4GYWA

Crystal structure of human o-glcnac transferase in complex with udp and a glycopeptide
Total Genus 281
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
281
sequence length
715
structure length
695
Chain Sequence
PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKHIYDNRIVLNGIDLKAFLDSLPDVKIVKNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 281
structure length 695
sequence length 715
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gywA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gywA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gywA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gywA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gywA03
1O6CA 4I9CA 5A6CA 5GPBA 4XIFA 4CDRA 3CV0A 1EM6A 4MI9A 3MSCA 3WAGA 4WNEA 1L5VA 3ESKA 3BEOA 2GPAA 1PYGA 4NEQA 3VDMA 1ELRA 5DBKA 3MTAA 3OT5A 4QLBA 2ONDA 1Y6FA 3LCAA 4RIIA 3MV2B 4F3VA 1NOJA 3SF4A 3T3EA 1PSWA 4X7MA 3QOUA 2MHKA 3S7BA 1HH8A 2ATIA 4GYWA 5I45A 3ZCQA 3OXLA 3Q15A 3RSZA 4L22A 5BW8C 2Y4UA 4CTNA 4W9RA 2V5FA 3RIBA 5CCMA 1NZFA 5A7DB 4JA9A 4I2WA 5HQ8A 3G2IA 2C9ZA 3MKRA 2F3SA 4GYOA 2IYAA 2Y4TA 3CEHA 3H4TA 3Q3HA 2FO7A 4YVQC 2R68A 3ZCSA 5FT9A 4HOQA 3T3HA 3NCHA 3ZHEB 3LY9A 4BQIA 4G2VA 5G04J 1Z62A 3D1JA 4U0UA 1GPYA 4ABNA 3G2LA 1C8KA 3TG5A 1TJCA 4MRAA 1F6DA 1PN3A 4AY6A 3NC4A 4UQZA 2P58C 1GPAA 4M83A 2LSVA 3FWVA 1RZVA 3VUEA 2X6RA 2PQNA 2L6JA 3GYZA 3ZN3A 2QN1A 2ACVA 2KS6A 4U04A 1XOIA 2SKCA 4G2TA 4AMGA 2GT1A 2LSUA 1FTQA 2VG8A 3AMVA 3HBFA 3URZA 4RIEA 3UYKA 5HI7A 3QWPA 3QDNA 3T7DA 5DXFA 4RBNA 3MT7A 4YUAA 5D01A 3ZFWA 1QKJA 5KJLA 1E4OA 3CKCA 5EX0A 4F97A 2IEIA 3MQFA 1NVKA 1IXYA 3OY2A 3TG4A 3ASFA 4GZ3A 1P2GA 4APOA 3DD1A 4UQYA 2IUYA 2WQHA 1WM5A 2VYIA 4EKYA 3PDNA 3CUUA 1Y8MA 1LWNA 3NP9A 3K9IA 2IEGA 2FEZA 4U07A 4EKEA 2AZDA 3LYAA 4RG9A 1Y8ZA 3O3CA 1JIVA 3HBMA 5FJYA 3ASHA 1XL0A 3OTGA 4BQFA 1WV0A 1LWOA 4AM9A 1L5WA 2FFRA 3G2KA 2QRQA 2F3PA 2P6PA 3D0QA 4AMBA 2X0DA 4U0SA 2QRGA 3CEQA 2KCKA 4A1SA 4AN4A 2F3QA 2Q7FA 4LEUA 3GZ1A 2XMPA 2C2LA 2R60A 4UI9C 1L5QA 2YHCA 1KT1A 1J39A 3T3IA 4NESA 3BCRA 3ULQA 4BFCA 3G2NA 4GCOA 3RJVA 3L7DA 2OOEA 3CK8A 3QWVA 3EBOA 3L79A 1ELWA 4GYYA 1NLMA 3QKWA 2KC7A 2H1FA 2QN9A 3IEGA 2UY1A 4N5CA 3T3GA 2HR2A 1A17A 1P2BA 3ZCVA 4EQFA 3OTIA 1OUVA 2I6HA 3TGOA 3O48A 3ZPJA 4AY5A 3ZCPA 5D00A 1P5QA 1K06A 1HZ4A 4H7XA 3WADA 5CHEE 2XA9A 3Q3IA 1C50A 2GJ4A 5TMEA 5JTUA 4KBQA 3ZGQA 4HOTA 1Y6GA 3OY7A 1NZNA 1GGNA 1P4JA 1QZ2A 1P2DA 3CKBA 4EJ2A 4WNFA 4F9FA 2PZIA 2JJMA 2R4TA 3AS8A 2VCEA 2XPIA 3LY7A 2QN3A 2SKDA 1JG6A 1IYGA 4G1TA 1UQTA 4KQMA 5KJMA 4JL0A 4RENA 2QN7A 1HXIA 3COPA 1Z6QA 2BGTA 1SXPA 4G23A 2YQ8A 2VCHA 2Q6VA 3T3DA 2GW1A 3NPAA 3PE3A 5DIZA 4F96A 2AW3A 3KD7A 3RU0A 2QRHA 5TMBA 1FTWA 2ACWA 3MV3B 4I9EA 4NC9A 2XGOA 4Y6CA 2R4UA 4RIGA 2KCVA 3QWWA 1SXQA 3GW4A 1FS4A 2XCBA 2AMVA 1YA0A 3CUTA 2KATA 4KQ1A 2XGSA 3KAEA 4UQXA 3JYSA 5DLDA 3MBOA 1L5RA 3TOVA 2ASVA 4N39A 1P4HA 2F9FA 4J8DA 4G26A 4RELA 2E2EA 2XCUA 3TSAA 3AS5A 4MICA 5LCWC 2AVPA 2O6LA 1M5RA 5HXAA 4G24A 3G2HA 3E3OA 2VGXB 5KJKA 5IKOA 2XGMA 2QN2A 3MRTA 2G9QA 3S7JA 5JJ6A 2X0EA 4I1AA 3CX4A 3ZCRA 3L7BA 3MS4A 4GA2A 4U0ZA 3CVPA 2ECPA 4WACA 5IKPA 2C4MA 3Q49B 2DBAA 3MS2A 2YJNA 3CK7A 5G05C 4BT8A 4GPBA 4BQEA 1BX3A 4MHOA 2QLLA 2VSYA 2IW1A 2BFWA 9GPBA 2ZB2A 1L5SA 3UPVA 4N3CA 3S29A 3U3WA 1B89A 2R66A 4FKZA 5EX3A 3RKVA 1A8IA 2G9VA 2PYIA 2C1XA 5EKQD 2GPBA 4N2QA 3FFLA 3E3LA 4B94A 2IFUA 1FU7A 1C3JA 1F0KA 3S27A 3C48A 4GZ6A 3VTYA 4HWGA 2PQRA 5JTTA 2XCIA 1VGVA 4RG6A 3ASDA 1UZUA 3ASGA 4AIFA 3EBPA 1AXRA 3ZCTA 4G25A 4JHRA 5G05J 4WNDA 4YVOA 4BT9A 3WXXA 2QLMA 1WUYA 4KXKB 3MTBA 2IV7A 3S0JA 3NF1A 4GZ5A 1HLFA 3CUVA 4BTAA 4N3BA 2GPNA 1NZDA 3SZ7A 4ME2A 1FC0A 2WTXA 3C4QA 1GFZA 7GPBA 3MT9A 3MEKA 3VDNB 2IV3A 2QRMA 2VQ2A 2R5SA 4JA7A 4N2SA 4J8FA 2PL2A 3HBJA 3L01A 1GZ5A 3S2UA 1V4VA 1XNFA 4EL5A 3BCUA 3NP7A 1FU4A 3LKUA 4NRHB 4LDPA 5ARGA 1FA9A 4J0UA 1Z8DA 4BTBA 4H7YA 5TVGA 3BEEA 2OFFA 2G9UA 3LY8A 3S28A 3HYMB 3GPBA 3DDSA 2VSNA 3RO2A 4WUYA 3UYLA 3IA7A 1JG7A 2J9QA 1ABBA 3MRXA 1XL1A 5TMDA 3E4BA 3R9AB 4HLNA 1NOIA 4YNDA 3VUFA 4GA1A 3CVNA 4HOUA 3OKPA 4GA0A 4O6FA 2FF4A 1L7XA 3DDWA 2BGUA 4RIFA 1H5UA 2BUGA 2QZSA 2HY7A 3TAXA 2QN8A 3GZ2A 4J8EA 4N3AA 3RO3A 1GPBA 4W6QA 4EL0A 1YGPA 2VGXA 5G04C 5D0OD 5ARFA 3MRVA 4M7PA 3BD6A 2FETA 1IIRA 4N9WA 3OXGA 3OTHA 2SKEA 4REMA 1WUTA 1RRVA 3S7DA 5BT1A 3S7FA 3GUHA 5FZSA 5AYWD 1KTIA 4PQGA 1ZU2A 1NA0A 2KCLA 3RT1A 3CV3A 3U4TA 3RHZA 1JEJA 1QQEA 1XKXA 3EDTB 5M72A 3CUYA 4I17A 3L7AA 3CEMA 1FCHA 3CVLA 1E96B 5KJNA 1ZBPA 4WHMA 2XEVA 5C1DA 3Q4AB 1KT0A 1B4DA 4KYOB 4BWRA 4GCNA 1WV1A 2PYDA 1XC7A 2FI7A 3LPZA 2XA1A 3OXFA 2VGYA 2HO1A 2XCCA 2C0MA 2F3UA 4MHSA 2AV6A 1GG8A 3QKYA 1WAO1 3WC4A 5DU2A 4CTOA 4MI3A 4NQ0A 3MT8A 3OKCA 2NC9A 1K08A 2PRIA 3D0RA 2IF4A 2PQ6A 2C0LA 4M60A 5CCLA 2GEJA 1PC2A 4UI9J 4WADA 3ZCUA 3BCSA 1KLXA 1AHPA 1XV5A 1L6IA 2JZCA 3C4VA 3N71A 4Y6WA 1NA3A 2GEKA 3CVQA 3IAAA 5FZRA 4WNGA 3AS4A 2G9RA 2JLBA 3OKAA 1E1YA 1PNVA 1FU8A 4HORA 3BD8A 4FZRA 5BNWA 3DZCA 3SYMA 3NB0A 3Q5MA 2FF5A 3BD7A 3QHPA 4KQ2A 1RZUA 4X7PA 5LCWJ 3T5TA 2QRPA 5D0QD 2IYFA 3Q47B 4IN3B 4MI6A 3MTDA 1JIUA 3H4IA 1FTYA 4YI5A 2FBNA 4I2ZA 5FZQA 3VTXA 3SYRA 4XI0A 3HBNA 1WW2A 1C8LA 4X7RA 3G2JA 1W3BA 4CGVA 5FTPA 1NOKA 1EXVA 1IHGA 1P4GA 5LQDA 4LEIA 1YA6A 3MS7A 2UY1B 1WW3A 4Z5XA 2HYZA 1QM5A 4RIHA 3RSCA 2H1HA 2QFCA 5JJ7A 4YI3A 3Q3EA 1UQUA 3CUWA 3L7CA 5JJTA 3PE4A 3NAZA 4GPKA 3FP3A 3CEJA 3FROA 2UWJG 3KS2A 5ENZA 3E3NA 1JIXA 4XI9A 2GM9A 2WPVA 2LNIA 2BISA 4HOSA 2C1ZA 2QNBA 2XA2A 3MA5A 4CGWA 2X6QA 3UQ3A 3UUXA 4UI9K 2QLNA 2X0FA 4X6LA 1P29A 1Z6PA 8GPBA 3BDAA 6GPBA 3ZHEA 3CK9A 2PRJA 4CTMA
