4GYWA

Crystal structure of human o-glcnac transferase in complex with udp and a glycopeptide
Total Genus 281
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
281
sequence length
715
structure length
695
Chain Sequence
PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKHIYDNRIVLNGIDLKAFLDSLPDVKIVKNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 281
structure length 695
sequence length 715
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gywA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gywA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gywA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gywA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gywA03
1XC7A 4GYOA 2R4TA 1NA0A 4HLNA 3H4TA 3MS2A 4B94A 4WADA 2R5SA 1WUYA 3HYMB 2XGMA 4WNGA 2VQ2A 5D0QD 4G26A 5TMBA 2VGYA 1Z62A 1H5UA 4U07A 4EL5A 3BCRA 1L5QA 1PSWA 4EKYA 4G1TA 5HXAA 4UI9J 3BCUA 4BTBA 2Q6VA 5EX0A 1E96B 4J0UA 3ZN3A 3QDNA 3QKYA 3L7BA 3R9AB 3G2NA 4UI9C 4GZ5A 1ELWA 2R4UA 3IA7A 3MTAA 2X0EA 3D0QA 3VDMA 3CV0A 1KTIA 3T3GA 4GCOA 2BUGA 1IIRA 3LY8A 1HXIA 4GPKA 3EBPA 3Q49B 2AV6A 4BQEA 5TMDA 5KJNA 3NAZA 4MICA 2QN3A 4LEIA 5DBKA 4ME2A 3ZCPA 3CKBA 4RIEA 3S7DA 1PNVA 2MHKA 3IEGA 2FO7A 1Y8MA 3QWVA 4U0SA 4JA7A 5FTPA 2FF5A 5G05J 2QRPA 5JJ6A 1WW2A 1L7XA 3RU0A 2ACVA 2NC9A 1VGVA 2BFWA 1V4VA 2JLBA 3WAGA 4BTAA 2VCEA 4M60A 3E4BA 4G25A 1BX3A 5LCWC 2X0DA 4GYWA 5KJMA 4LDPA 3CK8A 2UWJG 3U4TA 1NLMA 3C48A 1FC0A 2GM9A 2XMPA 3OTIA 5I45A 1NOKA 3UPVA 2QN2A 3COPA 6GPBA 4KQ2A 3MRVA 2PQRA 2QN9A 3RSZA 2KCVA 2PL2A 7GPBA 1P2GA 2QRGA 3MRXA 2QLLA 3WXXA 2AVPA 4WNDA 3HBNA 1JIVA 2F3UA 5LQDA 3ZFWA 2WQHA 4UQZA 2QRHA 4KXKB 1NZFA 1NOJA 4NESA 4N39A 4BFCA 1RZVA 3CV3A 1OUVA 3GUHA 5FJYA 2VG8A 3ZCSA 4GA0A 5CCLA 1Z8DA 2IV7A 2BGTA 