4GYWA

Crystal structure of human o-glcnac transferase in complex with udp and a glycopeptide
Total Genus 281
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
281
sequence length
715
structure length
695
Chain Sequence
b'PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKHIYDNRIVLNGIDLKAFLDSLPDVKIVKNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
total genus 281
structure length 695
sequence length 715
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gywA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gywA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gywA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gywA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gywA03
2AZDA 2VCHA 1H5UA 3RKVA 3SF4A 3PDNA 2VG8A 5G04C 2HY7A 2C0MA 3OT5A 4PQGA 4G26A 1GGNA 1XV5A 3COPA 3VUEA 4GZ6A 3UYKA 3RIBA 2LSUA 4GZ3A 5HQ8A 5DU2A 2HR2A 3ZCVA 3BD6A 1V4VA 2XPIA 9GPBA 2QN9A 3LYAA 2PQRA 5DLDA 4LEUA 2OFFA 3IEGA 1ZU2A 4WNEA 3LCAA 3MS7A 3ESKA 2IV3A 3PE3A 4RBNA 4RELA 1GPBA 7GPBA 4KYOB 1UZUA 4EJ2A 1XNFA 3RJVA 1HLFA 3BCRA 1OUVA 3TG5A 4KQ2A 4APOA 2FFRA 4EQFA 3MT8A 4RENA 3H4TA 1IXYA 3CK9A 1B4DA 4MI9A 3ASGA 4MI3A 4BWRA 2V5FA 5G05J 3C4QA 3MT7A 2QRGA 2X6RA 4CTMA 3LY7A 3OY7A 1F6DA 3R9AB 1PN3A 3N71A 1P5QA 1GZ5A 5TMBA 1EM6A 4RIHA 4MRAA 2UY1B 4NEQA 5FTPA 2SKCA 4MICA 4WADA 4N3CA 1FCHA 2ATIA 2Y4UA 2GM9A 4AY5A 1PNVA 4WHMA 1YA6A 1J39A 2QN3A 2G9UA 2F3SA 4REMA 3CKCA 1FA9A 2LNIA 4JA9A 1L6IA 1NOKA 3ZFWA 2QNBA 2I6HA 1E96B 2C0LA 2G9VA 1YA0A 5HXAA 3S7JA 3HBFA 5JTUA 4J8EA 4QLBA 3TSAA 1NOIA 2JLBA 4JL0A 8GPBA 2QZSA 2R60A 1JIXA 4HOTA 4XIFA 5BT1A 3ZN3A 4HORA 3ZCPA 1NVKA 1QKJA 5M72A 2AW3A 3OTHA 1L5VA 2ASVA 4GYWA 3UQ3A 3L7AA 2G9RA 4FKZA 2PL2A 2VGXB 4MHOA 2J9QA 3PE4A 5DBKA 3LPZA 5A7DB 2VSNA 4H7XA 1XL0A 3Q3EA 5KJNA 4KXKB 3OY2A 3NAZA 3Q5MA 3QOUA 2VSYA 3D1JA 3URZA 3DZCA 2XGMA 3ZCRA 2QFCA 3E4BA 1WW2A 4GZ5A 4KQ1A 5JJTA 2C2LA 3S0JA 2FEZA 2XCIA 2WTXA 4YUAA 3MTDA 3ASFA 3NP7A 3GW4A 2AVPA 4WUYA 2PYDA 4WACA 1C3JA 4AIFA 1KTIA 2GPNA 4Y6WA 5FZSA 3QWPA 3BCSA 3CUYA 1QZ2A 3GZ2A 3CEHA 3NCHA 4U0ZA 2JZCA 2PQNA 3G2IA 1L5QA 4GYYA 3Q49B 2IV7A 4EKEA 1Z8DA 1WAO1 4NQ0A 4J8DA 2GT1A 2F9FA 4O6FA 3EBPA 5HI7A 1P2BA 3O48A 3SZ7A 3MRTA 3T3HA 3ZHEB 3TGOA 4YI3A 3CUVA 5KJLA 2KC7A 3BCUA 3ZPJA 4CTNA 4AN4A 1IYGA 5TMEA 4NRHB 3QDNA 4GA0A 3L7DA 3CK7A 2IEGA 3CEJA 4M60A 2GJ4A 4U04A 1FC0A 2QRPA 3MRXA 3ASDA 4BFCA 4YI5A 4BQFA 1AHPA 3L7BA 1W3BA 3ASHA 3MA5A 3MS4A 3DD1A 3O3CA 4GPKA 2YJNA 4UI9K 4CGWA 1M5RA 3MQFA 3VDNB 3U4TA 3AS8A 1NZDA 4UI9J 1P4JA 3BD8A 4BT8A 3FP3A 2UWJG 2P6PA 4JA7A 2X0EA 3MRVA 1L5RA 2KCKA 2QN2A 2ZB2A 4ABNA 2GPBA 3GZ1A 2IEIA 3ZCQA 3QWVA 3LY8A 3S28A 5LCWJ 2FF5A 2QRHA 3DDWA 4N3BA 2AMVA 4L22A 3Q4AB 4XI0A 3CVQA 3LY9A 4RG6A 2WPVA 3T3GA 1Y8MA 2R4TA 1WUTA 2VYIA 2G9QA 2VQ2A 4EL5A 3VDMA 3LKUA 1PYGA 3QKWA 4G2TA 1B89A 3AS4A 2KS6A 2XMPA 4NESA 5ARFA 4GA2A 4YNDA 4BTAA 1FS4A 4UI9C 1NOJA 3GYZA 2GEKA 3TG4A 3MTAA 4N3AA 1FU4A 3CV3A 3QWWA 3MSCA 4F96A 1FU8A 2BISA 3T7DA 2X0DA 5LQDA 2Y4TA 4N2QA 2UY1A 1GPYA 2GEJA 3CUUA 2XGSA 3SYMA 3FWVA 3ZGQA 4HLNA 3TOVA 2ECPA 1UQUA 5I45A 2P58C 2ONDA 2QN7A 2X6QA 1LWOA 4G25A 1ABBA 4AM9A 2X0FA 4G2VA 4F3VA 5G05C 1GFZA 3G2LA 3NP9A 3E3NA 4IN3B 3L01A 2XEVA 3CVNA 3RO2A 1YGPA 2IYAA 1O6CA 2BGTA 2R66A 5IKOA 4HWGA 1IHGA 4A1SA 1L5WA 4BTBA 4CTOA 1GPAA 2XCBA 4I2ZA 2C4MA 1AXRA 5ENZA 3ZCUA 1NA0A 3E3LA 1Z6QA 5DXFA 4X6LA 2IF4A 3MKRA 2F3UA 4NC9A 1QM5A 1WW3A 3NB0A 4WNFA 1C8LA 5ARGA 1RRVA 2PRIA 1QQEA 1C50A 3ZCTA 1UQTA 3OXLA 3KS2A 1L7XA 1NZNA 1JIVA 4AMBA 3WC4A 2R5SA 1XOIA 3HBJA 3L79A 2KATA 1WV1A 3KAEA 5JJ6A 2KCLA 2XA1A 4GPBA 5FZRA 1E1YA 1XKXA 1Z6PA 4I17A 3S29A 1FTWA 4F9FA 4KBQA 3CUTA 4U0UA 1NLMA 3Q3IA 3OKCA 5C1DA 3BEEA 3U3WA 3WADA 2H1FA 1P2DA 3VUFA 4WNDA 2BFWA 5G04J 2QN8A 1KT1A 3ZCSA 3G2KA 3EDTB 4G23A 3S7BA 3CX4A 1Y6FA 5D00A 3MT9A 2H1HA 1P4HA 2IFUA 4N5CA 3S27A 2C9ZA 1HZ4A 3CUWA 4FZRA 4WNGA 2JJMA 1A17A 2DBAA 3OXGA 4JHRA 1Z62A 2F3QA 3QHPA 4N2SA 1EXVA 4G1TA 2BGUA 2LSVA 4W9RA 3Q47B 3D0QA 2YHCA 1RZUA 2QLNA 3OXFA 1ELWA 3SYRA 3T3EA 3C4VA 4F97A 3G2NA 4MI6A 2FBNA 3G2JA 3MBOA 2E2EA 5GPBA 2XGOA 3BDAA 5D0OD 4XI9A 4RIEA 4AY6A 2FETA 1SXQA 5D0QD 3NPAA 2XCCA 2SKEA 4X7RA 3S2UA 4CGVA 5JTTA 2VCEA 4U07A 3H4IA 3FFLA 1ZBPA 1KT0A 2KCVA 2QN1A 3BD7A 3HBMA 4GCNA 3WXXA 4CDRA 4J0UA 4M83A 3RSZA 5EX3A 1PSWA 4EL0A 2L6JA 3Q15A 2QRQA 3QKYA 4UQZA 6GPBA 3CVLA 4X7PA 3IAAA 3IA7A 3GUHA 4H7YA 2ACVA 5CHEE 4N9WA 1A8IA 3CK8A 3CEQA 3CEMA 1P2GA 3G2HA 4YVOA 3FROA 2VGYA 1FTYA 4J8FA 1JG6A 3MEKA 1HH8A 1WV0A 2GPAA 2ACWA 3JYSA 3L7CA 4EKYA 4Y6CA 3E3OA 2SKDA 3T3IA 4GCOA 2IW1A 3MV2B 3VTXA 3RT1A 2C1ZA 3RSCA 2F3PA 1Y8ZA 4G24A 5A6CA 1SXPA 1ELRA 3AS5A 3RU0A 3MS2A 2Q7FA 4GYOA 5LCWC 4RIFA 3TAXA 4KQMA 1PC2A 2WQHA 4B94A 5FZQA 5DIZA 5CCLA 1JIUA 2NC9A 1NZFA 2YQ8A 5EKQD 1P29A 4UQXA 3HYMB 2GW1A 3UPVA 3WAGA 1LWNA 4M7PA 3T3DA 1FU7A 3CKBA 3Q3HA 4I9EA 1L5SA 2HYZA 2PZIA 4HOQA 5KJKA 2PRJA 1WUYA 4MHSA 2PQ6A 3GPBA 3NF1A 3HBNA 3KD7A 3BEOA 2PYIA 4W6QA 1K08A 3T5TA 1VGVA 1GG8A 4I9CA 5AYWD 3OTGA 3MTBA 1HXIA 2C1XA 3AMVA 2QLMA 5TMDA 4RIGA 1RZVA 5D01A 2AV6A 4RIIA 1TJCA 2MHKA 2VGXA 2BUGA 1Y6GA 1XL1A 5TVGA 3K9IA 3NC4A 1JEJA 3VTYA 5FJYA 3MV3B 4AMGA 2R68A 1JG7A 2IYFA 2FI7A 1FTQA 1F0KA 5CCMA 1IIRA 4RG9A 2IUYA 4BQEA 3S7FA 1WM5A 2FO7A 4I2WA 4GA1A 2QLLA 4Z5XA 5IKPA 5BW8C 2R4UA 4UQYA 4LDPA 2XA9A 3OKPA 4I1AA 3RO3A 4N39A 1E4OA 1C8KA 4HOUA 2O6LA 4BT9A 4BQIA 3D0RA 1K06A 5KJMA 3RHZA 2FF4A 1BX3A 3EBOA 1NA3A 2XA2A 4ME2A 3ULQA 4HOSA 3DDSA 3UYLA 3ZHEA 3C48A 5BNWA 3CV0A 4U0SA 1XC7A 3OKAA 2XCUA 5FT9A 2HO1A 3OTIA 1KLXA 5EX0A 2OOEA 3CVPA 4YVQC 2QRMA 4LEIA 5JJ7A 3UUXA 2Q6VA 4X7MA 1P4GA 3S7DA