chains in the Genus database with same CATH superfamily
4PQFA 4IX1A 1XDDA 5JECA 5A6CA 3R76A 1T8WA 4IVQA 3CNLA 4WCFA 1G5HA 3KEMA 3M33A 5COAA 5I51A 1X7ZB 2NACA 1OT8A 3L43A 3T54A 4C3ZA 3GH1A 1Z74A 2HMYB 1YQQA 1UPCA 4RZ2A 4FSDA 3EU5A 2H4WA 3ESKA 2EG9A 1DJPA 2GN0A 5HQTA 3NDPA 4TLBA 3BWMA 1O6GA 1C0EA 5KNLA 2FN9A 1L5ZA 1LJLA 4IS2A 2GFIA 3IXQA 2OFOA 3ZU6A 3VPFA 1LK0A 7MHTA 3KUCA 1NU6A 1UZLA 2V4MA 2WYVA 5CLLA 3AI7A 3FVVA 2NVWA 3HN6A 3KQMA 4D3SA 3SR3A 4ZMRA 1KZPA 1VE9A 4S2EA 4QDZA 1AHNA 5AW4A 1U7OA 3MOSA 4BVHA 2WU0A 3B6ZA 4CE6A 2X5NA 3RSZA 1P74A 1E4VA 4OGKA 2HJHA 3WGVA 4E4YA 4OF4A 5EPOA 1U7DA 2P2DA 3GLVA 3HH8A 2CNKA 3RJ9A 1FMFA 1UQRA 4AKEA 5LU8A 5B3KA 4DX2A 4QVGA 4CEJB 4R5MA 2P9PG 1PO7A 4G0MA 4RVDA 5DN6D 2ZSIA 4M9SA 3ER9A 2AXZA 2AR0A 2OXFA 2R68A 4I5FA 4GW3A 3OBIA 4JOSA 4HOQA 4DBVO 2A9KA 5FBQB 3P19A 5L3QA 3RBVA 3GNQA 2C07A 5BMOA 4Y2YA 2W7TA 4BVEA 2BGGA 1UFVA 4PC6A 3DFKA 3UBTA 2NSDA 3CRRA 4KXVA 4D96A 3WAJA 2XDYA 1PN3A 4YHBA 1YVDA 2YW2A 4MITA 1E2UA 4TUUA 1IN6A 2DFPA 4JU8A 3EXEA 4GI7A 4A1GA 1T5LA 5AOCA 2E3JA 4IJQA 4OHWA 1HI9A 2O2EA 4J0KA 2V98A 1EAYA 4KE9A 2LSVA 5B4TA 5D5QA 3FPHA 3MSXA 4NLLA 4TL9A 4UZEA 5G0TA 3UI2A 3RVNA 5IEJA 2RJ3A 4M1SA 2BP7A 2FK8A 4ZOQI 4IFEA 1DV1A 2VRWA 5IM4F 2VP4A 4RZ3A 4QOSA 2WUWE 4IOMA 2KS6A 5C32A 4O2RA 1A8SA 2MYTA 3MTEA 1Y5NA 4QVKA 4X1IA 2ANBA 4XKJA 1W0KD 4G5FA 1OAKA 2V1XA 3WLEA 3HBFA 4ZT3A 4QWWA 2X9GA 3F5SA 2JGFA 4RY9A 4LSWA 4RBNA 5F2OA 5B1DA 1CS4C 2V7QA 3C87A 5H9WA 4J1SA 4V2IA 5KMGB 1ZK2A 4EYKA 2YS7A 3D9IA 1HT3A 1X5BA 4LZOA 4AJOA 3O4GA 4R2LA 5E9AA 4BX3A 3PPXA 1BE8A 3TG4A 2C9DA 4EUFA 2AN1A 4EUKA 2WMDA 3GEEA 1M9NA 2Q3FA 1D8AA 2C4KA 5DOZA 4EYSA 4Y9RA 3FPJA 4MVJA 3R7BA 2OYCA 4RY8A 2XE6A 4U2GA 4H7EA 3TW8B 5KYYB 2DPXA 4C6SA 3C5RA 1YA4A 3F9RA 4KO1S 3Q98A 4YRGA 2GPYA 1E3QA 4RVGA 5BPHA 2PSDA 3E84A 4JBWA 3VR4H 3HBMA 1EUDA 3NOXA 2M6LA 4AZSA 2Y9PB 3D7MA 4C1NA 2HAEA 4PYJA 5E75A 2OD7A 2R6JA 1WV0A 2FGKA 2HRQA 2JKYA 3A6JA 3AR6A 3HHEA 1W5FA 1PR9A 3PWKA 2F3PA 4URWR 2E1PA 4KUGA 1WULS 1J56A 1CJMA 2GKGA 1BZYA 3JD3A 3JVEA 2QC9A 1I3OA 3C3OA 1UBKS 4N6NA 3UAVA 4AN4A 2BKGA 2CV0A 3BXXA 5KX5F 1QIJA 1A4RA 3E2IA 4TWZA 2B4AA 1QFXA 3V46A 1XQ6A 1BKYA 1KOLA 3TIXB 1LBSA 1L5MA 4YP7A 5IF9A 2MSEB 3H0KA 3WG7E 3MZ0A 5EILA 4GCOA 1Q1BA 1MG0A 4C14A 5ALUA 3QWVA 3NANA 4ER6A 2JLUA 1T1IA 3H17A 5B3LA 1GG5A 3SQWA 2V45A 5C5CA 3KKNA 3VOAA 2VHEA 4GRDA 1TAUA 2YRWA 5GM1A 4EWLA 1JGTA 4YIKA 4DDTA 4HXYA 2CNWA 2CXNA 2RHJA 3F90A 1L5OA 1N7GA 4IJ5A 2VP5A 3T3GA 3VYSB 3HP4A 2GUGA 1WZUA 3DWLG 1O94D 3ACBA 3I4FA 3FAZA 2I4TA 3UXYA 3SIRA 4CT5A 4EHLA 1KI4A 3CLRD 4GMFA 2J0QA 4G8KA 1ZA1A 2N3ZA 4V0RA 4L6CA 1SK9A 3FIUA 3DHNA 1QJCA 5CHEE 2YZ2A 5C7OO 4LF4B 1CJCA 2WYUA 4RZIA 1PNTA 4TYNA 4MUFA 5JALA 3SWWA 1UJMA 2ZSBA 1E96A 1DUVG 5AKZA 2HSGA 1A2OA 2QQ0A 3ELDA 3L8YA 4P3KA 5K5EA 5KJCA 5TQ0A 3OA2A 3QOXA 2M1ZA 3KIPA 1XMSA 5C1PA 1CHDA 3K2IA 4I4TF 5CLJA 4JB8P 5LBUA 4WNFA 2WMOB 3DSTA 1XTIA 4RH1A 1CQIA 1AK9A 3EXFB 4MIKA 1M2WA 2RI6A 4OI2A 1F2DA 3LX8A 4FX2A 5E6RA 4BJ1A 3P71T 1IYGA 3RDPA 4F7AA 4HLUC 3DWGA 2AQIA 3RBZA 5JXWA 3VRHA 4HHEA 2QN7A 1T3SA 1P7YA 2G1AA 1PAUA 5JS1A 1PBTA 2R5FA 5AQEA 1D07A 3W2FA 3Q0IA 4DR7B 1SY7A 2VCHA 4Z4HA 1ILEA 1SBNE 3NPAA 3ND7A 4LPKA 3AEQA 4XVQA 4ZREA 1F8XA 2Y69E 1M72A 4HNGA 2I3GA 5BPPA 1GGKA 4BZWA 4GP6A 1Q84A 2GEUA 3QVMA 1J0BA 4NC9A 3WWZA 4N5MA 1FFEA 4RQUA 5K0GA 1D09A 5FBWB 4DLAA 2YXPX 1MYOA 2WNIA 2FY8A 4OXYA 1OV6A 2P5TB 5LA6A 5ARBA 4RTRA 1JNZB 3SMVA 3ET5A 3AG2E 1LF0A 3R09A 1G20A 1C3VA 1JQBA 4AY3A 4O4HB 4JUAA 4XYMA 2V6FA 3M1YA 5AAOA 1P0QA 4HBGA 3ZYKA 5FPQA 1PJQA 2KJZA 5FV7A 3EPLA 3R7QA 1QDLB 1G2QA 1O9BA 1YCDA 1T0JB 3WL8A 1NYTA 4D9KA 3BERA 1SCKA 3WLKX 1PG0A 5KOJA 4LERA 4JU9A 4F3RA 1K4KA 1SCAA 3S8MA 1KNQA 2ERYA 4PSAA 2V54A 4FCTA 3TLCA 4BP1A 3B95A 4NZNA 2GBLC 2HJGA 5CH8A 3LHKA 5FL3A 3ZCXA 1K8KG 4ZHQB 5JCJD 2FW1A 5EN4A 5IF3A 3RU2A 1K3UB 2WWRA 5HF9A 3WKEA 1QP7A 4O1PA 4EX6A 5IKMA 3KJZA 3VPGA 2EW1A 5JAQA 4JGBA 3SYNA 2ATXA 4I14A 3GZTB 3NRJA 3KU4A 4HB0A 2HSWA 4JL8A 4LJLA 2P4EA 4MHOA 3VOTA 1E3IA 1G1AA 1KKMA 2AOWA 3JQRA 4I81A 4WLUA 3AFIA 3OEYA 3U3WA 2CFZA 3A31A 5AHXA 4HGZA 2NQ8A 3AYZB 3C8UA 4NX2A 5G2OA 5JYBA 1PV1A 3U7GA 4ZHQF 4W5WA 4YRTA 3RRZA 4AP5A 1GFIA 1TKCA 1CJVC 4TKMA 3FH0A 4CYMD 1UZMA 2ZKLA 4FQ8A 4LDQA 1C3JA 1T91A 2O9JA 3GAAA 4KQEA 4M2LA 3AJIA 1KEWA 2HWKA 3AXTA 4QPPA 4RAOA 2F8MA 3RSQA 4UEWA 5CITA 2OMKA 2QYUA 4GZ6A 4II3A 1VHDA 2W2VA 3EEIA 4EKNB 4YAFA 1K3FA 2HCRA 5EIBD 2O05A 1PD1A 1ZPDA 3VTYA 5BWBA 3C24A 3HKDA 3F7NA 3E0QA 4L6IA 4RK1A 3SXJA 2V7TA 3UG6A 3B3JA 5DASA 5JDIC 2KWIA 2QTAA 3ADKA 3O8NA 5J63A 2ZDGA 3TDKA 2AEJA 