8UA 5F3WB 4BO0A 3QVLA 1XU7A 2X4GA 3ZE9A 2YYSA 1PS0A 4MRMB 1JHMA 4QUKA 2VHCA 5EINA 4V3BA 4L28A 2H2WA 4HNSA 3USZA 5CYGA 1I4EB 3C6XA 4C20A 4DM7A 4H18A 1YMPA 5ITWA 4AYTA 1ISMA 5DBOA 1P5JA 3FPEA 2J4CA 3DMYA 3A11A 1JPVA 5FNVF 2D1FA 2XI4A 1TKBA 2VJOA 3BXHA 5G40A 3QZUA 3N0WA 3SYKA 4Y2VA 4QQFA 3O4IA 5ALTA 3W5BA 2BZ1A 3SEZA 1T43A 3BAFA 2CXPA 1KS9A 3KSAC 4FM9A 1T9BA 5MN5A 1G5PA 1Q22A 3L77A 1PE0A 3JWPA 2Q6TA 3HXLA 3PCXA 1H6OA 1SW6A 3GAMA 3O94A 4BX8A 1L7DA 2XEEA 4YJDA 2PM8A 4KPFC 3L4KA 4DUIA 1ZM3A 2F4VB 5JYEA 2E4UA 2JS7A 3SR4A 4MW9A 4OG2A 3FRHA 3ER9A 4IUDS 5ER9A 1KEKA 1WKVA 4EG7A 3GQBA 1XTUA 3MYVA 1PNRA 1K63A 4EUSA 1AGRA 2P2GA 3B95A 3VH3A 3RYIB 4BMNA 4C14A 4WNDA 4AG6A 1FYDA 2DPXA 2OGUA 1NU8A 3L92A 2IYAA 2J6HA 4EB3A 4MS1B 4E5YA 1YI1A 1LGYA 5EZ6B 4H6XA 5TC4A 1MB4A 5FOXA 1VPEA 4WAUA 2GKOA 1XMIA 3U4TA 2JANA 2PX0A 5I7FA 3LDHA 1D1SA 2DYKA 4LOKA 1LBIA 2DM6A 4TXJA 4YDRA 1FX0B 5BVHB 4XGRA 3PFIA 1UC4B 1XRJA 3TE6A 5C8XA 4RELA 2EFHB 1RI5A 2ZI9A 3BA6A 2PMBA 1H3NA 1PWHA 2P9FA 1SUEA 4LZPA 4ZEXA 1H2EA 5EIEA 3DPSA 2H5IA 2O1XA 4C0QC 4HGZA 2WNIA 3BSWA 1TTTA 4A1GA 2VLBA 3SZRA 1EXNA 4EKDA 3IUBA 1RCTE 5J2TB 2P2LA 3JUEA 1XRPA 3VR5A 1WETA 4OPMA 5IAKA