chains in the Genus database with same CATH superfamily
1A1SA 3ZQ4A 1JTEA 4FDAA 3D9QX 4JOQA 1EWRA 3LD9A 5F12A 1WXDA 2G0TA 2QTTA 2XPIA 1RHMA 4NU8X 1VSQA 3FCOA 4RSRA 1O6FA 4D5GA 4YT2A 3NC1C 4WDRA 3WBKA 2VA9A 1FDIA 1NZJA 5FNVA 1GTMA 1W85B 3H1FA 1WDTA 2XYVA 2FEOA 4L3VA 3IKMB 2RAFA 3L77A 1QX4A 4GKBA 1YRBA 2J6IA 5CNMA 1VHDA 4C0MA 4WCDA 3LLUA 4GPIB 2CT8A 5AIBA 4J8EA 2NUAA 5HKAA 3ZX4A 4PWZA 5EQDA 4NQRA 3L9WA 4RFSB 3KT6A 3ZCPA 4M0PA 1QU3A 3W79A 1G2IA 1GUBA 5J5CA 3HQ4O 5C7OO 2IU0A 3WIEA 2ZIWB 1XALA 2CXNA 4UHCA 1D9XA 4FK8A 2C59A 4FJ1A 4ZDKA 3KJXA 2Q1XA 4YDWA 1IDN1 2RH4A 4ZO9A 5ABPA 2YXNA 4L7TA 3UG6A 1JR6A 4NENA 4O4HB 3SOZA 4M1ZA 4Q4AA 2PTHA 4M37A 4MP8A 3WBBA 1X9IA 2DPGA 4JUIA 3RBXA 1J33A 1WNTA 2VTBB 1Y1KE 2XUGA 3MRXA 4DSAA 2MOKA 5EINA 4RY0A 1ZPDA 3GT7A 3TEFA 3R7QA 1GZ6A 2E4VA 2X42A 3GJRA 5JRZA 1JHRA 2ZB2A 3U4QA 2V6IA 4MLPA 5JPDA 3LP5A 2FPOA 2X8AA 3UW1A 1AZSC 3VC3A 1G66A 1P7PA 2ZG6A 4Q3OA 5C35A 4D43A 3G88A 2VDLB 3PL1A 2I99A 1IVYA 3BG1B 1I33A 4CL8A 1OAOC 3VH1A 2XF2A 2XXBA 3M3PA 5HGXA 3FPFA 2CBZA 2BBOA 2VTVA 4N03A 1C9YA 3L40A 3UO8B 3T4PA 4QWMA 1C9JA 2I9KA 1AN9A 3I6BA 5K3BA 3MBIA 2IP2A 3RKUA 3WGTA 2QTVB 4AECA 3ZCUA 1H4QA 2RD2A 4LC1A 2B1QA 3H8WA 1ZMRA 5ARGA 3PQ6A 1QYIA 1LJLA 4HT3B 1QYWA 1CZLA 3THOA 4NNOA 5EP4A 3EDRA 1O94C 1N4PA 2VH1A 3GDWA 3HCAA 5BQ3A 5BT9A 4PHFA 3PUHA 3LQRA 2WV7A 3QPDA 2R6JA 4CKZA 5LVAA 2GNAA 3KKMA 5B5SA 2VQ6A 1D4OA 2BEJA 4UBOA 2XZDG 1ISJA 2AXEA 4URUR 4LFAB 3QJGA 1DCQA 4HQ6A 3L5OA 3BEDA 1S01A 2CUKA 4DARA 1SUDA 4P0TA 5A62A 2BJWA 2RCNA 3FAKA 3OG9A 2J3KA 4ALMA 1KE2A 1YMVA 4OA8A 1UFQA 1SC6A 4FR2A 1PQ4A 4ND5A 4PLYA 2QN1A 2WJ3A 2WP0A 3Q8KA 4G5GA 2YZKA 3Q15A 3B9PA 4HDAA 2GESA 1QC5A 5BXOA 1QIHA 2KZTB 4IOLA 2RCYA 4EKYA 2I4MA 4WNIA 2LR0A 3QE2A 2QP4A 2XRMA 2EYQA 1YDGA 2B4YA 4O2LA 1BW9A 1Z2EA 1VC2A 4NMXB 5CFLA 4ZTBA 5M34A 5EZ6B 1VSUA 2QXUA 3JD2A 5GOTA 3KG2A 4HQKA 5ULLA 3ELYA 3OFVA 4NZOA 1OH7A 3UENA 2IU3A 2BFBB 5EA2A 2IQCA 3ER6A 1HDYA 3EISA 4LNUB 4YJGB 4LF6B 1G1MA 1E92A 3P97A 1KF0A 5LMZA 4W7HA 3CSUA 1V95A 2MYPA 4P4NA 2QUBA 5E1OA 1W4AA 5JSUA 4HOUA 3FDZB 2J9GA 1PDWA 3LCMA 4C0HA 3AUTA 3P9ZA 3I28A 3L08A 5DISB 4Q02A 5DM4A 4PRZA 4Q16A 1B0PA 2J4FA 5DP1A 4Z9FA 1NF8A 3U9LA 4EI9A 2AJCA 2H6EA 2F8SA 3GFFA 1SUFA 3M4JA 2Z8XA 3T9CA 5A3JA 4MYTA 3KFVA 4K6HA 5CVVA 4BNDA 1P75A 4E7OA 3PXDA 1J0AA 4JP2A 2IDZA 4NABA 1KJYA 3E1SA 3I5YA 2G4VA 4LJ9A 5E9WA 2BTDA 5IDYA 4OLJA 3DHNA 3EFEA 3K32A 4G4JA 4XWTA 3WJ1A 2C04A 3CNBA 1EX1A 2G88A 4RY8A 4GI1A 2CHFA 4HNTA 4RHFA 1E3SA 4F9GA 1KI7A 5EP2A 4OHMA 3WOVA 1ZQ1A 2HD4A 4UTRA 1XCOA 4OHRA 4I1PA 1KI6B 3EZNA 1XTUA 3P71T 1R18A 3QUTA 2VDVE 3MTJA 3WB0A 1RBZA 1G7SA 1TYDE 1Z0JA 4I55B 2V4HC 4HZIA 1SVMA 2HSZA 2C2LA 1SC4A 4DCTA 3D3WA 1W36C 1OTHA 1X7ZA 3SLGA 4IIJB 2DBZA 1FX1A 1SUPA 3E30A 1RVDA 3EIWA 4L6CA 2VH2A 4A2CA 1L5YA 1N2HA 1P1BA 5CA1A 2EZUA 3ONLA 3FTUA 1V26A 2ETCA 1J09A 3CW9A 3WLLA 1VB5A 3T9KA 4QOEA 3C3DA 1OD6A 4EOGA 2RBKA 5GJBA 1EP2B 4PV7A 1FBTA 5HRYA 4H16A 3RCBA 5EJEA 2OTCA 2PBRA 1TF2A 4AN1A 3FFWA 3O2NA 1ZGAA 3JQAD 3UK6A 4NLLA 4Q3CA 3EIUA 1PR2A 5KWIA 4BIMA 1KS9A 1M2KA 4LI3X 3ZWMA 1GDTA 1T9BA 2QT1A 2G06A 1LSUA 1GPYA 1RRGA 3U60B 3IBCA 3GCZA 3K5IA 5CA0F 4OXRA 4CKWA 4LDJA 5F33A 1UJMA 1BWSA 5JJLA 5T4FA 3HY3A 4X6LA 5D2MC 4PS1A 1LC0A 4BB9A 2QV0A 2FOIA 4QQRA 1YJ8A 1R3DA 1RIIA 1XNJA 4DLQA 2EFCB 4QBGB 1NURA 3EAQA 2H1WA 4F2HA 4OFXA 2F8MA 2IU1A 1ZH6A 1U0NA 3BTVA 1UBLS 1V9CA 2X4DA 1YVEI 2AWNA 4LQLA 1G5RA 1GRQA 3LDAA 2E4WA 1M76A 3PDIB 4FQ7A 1I80A 3FWKA 4RZUA 4TXJA 1JQ5A 2RGAA 4RIEA 1KRHA 4BQSA 1HSOA 1F3OA 1GTL1 1T4GA 2VCEA 4C6SA 5LOVA 3IQWA 3VMMA 1MG5A 1C4KA 4UU8A 5LD2C 1BHO1 2DQYA 2P9TA 5SICE 4UQZA 2P9CA 3EMBA 3NKFA 1D4ZA 3ZWPA 1BFDA 1E2BA 5LZ2A 4DV3B 3GT0A 1ORRA 4I1IA 2BHTA 5L3SA 3REQA 4P5EA 4GP9A 2Z95A 1VBKA 5KTYA 2C5BA 4C7BA 2R8OA 5BNFA 1XELA 2G5PA 2GRMA 4NZPA 4JU9A 3VX4A 1C4XA 4MWCA 4QSMA 4YP1A 1TVKB 4W6QA 2D2EA 4DM3A 2CEAA 1KQGA 3LW7A 4JVSA 5CM9C 1AXEA 3TL5A 4IV5A 4F4UA 1I4LD 1K8RA 3S7FA 1RD4A 4TUMA 4XWWA 3FCEA 5H7XA 4QTUB 1Q6YA 2GH1A 1C9EA 3RSLA 4B3BA 5B57C 1FPPA 1ZRMA 1YZ3A 2JGDB 4V0SA 1KLXA 1N2ZA 1C3XA 3UAXA 3L6CA 4LYHA 1N36B 2GA9A 2BZGA 1RFGE 4MUHA 2X5GA 3GA7A 1VG0B 9GPBA 1EP3B 2NYUA 2Q6LA 5CH5A 4BUCA 1DJOA 3WFIA 4E51A 3HHEA 4HH0A 1UBKS 2ZW9A 3PPXA 5EJ4A 3WRVA 1W0JD 2ZYAA 5JD4A 3UOGA 3OSUA 4BGDA 3RFFA 3DKIA 3PVSA 1QQBA 3T9BA 4WCFB 3ROEA 3OY7A 4MRMA 4S1TA 3T9DA 3ROQA 2C9DA 1LCIA 1JNZB 1KSFX 3RNOA 3MERA 1NOKA 1K5PA 3ZU7B 1ONOA 1E2MA 2RKBA 1VBMA 3OICA 5B2EA 2XNKA 1OFGA 3UV3A 4C7XA 2BDUA 4OJNA 3EN0A 5MFZA 4LQ4A 4II2A 1SZJG 2BGGA 1ZCZA 4BPRA 1MB9A 1N0VC 3Q5MA 