3UUXA 4HOTA 1HLFA 1KLXA 3D0RA 2OFFA 1Y8ZA 1NOIA 2J9QA 2L6JA 5FZRA 1RRVA 3UYKA 4JA9A 5TVGA 2X6RA 3HBJA 4XI9A 2XA1A 3SZ7A 3OY2A 3PE3A 4AMBA 1FCHA 3RJVA 3TOVA 4X7MA 3WC4A 1GG8A 1FTYA 2DBAA 4EQFA 3VTXA 2ASVA 3E3NA 4PQGA 3RKVA 3C4QA 1FS4A 1NZDA 4GZ3A 2PRJA 3KD7A 4MI6A 4BWRA 2YQ8A 2GEJA 1C8LA 4ABNA 4CGWA 2QNBA 5HI7A 4J8DA 1P29A 4AY5A 2BISA 2PYDA 5JJTA 3D1JA 4WACA 5ARGA 3QWWA 2QLNA 3RO3A 3T3EA 5FT9A 1JG7A 1NVKA 4MI9A 3Q15A 2AZDA 4G2VA 4N3AA 5D0OD 3ZHEA 3VUEA 3Q4AB 1XKXA 1E4OA 2VGXA 4N5CA 5KJKA 1GPYA 1L5SA 1NZNA 4UI9K 4AMGA 2FFRA 2C2LA 3TSAA 3DDWA 3L7DA 1W3BA 4MI3A 1K06A 3ESKA 1UQTA 2WTXA 3MTBA 3ZCQA 4N2SA 2IUYA 4GYYA 3MT9A 5G04J 4RENA 2PQ6A 2LSVA 5DLDA 3MV2B 4J8EA 3MS7A 4I2ZA 4KQ1A 4J8FA 3GW4A 1SXQA 1Y6GA 4BQIA 3ULQA 2OOEA 5G04C 3TAXA 3CVLA 3OT5A 4RBNA 1LWNA 2H1HA 2G9VA 2AMVA 2C9ZA 2F3SA 4X7RA 3OKCA 4RG6A 3FROA 5AYWD 4REMA 2IW1A 1L5WA 3S7JA 4HOUA 5CCMA 2IV3A 4G24A 5HQ8A 3OY7A 4XI0A 3U3WA 4KBQA 1C3JA 1GZ5A 3CX4A 2XGOA 3ASFA 3ASHA 1FU4A 1QKJA 2HYZA 1FA9A 3MSCA 5M72A 2GEKA 1KT1A 3QOUA 2QLMA 1IHGA 4WNFA 4F9FA 3BDAA 2KCKA 2X0FA 2ECPA 2F3PA 4AIFA 4EL0A 3BD7A 3MEKA 1FU8A 4BT9A 2R66A 4O6FA 1WM5A 5JJ7A 2XPIA 1F6DA 3DDSA 3QKWA 1XL0A 5DU2A 4WNEA 5IKOA 3NF1A 3MBOA 3PE4A 3AS5A 2YHCA 4MHOA 3Q3IA 4F96A 5G05C 4WUYA 2VSYA 2IEIA 1YA0A 2ATIA 4N9WA 1E1YA 4GZ6A 3O48A 1NA3A 4JL0A 3CVPA 4YVOA 3OTGA 3ZCTA 1ZU2A 3GPBA 5TMEA 2BGUA 3G2LA 3OXGA 3PDNA 4H7YA 2GPNA 2ZB2A 4N2QA 3LY9A 4F97A 3S2UA 4GPBA 3CEMA 3O3CA 1GFZA 4GA1A 2QN7A 4MRAA 2C0LA 2R68A 3CK9A 5DIZA 2KCLA 3MA5A 3HBMA 2QZSA 4L22A 1WV1A 1JIUA 3CUTA 3NP9A 3H4IA 3TG4A 2PYIA 3DZCA 2KC7A 3WADA 2IYFA 3CK7A 2R60A 2PRIA 3EBOA 5ARFA 2C0MA 2FI7A 4CDRA 2XA2A 1K08A 2JJMA 3JYSA 3RHZA 5JTTA 3CEQA 1ZBPA 2WPVA 4X6LA 2C1XA 2FETA 9GPBA 1WUTA 3FFLA 4IN3B 