1MB3A 2YMLA 1YS1X 2QTCA 2EWMA 2ZYSA 5DXAA 2WWFA 2OQVA 3ETNA 3UK0A 3WOVA 1D9ZA 1WUKS 4MQFB 4MYHA 1ICIA 3VLDA 1ICEA 1ODKA 2CNNA 2QLMA 1CUDA 3A9WA 3FR7A 4YAWA 3W9BA 4M7WA 1GTRA 2V4HC 2IV7A 2H1WA 1JWBB 4BKQA 1HLFA 2EERA 4DV4B 3IL2A 2WT9A 3KEAA 1BMTA 3K72B 4RQTA 3CPEA 2A78A 2FPRA 2A5YB 3PNQA 3H8JA 3K0CC 1TVKA 1JVNA 1GFZA 2OG1A 4OVKA 1QXSA 4L72A 2JLVA 3DMRA 5H82A 1ZRHA 4LBVA 4RMJA 5IC5A 3LUDA 1BKSB 1ADYA 3HDYA 2C9BA 2Q46A 4I1VA 4MV0A 3MZLB 4DR4B 4NENB 1YHNA 2W48A 2WNHA 3OC0A 4LNGA 4MWZA 2WI8A 1R15A 4QPDA 5CLIA 2DGDA 1A69A 1TLTA 1HYHA 1U02A 1EFPA 3GLKA 4UE6A 4P2GA 1V3UA 2HLNA 1YBHA 3R3XA 5KSOA 3WWEA 4J0UA 3AG5A 3EC1A 1PSDA 2MWMA 3JPYA 5E2IA 5TVGA 3FUXA 5AKLA 2HNAA 3OX3A 3M1AA 3UA3A 4EY6A 2GN1A 2IIBA 1NFRA 2AJTA 4ZZ0A 5JH7A 1DBRA 4YCBA 2ZJAA 1EI9A 3ADDA 3HXFA 4KGDA 3NTOA 4MDHA 4QDOA 4MEJA 5LP6C 3ZJTA 1CS0A 1CJTC 2BEKA 2B2CA 2FCAA 5BVHA 1X1TA 1HG5A 1MORA 2L2QA 3V00A 3GA7A 4HEJA 1KR5A 4HGRA 3CVNA 2QAGC 4HFJA 3QEAZ 2WVJA 2H6EA 3H1PA 3BL5A 2PLFA 4Z7OB 2H6FA 2I91A 2BR3A 4HDAA 2A0KA 1IUOA 3NOGD 2JFUA 1C81A 3QPAA 5DLYA 3CT6A 5CFOA 1TYEB 3LGSA 1EIZA 2VDWA 4MPPA 3G17A 4EW1A 3UMCA 4EF6A 5CA1B 2DG2A 1SC4A 3SG0A 1VB5A 5DHSA 3ABKE 1VGRA 4M1QA 4NZYA 4JUFA 4QYTA 4RTLA 1NM5C 2I7TA 2C2MA 3E9RA 5L3ZA 3FWNA 4R7ZA 2GTPA 4QUDA 1J23A 2I7XA 3BL8A 2JI9A 3I3SR 3KYCB 3S7DA 1SBQA 4GMLA 2CFRA 3BSFA 3BTVA 4IXDA 1HT0A 3GUHA 4KXUA 5GVRA 4YRZA 3RADC 2IOYA 2ZIRA 3ULKA 2QY7A 1XIVA 2P67A 4MMXB 2CZGA 4K6CA 3GLQA 1QMPA 3BGIA 4WA7A 3T3MB 3APFA 3G0CA 3RV4A 2NSLA 2F2TA 2FLWA 4FDAA 3EJNA 1QQEA 1XKXA 4L76A 3OQMA 4RGBA 3T5BA 4EUHA 5KINB 4PAQA 1JEOA 3QJ5A 4Y2GA 5FWQA 3AZQA 3N70A 3SZRA 1JN0A 1TM4E 1ZBPA 3IMGA 1K63A 4YJHA 3UTDA 3FYUA 2UYYA 1F20A 1TO2E 3I1JA 5JO9A 3G2SA 3AZOA 1V41E 1RI2A 4B09A 3VSCA 1RMYA 4RO0A 2VF7A 5DTMA 1MHQA 1UKVY 3GJ4A 1L4LA 3OZCA 4MVCA 3B3QA 1JKXA 3ZWQA 4OHRA 3T9AA 2XT9A 4E85A 1LNSA 3EZYA 4DCMA 4KR6A 3P9IA 2O0MA 2OBFA 4NBNA 4WIAA 4YP0A 1K5HA 2HRCA 5D2CA 5DU2A 5KU7A 4JLSA 3R24A 2V4ZA 3ZWVA 1QHSA 4B6JA 3WDSA 4GUAA 4M6WA 1SHJA 3LVRE 1ZO8A 1E99A 2D06A 2FN4A 2UZAA 2ZIFA 3TL6A 1L7AA 3KQKA 5CCLA 1GTJ1 4DI4A 3AG6A 3A1DA 4WADA 4XJVA 4IH1A 3I62A 2XT6A 2AYYA 1PQPA 1E8MA 2JJ8A 4R1QA 4OLHA 1XLTC 2FHSA 2GCOB 3JQBA 1VL5A 3A1VA 2WXJA 5B1IA 3P9QA 4G86A 3DMFA 4CKEB 2WTUA 4B87A 2JABA 3LUGA 3Q1KA 5AR1A 3O8OB 3CVVA 4BLQA 3G88A 4DYDA 2C5AA 1JBEA 3UM9A 5CBPA 1WDMA 4BP3A 3L8CA 3FTSA 1N9GA 1J7KA 4W1QA 3ONWA 4X7PA 3BK2A 5C9ZA 1H19A 3FI9A 3LY5A 2HWWA 3O92A 3IKTA 4IIYA 2V0GA 2ZI7A 3EOAI 5G55A 2B5VA 3WO0A 5FZQA 1MOSA 2BR4A 4PZYA 5KUTA 3ISVA 2FWMX 2JLSA 2ORIA 2R5WA 3LDHA 2XB9A 4Q5IA 1MAVA 2AMLA 3DLIA 4MWOA 3RYHB 4X7RA 4FEAA 2I54A 2P4UA 1PT8A 1RXWA 1PHPA 4FN5A 1WMDA 4HWTA 4MRVA 5LQDA 4R2XA 2BWJA 5AMXA 3MS7A 3I23A 3HXKA 1T29A 4H31A 3U19A 3A6ZA 1T5DX 3L1IA 3NQ41 1ENOA 1QHHA 2BSAA 3K0SA 3E5HA 3MJDA 4QQKA 4L4RA 2ISCA 3DVAB 4XWKA 5H5JA 1YFJA 3LBHA 1TTPB 2HV9A 4LVUA 5AI6A 2I4MA 3WK6A 4YI3A 1R37A 1BE6A 1UQUA 1U8CB 2GD1O 4OXIA 4KITB 3ZBTA 3W5DA 1JXOA 3HRKA 1WXGA 1Q1QA 3FP3A 5HJEA 2PX6A 5ELMA 3E3NA 4C7BA 3ZZ1A 4CRWA 1NV8A 3DBRB 1TTHA 3W9YA 4CKCA 2WVAA 2GZ1A 4UHDA 4C0JA 5LZ2A 4RXUA 1WLYA 1IBCA 2C00A 5CLQA 2OXCA 3GGCA 3ZWPA 1JA9A 3LRXA 4CPDA 4D9BA 4EGSA 2MMGA 1BE1A 1PK9A 5FWXB 4X44A 1PEKE 2YMMA 1ZD1A 4MX8A 1D5WA 4L78A 3ZX5A 2PKWA 1MAWA 5DHQA 4NYMQ 1T0BA 4LSZA 4DX5D 3DXKG 2LP4Y 3IIIA 3NNSA 3T4UA 4EGAA 1GEEA 5K6TA 1UDCA 5HZKA 3LS2A 1AQJA 3HLKA 1M67A 1E9RA 3KL2A 4YRRA 2JVIA 2OZEA 1O6CA 4J9UE 4NMWA 4MKHA 4QARA 1KY2A 5DHUA 4B85A 3ZWNA 2XZDA 3NG1A 5DMHA 4QASA 3D4OA 1U5AA 4WECA 4G9BA 1NBOA 3FUEA 3BSWA 3R4VA 4X3OA 5IJXA 1DE0A 4F9EA 4V1CI 2FX3A 1TB4A 1TN8A 2BEJA 1AHIA 2XT0A 4KXNA 4NP6A 1NLUA 3GLGB 3GF4A 1L5VA 5L3SA 3B1WA 3WNDA 2B1QA 4YT4A 2O2SA 2GPAA 2J5XA 1EK1A 2OWEA 4JLOA 4D26A 3IV0A 2A2ZA 3RSFA 4L3OA 2AF3C 3QQPA 2IGTA 1KZOA 1ELRA 1S5PA 2NU9A 3UC5A 4QHTA 1M6VB 2WK1A 4A3SA 4R7LA 2WICA 3A32A 1AO3A 4DY6A 4XUEA 2QR2A 5IJ9A 5AJYA 3MGAA 2RGCA 4JI4B 5FOUA 3TFWA 1PX2A 2YWJA 4OFXA 2Q9AA 4B7UA 1A4XA 4E0BA 3I6IA 3LCRA 2NZVG 5I45A 4J4TA 1GXSB 4HVTA 1NKVA 1DG1G 1NVBA 1P3DA 1X39A 2V6GA 3AKYA 3KQTA 4PEVA 4B17A 5B1YA 4DX6D 4R16A 1EJBA 4X24A 3OX2A 4GZDA 1NQWA 4M0LA 5I8WA 4K28A 1XXHB 5AI4A 3KK0A 4TVBA 1P9NA 2ZWPA 1T0UA 5C4MA 1KGDA 1ZG3A 3MKRA 5AK4A 4OP2A 5T4YA 1DBPA 2OAP1 2OOKA 2PUHA 1T8UA 3A06A 4WK2B 3CEHA 1Z4KA 1WU7A 1YRYE 5SYMA 1KOFA 2WDPA 1MPTA 4OYYA 4V0OA 1QB8A 3CLSD 3OH8A 1UOHA 2NU9B 1QQ6A 2W0SA 1RAAA 1UBJS 1WF3A 4X8MA 4MLPA 2PS1A 4F46A 2VSXA 3OOJA 4HPJB 3IOMA 5LYJB 2J0EA 4MRAA 4I1OA 3BFJA 4Q9HA 1R9NA 3WBJA 2QU8A 2YVLA 4ZVQA 1SUEA 4LXIA 3F47A 4Q24A 1YZUA 3W2HA 1PWHA 4Q1VA 4WASA 1X8XA 2EC5A 3DE2X 1LD7A 1ECBA 2Q8NA 3LLSA 4AJ4A 1BE0A 5ICEA 1NPDA 3DEOA 5JBIA 2RAPA 3RASA 1TFRA 1N2IA 5JVDB 3JQFC 3W4IA 3K6RA 1VPWA 2EQBA 3VSAA 1U8AA 3OUUA 3TZQA 3DG9A 3CNOA 2QL5A 3PH0C 1R1DA 1WUHS 3VAZA 3S8YA 1RAEA 2IPNA 3EGCA 2XX3A 3L6EA 1JAZA 3MIIA 4RK6A 2GPSA 3V9PA 3PUWA 4OUKX 3QDNA 1K8XB 1DZ3A 2Y05A 4H7PA 1WQ1R 1AGRA 2DZDA 1DC3A 4XCQA 1UZAA 1YKSA 4XEHA 4YROA 5BT8A 2EEZA 3PJFA 4KQXA 1IXYA 3W5SA 1VLZA 2XYGA 4GKVA 1YOVB 4MS3B 3E27A 1KVTA 4UQYA 