3U44B 4Y0VA 5BMVF 1R0RE 1RRKA 3TLYA 4C0SA 4RCZA 3HB7A 2OV1A 4UBNA 4PTZA 2BGMA 1KK3A 2UYQA 4BVKA 4FHDA 3PH0C 4HC4A 4WACA 1XVLA 4E5PA 3QJZA 3JQBC 2PJDA 2V5VA 3ETLA 5E75A 1ZJ4A 1EFPB 5TIIA 5KC8A 1QQ5A 2JFHA 1T5BA 4EW3A 2WXLA 1RPZA 1XHEA 3DL0A 4I9UA 5FFNA 1U9YA 1N7IA 5CPBA 1I2MA 3K0FA 3PDWA 3WL4A 2IFTA 2H7XA 2PT9A 4GPTA 4H08A 4YRIA 3C8MA 2DFTA 1BLXB 4DR3B 1JDUA 2AMFA 2QXTA 3DEFA 5MN5A 2EV9A 3DOFA 1EVKA 1U2EA 4FONA 1PYGA 1B89A 3DRAA 3CVXA 1ECBA 4TV9F 2WHPA 4PPNA 1H2WA 2F3RA 4FZ3A 4HAIA 1AKVA 3TD2A 3AL0C 4B6FA 4ZOCA 3PNYA 3GPDG 3H2YA 4OHVA 3B7BA 1T9DA 3HKDB 2WJHA 1H5QA 4IS2A 1ZK3A 3E5RA 4IOJA 2Q50A 4AKTA 4WOPA 3ZU5A 2FP4A 4DL9A 1O95A 1UQTA 3KWJA 1YDWA 4AMBA 1EZZA 4KR0A 4YLYA 5BRNA 3AV3A 3AFOA 4RKEA 4GOJA 4CIVA 4RL6A 1LX6A 4K9LA 3PQCA 3BRWD 1WRBA 2FOXA 4NHEA 1Z5SC 4YRAA 5F7OA 4IH9A 3HCPA 3SJBA 2IONA 3C39A 5ADWA 3X1ZA 4GXQA 2IX3A 4KFRA 4KUGA 1U7TA 2YWFA 1A9QA 2QRQA 3ASYA 4M7WA 2C7VA 4I50A 1A8IA 2VJMB 2VKTA 3FSJX 4FT2A 4B6RA 3I92A 2PR7A 3SIRA 2FGKA 4TUYB 1Q21A 1OJ7A 5E9JA 5KJ1A 4LJLA 4R8VA 1Z34A 2ODAA 1P4SA 1M73E 1B0AA 2C78A 2R4QA 2GOYA 3ND5A 1F6WA 2Z6AA 4J7CA 3TLKA 3LGSA 2YWCA 1DWPA 3DBHB 4YUWA 4RMGA 5JD6A 2IYUA 5TEVA 3A2NA 4E2XA 5IJXA 2I9PA 4I2WA 1UXJA 4KXUA 2V3WA 4M9RA 1BDBA 1X6VA 4KL8S 3QBTA 2BFEA 5K8UA 1HE5A 3HXKA 1DBPA 2Q6VA 1E66A 2QWXA 1IOWA 4DBZA 2MYTA 3Q11A 4PQGA 4Z9XA 5ENPD 3MXOA 2WUGA 3OH8A 4WV3A 5HQ8A 2FWNA 1X14A 3JQAA 2EBFX 1Z2OX 1SBIA 4KWCA 1GGEA 3F73A 1I51A 4GWLA 4M55A 5HG0A 4CQMD 3GEDA 2EP5A 4PCUA 1LFDB 1VXOA 3KRTA 1IJFA 1GCUA 3MT7A 4IHQA 3KXPA 1LPBB 4C1BA 1PF7E 3MMSA 4BV9A 5AH0A 4H3HB 4P2GA 4FC6A 4W8HA 3U3RA 3KZNA 3KAKA 2QD1A 2N3ZA 5DHSA 4QTTB 2JEZA 4A8TA 4KQIA 1KVTA 2ZLBA 3BWVA 3P45A 5B64A 4Q4HA 1SVIA 2HMWA 2PX0A 2PNJA 1DC6A 1SURA 4ZFHA 2QTNA 2TSYB 2C7GA 1RPNA 3VKWA 2D13A 2E48A 5AJLA 3CR3C 5T41A 3N3BC 4F8JA 3VISA 2CL5A 3C3OA 4EHAA 3NCHA 5G0VA 4PO1A 1R6BX 3CIFA 5FF9A 3DV9A 1H8HD 2NUTA 3WAJA 4MGEA 4Q4JB 1L9XA 3WB2A 1U8FO 4OQDA 4JI8B 1H93A 1AHPA 3WRYC 3WIOA 1CRQA 3E61A 1S2LA 4JJIA 1X38A 3HN6A 4EPTA 3TW6A 3WKBA 3BWMA 3ADPA 4EGQA 5CM2Z 1Y5NA 4QUEA 1V3TA 3VI3B 3HVEB 1WUTA 4UHEA 3QPUA 4H0NA 3DAPA 5DX8A 2OWEA 2YNMC 4V1CB 4L7QA 3DCJA 1I5OA 5E3IA 3ADBA 4N7BA 4L8LA 2OQ2A 2AXUA 1L7AA 1G19A 4US1R 2OCDA 3MMNA 2WAYA 2OFWA 3UPDA 1XJ0A 4FUTA 4BQRA 3BMXA 3IQIX 5FBZA 1NYTA 3KQQA 3ORRA 1WUHS 3ZVNA 2FQXA 2V45A 3EUEA 2HLPA 1ZD3A 4JFRA 1F2UA 4UFOA 1GKUB 2XYRA 3MHPA 1JXOA 3SJ7A 2ZJZA 1JQ3A 1PJSA 2PCLA 1P9NA 4ZMSA 4S0ZA 4FCWA 3DOHA 2ERCA 1X70A 1PT9A 3G68A 2XMBA 4G01B 3AL2A 1ACLA 1U1DA 5IC6A 1P1HA 4Q6WA 3WLJA 2VOEA 2G67A 4EIWA 4OI0A 3GEGA 1WPXA 4BJHB 4JNCA 4XRRA 2WRZA 3DFIA 4L5JA 1U63A 4PANA 1HO8A 1PEKE 3NS7A 1SKMA 1Q74A 1PJCA 3DO8A 4IVQA 1W0JA 4KSYA 3PQ4A 3JRXA 2AG1A 3LT4A 3CGWA 5FD8A 4J9UE 3GZSA 1C3LA 5IJ0B 5CA0A 4TVOA 4MDFA 3F0TA 4OAVB 4NXNB 5KCMA 3ADDA 3B3FA 4ITUA 4RWZA 1PFVA 2Q5CA 2NV0A 4YVOA 4OUDB 2QVBA 1HH8A 5DYIA 4M8NE 4HVBA 4PHGA 1QQ7A 5JROA 4G24A 1ESCA 2GBFA 2O8EA 2W2KB 3CZ9A 3SDSA 1EMDA 1Z22A 2FDCA 2OSVA 1ANKA 4R0VA 3VR4D 2VDRB 1LBHA 3OTOB 1LPAB 1C2YA 5AHXA 2AJAA 3UC5A 2CL6X 3D43A 3U1TA 2RIRA 4MEBA 1K08A 3R3SA 4JJAA 4RANA 4E30A 3ZVVA 4U6QA 3P2BA 2CXTA 2GN2A 4KO2S 1OLOA 2UUOA 3JQRA 3P2MA 5DE3A 2CVOA 2WP8J 4KQFA 2WD9A 1SHUX 3AF4A 3H42B 4D0LB 3D6FA 1BX3A 3N1UA 4DR4B 2YXBA 5INTA 4CNBA 4XJVA 4V2IA 1O4WA 1ZUNA 3LVQE 1X1QA 4RK0A 5DTEA 2HO1A 1B6RA 1DDIA 1OFTA 5D3ZA 2B30A 1S7CA 4I4LA 1IVNA 1E3WA 3E9CA 3UIEA 4FFVA 3P94A 3GELA 5DU2A 1R0YA 5BN5A 4C0BA 2YZMA 1DXQA 2X7JA 1S2DA 2QN9A 1JYEA 3L17A 3IMCA 1XZ8A 1RTTA 1YJXA 4H15A 4JELA 4QHYA 3I72A 4EY5A 2O7RA 5HE8A 2MSNA 4RU1A 2C5AA 5IH7A 3PD0A 2QAGB 4Q01A 4UJ5A 1F6DA 3PX7A 3K1TA 1LTKA 2OE2A 4PAQA 1RYFA 1EIWA 1RHRA 2DY1A 3MUEA 3LUJA 1GTG1 3ZWXA 3SC4A 4E11A 3FHEA 4GTOA 5E6RA 1QH8B 1YA0A 2AUNA 4P0QB 2YJ4A 3COSA 2PV7A 2UAGA 2C3UA 4XIYA 4F85A 1T8PA 3N8NA 4GDFA 4LUCA 1ZJWA 1ZO8A 3P9PA 5KJNA 3BRWA 3QOUA 4G5RA 2J6CA 3IPYA 2H0RA 2C20A 2J9FA 3AM5A 2HA3A 3KQSA 5TJ9A 5REQA 4O6FA 2GEBA 3P0EA 3SSOA 3MRTA 3QI2A 2IGTA 1E1RD 1F0PA 3RIGA 4XM2A 1DAFA 4QGGA 5ARBA 2C31A 3EJ6A 5AQ1A 2AZMA 3JXJA 2MSCB 2ZYTX 5EEGA 4TZ0A 3BGDA 1G8YA 3SEQA 4D80A 1M1YB 2XMZA 4LN1A 4PLVA 1M2GA 4D4GA 2D3TA 2VQ2A 2A9PA 2XQVA 3QKSB 2MINB 3WKEA 4HLLA 3ELWA 2XI4A 3IMGA 1FU4A 4WJZA 1NC3A 1ZXBA 1RM3A 1RYHA 4M7RA 1BOOA 2YJZA 3ABKE 3ONNA 2F6RA 3G9TA 4P53A 3B95A 1XDBA 2B36A 4XJSA 3NUQA 4U9IS 3OX2A 1NVEA 1GTRA 2LD4A 1FNSA 4YRDA 4QFMA 2Z57A 3PFNA 2BHRA 4WUVA 3VVLA 3T1TA 2ECKA 3N0WA 4UU0A 1GL9B 4WWHA 3U4CA 3IR5A 3TQRA 1WV1A 3MJSA 3RC7A 2XA1A 2UYHA 1SGWA 4I17A 2YCBA 4K0KB 3B13A 4KJZA 2VL7A 2XQIA 3F2IA 4ID3A 3EDTB 4DIOA 1DAGA 3TFQA 1QAOA 2DT5A 5D5PA 2C8JA 4EFKA 1SOAA 3AONB 2WG2A 1Z17A 1CJSA 3H0EA 1SXJC 3F3MA 4JP1A 3MBOA 5EPOA 4KKXB 2HLDD 3PQ7A 3DYBA 3AVVA 2A59A 2UVPA 4NBRA 4OO3A 2ZRMA 3ACCA 4DMCA 1JAHA 2E6KA 3E2PA 3A3KA 4JWTA 2RGWA 3P5BA 4G6ZA 1XTZA 5ECDA 4D9GA 3IAAA 2ACVA 2HA0A 4WN9A 3EHMA 4IH4A 3U4HA 2DC1A 3GU3A 1OH5A 1CUHA 3X1KA 4L1KA 5CMLA 3ZHSA 4NBTA 3OZWA 3A0UA 1KEWA 3TJMA 3ZBQA 4JP3A 3DONA 1TYZA 1E8WA 2P0EA 1V5EA 4Q93A 5ICMA 2VF5X 4DYDA 2WHEA 3FEYA 4NYIQ 2OXRA 