3MS4A 1XL1A 5BNWA 2YJNA 3S7BA 3T5TA 1YA6A 2V5FA 4GA2A 4YI5A 4HOQA 3G2IA 4AM9A 3QWPA 5C1DA 3ZGQA 2UY1A 3L01A 4HORA 3SYRA 1O6CA 4XIFA 4KQMA 2GJ4A 3GYZA 4U0ZA 1HZ4A 2IFUA 1P4GA 3Q3HA 4F3VA 3MT8A 1QQEA 4NEQA 4BQFA 1SXPA 3MKRA 4U0UA 1WW3A 1C8KA 4WHMA 1L5RA 4RELA 1YGPA 3SYMA 2P58C 1WAO1 3ZCVA 2PQNA 2IEGA 5EX3A 1FU7A 4HWGA 3N71A 5CHEE 3KAEA 2HR2A 4YNDA 1P4JA 3BD6A 3MQFA 4Z5XA 2GPBA 4YVQC 3VTYA 3VDNB 2G9UA 3G2KA 2FEZA 2I6HA 2FBNA 2GT1A 2G9RA 3KS2A 4N3CA 1P2DA 4U04A 5EKQD 3OXFA 2GPAA 3K9IA 4UQXA 1GPBA 3SF4A 2Y4UA 4Y6CA 5FZQA 3LYAA 2VSNA 4X7PA 4I9CA 3VUFA 4MHSA 2C4MA 5ENZA 3CUYA 3RT1A 2KS6A 1L6IA 1JIXA 4QLBA 1B4DA 1F0KA 2XGSA 3G2HA 3T3IA 3MT7A 4CGVA 3CEHA 3UYLA 3OTHA 4AN4A 3LY7A 5GPBA 4I9EA 5IKPA 4JHRA 1QZ2A 3NB0A 3Q5MA 4A1SA 2ONDA 1P5QA 4M83A 3OKPA 4W9RA 3L7CA 1PC2A 2VYIA 5LCWJ 4KYOB 3QHPA 3LKUA 1ELRA 3S0JA 3L79A 3ZHEB 2IYAA 2KATA 4I1AA 4BT8A 3BCSA 4G2TA 3RO2A 2Q7FA 3E3OA 4NC9A 3ZCRA 3NP7A 4YUAA 4RIGA 4EKEA 5BT1A 2QFCA 4LEUA 1C50A 1PYGA 3C4VA 4CTNA 1J39A 4EJ2A 2XCBA 4RIIA 3NC4A 3BD8A 1UQUA 4AY6A 3CUVA 3T3HA 1IXYA 5DXFA 2G9QA 4NQ0A 3NPAA 2XCIA 3CUWA 1WV0A 5JTUA 1Z6PA 2O6LA 3AS4A 1GPAA 2F9FA 1XV5A 3E3LA 3LPZA 3Q47B 4UQYA 4APOA 1XOIA 3FP3A 2LSUA 4W6QA 1FTQA 3ASDA 2QRMA 3CUUA 3G2JA 5KJLA 2ACWA 2HY7A 2UY1B 4RIFA 3T3DA 3URZA 2LNIA 3NCHA 3S29A 4CTOA 2PZIA 4RG9A 4FZRA 1XNFA 2VGXB 2XA9A 3BEEA 2C1ZA 2QN1A 2SKEA 3OKAA 3T7DA 3S7FA 2VCHA 3ASGA 3L7AA 3FWVA 4G23A 2XCUA 1KT0A 1Y6FA 5BW8C 3DD1A 3BEOA 3CVQA 3GZ2A 2E2EA 3OXLA 1QM5A 2QRQA 3MRTA 3IAAA 3S27A 2QN8A 2JZCA 1ABBA 1RZUA 4FKZA 4GCNA 1A17A 3CKCA 3UQ3A 1JG6A 2X6QA 4RIHA 1HH8A 1LWOA 3HBFA 1EM6A 1FTWA 1PN3A 1TJCA 1Z6QA 3CVNA 4N3BA 1P4HA 2Y4TA 3RIBA 2P6PA 3AMVA 2GW1A 1IYGA 5A7DB 2SKCA 3RSCA 3MTDA 8GPBA 3TGOA 2AW3A 1AHPA 4I2WA 3TG5A 3Q3EA 3S28A 2IF4A 4NRHB 1A8IA 1UZUA 5D01A 3LCAA 3MV3B 2SKDA 4M7PA 1GGNA 3EDTB 4YI3A 1M5RA 1EXVA 4Y6WA 2H1FA 4I17A 1L5VA 3ZCUA 3ZPJA 4HOSA 3AS8A 4CTMA 5D00A 2F3QA 2XCCA 1B89A 2XEVA 1AXRA 2FF4A 1P2BA 5FZSA 2HO1A 1JEJA 4H7XA 3CEJA 5A6CA 3GZ1A