1GU0A 3FTQA 4RV9A 4ARVA 3DLPX 4O63O 2JC3A 3P27A 5JDIA 3EA4A 2RK4A 3SC6A 2BFMA 3QVJA 3A9VA 1X9HA 4V0QA 5CH3A 3VTZA 4DIBA 2FEZA 2IW3A 3RUDA 4MVWA 1U04A 3OSZA 2QM0A 5HRYA 3K4HA 1NN0A 3WFIA 1CVIA 3NUQA 4LMAA 5IP5A 1I6WA 1VJ5A 2VTKA 3CLVA 1ZAYA 4HNRA 4LGCA 1JFVA 3CLUD 2H5EA 3ABME 3OQIB 3UJ3X 3OTOB 1ND5A 1ZD5A 4H6PA 3RVRA 2ZXFA 2YZMA 3D0QA 3ONVA 4Z0PA 6Q21A 3MJEA 2GEDA 4U0SA 1SVMA 3CKKA 2WA1A 2A5EA 4JXJA 4EI9A 4JKOA 2C2XA 3KB1A 1R50A 1RRPA 2Q7FA 1A27A 2PR2A 3M6UA 4BQPA 5FUXA 3VX3A 4RHYA 5BQPA 3DOEA 4BS9A 5DNUA 3H2GA 4BNHA 5H4HA 2IZZA 4JB2A 4WN3A 5F98A 3JAWB 3EOZA 3VV3A 3DKRA 3KSRA 2FG5A 2P3OA 3TM5A 5EIBE 1HK7A 3BMCA 4C4SA 5I8ZA 1XNJA 1LSUA 1OZGA 2O2CA 3L0ZA 1BXRB 2BKUA 2O0HA 4S05A 3D9PA 3HHMA 5CFLA 1TU0A 3DTNA 5AI8A 3TLEA 2OEPA 2VXCA 4ZHBA 3PDIA 3V4PB 3VKGA 1N5MA 3ZPJA 1OYWA 4N49A 2E7ZA 2VOJA 1T4GA 3ANYB 4IQGA 4YDOA 3V2HA 4HX5A 5BQOA 4H7XA 1Q1NA 1SUSA 4UHHA 3EY4A 3FWYA 5ERGB 4FMDB 2PNFA 1HDRA 1ZI6A 2YRFA 3PRHA 1TECE 4G9EA 3OOEA 4IV0A 3RI3A 1J2JA 1JKFA 1OX4A 2XTZA 4HAYA 4L08A 4HOTA 1QOQB 1A72A 5IK2D 3KHKA 4JX9A 5JSQA 1QVWA 1JQKA 1EVLA 1P2DA 1ST2A 2VSQA 4XJSA 1PF7E 5BUSA 4EJ2A 1G6OA 4LWQA 1H6OA 1QYVA 2D1QA 2ZB3A 4N0DA 1G5PA 2CVFA 2Q29A 1RYNA 3E9EA 1C4KA 1CZLA 4KXMA 4DOMA 1JG6A 2ID8A 5CDSA 4CIDA 1RZRA 5TPZD 3EMDA 4F5YA 2P40A 4UW9A 2HDHA 3FCXA 2C5GA 3GRKA 1UN9A 3QE0A 4OQYA 2DSTA 4RENA 4WNYA 4B7CA 2BGTA 3BXZA 2ZRJA 4HGPA 4D79A 1XVUA 2YJTD 2FDXA 3PXEA 1VIYA 4IX9A 3GJQA 3SYTA 1N94A 1HDOA 1SCQA 2PFKA 2XPCA 3D9LA 1MGPA 3PE3A 1E9FA 1HO8A 4K5CA 1RQXA 3O9VA 5DVZA 4C4OA 3CIOA 3KD7A 4ENSA 1AQLA 5JWOA 2DPMA 3SEZA 2YVKA 3ZK7A 4KRFA 3CTMA 1J4AA 3H2JA 4DMKA 3KXDA 4YN3A 5BV0A 1ULSA 1X3SA 3Q79A 4MGHA 4YVFA 2C7BA 2ORVA 1NXWA 5CPFA 4UQXA 1YB5A 2QPTA 5BYKA 3C7CB 3TCKA 1WBDA 3RVPA 1CSEE 2OEWA 4WZBE 4IULA 5TIIA 1N0VC 3RYIA 4CMCA 1GGVA 2OAGA 4HAOA 4GS5A 4WOKA 1Z47A 3EASA 3UJ8A 3OWXA 4MWTA 5CFPA 1JX6A 4FK8A 3ABSB 2XCUA 2WWHA 2SCUA 4EITA 1K9SA 1WE2A 3IJEB 3NTVA 2ADMA 3NWBA 4E46A 4H7DA 5IXYA 4CQLA 4R4JA 4B4VA 1ZUNB 3TM4A 4I6JA 1L3CA 3D8SA 1ZUHA 1UJCA 4H4CA 4UATA 4EZLA 4AJWA 4N12A 2IXGA 3ULYA 5KNDH 2GILA 2ZVQX 4LYDA 3S3TA 3TN7A 2Q5CA 4OPMA 3C74A 3QEJA 3B3FA 3R5TA 4U02A 5H02A 2P6UA 1EB8A 3ZDBA 1SUIA 5BYBA 4DUPA 3DE6X 4N47A 4FZJA 3O2NA 3BMOB 1JDBB 2FEAA 4IDAA 3RTGA 1XAHA 2C4MA 3NUZA 4AY2A 1L8OA 3CK7A 2CLKB 4BT8A 4WDQA 3VR3D 5CXXA 3UMGA 1SQ6A 1UK7A 4LRWA 2Y6VA 3F6CA 3HXDA 4UNRA 1UM8A 2PBRA 2IW1A 3TTTA 3AVTA 4YRIA 1Q14A 2IY7A 1QG4A 1Z5PA 2RKKA 3EZFA 3ER8A 1XJWA 1TZBA 3LLMA 4FGJA 5IN4A 3SZ3A 3T7KA 3W2GA 3GP8A 1UCFA 2WUGA 1OI4A 1WDYA 1W0JA 4D4GA 3FFLA 1CY6A 2D2XA 3ABOB 3T7TA 2Q3JA 1JLKA 1UODA 1XWFA 2WSBA 1FU7A 2FB9A 4PAWA 4YRNA 1PZGA 5EZYA 1M74A 4IIDA 1SCJA 3TYXA 3K0AB 5EXXA 1GKYA 4YV7A 4YV2A 2DT5A 4HXGA 2OC4A 5DN6A 4YMGA 1SZJG 4GM4A 1LW6E 2Q41A 4GKAA 5HCNA 1RWOA 2Q9BA 3FOZA 4OLFA 1FJGB 2PQRA 3LF1A 1CQIB 2J3LA 2WVHA 4ZEXA 2XCIA 2WMOA 2L19A 3QX9A 5I3ZA 1RFGE 1VJRA 1VRCA 1GPWB 1LJUA 3G5TA 3ZNOA 4N40A 3EG9A 1XI2A 1NNI1 3KVVA 3EQZA 4A8JC 4NK5A 1BCRB 5K6RA 1TZCA 3OFSA 3GP5A 3BHMA 4HDSA 3THYB 1CLEA 3B9RA 3ZXUB 3OFKA 2I1LA 5HILA 3CCBA 3HJUA 4O4JB 4RGVA 5KYTA 3LPNA 5L8VA 1FRQA 1KK3A 5AVQA 2CG2A 4LFCB 4KFCA 1PR5A 3D8TA 4FOPA 2QX7A 3ZQUA 1AQYA 1FC0A 2AZTA 2RH4A 7GPBA 1V5GA 3R0VA 1P7VA 2FE4A 3TBFA 1VJGA 2B20A 2VDLB 3HCFA 2VQ2A 3CLUC 4YMVA 4GTOA 2QTLA 3ZUGA 3MCUA 3WIOA 1JDSA 2HW8A 3AWDA 4MSUA 3F98A 3SK1A 3N2ZB 3E05A 4GBED 2F1HA 4D45A 2V6BA 4F60A 4ZMSA 3THWB 3X43A 4O2BA 4Q69A 4A2CA 3BCUA 3D4NA 4JVLA 5A9RA 2EFGA 5JSZB 2HX1A 2DQ4A 3C15C 5EHZA 2IZ5A 1NHGA 2PPLA 3COYA 4BTBA 1H6CA 4H7YA 3NIWA 1WY7A 3NWOA 4R6WA 1RVDA 2PUGA 2DCPA 1QHGA 1YH3A 3HLTA 5DF1A 1XJ5A 4FWBA 2O0LA 5CYGA 5KNDD 3GPBA 2WWWA 1DFGA 3AESB 3C7DB 3GRZA 2RHLA 4R31A 1Z5GA 2YXDA 3OPYA 1B2RA 3EPJA 3CKYA 2OV4A 4LGYA 5DM70 4C4YA 3R8FA 4PC1A 1Z38A 5IVKA 3EEYA 3R9AB 2BOVA 1UEXC 1NOIA 1ZA2A 2F3RA 1G20B 1MFZA 2FDRA 2X19A 3BHNA 4XWTA 2BM8A 4OHPA 4Q39A 4LFBB 5KKNB 1W25A 1G5TA 4U3JA 1ZM4A 1A8PA 3C6YA 3PUYA 2GBGA 4PTYA 4MKTA 4I6GA 2EKPA 3KOZA 1T6ZA 3C8HA 4O4IF 1EUDB 5CDFE 4E6EA 2ID7A 2JK0A 4DLUA 3U80A 1Z2NX 2AUMA 1IUPA 3NALA 4NAVA 2YYYA 3R9XB 3GVHA 4NE2A 3OX4A 5ABPA 2OV2A 3E37A 5D0OD 3OJXA 1WD7A 1X7GA 4AYXA 5T4EA 4IJ6A 4PS0A 4K5BA 4CIVA 1UC4B 3JYOA 1IWOA 3IT2A 4B4WA 3LUJA 1KDOA 2BGNA 1PGPA 4REMA 5GZ6A 3NTXA 4BDSA 3VU9B 1SUCA 2YOFA 3TB6A 1JIQA 3KOYA 4UVDA 2X6HA 5K03A 2CLMB 3S70A 5L51A 2JASA 3QPCA 2H7CA 1FFDA 4TV9A 1PSZA 2B4RO 1JYEA 1WSDA 3EHQA 3ZTWA 5JRDS 3RAGA 4AVYA 3HRIA 4B31A 4C07A 2OENG 1VKRA 1M2VB 3BWBA 3IQDB 2OXTA 3VDRA 3QU9A 2NSZA 2P0YA 3L8DA 3UHAA 2GGFA 3PDIB 3HO6A 4ZVLA 4DX7D 4X1IB 2P30A 4XGQA 3PFIA 1DUSA 1GNQA 2D7JA 2H54A 5GONF 3UB4A 1XBTA 3A8TA 4E4TA 1WCWA 1EFAA 2X15A 2VWHA 3CCCA 2J67A 1XC7A 1CR4A 3EGXB 5CIYA 3PSHA 3TZKA 2C0MA 3FUUA 1ODJA 1NLZA 1WXDA 1BGXT 2O8BA 4JS0A 4JEMA 2EZUA 1QLHA 3EYWA 2UKDA 2DYRE 3QKYA 1UW4B 1BH6A 1GDDA 3U3ZA 3DMGA 3QW4B 4KN9S 2XWJI 5K3CA 2GN6A 2HCBA 3GR6A 3VC1A 1YZNA 1AMOA 3PKZA 3LTEA 5ES4B 1SCIA 3I3NA 2QVCA 2VPWA 1U0OC 5FORA 3JCKC 2I7CA 3CH4B 3OM8A 4QDTA 4EGCB 5JHGB 1HKHA 3UWSA 1FLAA 2PXAA 2OA0A 3C4VA 1KAQA 