1L7EA 1QPBA 1TJCA 3CX6A 3DBOB 4HTFB 1VI6A 2OD9A 5DTIA 3FWHA 1N6LA 1RAAA 1YS9A 3LO5A 1H8HA 2FQQA 2IYFA 1UJRA 1CUXA 4DB2A 1E7UA 4AO6A 4MB6A 1DEXA 4JVMA 4E7PA 3T7RA 1CY0A 4MQMA 2ZYDA 4IQ4A 3HL4A 3QU7A 2X2FA 1NRXA 2D62A 2WKSA 3SY8A 4TMZA 4UM9B 4F5ZA 1X74A 1CUVA 2FFGA 4MO2A 1I6MA 2ZBQA 1R0ZA 4CUJA 1V5FA 4IUYA 1NIPA 3E37A 1H0AA 5HJ7A 5E9AA 1QF7A 4M38A 1DRWA 3ZD6A 4MCIA 3JQ7A 3PDHA 1DBQA 4WZAE 1VSTA 1VCHA 4XR9A 1N34B 3ITNA 3GMTA 5F21A 2CHGA 3N2NA 4WLEA 4ABYA 3QF7A 4FB4A 3PNOA 2D2XA 2HF9A 3JS5A 4X8LA 1GFIA 3UNXA 5DVZA 3N71A 4PU0A 4QVGA 2OZLA 3BD9A 4NPHA 3EIFA 1Z3YA 4EA8A 5FQ6A 4FHZA 1U2VG 3WRWA 3V34A 1CY8A 3M34A 3WV4A 1X39A 4IL5A 1EM8B 3K9BA 3AEKB 1KDTA 4G8JA 4N4AA 2ZRDA 7REQA 1ENPA 3FCCA 4PC1A 5DFAA 4U7FA 2F64A 1G20B 2EW2A 2XGMA 3IVAA 1VA4A 3PIRA 4YO7A 3FVVA 3A4TA 3W8RA 1IU9A 1EZ4A 5FDFA 4Y30A 2I6FA 2ZSAA 4QUDA 4W9MC 3ZC3A 1OLXA 2PS3A 3T0IA 5AW0A 2COEA 3I5AA 1NL4A 4CF5A 1HL3A 4TYPA 3CLSC 5F64A 5HZHA 4MINA 2G09A 1HDXA 2ZXWE 3IH5A 1AK9A 2PS9A 3DUFA 2MTBA 3EG9A 5J63A 1L5RA 1ZD2P 2XUHA 4I46A 2XX3A 3P2EA 3AG2E 4IV8A 4LHSA 3WLSA 4YYZA 4CG1A 1FUKA 1Y8MA 2HMAA 1CBUA 1SHZA 3VR4A 3I9FA 2PH7A 3R0JA 1ZNXA 3Q7RA 2VWGA 1UBOS 3V33A 3A14A 4Q1AA 2VC2B 4UDNA 5CJJA 3LY5A 4IDCA 3K6SA 4C4YA 4ENRA 4C3VA 1UJNA 2COKA 4RVBA 3ENZA 1N4DA 3Q7PA 2ZVPX 5C9ZA 1GCOA 3IA2A 3TECE 3RJZA 5DMXA 1T34A 5JMND 1Y6QA 5JWHA 2QN6A 4FJ0A 3PQ5A 1JA9A 2BFCB 2Q1WA 4F86A 4GPEA 2YMQA 3UMSA 3L0CA 3D9JA 3BMOA 3QU2A 2QI9F 3LPCA 4M0UA 1AHHA 3BEEA 5ERYA 2F37A 5EYLA 3IAFA 2W90A 4YUZA 1QO7A 1C4OA 4EM6A 1Y8RB 4FZRA 2ADFA 2RSLA 4B7XA 4GW3A 3NONA 4RPLA 3BZUA 4Y0AA 3ND7A 1YE3A 3NPAA 2VDWA 1RI1A 3AHHA 1OYYA 1NRIA 5H68A 3PC8A 1POWA 4XQCA 2H29A 2Q7OE 2QSUA 4JJEA 1OV4A 3PQFA 4N18A 2KM1A 2CD9A 1CDZA 4PLGA 4DNFA 3U7FB 2ZJ4A 4AYWA 5HKPA 2BTQA 4PFJA 3ULEG 3RIHA 4JBNA 4FX5A 1N25A 1KSJA 1FXWF 4YN3A 1HT1E 5FJIA 4GLOA 1P29A 4LI0A 5IT9A 2E5WA 3LT1A 4G1MB 2PLAA 1GILA 3GCGA 2JLZA 1R0CA 3GJ6A 4J0GA 4OU5A 2PYIA 2LIVA 3COZA 1U6JA 4HNVA 2O14A 5JFGA 2QNRA 2Z9DA 2O2ZA 5ALKA 1TM7E 4DCCA 2A0YA 3BJZA 3KLOA 1S8AA 3VO2A 2UZIR 1GO2A 4B0OA 1B2RA 5LOZA 4Q1CA 5C5EA 2RH5A 4YAGA 2PUCA 1ADBA 3TLZA 3FUIA 1N6KA 4NJOA 1Y34E 2J5RA 2HUPA 5FEUA 1T3LA 4U0SA 1P9WA 3FGZA 3GQVA 4R71A 3T3NA 2IYQA 1HQDA 4YJHB 4G5XA 4II3A 1ZN8A 1NX9A 2FLWA 5BOSA 3O7WA 3ZHRA 3A4LA 3J5QB 1OE0A 3U5TA 1NR1A 4NI5A 1IN7A 3EH2A 2PM6A 2EDCA 1DELA 5I9LA 1YRLA 4N47A 3QVVA 4W5NA 3BRSA 5AKHA 2QLFA 3TG5A 4IDNA 1XPUA 4APOA 3MF4A 4KBYA 1PNQA 3PXEA 2XD4A 1K6IA 3CG0A 3UJ9A 4IHJF 1GM5A 4Z0NA 3PGVA 4BC0A 3R5SA 1LS1A 2WT8A 1SD1A 3DOOA 3VPHA 4EW1A 3R7NA 3EZXA 2FU5C 3S7JA 4TV3A 3CT6A 3NANA 4F3RA 2F62A 2BL4A 2P4QA 4DRZA 2CC2A 3CX7A 1Q0QA 2G9RA 2VYQA 4QBHA 4D98A 2J46A 2C0QA 4MVJM 5GOZA 5LR6A 4RGYA 4LMRA 3UHOA 3V4SA 4Q7QA 1ZNYA 4JI3B 2X4IA 4U0ZA 4Y2JA 4MUEA 2NSZA 2DXIA 1O3YA 4ALIA 5J5AA 3R6GA 3GNSA 2HLDA 2PX3A 5CLFA 5AK5A 2V7VA 3P20A 2HADA 3HLYA 3WLAA 1SHTX 5DN6D 3A9UA 1O97D 3L6DA 5EIXA 3D4LA 4ZYXA 5CNJA 5DGTA 4BN5A 1X77A 4U8GA 3L8CA 4GPKA 7ABPA 2IX9A 2EJTA 2CG3A 4EB6A 3CE6A 5JAOA 4G0XA 4XARA 3RYIA 3K35A 1E20A 5AAOA 1XZCA 3HXQA 2OFOA 5C46F 4EQ6A 1Z0IA 3RFCA 3TSYA 1BMDA 2CKMA 4L1BA 5L3ZA 4ZAZA 5F1OA 4C21A 4JB0A 4AJ2A 3LOPA 3PZ4A 4YPVA 1XF1A 3D8HA 1OCRE 4MV4A 3KLPX 4JLBA 4TXLA 1SQ6A 4OMUA 2CLEB 1N5RA 4CEMA 3CR7A 2FYTA 1KJJA 4U8YD 2X9QA 4NE9A 4EY4A 3S7ZA 4YCSA 4Q94A 5EXTA 1V8BA 4CPDA 3LCVB 4UREA 2F00A 3HYTA 2YZGA 5JY1A 5LXTA 4WKPA 4BKOA 4D9MA 2HA6A 3M4XA 4P9NA 4LXYA 3WGVA 4LZNA 3SXJA 2GA8A 1KAMA 3KKKA 5JNVA 1KMQA 2ZI5A 4GXRA 2VNHA 3HM2A 4OYHA 1BX1A 2AFIE 3IDSA 1IQUA 2A0UA 4ZHQF 3K9NA 4CM7A 1CIVA 1TIBA 4NYMR 5FPPA 3FY4A 3AJAA 4RH0A 3F90A 4IKOA 4KLCA 2JVIA 3THYA 2OHHA 5EMHA 2G1JA 2FBNA 1KZPA 1NRJB 5KOJB 3L93A 3WNCA 4D57A 3F7MA 4E2ZA 3AQ4A 1Y5LA 2DFKB 3AKEA 3K9FC 4QTZA 4TWZA 4B32A 4HRYA 1YB2A 1C7IA 4FR5A 1TVMA 5FH9A 5HDBB 2PUAA 4J8FA 1ZOSA 2X8LA 3TFOA 1MNAA 3B52X 4QUAA 1QVVA 1A9TA 1JVBA 2AL7A 4ZT3A 4F11A 1P4AA 1E9CA 4DBLC 3ABLE 3IRVA 1SKBA 4XYBA 3WGLA 2ZUUA 1D1QA 2JD0A 1KOGA 4IULA 3PNSA 4KGZA 1CUEA 1JR3D 3TJRA 1ZOPA 3R1IA 1BYUA 5B4UA 4RYLA 3GYXB 1KYQA 3OPYI 2ZJ8A 3M6LA 2OAQ1 4D9FA 5COBA 4H7KA 1J2YA 1SC3A 3WJAA 1E4OA 3N5KA 4UNPA 1KWKA 4WESA 2P0YA 1VJ5A 3C7TA 1VMKA 1X7HA 2ZTVA 4UTPA 4IMJB 5JBQA 4QNNA 1T2VA 3I2IA 4I1MA 3UUXA 3ZYZA 3MWEB 4UPEA 2BUAA 2ZCJA 3HI6A 1HF8A 1NY6A 4HX5A 3STYA 4DMFA 3WWDA 2ANCA 3V1KA 1GKYA 4IDGA 2D0IA 3MG9A 2NVUA 1ACJA 3I4LA 3KJNA 1NP7A 5DBFA 3VR6D 1JW9B 2G1KA 3ML8A 3WFZA 2X38A 3VZQA 3I9NA 1B4DA 5C2YA 3HWX1 4ZOAA 2HB6A 3KSAC 1UKYA 2ZIXA 2ZDQA 2ZUWA 4ON9A 2IYRA 4NARA 5CGQB 3NYWA 4HJXA 4NYMQ 3SC2B 5FLKA 5ADUS 3QFTA 4RABA 1914A 1U3WA 4AY5A 1RWWA 4FINA 1G0OA 2FXVA 2VJDA 5FWAA 1L3IA 4ED9A 4JA9A 3VAAA 4P3OA 1OCOE 1QTNA 3U1VA 1CUZA 1FSGA 4W8OA 1Q7EA 4IGAA 3MGGA 5E2IA 2AXZA 4XIFA 4J3FA 3D9NA 1WB5A 4U9HS 1YO6A 2E21A 5FR1A 3JPYA 1UWKA 4LRZA 5CYGA 1NXPA 4HX9A 2I80A 3D2LA 1BD3A 4JUAA 3DBLA 3DPSA 5M04A 5L95A 4YQYA 1T5HX 3U64A 5T4HA 4Z0HO 4KITB 3T4EA 2Q0QA 1VFNA 3O48A 4YJ2F 2O57A 4D8TA 5BN3B 1L8OA 4OU4A 3OCVA 2GRUA 4HMOA 3A26A 4HXYA 1QIMA 5EXSA 3OPVA 3H8VA 2P35A 4YV1A 3FNGA 3N0RA 3V31A 