The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
15
|
sequence length |
83
|
structure length |
69
|
Chain Sequence |
MLLSNEEFLKKLTDLLQTHVYLSQKNPVDEASVLIRAKSGAAEKISTVVELDYFTDFFQSYAEVKGQIV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of Srp14 from the Schizosaccharomyces Pombe Signal Recognition Particle.
pubmed doi rcsb |
| molecule tags |
Signaling protein
|
| source organism |
Schizosaccharomyces pombe
|
| molecule keywords |
SIGNAL RECOGNITION PARTICLE SUBUNIT SRP14
|
| total genus |
15
|
| structure length |
69
|
| sequence length |
83
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2009-01-25 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02290 | SRP14 | Signal recognition particle 14kD protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Signal recognition particle alu RNA binding heterodimer, srp9/1 | Signal recognition particle alu RNA binding heterodimer, srp9/1 |
#chains in the Genus database with same CATH superfamily 4UYJ B; 2W9J A; 4UYJ A; 1E8O B; 5AOX B; 1E8O A; 5AOX A; 1914 A; 4UYK B; 4UYK A; #chains in the Genus database with same CATH topology 4GZ3 A; 1UJR A; 1JNZ B; 2X5T A; 2FFG A; 4GZ6 A; 4N3B A; 1QMO E; 1E8O B; 4GYY A; 4XIF A; 2FJE B; 4XI9 A; 3V3L A; 4AY5 A; 4UYK A; 2W9J A; 3BT3 A; 2A90 A; 1X4R A; 3GYX B; 1JNR B; 3OMS A; 4CDR A; 1E8O A; 2DK6 A; 5BNW A; 3ITW A; 2FJD B; 3SK1 A; 4UYJ B; 4AY6 A; 4N3C A; 4N39 A; 2FJA B; 3PE3 A; 4GZ5 A; 5AOX B; 3TAX A; 2FJB B; 4GYW A; 5C1D A; 2RSF A; 2X5H A; 2K4N A; 2KJZ A; 4AKX B; 4UYJ A; 3TU3 B; 2X5G A; 3PE4 A; 4N3A A; 1U7I A; 5AOX A; 1914 A; 4UYK B; 3VCX A; #chains in the Genus database with same CATH homology 4GZ3 A; 1UJR A; 1JNZ B; 2X5T A; 2FFG A; 4GZ6 A; 4N3B A; 1QMO E; 1E8O B; 4GYY A; 4XIF A; 2FJE B; 4XI9 A; 3V3L A; 4AY5 A; 4UYK A; 2W9J A; 3BT3 A; 2A90 A; 1X4R A; 3GYX B; 1JNR B; 3OMS A; 4CDR A; 1E8O A; 2DK6 A; 5BNW A; 3ITW A; 2FJD B; 3SK1 A; 4UYJ B; 4AY6 A; 4N3C A; 4N39 A; 2FJA B; 3PE3 A; 4GZ5 A; 5AOX B; 3TAX A; 2FJB B; 4GYW A; 5C1D A; 2RSF A; 2X5H A; 2K4N A; 2KJZ A; 4AKX B; 4UYJ A; 3TU3 B; 2X5G A; 3PE4 A; 4N3A A; 1U7I A; 5AOX A; 1914 A; 4UYK B; 3VCX A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