4MP3A 3PQ5A 4DKJA 1QZXA 4I4IA 5EHQA 1LK5A 1URPA 2VUUA 4PLPA 2FJUA 2G4CA 3G9XA 5DSZA 5DTQA 1UK9A 1JT2A 2BHRA 1MRZA 3IPYA 4H0FA 4DDKA 4ZODA 3P5SA 2WPDA 1H2BA 4G3XA 2NIPA 4NL4H 3B7PA 4BRSA 4DRYA 2ADOA 5KTMA 3D59A 2FLKA 1A7AA 4NF2A 4F85A 2I8CA 2HLPA 1X1RA 5AQAA 1I2AA 1NATA 3FRHA 3LF2A 5FPSA 2XB6A 4J16A 4B2PA 4HT3B 4O2LA 2RH5A 2I3AA 4RA6A 3EGVA 5E7QA 1YA6A 4HAUA 1KO4A 4ZJPA 1IBSA 3BKWA 4KR2A 1NJ5A 2F64A 2IS4A 2JCYA 3GB9A 3HS3A 3HKEA 1DCTA 3BMCB 1R4MA 2J4DA 4FBLA 3RT7A 1NI5A 2V9PA 3R7LA 3RVSA 4WBSA 1MP0A 2YASA 4YMSA 3MGGA 3CNBA 3GLGE 3R6LA 4DLSA 2ZRAA 1XRMA 4DQXA 3HXMA 4E21A 5HMLA 2E1RA 4XI9A 2GM9A 1V39A 1VOTA 2NZWA 4HD8A 2QJWA 2X2EA 2X5KO 3IDFA 4L02A 3DW1X 4MW4A 3RLIA 1IJFA 1A71A 2J5RA 1IHXA 3L49A 1AB6A 4JP2A 1T9BA 1M8FA 3VU3A 4R5HA 3ZXXA 1QU2A 1L4GA 2QVLA 1HZZC 1PT9A 3I9FA 2VAMA 4NMLA 1BXRA 2EJCA 1K92A 4ND8A 2FJAB 1B43A 1IYZA 4Q3CA 3MFYA 1I5RA 2UVPB 5L45A 3DTVB 4PQRA 4WPGA 4I9CA 1T9KA 2WOOA 3F1KA 3Q9SA 4RJKA 4YAKA 5C7IO 1E77A 3P0FA 1E9DA 5CX1A 2HV8A 2A9QA 4NJMA 1LV8A 3GEIA 1XLTA 1SUBA 1RHRA 3L16A 3CLJA 1WVGA 1HFEL 3IPXA 3PNOA 4E2FA 3G6WA 5LPNA 2FWRA 2OYRA 1RTKA 3S68A 1MU0A 3TDMA 3U4HA 4BMXA 5FULA 4HQ6A 5ENRD 3VCXA 2BI7A 4ZEVA 5CX1B 3HUDA 2OCLA 2VH1A 1CQXA 1E6CA 4K9LA 1R0WA 2PZFA 1KC1A 3NS7A 3NYIA 1U9IC 4RIIA 3GYXB 4F2HA 1ELKA 1F8FA 4BNMA 4C2UA 3HUUA 3SNKA 4HRNA 1SHZA 2AOXA 4E5YA 5B36A 1L6RA 1FFXB 2W2TA 4R2JA 2WKRA 4ND8B 5IJ9B 3INTA 2CFCA 3ETCA 2EU8A 2Y1EA 2NPFA 2C4HA 3CPJB 5ILOA 1NA5A 1KEKA 4EBBA 2HSZA 2VT3A 1KDZA 2XKBA 1COWD 5T67A 2ZIWB 4D8VA 3TXMA 3PFBA 1GZ4A 1R5NA 2P65A 1MB0A 3DO5A 3G7UA 1UBTS 3GCGA 5EIAA 3ZW7A 4UWHA 2V0NA 3RUHA 3NMUF 4DJFC 2FYTA 2QJTA 1JYSA 2XMCA 3FIJA 3MJHA 1K6MA 3B3AA 3IEUA 3RFCA 1G3MA 3RUAA 1V1MB 2UYGA 1V5WA 3MWYW 2WIJA 4FOOA 5L3QB 4TQ9A 4RHCA 1JHVA 3W6NA 3U7IA 3CLSC 1C9MA 3WB0A 4X00A 2OHFA 1X8JA 2YIMA 1DPFA 4YPOA 4HL6A 2X22A 3ODPA 1M5TA 3SAJA 5K3FA 1ISMA 5L53A 4U0UA 1GPYA 2IRWA 1AV7A 5ENQD 4KDFA 1RYBA 3RO7A 3ZQJA 2O2GA 1QQBA 3V1MA 5HRAA 1Q0LA 1KEEA 2QIOA 4BE4A 1O8BA 2E4WA 3RFUA 4JLJA 1QANA 2UZ3A 4XGKA 1T1RA 3D5QA 4JDPA 2F8SA 2DZOA 1M1NA 1YZKA 4Y9TA 3VUEA 2I99A 3B52X 4MV7A 3PQ2A 1D6NA 1CUFA 1SD1A 2DKNA 2C7PA 1K2WA 4S1VA 1OU0A 3GJ3A 2AHOA 4LNBA 4K3VA 3G2WA 2R59A 1M2KA 2QN1A 1TMGE 4F84A 1IWBB 1ZOLA 3LLVA 5AW5A 4QYSA 3OICA 2OXIA 2CVPA 2UZ4A 2VG8A 3A70A 4GIBA 2WIKA 3HYRA 5BRAA 4CZ2D 1NJGA 2VJDA 1DQYA 3QKIA 3FOCA 1DCMA 1EGHA 3EF3A 4INAA 4YUAA 4GDMA 2RHRA 3FCYA 2WT8A 1QQAA 2HPHA 2RGUA 2RHWA 2A4MA 3RROA 4YJ3F 3ETLA 3G02A 2WC1A 2MYOA 2OB2A 1Z22A 2DFLA 1EX7A 1O58A 2C20A 5AVXA 2H29A 3MAJA 1EGMB 1FMTA 3L82B 3PC8C 4M99A 4WKOA 5B37A 2PUFA 1ADFA 3F9IA 2ZISA 1Q1ZA 4HFRA 3K6JA 2R7KA 3BSYA 4KZKA 3LYAA 4EW3A 1XGWA 4I50F 2EIJE 4UUOA 2AN9A 3LP6A 4FLEA 2V5QC 3SX4A 5BXYA 3HG7A 3T5AA 4LRSB 3WZMA 3ORFA 2DFNA 2JFQA 4D9NA 3WK9A 5ENTD 1EVJA 3QYPA 3WWYA 4TV8B 4ZOCA 4I99A 3VNVA 3DXZA 4E31A 5KVVA 2DOKA 2XSZA 3HKBB 4GBGA 4TYPA 4MWDA 4BNZA 1KBQA 5FWYB 2XUJA 3IE0A 1DQRA 5KTRA 1HE2A 5AARA 5EXTA 3L0SA 3GZ1A 1NUUA 1U7UA 2R60A 2WAMA 5DO9A 5BMVF 3AVQA 4Q15A 3KOXA 2VSOA 5K3SA 2VS1A 1XCBA 4QO8A 5F5NA 3VPAA 3TUZC 5CLFA 2M98A 1NR5A 1PR1A 1WABA 1A82A 1H8HD 2ZRIA 3ITNA 5B3AA 5G4LA 2ZRMA 1Z4LA 5C4IA 4AKXB 4EI7A 4JHJA 1MC4A 1HQCA 1YR9A 4HI8A 1I7PA 1YRQA 2VSFA 3LGXA 5A2GA 3O4HA 5AI9A 3NDBB 4MW0A 2AGVA 3N6XA 2I2BA 2VP3A 3OLWA 2G4LA 2HR2A 4KBFA 2FEPA 4WNCA 2E0IA 1B6TA 4NNPA 5DV9A 1I24A 1MX9A 3CINA 1KBZA 4OHZA 1FVHA 1PFQA 1JI3A 1W0KA 4R84A 5JSKA 1K6XA 1Y8QB 1GQ2A 3EFHA 1D2HA 5D00A 3JALB 1JE1A 3LK6A 5CIWA 2QN6A 3RQSA 2VHCA 3PVCA 3QNMA 3DRAA 4OTZA 1RWBA 4B8AA 3E61A 1WR8A 1YRWA 5KOIA 1VIMA 4P4SA 3NAGA 2QYJA 2ZJ0A 3RNOA 5FOTA 4JZYA 1OFTA 5TMEA 1OAAA 1LLFA 4HH1A 1XTSA 4IYJA 4KUEA 4AM8A 3L8GA 1SHKA 3V4FA 4E4RA 1PNQA 3FH8A 2BM0A 2I7VA 2WV9A 2ZJ6A 3ENZA 4P1ZA 3GMDA 1EEHA 5AW0A 2QZAA 1U0FA 2YWCA 3OZTA 2RJOA 4C0SA 4AN1A 3H5OA 1R12A 5HFJA 4CM3A 2CNBA 1DIGA 3R20A 1XZEA 3P4YA 1GP2A 1R3DA 3DFZA 3RS5A 3EZ9A 3B20A 1X7HA 1Y80A 4B3CA 2XWBF 4Y0NA 1IOWA 2PBZA 1Z6QA 4GYJA 1YI1A 3W34A 4BMYA 2JPDA 3NLLA 5IN5A 3OLXA 2BRUC 5E6UA 3G0HA 1FZTA 2OCCE 4YRDA 2H7YA 4ZHSA 2J0UB 1PP4A 3OCXA 1JXAA 3LT1A 3DEHA 3Q87B 2WHPB 3W3AA 2WFZA 3LUKA 4FYJA 2BHLA 1NUSA 1YKFA 2FPIA 1TD9A 4FWIB 4WOCA 1CERA 3SYKA 3OVMA 5KVSA 2ZUFA 3KKZA 3ISTA 4O3MA 3FEXA 4OAPA 2KATA 4J7AA 2XGSA 4EGJA 2R8RA 4AEZC 2HWYA 4XAQA 4U39A 4ZWNA 4JYPA 3H3XA 1W49A 2W98A 2Q6LA 4R3NA 5DM2A 4X8QA 2QZPA 5EN5D 1Z4MA 5ER9A 3ACCA 1UC5B 3IBYA 1NULA 4YRSA 2LCQA 1WOMA 3AS5A 4NENA 2AVPA 1V3VA 4OJMX 4WXMA 1RLMA 2EVWX 1I4DD 3RWOA 5KTTA 4EPZA 4OXKA 4OI0A 3VPBA 1M8GA 1PJSA 4ZYUA 2G9QA 3JRWA 1E18A 2EG5A 1V8DA 1USWA 1WXQA 3ZCRA 3O7MA 4ZU6X 1X80A 3FWPA 4LF9B 5E76A 1N4RA 2L0IA 2ZBGA 5H8WA 1XD8A 1QV6A 2FPXA 5DI3B 3VVCA 3BB3A 1MIHA 5CVUA 3FTNA 5LDDC 5KSYA 1TEHA 1UF9A 2AHRA 2Z09A 1LBHA 2BDUA 4RVHA 1XD2B 5I9TA 4FGLA 3T0GA 4JT8A 4R69A 4F3KA 2E21A 4MH0R 3E23A 1JLSA 2CF6A 4K9KA 4DFDA 1P17A 3ZXSA 2BFWA 3RH0A 1QH1A 1U0RA 2Q3CA 3GEMA 3MB5A 5K1ZA 4AXXA 1VMEA 4N3CA 5BUZA 1QTRA 1S7CA 2PV0A 2R66A 1DELA 1XD9A 3DAFA 3OOSA 4IVNA 3DTTA 1KMHB 2G9VA 3OTWA 3WGIA 4DZRA 1QFJA 