1PK9A 3IB3A 9LDBA 2NP7A 1QRSA 3LECA 3W6OA 3RC9A 4KQ6A 4YJDA 2XUKA 4OQMA 3LY8A 3LXXA 1B2LA 1F8FA 2LTAA 2JA2A 3M6UA 1UXIA 4A2QA 3KQHA 4L3OA 2EJVA 3AS4A 5ARFA 4Y1GA 2IS4A 2OC4A 1MJHA 1QGZA 3F6RA 4FWBA 2ZZNA 1QV7A 3V9AA 4PS0A 4BBZA 2OAP1 3IAUA 2PJRA 1T1EA 2R6AA 5AM4A 3WNDA 4LY3A 4KPYA 3NP9A 1MF7A 2DX7A 1MABB 5ALFA 5FFMA 3A10A 3U17A 2C5HA 2ALJA 2WQ7A 5F9MA 3E82A 1USKA 4MVXA 2IYSA 5DI3A 1FP1D 4LQDA 1I1QB 2WA2A 1L7MA 2B78A 4XIIA 2WPDD 3FYUA 3O83A 4IDEA 4TTAA 5LYYA 1NJGA 2R65A 1W1IA 1ZW6A 2YWDA 4B3GA 1ISMA 3TI7A 3VNRA 1I2BA 4RHXA 4CKBB 4DV5B 4BGUA 3UJ7A 4YALA 3UCEA 3THXB 2ZYVX 2PU5A 5EHNA 2CDCA 5A0VA 2K7FA 1HZ4A 2XOEA 2Y1LA 1PKEA 2O8FA 1SA0A 2AB0A 1V1MB 3OPXA 5FWYA 2IA5A 5IJAA 3E70C 5K8JB 3CURA 2FHSA 2YMMA 1QGED 4K03A 2GCNA 2ZUTA 1LB1B 1YI8A 2XYPA 3IO5A 3CUSA 5B1HA 3QELB 1K2VN 2WNHA 4HDQB 1RDFA 1BH2A 4CEIB 2BCJQ 2DFDA 5K6RA 5BWCA 3FCUB 2Y1LE 1W5AA 5CGZA 10MHA 2Q7FA 5GIPE 4PWYA 2VHEA 1W4CA 1IXKA 2YQ8A 3COWA 1DC4A 1CNEA 3QLUA 1QIEA 3LP6A 1BDMA 1PAUA 4D8WA 1I4WA 4D56A 1A5SB 3CH4B 2EU8A 1E7MA 4Y7CA 1GNPA 2EIJE 4KSCA 4EATA 3CZ4A 1U1IA 1B0UA 3DXXA 5E7IA 2XADA 3BGOS 4Q1EA 3O2JA 4BFWA 3CHMA 3T7KA 1J23A 3EUVA 5BR4A 5KYGA 3IO3A 4CM5A 2UKDA 1JKJB 5DN6A 2BCGY 4GH5A 3N2GB 4LJYA 2MOWA 1RPAA 4C5BA 4DWWA 3O2QB 4D1YA 4QX6A 4QPJC 5A9TA 4M4SA 1JNXX 4JXTA 3HJUA 2C2WA 4EG6A 4E6PA 3PQ3A 1P4GA 3GFQA 1GAJA 3K70C 3IHKA 2IITA 3LUCA 2OOKA 3ZHZA 4G26A 1Y7LA 5EL0A 4GZ6A 1K68A 4MWZA 5FV4A 4X8MA 4HWOA 4ABTA 1J0DA 1AKEA 4PZZA 3SJAA 1LLFA 4J2HA 4OGFA 1EHIA 2I6UA 2YWXA 1GSOA 1JAXA 2LE0A 2FWMX 4YJFA 1ADYA 3UMFA 1NULA 4RKYA 5ALQA 2CNBA 3R9AB 4KK4A 2Y1WA 4RMNA 1FCHA 4DZTA 3TJZA 3GJ0A 3CXUA 3BRQA 4YMLA 1AO0A 3CKCA 4U2CA 4NIKA 2AOTA 4XRGA 1SUSA 4L2LA 4H1HA 1L5KA 4C2AA 1T9ZA 1E2HA 1VPDA 2GBCA 4Y7DA 1K7EB 1U2PA 4JC4A 5CM8B 2Q5EA 2GAAA 4RS4A 2VUIB 4AYTA 2W8BA 3ENKA 3URZA 4QYXA 3QE0A 1X80A 4FXOA 2JFNA 4ER5A 5A71A 2AW6A 1PFKA 2AVPA 3ONKA 4HATA 4HZUB 3GLHA 2O2GA 1LJ8A 4TS4A 2PUVA 1QGOA 2ORYA 2CCKA 1JPNA 3EB9A 2KC7A 4PPYA 1GAEO 4IJ6A 3CEJA 4IHJA 4YHHB 3ZTTA 5JIBA 3VR0A 4BMOB 5FBWB 4PLWA 1NI5A 1K86A 2GN8A 3PJEA 1P4JA 4DDUA 1QHNA 1A9ZA 1E7SA 4M0DA 1K3UB 4MJ7A 3EXAA 5K6TA 4LF8B 2PAFA 5CRIA 5FHRA 2WYVA 5EKUA 3GLHE 2D1FA 5FWDA 4RKRA 2KWIA 3SMQA 2EW8A 4MKHA 4A0FA 1SVOA 3Q2IA 4RTMA 1JR3A 2QTWB 1L5NA 4CR6A 1N0RA 4W1SA 3TLGB 5CIYA 2AMJA 2CNKA 4ZC8A 4P81A 1NXWA 4WOJA 4A1SA 5DWVA 1FDTA 5MDHA 3PA6A 2CNLA 1OGIA 5IN5A 2XDYA 3MM4A 1JAZA 1TT5B 2Q45A 3DAOA 5HFAA 1E2FA 2O2HA 3BB1A 1I4EB 5AK6A 3WC4A 4MUMA 1VHQA 2ZYUX 4BO9A 4AVYA 3QA3E 1PR0A 2R00A 3RU3A 1NDHA 2R9VA 1FTWA 2P2DA 3PWKA 1PFGA 3MB5A 2Y68A 2AZ4A 4H7IA 1PJZA 4Q3NA 3GNLA 3L82B 1NVXQ 5KKCA 3ELDA 4N40A 4CV3A 3VPAA 2BSXA 4Q24A 1NFRA 3PV0A 1LK7A 1GR0A 3WYCA 3K6JA 3EODA 3RS4A 2RHHA 2AN9A 3FUTA 2KJZA 3MWDA 3AOEA 4YIHA 1N2CA 2L0XA 4P80A 1M34B 1MRNA 3E7XA 5HJ5A 4Y2TA 3ND8A 2XNCA 1CY1A 2NO1A 3AU8A 2BH9A 3QXGA 5KNBD 1A77A 4R41A 2O07A 3UWSA 1BVYF 2XVMA 1EBBA 2P5UA 1U2DC 4XGRA 1JWGA 2QG6A 1OYVA 1XXLA 5LQKA 5JATA 3D9MA 3AHGA 1MO5A 1CB7A 3VKUA 1YZGA 4LXIA 4YASA 4GNKA 1HQKA 3EQ9A 3I6IA 3HYMB 3BORA 4FLMA 4UNIA 3GYGA 1EUCB 1E4VA 3TIXB 4ZHQA 3LBFA 4DTCA 4NK5A 4BTVA 2RG8A 1E1KA 3QW4B 2NT3A 5E38A 2I3DA 4ETNA 4YTEA 1FRVA 4FA6A 1UC4B 1R2QA 4OHBA 3P96A 3EEQA 3MLBA 1L3CA 3KBBA 3GN1A 4B3FX 1W581 4G41A 4Y1RA 3PR2B 3AESB 1H2ZA 4NMWA 2WNSA 3WLRA 3H97A 5KJMA 2M6SA 4OK3A 3FJYA 4ARCA 2YQ4A 1CJUC 4M98A 4NK4A 3OUZA 1ZH4A 4C87A 5JHHB 1JV2B 1MC5A 2G17A 3ZEAA 2AZDA 3W5SA 4RGQA 3AAAC 3FF4A 3LI2A 5E8RA 5F2EA 1JQAA 1XTRA 5FBLB 4LGCA 1XIVA 4YUVA 5A23A 4BFXA 1VM6A 2M6RA 4LF7B 2PVPA 1YASA 4Z0PA 1V8OA 4HY3A 3U09A 5BY2A 1H22A 2X8JB 5JQGB 2Z4SA 4DEVA 2CXUA 2I55A 5AW9A 2FMFA 2JRCA 4BX0A 2HZ7A 2E7ZA 4DS3A 4ZVMA 1IULA 1ZGBA 2GN9A 5A7HA 1QSGA 3LXRA 2NUPA 1T5OA 4L5BA 4RFVA 1L5OA 1AHNA 4P3XA 2I8LA 3IJEB 4MUFA 1Z2AA 3Q9UA 4JOCA 4RPKA 4J0KA 3C6XA 1OBCA 2WPDA 1EUZA 3BHNA 3PEFA 1NU6A 2X1VA 2GKGA 2PANA 1KVQA 5IBCA 4KXFB 3KZCA 4TXNA 5DYTA 7MDHA 3MB8A 4KHZA 1H2AS 3IQGX 3SSMA 4U2GA 5BXYA 4NXMB 1SUCA 1Z8HA 3K0AB 1ZR2A 1YSCA 2VSYA 3UC9A 1WD7A 1BCRB 4KQ1A 3HG7A 4KE6A 5EQTA 3PHJA 1WMAA 2ONKA 4B6OA 4CMIA 1G291 3I9KA 1TYBE 2JZCA 4BNNA 2DYSE 2PQNA 2Q46A 1K1EA 3H2HA 3Q49B 1SFRA 1ZVMA 3ZYMA 5LPNA 1OUMA 1PZXA 3CWQA 3KOOA 3B78A 1WTCA 4JXKA 3UJNA 2GZMA 2FDXA 5ETJA 2NU8A 5HJ2A 3DDOA 4LDZA 5DGDA 4ZU6X 2RK4A 4MPPA 2J0UA 1VA5A 4LAFA 1ZIYA 1EFVA 2A1TR 2ILVA 2OHVA 1U65A 4UWGA 1OX4B 2ZSBA 2MIIA 3LW8A 4HCJA 4ZXPA 4Q9IA 3R0VA 3AR6A 1YB4A 2RK3A 4NBUA 4ZCTA 5JAHA 1MYOA 2RGEA 3TQQA 3SG0A 3NM5A 5B1AE 4CEJB 1S3IA 1BG6A 1J8YF 1SKUA 3W1EA 1B6TA 4BVLA 3UT4A 4P84A 5IPFA 1U4SA 4BU0A 2VJ8A 3IGFA 3HFRA 4TV8F 3ZLVA 4M0CA 1Q3KA 3QVLA 1PL6A 3EPRA 5HW0A 5KPJA 1JB1A 1VLJA 5CFNA 2QR2A 2HNAA 1D9ZA 1UJ2A 4TL6A 2V0CA 4YJ2A 2WF9A 2HU7A 5LZ8A 1E9FA 2YDXA 2K5UA 1S02A 2MYOA 3O75A 2BTOA 1B74A 4BS9A 3QSGA 3RTEA 2H63A 2RGUA 2A4KA 2PT7A 1CK4A 3RVOA 2JI8A 2QZJA 5CHYA 4DIUA 3ZG6A 5HR5A 1HTWA 1ID1A 1WW8A 4GR5A 3WQBA 3TWWA 4G8BA 1L3BA 1XTKA 4D9NA 3SF0A 4GLLA 3HA2A 2X41A 5EY5B 1B73A 3KS9A 3BXOA 3H83A 4B3HA 1EWVA 1RZUA 2GNPA 2NMVA 2XRYA 3JQCA 2I22A 3AJDA 