3R3HA 4XLZA 3BILA 3PGVA 4WZ6A 4FJ1A 4BVKA 4H3VA 2B21A 2M2IA 2LV8A 1C1XB 2Q0QA 3I58A 4FMDF 4HS9A 4S0ZA 3UX4A 1XLWA 5G4KB 1M0WA 4OI4A 4PU0A 3ZK9A 4ZGWA 3C3EA 3HXTA 5A3JA 4TTJA 1YULA 2R4QA 1MV8A 2DWPA 3FGNA 3MINA 2R1ZA 3G2QA 1MPXA 2GZDA 1OT5A 1F0YA 2GRQB 3MWKA 4L8GA 3TGLA 1BO6A 4HWOA 4DYHA 5BXOA 1EXMA 4INJA 1Z5UA 1MH9A 4U2FA 4A4DA 2PL9A 5KQSA 3G8DA 2PZLA 1EB9A 4EHIA 1SXJC 3ANTA 4G25A 1Z2DA 2G83A 4WNDA 2GAOA 4Y9SA 3C6MA 2Q99A 2I3ZA 2SHKA 1L1EA 3Q7AA 1M6EX 3HA5A 4CL3A 2C2YA 1W581 4JIMA 3PZ4A 4B2IA 3ESAA 1ZC3A 5DBOA 4RS3A 2KZTB 4QULA 3KCNA 3EARA 3D6UA 4F8JA 3EMBA 3RUCA 1V1RA 2QYSA 5HIIA 2X8WA 5FR1A 3ZDYB 4F6RD 1FVOA 1LI5A 2UVDA 2ZYAA 3SM9A 4L3WA 5KVQA 1T2NA 4WEOA 1DOZA 4HB3A 2UV8A 2OP1A 3MWFA 2A9VA 1CZUA 1R0BA 4X1KA 3LVQE 4KDEA 4GLOA 4G07A 2H11A 5J59A 1XDWA 1M6NA 4NV1A 4DIKA 2ZJ5A 1XEAA 1QJ4A 1I01A 2VSXE 2EX0A 1BS9A 2HREA 2YHEA 3PC8A 4MV9A 4BWVA 3P2YA 1GZ5A 2IXTA 2ZAMA 3ESYA 5BW5A 5D3MA 4QFVA 1KYYA 3B89A 3LKUA 4CF3A 3V6MA 4YMUA 4IDCA 3U7FB 2PZGA 3KVOA 2P41A 4NBSA 1YR7A 4OHBA 1X1EA 2X3UA 1JXMA 3AT1A 4QQFA 3FSGD 5F9MA 1UL1X 3LEWA 4Z4QA 4YTEA 3LP8A 1GPH1 3IYLW 4EM6A 1J0XO 1W4BA 4WRRA 2ZYDA 4E09A 1UPFA 5THKA 3S99A 5TMDA 4BO5A 2IDZA 1PTKA 5AVOA 3BGWA 4IIJF 4D74A 1SEPA 2GRPB 2IUFA 3SQVA 3I9V1 3N8DA 4IEFB 4BNWA 2QTVA 3NEJA 3P97A 2AWNA 2P3QA 1WG0A 3Q3JB 1RXSA 3U9SA 2HH9A 1KTVA 1YGYA 4XYGA 2WXFA 2CMFA 5KTNA 4LJ7A 3L07A 5LZ5A 2YFQA 4GTRA 4WZBB 3W2IA 3T9DA 1J7JA 2Q6KA 2RHDA 2QN8A 3LKVA 3KT6A 4JVSB 4PZUA 1EWRA 1EVKA 5BN3B 4U9UA 3H97A 1WETA 2IKSA 2W2NA 2HA0A 5AIAA 1XKLA 5H70A 1M8JA 2VF5X 4GEKA 5ARFA 4KPUA 5HIJA 3SF8B 7ABPA 1II8B 3LYHA 2PQ0A 2JEYA 1Z13A 3HJHA 3HB9A 4PE5B 4C4AA 1RT9A 2BIFA 4TSFA 1ZN7A 1TCCA 3AK4A 5H9VA 1C0PA 1D0VA 4BGDA 3O2QB 3E22B 1PJ4A 2DWOA 4R1SA 4U0KA 3DAOA 1NVTA 5LBTA 2G1KA 3NFRA 2CF5A 5SZHB 1K89A 3DUFA 5DCLA 3MQ2A 4L16A 3VQTA 3WR5A 1JF8A 1U28A 3U4TA 4UNSA 1SA5A 4LV5B 1EDDA 5J2TF 2BFDB 3B6IA 1TD1A 3TG8A 5JISA 4NYIQ 1EIWA 3O3OB 3L7AA 3U7QB 1ULTA 3FLMA 3ILSA 1FSZA 3O94A 1FCHA 4L50A 2QVYX 1NNUA 4OFBA 3VU1A 2IO3C 4FZVA 3PFKA 1K3TA 4C0LA 2FOLA 5LMNB 1Z4QA 4R2MA 3F3KA 2J3JA 2P2CA 5C5IA 1HYQA 2BMEA 5B58T 4XQ0A 2JAOA 5DLPA 5KWIA 1ZM2A 2PLAA 4HTAA 5AXCA 3TLXA 5P8WA 4CUKA 4X84A 2XUAA 5A9SA 2GN9A 2IPLA 4QTTB 4EPRA 1XQWA 1DLJA 3OAAA 4O4JF 4QU8A 5AVSA 2VA8A 4MHSA 2XZTG 3DXYA 4MRMA 5J2TB 3VSEA 1H05A 3HEAA 1A9XB 4MUNA 3LUAA 1VHWA 4AN0A 3KETA 1Y8RA 2NUAA 4CCWA 4ATNA 2CFUA 3CG4A 3CSSA 3PUXA 2XZDG 4RWEA 121PA 2WIBA 4DCPA 2GK6A 4RZHA 2VNAA 4ISCA 5ICMA 1DOAA 4JA2A 3FCSB 4DKXA 4EHHA 3T1HB 4TM8A 1U4SA 4H7IA 3UWPA 2V97A 3PRJA 4LSZE 1FFBA 1YOBA 3GLIE 4UI9J 2EX1A 3OO0A 3QOYA 3GQVA 2R2GA 1SVSA 3KYDB 4AY4A 1Q6YA 1PRYA 1N3BA 1O3YA 2ALJA 3IAAA 2VT6A 5A62A 3CVQA 4CNQA 2B7CA 4PGMA 4UFNA 2R3SA 4ZQFA 4Q4JB 3PXXA 1XU7A 3EDQA 2GCGA 5CYFA 4FZRA 5AVTA 2WWTA 3K4QA 3GRAA 1SN7A 4IJKA 5JW6A 3KFVA 1NUTA 4BN4A 9ABPA 3QHPA 1DU4A 4BTLA 4FU3A 3D7LA 3ZDDA 4XQCA 4MVJM 1Z0SA 1V54E 1JWGA 3ICVA 4IGFA 4UBJA 1RD4A 2NUTB 3DO8A 5EMMA 1DKRA 3LXRA 2EV9A 2W37A 1SQ5A 1OLUB 4Q9NA 4UHBA 1ABEA 4WAUA 2O8EB 4DNQA 3QFRA 4RVCA 3MWGA 3E7FA 1SFRA 3GFOA 4Z1MA 1QX4A 1HDYA 1IZ0A 3E4CA 4BVLA 3DBVO 1NW9B 3OBBA 5IYZA 2P62A 3PCXA 3GDHA 3THYA 1G2PA 1N8SA 2BY4A 1W44A 4N8EA 2OBMA 2J0SA 1OPRA 1B74A 5F2KA 3D9NA 4U8HA 2PGXA 1LTXA 2VK4A 2ZSAA 4AJ1A 3MCVA 6NULA 4JLWA 1CLUA 4LBZA 3ZVVA 5F3RA 1E7VA 1TQ2A 1LF5A 4G1FA 1G8AA 1W5SA 2O4CA 3BJEA 4O2AA 4EPVA 1CJSA 2BP7B 3NAZA 2A9RA 1O97C 2FNAA 1CNEA 4KMMA 1GRRA 1RM3A 3K9BA 4L95C 4M8KA 2WPVA 4EPYA 1RKBA 1V5IA 2RG7A 3IKVA 3MTIA 3MGBA 5IPFA 2OV1A 1QDEA 3JAMA 2WF7A 1X94A 3T3HA 1U7TA 2BLLA 4UAUA 3ZGLA 5JY1A 1SCBA 1NP3A 3SZGA 2JA2A 4FD2A 5J5VA 3VVMA 1O1RA 1ZVQA 3VZCA 3NBAA 5J43A 4MV8A 4KMRA 2WFLA 3FJ1A 2YN0A 3EEFA 2DK6A 5SYNA 1UBLS 5TS2A 1KYVA 4KXWA 1BGVA 1CR2A 2EBUA 1A4IA 2JBHA 4IDNA 5EWMA 7ADHA 1W5AA 1LTHR 3E0XA 4H77A 3S1AA 1XNRB 5REQB 5ITSA 4EHKA 1JU3A 4TVOA 4JROA 3AG4E 3O8CA 1V8FA 2G0NA 2WF8A 4BE9A 3X2QE 1Z8NA 2G8NA 2LPMA 3M6FA 1ECFA 5H81A 3SJ7A 3BMNB 2HIHA 1DL5A 3K1TA 1M34B 4WLVA 1E8ZA 1A2QA 3TZBA 5ADUS 5K8CA 3U4CA 4JI7B 4ZDWA 2WUVA 2XTJA 2JFWA 1H2AS 3BEOA 3K70D 3AV3A 2A7XA 1ADBA 3VDMA 4OU4A 1UPTA 1GEGA 1UXKA 2G1UA 2YYSA 3H9GA 4OGWA 1ZWLA 5ED0A 2IX9A 2NU6B 4R1NA 3SF4A 1J8YF 1VLJA 2XH8A 3TRIA 3U2QA 3GLFB 1PJTA 5EZSA 3Q8WA 1GVNB 3MF4A 3EIFA 4U8YD 1H8EA 1EJ0A 1G6HA 1FNSA 1IEWA 1OXSC 1VA5A 4GYWA 3A4YA 1HLDA 3CC8A 3M4JA 3L1UA 4MV4A 1XSEA 2WSSD 4RV5A 3DZFA 1C9NA 2A33A 3BK1A 4ANXA 3L8EA 4PZAA 4UPDA 4AXBA 3QM1A 4HN2A 3ICEA 1NQUA 1B6SA 2FPWA 4X54A 5G1NA 5FTNA 1JEYA 4Q05A 1TU4A 2GHIA 1WCXA 2Z1MA 1N5DA 3HE3A 5BSRA 2F37A 3BQMB 5A7DB 3OU6A 3JD0A 4URVR 2F3SA 1PFYA 4EFLA 1XMVA 4AYWA 3AHEA 3H4TA 3ZYZA 3SBOA 2M32A 3JATA 4K9SA 5AOVA 1G98A 1T9CA 3LBYA 4U2CA 2FPGA 5KDOA 5L7TA 1EFUA 3B9QA 3ETGA 1GZHB 3BREA 1P61B 1RFLA 3INYA 3AB3A 4RS4A 4C7MA 3FWHA 3A6GA 1G8YA 1Z6XA 3IAEA 4M9XA 4V0ME 3ZHBA 3TU3B 1TJ4A 1C3EA 5K2MA 4PW0A 2ZTMA 5C8YB 3DEJA 4GOKA 1X3LA 1TN7A 3EHEA 3TIGA 2XDQA 1ILWA 3PX3A 4MB0A 1W2WB 1ANKA 3D0OA 1C7QA 1VYHA 4AP9A 1XQXA 1EXWA 2I9PA 4Z4GA 3PQ3A 2H9YA 1X1BA 1A8QA 3PNMA 4CKXA 3R6GA 4PSDA 