4J75A 3WGOA 3WISA 2E55A 1ZA1A 4UE2A 5JTTA 3KEOA 4J0JA 3BDVA 3GT4A 4ADSG 1MFZA 3GR6A 5A2GA 3L84A 3CKMA 2OMKA 1OCCE 2Z4RA 1H6BA 4UUAA 2PUEA 1US8B 2BEWA 1U3CA 2P91A 3H3FA 3L7MA 3R6LA 4DLAA 4AP5A 2VDUE 4PEVA 2J3IA 2PCJA 3HG0D 5A6CA 2WWRA 2I2CA 3RU0A 2QMQA 3ZDRA 3GRKA 3DSVA 3TRDA 3QTLA 5JS7A 1GSHA 1I7QB 1GPMA 3RYTC 1QDEA 2FZCA 2DCMA 2O06A 4GSYA 1OOEA 1TUBA 3BILA 4PVDA 3LNCA 1DBVO 4XR4A 3JD3A 1SD2A 3P4XA 5ITZF 3LGXA 3K3PA 1QR6A 4A16A 1IE3A 1XCGB 4POAA 5AK3A 2YIDA 4D0RA 2BF0X 4PLZA 4BQEA 1BCSA 1ZGZA 3IODA 2ODQA 2R7NA 1LW7A 3ED1A 3HA3A 2FW9A 1U0LA 5DLEA 1KEKA 4D6XA 3FZNA 3BE4A 2XA2A 3N07A 4RQTA 4HOSA 4UQPA 2UV8A 2HQOA 4WXPA 4Z86A 1WUKS 4IQGA 3TE7A 4CM8B 5JJ7A 2WJYA 1A8UA 1Q95A 3V42A 4B46A 2Z09A 1GZSA 4ERXA 4HNAD 1IHBA 3GP5A 1EGAA 3B2EA 1JB9A 2AGVA 3PTLA 3W1WA 2G04A 4JL6A 4GXTA 4FNAA 3VZSA 4RBNA 2M1XA 1JDBC 1JEDA 2Q3DA 2FFRA 5C4GB 5JXIA 4R1TA 4IRUA 1W19A 1TNYA 4A23A 2Z5LA 1U9JA 1U11A 3A1DA 1E6WA 1RVV1 2XUOA 1WZIA 3GRPA 2X6RA 5B1SA 4MTCA 3QEBZ 5CT8A 4RCYA 3PFBA 2WM3A 4EI2A 1G3IA 3EVTA 4M7CA 4AXXA 1U5BB 3KYCB 2G9UA 5DB4A 3WGJA 1QG2A 3UAWA 3UJHA 3AO0B 2QMUA 1XNQB 4LCTA 4DJJA 2W0SA 4ZREA 4X5OA 4Q37A 3IOMA 4HDOB 5C18A 3ULYA 4GD3Q 4E21A 2FJUA 1U90A 4HG2A 4F46A 3LPZA 4GVPA 2V9PA 3ZE0B 2VDPB 2C8VA 2NXPA 3K6RA 4NCHA 1R6TA 1MAAA 4NATA 3KR0A 1UXKA 2WAOA 5TQ2A 1S3FA 1TCAA 1Z2CA 3ZUGA 5HOQA 3FPBA 3EBPA 3SZ7A 3TGOA 4GKVA 3B5EA 4ZWNA 3OURA 5AXDA 3IKTA 2XITA 5J43A 4EFNA 5GAJA 4ZOEA 5KNBA 1FP6A 3P9XA 4PLFA 3H11B 2Y1FA 1PLKA 3EC7A 3NDJA 1NZDA 5FUMA 5LQNA 5T3RA 3OE7D 4G4SP 3FP3A 1J5XA 2UWJG 4MQEB 4UXIA 1XZBA 4MRUA 1ZC4A 1IQ0A 1FEZA 4D4MA 4ZQIA 2JKYA 4JOSA 4JBYA 1X8KA 2X13A 3DVLA 4RJKA 4WNYA 3IQHX 1PZFA 4RZHA 4LGYA 4X92A 4EYGA 2ESRA 3RSGA 2CXXA 4JP5A 4QXPA 3ESBA 3ZCXA 2RONA 2IIPA 3A32A 1VYTA 2GTIA 2RGXA 5G4KA 4R9NA 3F47A 3T9FA 5L3RA 1KVRA 3FTSA 1MVOA 1B8OA 2HPHA 3BXGA 4EHBA 1U2QA 1TQ2A 2A35A 1QHYA 3C6ZA 2AUTA 3NIGB 4BCBA 2ABWA 1GUFA 5DULA 2Q29A 4B3RB 4YQEA 4RVCA 1GAWA 1N4AA 3LUGA 3RKSA 4Y2XA 5SZHB 2BGRA 5G1OA 3K15A 1SC9A 2YVKA 1WBBA 4U7JA 4QYIB 1GNQA 3FAZA 4O6VA 4ZZ0A 1YL5A 1O2DA 2P1ZA 5AWFC 1ZD1A 3WIUA 4D8XA 1NC1A 4G97A 1H4VB 1RYDA 2J85A 5GPBA 4D4IA 3DS8A 4NE2A 3G0BA 2OXEA 1H8ED 3RG2A 2XCCA 1RFLA 5HUQA 1XZFA 3OAWA 3H4IA 1GXSA 2PX6A 3O7MA 2HSGA 3SQXA 3P2KA 5AVWA 3KXIA 2JLYA 3D8BA 3NAWA 3UATA 1HOTA 3RJMA 4KOEC 3OUUA 2FR8A 1N32B 3JYQA 4CZ2D 1EFTA 4D6YA 3LQ1A 5EWMA 3BJMA 1TR4A 3NYQA 3QLTA 3VQTA 1E9VA 4W4TA 3GPLA 1MFPA 4FYJA 4HNSA 3WNBA 4QU9A 4QPCA 1JF8A 3UT8A 3QX9A 3QLVA 4BFRA 1XRRA 1XXHB 2ORVA 3KD7A 5G3YA 3C6BA 3KSRA 3OE4A 5EWLA 2PVCA 1C80A 3QVKA 1Y8AA 3R5TA 4QG3A 4BB5A 2BMAA 4LGMA 2XTZA 5CITA 2DLCX 2RHBA 2QLLA 5EE0A 3K7EA 2GPYA 3TLAA 2Q2QA 3H5LA 4MS4B 1NJ6A 3PWTA 3FFBA 5KIAA 3UY4A 4ME2A 5KC9A 2ZAYA 2B1IA 4R16A 4YFYA 1U3TA 4BB0A 3NHBA 2CL0X 1MB0A 3U3KA 1W75A 3OEYA 3VBEA 4JLPA 3WICA 2YIVX 3UYKA 5CIWA 2V6FA 3QXCA 5BN4A 4YDSA 3D8RA 1CUGA 5DLDA 2ZU6A 5AJWA 2UYYA 4M87A 2P9FA 3TW8B 2B37A 5EHXA 4NYIR 4HVAA 2K87A 3ZU2A 5TNXA 4PQEA 1VLVA 3CW2A 3KHTA 3H75A 3K5WA 4K9DA 1JWFA 3H4TA 1ZAKA 3ESYA 5M7EA 2WHQA 5CX1B 2EJCA 1W49A 2GK7A 5HBRA 2C84A 5F1KA 3T5PA 1O57A 5BMVA 4E4TA 4RIHA 3FTWA 2GSDA 3MINB 3KDPA 3GRZA 4MR7B 1CY7A 4G07A 4JSTA 3EE6A 1YUBA 2R2LA 5DIFA 4ZYYA 2ZCVA 1RPJA 1YQDA 1AN0A 3QFHA 3Q40A 2EARA 4W5QA 1LD7A 1D6MA 4H7PA 2ID9A 1UH5A 2OC9A 4B3JA 4MKTA 4OREX 2JAWA 3HVJA 4NL4H 1GV0A 2XH8A 4IDAA 4FI3C 1VKNA 4YR9A 4AS1A 2OP0A 4KAJA 2R2GA 1YR8A 3UUFA 4P08A 3CLRC 3BCUA 2QHXA 3ZPJA 3AERA 1T6YA 2B94A 5AN8A 1ZH2A 4TV9A 1PGPA 1UBUS 2XNHA 4DCOA 4EDHA 3MBKA 4QXOA 3NBNB 1JHQA 4CQMA 4EF4A 3CRNA 4RY2A 1OI2A 2H1IA 4EB8A 1MJ5A 4ZFNA 3S5UA 4GE3A 1GL3A 2VATA 1R8XA 2C07A 3GPCA 5ICCA 4DIMA 3BIWA 3S2SA 3RWBA 2RGBA 3PRHA 5AI6A 621PA 4GWKA 1NFFA 1YCDA 1NI4B 1ETHA 3OC0A 3QI7A 3AUJB 3T7DA 4P86A 2EQAA 1XNGA 4ZV4A 3EVBA 4XLZA 3PP8A 5EIWA 5CLLA 3JWHA 1JXMA 1ZEJA 4XDZA 1MX2A 5ERXA 4LRXA 2P9NG 3TWOA 5DBIA 3K92A 1D03A 1QPGA 1SBYA 3Q6MA 5KYUA 1V71A 1QRAA 2F8XK 4A2WA 3SXUA 3T7IA 2R0QC 4NC9A 2VSXA 1GKLA 3ZS8A 2ZRJA 2OHFA 4QBFA 4PQRA 3IUQA 3USZA 2R6ZA 1PT8A 5JNSA 4KBQA 1APBA 3CIAA 1DGQA 3U0BA 4HNAA 4Q9NA 5FOWA 3BGVA 1R4MA 4TM7A 4HBGA 2GJ9A 4PXAA 1U98A 4Y2RA 4ACLA 4Z4GA 2GD1O 5IDWA 3GJZA 1T2CA 1J49A 2O05A 1SU4A 5J2TF 1MKYA 1C7JA 3H6GA 4TV8A 3KOXA 3C45A 1N6PA 4JVLA 4FB5A 1U3GA 4CTJA 2XDQB 3PGXA 4ZKDA 3H9CA 1YL7A 4R31A 3G49A 4G86A 5JSKA 2G28A 5J3JA 3ZI4A 2OYSA 3D8UA 1I3LA 1CRZA 3GG9A 1KO7A 4NOLA 4A0HA 2JLVA 4RV5A 1QHSA 4TMTA 1I8TA 4Q15A 3AVYA 3K05A 3SP1A 3DEJA 4M86A 4B76A 1H94A 1F2TB 1HTBA 1KZ9A 4HYTA 1PSDA 1HLPA 5FQOA 1O8CA 2PXXA 3SLRA 3GH1A 3UGQA 2PSSA 2AYYA 3A1WA 1EXNA 1PEDA 5FWXB 1ZCAA 3GOQA 4IYPA 4RH1A 3VVBA 2I0FA 3C3BA 3HXPA 1QJCA 2O3JA 4PICA 1TUEA 4DUGD 3HGMA 3QWAA 4BESA 4IDBA 2R85A 2XIJA 4AS3A 5K03A 2JLSA 1DLIA 1NGSA 3I2FA 5BW8C 1Y6ZA 3ZU6A 2V7WA 1AZTA 1K0UA 5HTOA 5LQMA 3BF7A 3RC2A 4OQPA 2WLTA 2MMGA 2ZR0A 2XUJA 4NAVA 4E12A 1Q83A 4O1OA 3FHOA 3IEVA 4YDYA 1XVIA 1XNRB 1CIJA 4PYMA 1XEXB 4U7GA 3OE7A 1XTTA 3RG8A 3UMVA 4BSZB 4KV7A 2K7ZA 1XMPA 4NDZA 3B1KA 2X40A 3FGPA 4ZOLB 2XPYA 3WLEA 3I6YA 4F3NA 4Z4QA 3K2EA 3KQTA 