1RHJA 4XPIB 3DQZA 4TVKA 3G2UA 2ZRKA 1RZ3A 2G28A 4L51A 2R6AA 4QX6A 2QJFA 1E2QA 3AM4A 4PRYA 4DJDC 1V8BA 5D2MC 2CDCA 4DF3A 5HHTA 3PHHA 1JU9A 2LDBA 4UKDA 2YL2A 4IDQA 3Q9LA 4X8LA 2PSEA 1AA9A 3O8QB 4AO8A 3A3PA 3ENNA 3FUTA 5BSKA 4YO8A 2C2BA 3DZBA 5HI7A 1MUUA 4KTVE 1SXJE 1T8PA 2R65A 2G0AA 4H08A 4MVJD 1YZ3A 4WDRA 5BSHA 3W8EA 1N6RA 1OFVA 4C7OB 4TWBA 3MT7A 1VI6A 1Q0TA 4X1YA 4GMHA 1GAQA 1IWPB 2R1TA 4HZGA 2R6DA 1NXTA 1O5TA 3NJRA 4G63A 1OI7A 3O8RA 3UT4A 1Q95A 2QS9A 3JQEA 2EP5A 1P2GA 5LZ4A 3T8KA 1P77A 1UT6A 2IUYA 2R8BA 4EKYA 1WSAA 1AH2A 1XTZA 1X77A 3FFBA 1CF9A 4HAIA 1NDHA 3IBFA 4PG5A 1UMKA 2W0MA 1UWLA 1XE3A 2QTHA 2W2QA 3EAGA 3FXAA 1WKVA 1KXJA 4HMQA 4Q18A 3TW4A 5IANA 4Q9DA 4LGVA 4OKSA 2JIQA 1QQTA 4GQAA 3I9NA 3CX6A 1T15A 3R75A 1Z0ZA 2NV0A 3IP1A 3NBQA 1PJ8A 2UUPA 3A4IA 3MLBA 3P9SA 2BFPA 4TLCA 4UEKA 1JAXA 2CFIA 3W5UA 2R6HA 2NU7A 4EA7A 1SCUA 4D9GA 4L28A 2DHDA 3B2EA 4PO8A 3MCXA 1L5WA 2ILTA 5EYLA 1JP7A 2DPGA 3PVLA 2QRQA 3NOVA 4MB2A 3WRXA 3FYUB 3GFRA 4PHFA 3CZAA 4FMBB 3PHLA 2MOKA 4FFPA 1Y6ZA 3WL5A 3OF3A 1ZL2A 4J2HA 3ZTTA 1ZS9A 4EG8A 3EXIA 2O5EA 3QOWA 3ZD9A 2WXOA 1IPEA 2GZAA 2H5LA 1PVDA 4UI9C 2XMPA 2O23A 3MWJA 3PXAA 4JX8A 5D7BA 1PWYE 1PK7A 1U6KA 2IEJA 1RJ9B 4MUXA 1SZAA 2X4IA 3EEBA 2N47A 1YAJA 1UK6A 1YR1A 3WYAA 4BFCA 3B5EA 1MC1A 3P32A 4QUEA 3TXXA 2CNOA 1DKLA 2VPPA 4D82A 2QLFA 3FNHA 4LC9A 3CK8A 3QPUA 3RCBA 3RRNA 5A5FA 5CEJA 3HFGA 3KD3A 1M6WA 1RHQA 2JH8A 3ORQA 1XTPA 3DGEC 1RJDA 2BMDA 5KHOC 2ZE8A 1U5BA 5AIJA 1QO0A 2B35A 2ODTX 3E33A 4AAYA 4BFLA 2CBZA 4YDRA 4XEIG 2IYXA 3UIPC 4ZFHA 4FFLA 5AOXA 3ED1A 5HJ2A 3W6PA 1D9SA 2NSJA 2I6HA 4HPXB 5KDDA 2OECA 3NGXA 2VDWB 4HDKA 3STXA 1GTVA 4B7XA 2X86A 1KJ8A 5F64A 4BNVA 1D8DA 4HY3A 2O2JA 3DTYA 3ZE0B 2XUIA 1H5QA 3JWIA 1EFKA 1ZH2A 5EP4A 2ZRLA 3CZQA 2M6KA 3AETA 4S1WA 1W96A 3FBTA 1OFUA 4RK5A 1C50A 2HRZA 3KBBA 2IV2X 3ZGQA 4OBXA 4WX2B 1JEQB 3C3CA 4DCNA 3IVGA 4IMPA 1Q83A 2WJVA 1DI0A 4FFSA 5HQJA 4YAIA 1PLKA 1J0CA 1U7ZA 3TWXA 4TKUB 5BNFA 1MJ0A 4D0NA 4DLLA 1Z2AA 1OJ7A 4LTDA 4TV9B 4P6VF 3JD2A 1JDVA 3U4IA 4M9ZA 2REOA 2ZUDA 4KV9A 4YAEA 2C1EA 1XZ8A 3IDOA 3QBDA 3COPA 4OATA 1TQ6A 1WO8A 1WP9A 3RRMB 1HO3A 2ECQA 3AU8A 1H2UA 4G23A 1TYZA 2H59A 1KL7A 2O6HA 3TJMA 4QRDA 3VO9A 1K1BA 2GW1A 5JC1A 3W8NA 1DKQA 3N2LA 1JKMA 4DV7B 2WF6A 3BORA 4FE7A 2AOTB 4KRGA 2XEDA 1EP1B 4H6XA 4UUMA 4X3PA 1YE8A 4W5TA 3HUFA 3KM0A 1IQUA 3QWWA 5EE5B 1C1DA 1IQRA 3ECAA 1PT5A 1E6LA 3GW4A 1ZHHA 3WL7A 1ZIDA 4I50B 1CUWA 3NHPA 1YB2A 1PQWA 1FP2A 4LHSA 1JBQA 2QA5A 5HIKA 3QE2A 2DWZA 1P2FA 2ZIVB 1RZ4A 3MQ4A 3NJ8A 3B7SA 1JJBA 3PEFA 4G5OA 5CNMA 3S2GA 4BHTA 4RVNA 3UAXA 4L7VA 3ZEFA 1U1CA 2F59A 1IJKA 2XXAA 3LVBA 1W4AA 2WAAA 4NULA 5DH9A 1W1WA 1RPTA 1E94E 1AOXA 1KAMA 2O6LA 3VH4A 1DXOA 4GR5A 4KN5A 3ZW9A 4DA6A 1P1CA 3Q72A 3MRTA 2IYYA 2J4CA 1Q3TA 2TRSB 1EVEA 2J5QA 2ZW9A 3DEAA 4ASUA 5CB4A 4TWIA 1CNFA 1PJAA 3KXKA 4C76A 5TQ2A 5BVHB 1IBMB 4GA2A 2ZQYA 4DLQA 4G37A 1ULHA 3DZIA 4DN6A 2F43A 3L5KA 5ERYA 1N9GB 5JHHB 1E8XA 5LQCA 2O7SA 2X76A 4EHMA 1R8YA 2PCJA 3Q49B 3KQWA 4JB8A 421PA 5AOAA 1C8BA 3BWDD 4EA9A 4EI8A 1C3OA 4HDNA 1KSFX 5SV2A 5CB4F 3FZQA 2QD2A 5ADVA 4OGFA 3LBFA 5C81A 4U8VD 1KEPA 2H6GA 4LYFA 2IYUA 2WA2A 2MSWA 1NI1A 2FMHA 1PL7A 2C88A 1XN1A 1J00A 3GDFA 3NHUA 5G0WA 2O7QA 5TGTA 1AGYA 1C3OB 2J7KA 4HDNB 4ENRA 1MABA 2IP4A 3GXOA 2GPBA 3OIWA 1BCRA 4B7ZA 1UJKA 4YJKA 1VBMA 2VJMA 3AAAC 1VZ2A 1REQB 1LDYA 2WWGA 3H2YA 3MILA 4IO1A 2GM4A 1ZRMA 2XW6A 3MRSA 4UUAA 5HK8A 1YZHA 3C48A 3DL0A 4YRMA 4ZIRB 3ORYA 1II8A 1RMQA 1HFJA 4AIRA 4WD3A 3RVBA 3A1CA 3R7DA 4LMBA 4HWGA 2JI7A 1VHLA 4JQSA 3COZA 1T9GS 4J2TA 2MOWA 5HQ3A 1WDKA 1JSLA 5CRIA 3RJZA 4DBLE 4YUZA 2H1OA 1KHHA 5FFFA 4JEIA 4WA8A 5A3QA 1KF0A 3HB0A 3QWIA 3UFBA 3FY4A 2W11A 3SBTB 5A1TA 3DLBA 1P6XA 2ZRQA 2W70A 4A8PA 1UM9A 4DSNA 3L0OA 3DEKA 4BERA 1XZFA 4IG4A 4DWVA 4QTUB 5CXQA 4HQOA 2EW8A 5LBIA 4XZ3A 4N3BA 1IHUA 4DCOA 4G0UA 4DR6B 1LB1B 1T3ZA 4KPEC 2REQA 2A0WA 2VDPB 3EFOB 2RIPA 1K7CA 1LQ2A 3H2KA 5EP3A 1J99A 1N9AA 4ME2A 2GEFA 3DOUA 3ASNE 1EX6A 4P33A 2H4FA 1G41A 1I2ZA 1Y7TA 1GA4A 3DP9A 1E66A 1VJ0A 4MLZA 4BMSA 3VKHA 2JS7A 1P5ZB 2P1DA 1C7JA 1CQJA 2HM8A 1VBFA 4LYAA 5JDCC 2X1LA 1WEHA 4QFCA 4HG2A 2IOFK 2C59A 1Q1GA 2AVNA 2CFOA 1Z8DA 3AKDA 3FH5A 4B81A 5JFTA 5F7ZA 5GGXA 1QYRA 3CG0A 3UCXA 3VR3A 2D62A 3V8MA 2ZZNA 5IAAA 2P11A 4WUYA 4A91A 3JRXA 2UXCB 3V8VA 3H9EO 1QRUA 2EWVA 1NAHA 2KZTA 1GSIA 1LRJA 3MJSA 4K6HA 3RVQA 1RPJA 3UXMA 1ABBA 2OGTA 3P5BA 4HWSA 3LUFA 5CD9A 5BR8B 1XL1A 1U4OA 3SI5A 4HVBA 3QH4A 2XRZA 3IJ5A 4RKEA 2JBAA 2QTGA 4F4HA 5JC8A 1VSQA 1IN7A 3OKPA 4ZVOA 2Z6QA 3EGDB 1ZHOA 4PG8A 1JG3A 4O33A 3T0IA 2V4LA 5B1EA 1NJ2A 3REOA 2FZKA 3PC3A 1Q19A 4O8ZA 5MN4A 2I67A 1E58A 4PS8A 2WSSA 2O1XA 2XWPA 4JD2G 1MZVA 1SU8A 3CUEF 3EUWA 3L7KA 4UWFA 3JPWA 4JNKA 4W6QA 4Y6OA 1KZGB 4YPFA 5C7LO 2OYSA 4PCUA 5A4KA 1OI3A 2N1BA 3IS3A 1YJ5A 3IO3A 4FJ2A 4PAGA 3KUKA 1TPYA 2COEA 2Q2NA 3QU4A 6PFKA 3WIUA 2SCUB 3ETEA 3V48A 1JWAB 1GG9A 1R8QA 1RRVA 2HF7A 3FMGA 4H7JA 3RGGA 3X2FA 1D03A 1F48A 1Z36A 4ZAWA 3PI6A 3SBXA 2QXYA 4LHZA 4OEHA 4PYQA 1QIMA 4CDGA 1IK6A 4TKZA 3TLYA 5HUQA 1NXQA 1A9PA 3OM1A 1MX2A 2KCLA 3ANNA 3QWBA 5FB3A 1XZIA 1JQLB 3NAMA 2POCA 4QRIA 4U6SA 1V0JA 2GQ0A 3UIEA 5M72A 3KSDO 1MO5A 4MGYR 2ZSUA 4PAOA 4BECA 3LHFA 2VTDA 3WGUA 1L7DA 2CHXA 3WXMA 1BDIA 2V7WA 4XQ9A 2PKRA 5EEHA 1U9JA 5C1DA 4PSCA 5JAOA 4IPTA 4JUCA 1D9XA 3IMKA 4D8YA 4MQEA 5L4LA 2WNSA 3JASB 4F93B 3PLAE 4EI2A 2GGSA 3BD9A 4LTNA 4C3UA 3B1VA 4PGHA 5JAMA 5JNSA 3ZZUA 1SBTA 1T2CA 3D6HA 1G3RA 1DRKA 1U0JA 3BFPA 2RCYA 3EDCA 4KI0A 3V2GA 3ODGA 4JGGA 4WKBA 3K96A 3WLNA 1M5UA 4LXXA 1QQ7A 1ZD4A 2GVNA 1LU9A 2VJKA 4N0EA 4JI1B 4DT1B 1KP2A 2F55A 1AXEA 1KPGA 1WCIB 1TR4A 1K8ZB 1Y1KE 4TXPA 2D0IA 2FSUA 2XECA 3MT8A 4GXQA 2ZYGA 4KJXA 5DM0A 4FJZA 1Q16A 2VDJA 1QR2A 4HB2A 5CDGA 4MR7A 2JFYA 3ETHA 1RWQA 1XTBA 3DL7A 1TAQA 1QYDA 1UBGA 1FDTA 2IELA 2ODBA 2R8PA 3I6BA 3RC2A 1QF6A 1JECA 1OHHA 4LV6A 2O2YA 5KWJA 3TW6A 2JLBA 1Z88A 3Q7FA 3IAS1 1H6DA 3C5CA 2ETXA 3FUHA 3KDAA 5AN8A 2WSIA 4IOLA 1QE0A 4DCSA 1T9GR 1OU4A 4ALLA 5CIQA 2V03A 3T5TA 2XEEA 1GNLA 2QRPA 1VP3A 4N65A 3D9QX 3IAXA 1BAPA 3CXRA 2AT1A 2NYJA 2XITA 3LH5A 4ZHQA 1B0UA 4I2ZA 3UINC 2RGNC 3C6KA 4YWJA 3UM0A 3A10A 4X1OA 4HDMB 1D7AA 2Q28A 4GLFA 3WIDA 2P0EA 4CLDA 3X1KA 4B9EA 3WLRA 3I9OA 4E11A 2YIJA 4CGVA 3PPIA 4D43A 4YS6A 4I36A 4L8WB 5CT9A 5DT2A 3HDXA 5LD2C 1FRNA 1XAJA 3K94A 3KJGA 2L9BA 3QEMA 2ZJ8A 4JT4A 3CR3A 3T9BA 4GXNA 4H17A 2L17A 1MJGA 1YVEI 3IBTA 2Y4NA 1VPVA 3KV1A 3E3MA 2QVGA 3R5HA 3PIIA 5ENOD 4L6AA 3G5UA 3ZWCA 3T38A 5JJTA 3LX4A 5LA6B 7YASA 3OQIA 3M5WA 3R0IA 4E5SA 1J33A 3KS2A 3TWSA 4C43A 5AM3A 2Y4OA 3ZGVA 1TL7C 5A6SB 3SGHA 3CRZA 5EP1A 4YDHB 4JLAA 3N05A 4BO1A 1QIHA 4ZCPA 4D9IA 5JBQA 4F3NA 1RLOA 2XA2A 4X63A 1O0SA 3H9JA 1G8FA 3ZKWA 721PA 1LX7A 4CGWA 4PIMA 2X6TA 4QJ5A 1N4PA 5LKRA 4Q0MA 4WY5A 3HY4A 5IG2A 3T7EA 4CQMB 1CUXA 4PYKA 2FWBA 3ZLBA 1P29A 3ONKA 1AC5A 3B85A 3FUFA 4NFLA 1II9A 1NYLA 2HHJA 3HPRA 3JQGB 2W6ID 1PJ3A 4YALA 1CIPA 2R8OA 5LA6F 4EYGA 5BSVA 4K6GA 5K8IA 3LDAA 5ES3A 4PFKA 4QUKA 5KI6A 1BOFA 4IIGA 3QKTA 5K0LA 3FB1A 3K0CA 2AOVA 3R5KA 4X45A 4MQ6A 2EILE 1WQ3A 2FEKA 3EGEA 4IV5A 2Z1NA 1L3BA 3E9QA 5AJXA 5LQKA 3MSCA 5BWNA 2I6FA 3ACDA 3AEUA 3IH5A 3ME5A 4LS3A 1D2AA 3TXNA 1DO0A 1G8GA 4RPJA 4URZR 3RG8A 2PA3A 1PFUA 5AENA 1Y5RA 2VXYA 3SKXA 4R68A 3HWX1 3UN1A 3O8LA 5FQOA 2VSOE 5EGNA 2VP6A 4I9GA 5K4GA 1QC5A 4NYMR 3ORRA 3T7RA 5JVDA 1Z5WA 3QOUA 1C9JA 1Z4NA 2P7IA 1YNSA 2HGZA 3NV7A 4R54A 5EWMB 4CLHA 2BT4A 1OCRE 4AURA 1HNWB 2CHEA 5JADA 3I9KA 3JQDA 4Z9YA 1Y3AA 5A5VA 1C29B 4XPZA 2B36A 4I43A 2QP9X 3V32A 3PCRB 4FGKA 1EP9A 1GKLA 2I4LA 4OO3A 2Y6UA 3DB1A 3USCS 2OCGA 2PEYA 3R3UA 1GUYA 2DR2A 3QBJA 4M36A 5T6BA 1C41A 2PV7A 5IYZF 1DT3A 3E34A 1V6SA 4MQUA 1QUEA 1LSSA 3QB2A 2Y4TA 3P0IA 1GL6A 2EW2A 4CV2A 1DQPA 3L4EA 3ZCSA 1R9GA 3TE7A 2WM3A 4MJ7A 5AM1A 3TX6A 2EHDA 2Q4EA 3QVOA 2Z8XA 2Y99A 1M1YE 1TUBA 4K9OA 3C3BA 3CW9A 3OD5A 2F0YA 1Z62A 3PGMA 1NMYA 3QELA 2JHCA 1V95A 3EUFA 1NQVA 3FNBA 4Y1GA 1KU6A 4CF5A 4DGSA 3CX8A 3UTMA 4TYWA 4L85A 3AR4A 2I4OA 4XDYA 4HNHA 3M6LA 3NC4A 2HJSA 4J75A 4MJLA 5DTIA 2BBSA 2CXXA 3C1TA 1LLCA 2E85A 1W75A 3UMBA 3MGCA 4Y6SA 1U7HA 1XR3A 1WS6A 3AUAA 3CF0A 3EGWA 1RQPA 3PEEA 5D86A 4BO8A 4E1VA 2ODAA 1EH5A 3AU9A 2QTFA 2R6CA 1KDYA 4PSUA 2GZSA 2R7LA 3HO8A 4YREA 3V6LA 4XOUA 4C01A 3TI7A 2EHJA 1YC2A 2GHTA 3TH5A 1HFAA 2CWDA 2J5BA 4TTTS 4DM7A 5A6SA 4FGZA 1LBQA 2XNHA 3I73A 3PICA 3NORA 4PY2A 5GV7A 3V3KA 4F4JA 4NMHA 4KEAA 4DDVA 2J33A 1JHRA 4B32A 4Z2AA 1MT0A 2UUAB 4MI1A 4KDRA 1IOVA 1R00A 2AJCA 2C31A 2Z3ZA 4LC1A 2JFZA 2B0JA 4KU4A 5EGSA 1JMKC 3HYNA 2DYSE 1Z34A 5AQ1A 4CXMA 4P80A 1N78A 4PLHA 3VLEA 1FQKA 1OUMA 3R3WA 4MS6A 1IXRC 2NUAB 2V7QD 8LDHA 3JQ8B 2FMFA 2HRRA 2PGDA 3C45A 2GRNB 2GBLA 2R48A 4GI2A 4RQAA 1ZW6A 4CR8A 3E1KA 2YFKA 1DAGA 4B76A 2NSHA 2X5HA 2WP8J 4RG9A 4N82A 3GGDA 1R6XA 1Z73A 2ENUA 4IBOA 4BEVA 5A9SB 2FPMA 2Q3LA 4Q16A 1EXNA 2DUMA 3ZZNA 1ISFA 4P9NA 1RPZA 1NJ8A 4I55F 1NXPA 1PFVA 2BHNA 3PFHA 3G2KA 1QCYA 4GH5A 4NNJA 2O07A 2K4NA 2HA3A 3RAFC 1W4RA 3AF0A 4B84A 5T6MA 4WBNF 1D4FA 3ICQB 4WNAB 1TF2A 1UBFA 1EFTA 1YQWA 1FDIA 4HVAA 4KQIA 5H0IA 3ZHVA 3ZVKA 2E89A 2FWIA 4B3SB 5LWHA 2CW5A 2GCOA 1W88B 3CLHA 2AI2A 1H2WA 2R2AA 3LV8A 3MGKA 3OAAD 1WHTA 1YTUA 3ESXA 2DUWA 2WB2A 4EENA 4GL2A 1DC5A 4AF7A 4BZQA 4FB4A 4BLRA 1WSWA 1EINA 2FO1E 4AWBA 4K1XA 3MD9A 4G0ZA 3UHJA 2HK6A 4BUCA 3EBOA 2FFQA 4Z1OA 1YZTA 1CFZA 4W5JA 1QDUA 1PX0A 5I9NA 1XZAA 4EG3A 1PKXA 3GHYA 3QXGA 4IAOA 4MCAA 5GMOA 1WAMA 3HYLA 4NOJA 2E18A 4QU9A 5IASA 1MW8X 1O94C 3ZOZA 2O5VA 3QE4A 4BYGA 5FV4A 3BOSA 3RSLA 1V9CA 5M2QA 4DADA 2WUDA 1H1LB 4D0LB 4CETA 3UMVA 1ETHA 2B92A 2YHBA 1DQZA 3HCDA 1X2BA 1L7VC 4LCJA 1QH9A 2IZ7A 4DL9A 3C6BA 3IPAA 3QTTA 4LDNA 2FEOA 2BM1A 4Q3NA 1PVOA 2OAQ1 3KZ1E 1HF3A 1UP6A 2FQ1A 2C04A 2NSYA 4HWKA 3ZV5A 5LUAA 4F3TA 3CVUA 3HEMA 3T5DA 1ID8A 1R4MB 1GZUA 1QPZA 2IYNA 4KE7A 4D4HA 2VZ8A 4PYMA 1UPUA 1HX7A 4JWTA 4C6RA 4HYQA 3AF4A 1YF3A 1VCOA 4XWWA 5K0TA 2TMKA 3H2BA 3KWFA 4F9FA 3AS8A 3F4BA 4YXFA 2OSBA 5K20A 5CM2Z 3NKVA 3JWEA 1G2IA 2D5IA 3SZOA 4A03A 1RQ7A 5FI1B 5I47A 2UDPA 2W93A 1UMBA 3ASYA 4R9UC 3V8QA 3V1LA 4A5SA 5HP4A 1S01A 2JAUA 3B82A 3UF0A 2AZMA 1SXPA 2Q07A 2JIPA 3K5IA 3HVIA 4RZQA 2VATA 3OE5A 3VR6D 3INRA 3OURA 3VU8A 1JKIA 2Y0DA 4D3XA 3DOJA 5ESWA 1DDIA 1OT3A 1YS2X