1DWUA 3P4UA 3HYCA 2HPZA 3FI0A 1V4VA 1YS6A 3ITEA 4DNOA 3HXDA 3E1KA 5L3QB 1OH6A 2AG5A 4FHEA 3BERA 5BSGA 1TAHA 2COUA 3JALB 2ZIAA 1JG1A 4B9EA 1Q20A 3AB8A 4JVOA 1N0UA 5K20A 4O2RA 2ZUSA 2FV8A 1X2BA 3DEZA 1BU5A 3TM5A 1MPXA 4Q1BA 3O4RA 4BNGA 5FTPA 4UVGA 3FMGA 4R8LA 2NU9A 3AL3A 3B60A 2QD3A 5JCOA 4N6OA 3IE1A 2CLLB 1HEYA 3ROGA 4ITRC 1T24A 2ZUBA 2APJA 1VP9A 3PVCA 1Y5RA 3L41A 2WW8A 5AM3A 4WKCA 2HGZA 3C1OA 2BFFA 3WB1A 3DGFC 4PGMA 1G7RA 4L0DA 1QVAA 2QSZA 3PBKA 3H8JA 3L7NA 1PK7A 1P7YA 3OZRA 2EJWA 4BLRA 2H2HA 3W1VA 4IWXA 1TPZA 3GFRA 3MTDA 3ISVA 3NBKA 4FYVA 1R5OA 5GJCA 2WWFA 1MGPA 1H8EA 5A03A 3L16A 3T3HA 3ESLA 5KJLA 3H1BA 1WDYA 4MQLA 2ZAMA 1SOWA 1ZNZA 4Y1FA 1N1GA 4A8JB 3ZGVA 3CH6A 1QMGA 4LKRA 2ACKA 4EPWA 1M5RA 3G2SA 1AGRA 1W4LA 2VK1A 4UM5A 4CZ2A 3FF1A 5A7GA 3RV4A 4DJAA 2C1EA 3EYWA 1GQ2A 1FFHA 5D5QA 5TV2A 1A8SA 1ZMTA 1XJ5A 2CSUA 4U5QA 5TSDA 1QUEA 3U80A 1Q17A 2GEKA 4M99A 4PHCA 2NXCA 4UAVA 1ZGJA 1ATIA 5EAIA 4EQZA 3UAYA 4DCNA 3VC7A 4JIMA 4W5OA 4OL0A 2VT6A 3A9TA 5CFQA 3RS0A 4G25A 4IP0A 2M63A 1GW6A 2LUHA 3Q7SA 5C4IA 1DG1G 1T2AA 5B7GA 4BTBA 5IN4A 2G63A 4WE3A 3HEBA 2GETA 1NN5A 1PZEA 3L02A 3G02A 5LP6C 4ZGWA 1YFJA 3JQEA 3OO0A 4H60A 1S2GA 4J7AA 1SBNE 4B2IA 1DIOB 3K0EA 1B93A 3LL7A 4N1AA 3KC2A 4Q34A 1E1RA 3LBYA 3OZXA 4H17A 3AY0A 1J25A 1RLTA 1ILWA 3OIVA 4BKUA 1CVRA 5BSVA 2MSLA 1GUAA 2GMWA 4K9PA 2A4MA 4NCIA 1CT9A 2H2FA 5CAEB 1VIMA 3QC1A 3O8QB 1SK8A 1AE1A 4DV1B 2I7XA 3WKCA 1RYYA 3AF6A 5FO0A 4XYGA 1MQSA 3GCWA 2WFMA 1R74A 2RD0A 2E6UX 3AY6A 2FJBB 1GHTA 2DT8A 3AOGA 1K5HA 4PRYA 3RABA 1ZR4A 2ZIFA 2IWHA 1Y1QA 2IHNA 3AR2A 1SAYA 4BPBA 5BYKA 5L40A 1V2HE 3O90A 2VBIA 4BLQA 4AXBA 1T2NA 4DSUA 2FUNB 3JTMA 2O0HA 3WO1A 3DXKG 3I1FA 3MWLA 2AR0A 4RADA 1JI3A 2JBAB 5B7QA 4GPAA 5IU6A 2JI4A 1K98A 1NLYA 4H18A 2IPMA 1UZNA 1EYHA 5TGTA 4E46A 1BWRA 1IM2A 3NFYA 1KJIA 3IFSA 1GYQA 1S2NA 1YI0A 4RJLA 2ZE5A 4K8RB 4PSUA 4X00A 1ORIA 3U7EB 5AOXA 1DHRA 3WL3A 1ULUA 1O77A 4S04A 4PAWA 1CQPA 4H7DA 4FSXA 1KMCA 3WK4A 3APDA 5CHEA 3R3YA 1N3LA 2ZYIA 3V46A 2A30A 5AHRA 4LE1A 1EA5A 3CZ5A 1ZH0A 4KQ9A 4MWDA 1RC0A 4G4SO 1IY8A 4G37A 2V6JA 4BMXA 1XZGA 4AURA 4L9SA 1K7CA 4DK5A 3ZIMA 4C04A 3COPA 2AI1A 2IEAA 4ZAVA 3B53X 5KTKA 1TNOA 2VPYA 1N6HA 4LERA 1PNOA 4QE3A 2EC5A 5A9SB 3BQOA 1EXWA 4QJ3A 1FYFA 3FOWA 4NOMA 1VJRA 4B7UA 2Q5HA 1M8GA 2PJUA 3L7YA 5K01A 2VBFA 1JLMA 4YGYA 4RMHA 2AJBA 1QE3A 2PGIA 2A14A 4EZLA 4B8WA 3E9ZA 1I14A 2ZZMA 1E3QA 4TSRA 2JABA 2FKNA 4PY2A 2PYZA 2ZUFA 4N3GA 1PGOA 2QOEA 1KFKB 1H2TC 3EGDB 4NFSA 3KZVA 4LVOA 3AV0B 2QRNA 1OC4A 3FOZA 1P7VA 4AROA 5A7DB 2HV9A 4GPMA 1WSWA 3D1JA 5D3QA 3QIVA 3HXFA 1UP6A 1JS1X 3C8UA 2REOA 2OK8A 5DYNA 3OKFA 4WLOA 1C3JA 2ZTHA 2ZI7A 4BNTA 3F2VA 4MQBA 3UM1A 4TTRA 2F17A 1SCUB 3DLIA 1SD5A 3O8OA 1HUQA 4Z7QB 3CHPA 4C06A 3HCWA 3QDNA 4XGQA 1U8EA 3PX2A 1CU1A 3BYZA 1QTIA 4F91B 5A3QA 3O0TA 3DCNA 3L1KA 3F1LA 2VYND 4HMPA 4UI9J 3WA7A 2X0EA 2H7CA 1RP7A 4O1PA 2YICA 4D41A 2VK8A 3ZWDA 3F5DA 2JG3A 5AARA 3MCTA 1AT1A 1I94B 1KA9H 4G0VA 4RNDB 2VRWA 3BZWA 4NH0A 3EXFA 2C95A 3EDOA 1AA9A 4UI9C 2XODA 3QG5A 3ZE2B 1QANA 1R4NB 1CYEA 1SEPA 2RGCA 3KYIB 5KVSA 5G1PA 3D1LA 4K2AA 4QNMA 4G2VA 3HYSA 2DCPA 1FNBA 2WPNA 4GT1A 4V24A 5ITVA 5ICEA 1Z73A 3BCHA 1QAQA 3RV3A 2H7YA 4D7AA 2BEVA 1Q12A 3B70A 1BI7B 5DHPA 3KE9A 3KX2A 2GCGA 2QM7A 5G4LA 3QXXA 3RGGA 4UM8B 1NP3A 5LYJB 2X9GA 5FR2A 2CVQA 1L5HB 3K09C 2H17A 3JATB 2C2KA 3N86A 1U0TA 5AVJA 3HCNA 4YQFA 1NUTA 5IKXA 3GO4A 2WSSD 4LX8A 1ZITA 4QECA 4UTOA 5TS3A 3UV7A 3JQFA 3HH8A 3E32A 3OM9A 4KIUA 4H31A 3SIXA 2QDXA 3IT2A 5EHGA 5IUJC 4C43A 2Y0CA 2DR0A 4BBAA 4X71A 1O9BA 2CJWB 2GD0A 2HBYA 4E4RA 4BERA 4IEFB 3GLGB 3KZ1E 5F7XA 3U4IA 2Q2VA 4PPQA 1BMQA 1E3DA 5KYWB 3I6QA 1FXUA 4WKOA 3UVEA 3B2NA 2AZXA 1E7WA 5EI5A 2R1UA 1IUNA 3K0SA 2W4IA 1ISFA 1WHTB 2OKCA 1E64A 4OX9B 1EWQA 2ZBGA 1JG6A 2CFRA 2YOFA 5B7NA 4DRXB 2ICAA 4IGFA 4GMXA 4MSUA 2NZVG 4UCXA 2R6CA 4J2OA 2DQKA 4JD5A 3LZDA 4BWGA 4KCGA 3K30A 2GYYA 2D7CA 4ZQCB 4FGKA 1WULS 3JY6A 1KKUA 4RTQA 1MH9A 4HOQA 4FKBA 3N70A 3Q75A 4IFTA 4OPMA 1T15A 2XW6A 3AW8A 5FUYA 5D3KA 1XJWA 2HA2A 1MUUA 2PO5A 2P9JA 5JXWA 5TJHA 3NBZC 1JG7A 3WDKA 1C1DB 2GBIA 4KFTA 4RZSA 2Y1CA 4UEKA 1JMYA 4CHGA 1K6EA 2BHNA 2ZWVA 4FVTA 4NX2A 1X1SA 3K9HA 1ZU5A 3PJDA 1K06A 1MU0A 4NRDA 3EVEA 3MQ2A 4HGQA 2P27A 1Y6JA 2PGOA 2HMUA 4ZOQI 3ZHQA 1GNSA 4CT5A 1NKVA 1U8UA 5DEOA 1DAOA 1NHGA 4P83A 2ATEA 3OOSA 3A4YA 1USGA 4FFBA 5FLXA 4B71A 4FYHA 3ZZUA 5LQRA 3AKCA 3HDYA 3L1HA 1RJ9A 4CF4A 4L23A 4Q7KA 1Y1TA 3BGIA 1N11A 1BIFA 1YBVA 5DBEX 3VDXA 2XEEA 1I7SB 1U1EA 1RYMA 4ZMRA 2WXNA 3AIIA 5JR3A 1ZCFA 4A7PA 3C70A 2UZ0A 1OVGA 2VWPA 1UPTA 1LX7A 1DQYA 1FUUA 1FDVA 5ECGC 1J2RA 5HQTA 2ZR8A 5K9ZA 4TTPA 1FQKA 2ZRCA 5IVDA 3VDQA 2FN3A 4I5DA 5G1NA 1JHOA 4IEIA 1DIHA 4L4YA 3LCRA 5DTMA 5B3SE 2X0NA 3CZMA 2BF7A 4U7TB 4APFA 4BDSA 3EXG2 4KNVA 3AM1A 3GJQA 3U39A 3DQZA 1HETA 1Z15A 1RM4A 4OY3A 1E9BA 4M21A 1V8PA 2CCGA 1MEOA 4HPXB 1Z5NA 3AXTA 5ENQD 5HQ3A 2Z08A 4EKDA 2WSLA 1UMCB 4HQOA 5TS2A 4IG9A 3L22A 3FH0A 5HFJA 2C00A 2WJPA 2XVZA 1MX3A 4BX3A 4QGSA 4LA4A 3QV2A 2QU7A 4KWHA 3EWIA 3TNLA 3BA6A 4TL7A 1FX0B 4AI6A 3D7SA 1O0SA 3LX8A 4TROA 4ASUD 3C14C 4HQFA 3UMRA 4DE5A 1I4TD 2H48A 1UWCA 2R8EA 1LDNA 1VBNA 4JI7B 5G55A 2AOUB 2QYOA 3SNXA 3FTDA 2CEKA 4UUCA 4R54A 2R5WA 3NMUF 3QZUA 2CJYA 2QTMA 5TQVA 1QP4A 4NG4A 3SEZA 3GRVA 4KR2A 2AOWA 2PR2A 4X8OA 4RS3A 2WBLC 1XZHA 5JRJA 3BU8A 5CBPA 4W8GA 2V55B 2FRXA 3ROTA 1IY2A 4AW9A 4HAZA 2C57A 3SVLA 3N2KB 3A9RA 1C1XB 3KB1A 2J4CA 3E81A 4BX8A 1K4KA 2BMEA 3JRNA 4I5IA 4FWIB 1P44A 1Z5PA 1CQJB 4ZEMA 1RXVA 4AJKA 1JHMA 5IBQA 2ZXEA 4TOIA 3QHPA 3T0FA 2CMDA 2YBEA 3Q2KA 1OKKD 3ML9A 1ELWA 2B0CA 1FSPA 1PR3A 5ANRA 4G85A 4RW0A 1R66A 5H02A 3WWCA 4AZ0A 1E8XA 1FXWA 3V7NA 1XWWA 2Q5OA 2GWHA 4K9MA 4JH0A 4RMJA 4XFJA 3G0GA 3C8HA 3LTEA 5K3EA 2ATXA 3KTAB 1DRKA 4XD2A 3WTBA 5CVTA 2QMZA 3HR7A 2GBGA 3VSBA 1NPTO 1H2UA 2XMGA 4KGDA 1A4IA 5ILGA 2PT6A 4EJSB 3SC6A 1HE3A 5DM2A 3L06A 3UTMA 3JVEA 3WRXA 3O93A 1BN6A 4YLGA 3W4JA 4US2R 4K05A 4C7KA 5BR1A 1QHFA 1BJKA 1OYWA 1PGNA 2QVLA 2W2TA 3R7BA 5H3HA 3QB2A 2GRLA 2BPOA 1GYRA 3RYHA 3ROZA 4HDNB 3PCXA 5JDIC 3G0IA 2QTBA 2FMUA 5K0TA 1ST3A 1F0KA 1JHDA 1P0PA 4UYJA 4LMBA 4BEBA 3ZW3A 2Q0SA 5EJMA 4C07A 3RYCB 1UEJA 5DEIA 3K72B 4EUFA 4X90A 2ZWAA 3RI3A 4GUAA 1HR0B 2VYNA 2ZS7A 2BLNA 4D9HA 2A8YA 2IY7A 2XAAA 3C98A 1NJ8A 3FNBA 3DC2A 4FYPA 4X0EA 1IM8A 4FHCA 4MARA 3EXEA 3Q15C 1OFHA 4QRIA 2H6IA 4QPNA 2EHDA 1D04A 1I30A 4J1NA 1CLEA 1HKHA 1MOSA 1R8QA 2H4WA 4P7FA 3G2UA 2QQFA 1KQPA 2PQRA 3LA6A 2HJRA 1YZFA 2JLUA 1Z38A 1N2XA 4ZEWA 3UJBA 4KYOB 3F5SA 3JCKC 2FG7C 4P58A 2AD1A 1PE0A 2GZ1A 1IKND 4EGAA 3AUAA 4RVFA 1ONNA 1VGQA 1WXWA 1T36B 2H3HA 2Q3CA 1QMOE 5CD9A 5AKIA 2V6MA 3GHYA 4PLCA 1V9LA 5KZMB 4OMCA 5HILA 2PSDA 1T35A 4JZYA 3HB4X 3HKBA 2ZOSA 1Z4JA 5HXAA 4QLBA 3KL2A 2IRWA 4AUKA 2WSSA 4IW3B 1ZK1A 2V9CA 3WLPA 3HRHA 1L7VC 3WZ2A 1CDEA 1QKJA 4LOLA 1U7UA 4E14A 1IJBA 4QU8A 4PZDA 4PSAA 1IWOA 1NW9B 1UM9A 3UXMA 3DA8A 1OR8A 4EDFA 1HLDA 2W48A 1O03A 2R2AA 2GYUA 3I9OA 3UUGA 3KYBA 1FMLA 3VPGA 2VR1A 1JR3E 4RHCA 3SQMA 3DQPA 3DSTA 4OB6A 3NBMA 4GA0A 4WOCA 4B85A 4TQUS 1QZXA 5H81A 2HSDA 3G7NA 3VR6A 2NU7B 2GARA 4DXDA 2N47A 4GX1A 2OM6A 2C96A 4LY9A 1W94A 1CVLA 3OWHA 3CBQA 4B82A 2FPPA 1VZ2A 3LY9A 1U0SY 1B3RA 1QONA 1WNFA 3ECAA 2ET6A 4MQFA 1E5DA 4GA2A 3DULA 4KRXA 4KWIA 1IY9A 4DANA 3JWJA 5CRVA 4LY0A 3QWHA 2OHJA 2BUCA 5B1BE 4LYAA 4EPRA 3RK6A 1KZ1A 3MLAA 2ID4A 2JFVA 2I1VB 2Y2UA 1WHSA 4MWTA 2EIKE 1SXGA 3Q0TA 1QGYA 4DCUA 2D7DA 2OZVA 4HEJA 3CRW1 4HB5A 1N2CE 1IQRA 3EWAA 3Q9SA 4NFYA 3MJDA 1G8MA 1ZM4A 1JH8A 4IBOA 4J8SA 1XZQA 1IEQA 1V6AA 4CDNA 4C88A 5IYZF 2PZ8A 3WADA 2EFYA 1NUQA 5BT8A 1KRWA 2W5UA 5EKSA 4JI5B 4LJ7A 3EUWA 4AK9A 3UKRG 3WLOA 3IVRA 5HK9A 4KUHA 2LSVA 4YECA 3NHJA 4WFQA 3MLEA 2ZSJA 1CE8A 1QGUA 1NM5C 2CFZA 4UOEA 3G8BA 3EXG1 5ELXA 4F3KA 3AVUA 4I81A 2QGZA 1PQYA 4TKVA 2VGYA 2OCXA 2DVWA 3LC2O 4F4DA 3OPYA 5F1PA 1WVMA 4TXHA 1VIDA 3TMYA 4KVMA 2YWJA 5THQA 1XZMA 4I66A 1EBUA 1P2UA 2V3CC 1XX6A 2JGMA 3E7PA 2O4CA 1ABFA 4KAAA 4ESEA 3NAQA 3MOIA 4DDVA 4EENA 3KK0A 3HDTA 4I9GA 1HEIA 2CJFA 1CY2A 4HLDA 5CNKA 1YOVB 4MKGA 2VOJA 1RZVA 1UC8A 5CDUA 2D7JA 2QF7A 4YYEA 2I8AA 1DARA 5KWJA 2DY0A 1H2YA 1KOJA 1DI0A 4GNRA 4L57A 1T5LA 4O5AA 1JN0A 2HU2A 4NWIA 4ETMA 4I1AA 1HBJA 1L5JA 3A37A 3JQ9A 1W25A 1X1RA 1E94E 2GR9A 3FPEA 1L5ZA 2C61A 2CLMB 1L4FA 1PFQA 2KLHA 1T8YA 5FQ4A 2W58A 3I37X 1RYNA 4ASUA 2V7PA 1Q0ZA 2IPNA 3U3JA 2R1VB 4Q3EA 1TAGA 3H4MA 1GUDA 4ANFA 1EFCA 3OCYA 3C3PA 2XEHA 3QM1A 2JFFA 1DC2A 5A0FA 5LBUA 4WNEA 3PE3A 3BDIA 2ZS8A 3KBOA 1TM4E 3EOAI 3GD7A 3K5PA 1CNFA 3AINA 4Q5IA 3H5IA 4Z1MD 5H3CA 1UINA 3B6JA 4OAOA 3CSSA 1L4YA 5K0JA 2QUIA 3ZHTA 4B2YA 3MELA 3P9QA 1RMQA 2NTEA 3AG3E 3NBUA 4OQQA 3QEMB 2WM2A 1W5SA 4QUGA 4HFRA 4HGOA 1P2VA 2OCKA 3R74A 4PNZA 2AX3A 1PQPA 2JASA 3QYFA 5A4FS 3ERCA 3VC1A 2OBBA 3HFSA 5LQCA 2JLBA 4CKEA 4PX5A 3I0ZA 2QX7A 3SQWA 2EF0A 2WIDA 2X1HA 5J23A 3V3KA 3MILA 2IYNA 1DRUA 2ZUDA 2CFCA 5IZCC 4MLCA 3ODPA 1E0JA 1QIFA 4PRLA 521PA 1E2GA 1OKKA 1NMSA 4XGIA 3OWXA 1WZ2A 3DH0A 3ADOA 4RD3A 3NNNA 2F9FA 1Z3IX 5AOCA 4AY4A 4GFDA 3TXMA 3FNIA 3S1AA 2LKCA 4S0XA 4B5LA 3RVRA 4PIPA 3G1TA 2Z9BA 5K4AA 1XDDA 3FMIA 4PTLA 2V3VA 3P9KA 3LTNC 1MX6A 3ZHYA 4DOMA 3OLXA 3D81A 1IIBA 1T13A 3W7AA 3B6MA 3GRCA 3EXHC 3VOTA 1CXZA 2QRHA 3EGIA 4LDNA 2BDEA 3AILA 1ZD9A 2IEDA 1AX9A 1FP4A 3H3XA 3SBDA 4FT4A 2FJAB 3DV0A 2V98A 3O2SB 1JQBA 4D9EA 1RWQA 4K86A 1EE1A 2UY1A 1VPEA 3GUYA 3MNFA 1UG3A 3RASA 4MS3A 1ABBA 4MCAA 4W82A 4B09A 2OT3B 2EFGA 1PFWA 1IY1A 1Y7TA 2FWPA 5T6MA 4MIEA 1UKVY 2P3SA 5ENZA 5FTKA 2HHJA 4DWOA 4NJEB 4AJIA 2BY4A 1NBWB 3STUA 1NSFA 3MUNA 1VHLA 2HDNB 4MBGA 2D5IA 1F06A 3NPMA 3ESCA 1I3KA 1TVCA 1IN1A 3DFUA 2C9MA 2JIDA 3QTTA 1FDWA 2PL3A 4N5CA 1A17A 4DSTA 2JFYA 2P65A 4ND1A 3HCCA 3Q8WA 3VH4A 3R0XA 3L7OA 4CUZA 3PHIA 5D3MB 5G0UA 3OBIA 2SCUA 3KVVA 3ZV6A 4FM9A 4N6NA 4QFBA 3P2JA 1NQ5A 3IIEA 5I9NA 2AN3A 4F04A 1UKZA 3PHLA 2NXNA 1PO7A 5C7LO 4Q9LA 1UBGA 4Q1FA 2NG1A 1MO2A 4CM3A 1JSLA 5C8XA 4FYMA 2Z8YM 2R62A 1XE3A 3W8EA 1KDOA 1M0EA 2IS6A 3FB4A 4WA8A 5KNDH 3LZ6A 2LCIA 5ALHA 3IT1A 4WBNB 3C5HA 3ZN2A 1IUPA 1O95C 2ZR7A 1II8A 5BSKA 3T8YA 3KUCA 5DKFA 3ILVA 1AZWA 4KO1S 3AGPA 1P5ZB 4DJDC 5KNCH 3QARA 2BMVA 4BMDA 1J99A 3V8EA 1DVPA 2PGJA 1C1YA 5CCEA 4AKXB 4J7UA 3LBIA 3CC8A 1ACMA 4TLMB 5HQJA 3UJPA 3DWIA