chains in the Genus database with same CATH superfamily
4GYOA 5A4FS 1BVYF 2B5WA 1EDBA 4B94A 1PLJA 1XQ1A 2Q5QA 5KTKA 3OQNA 4R41A 2I3BA 5A9SA 1GITA 4HLLA 2NADA 3A14A 4G0XA 621PA 1TRKA 1C9EA 3JX9A 4G26A 1YRLA 1Z5GA 2HLDA 5TMBA 4D3ZA 3DSVA 1RXWA 5E2AA 1RC1A 1YU6A 4JD5A 4PPYA 4KQCA 3FUHA 5JDIC 4RH1A 4E2WA 4Q4LA 4DEYA 2AN4A 4WLEA 3DE2X 3FLBA 3PNTB 4W5TA 1XNJA 5F33A 4J0UA 3KQTA 1T0HB 3Q9UC 1HYHA 2QA5A 1U0OC 2WUDA 2XVAA 3AIOA 4O2AB 1KI3A 1WU8A 3MC1A 2G4LA 4UEKA 5K3SA 5A6SB 5IKEA 4TYWA 2XWJI 1W4ZA 1R8JA 2G88A 4HLUA 3PFCA 3SYNA 3EGVA 2QRZA 4H9GA 1E4VA 5EJ8A 1GNQA 3NWPA 4LRYA 1JA0A 2VUHB 4IDPA 3TX6A 1Y4ZA 1LSUA 1HEIA 1HY3A 4XJXA 5ALDA 1QUFA 5L3SB 3W7AA 5IHPA 3DSTA 3LPAA 3WWOA 3Q4GA 5KJNA 1FY2A 4IUDS 3EJNA 4TQUS 1P9OA 2GAOA 3A31A 2FFQA 1R0SA 2CNOA 3GZNB 2JFFA 3PWZA 4JJIA 3L43A 3EEIA 4IO0A 2JJ8A 2VUIB 5KQMA 1Z7GA 4I8XA 3WIDA 3QWVA 2R8PA 2WIJA 4DLBA 1LPMA 3KZXA 4XQ9A 3NX4A 4TKUB 1V8DA 3K8ZA 5AI5A 1W0KA 4F9EA 2Z95A 2D2XA 1LU9A 4Y6PA 4FYMA 3OUTA 1VGVA 1SQMA 4W82A 3TRJA 2WW8A 4D3YA 4EUNA 4YR9A 2BEKA 4Y1RB 4D8VA 2E2WA 2GRAA 1O97C 3N87A 5IDWA 4KE9A 1I7LA 1W0KD 4BGEA 5M34A 5IRCD 4YRRA 1WDKA 5H82A 2MINA 2AG1A 5IEBA 4FFDA 1DC4A 1JB1A 4QUIA 3UPVA 3OU7A 2HMUA 2ERYA 4WTOA 4YCBA 1W19A 4ATZD 1G3IA 3IPRA 5EXDA 5G40A 3T95A 5A2GA 2QRGA 3MWYW 4DDMA 2PO5A 3HEMA 3IVMA 4IDGA 5DNDA 2WZQA 3ELYA 3ESAA 4J16C 1ODCA 5GGYA 1A5EA 2E5WA 5DXAA 3ZDRA 4Z54A 2XQGA 4B8WA 4L5IA 1T4DA 3OE7D 1LBIA 2A4KA 2WYOA 5EMMA 4DADA 3ZFWA 1B6GA 1EK5A 1TPYA 3PNPA 4B0PA 4DQVA 1GSHA 5LBIA 4CUZA 4AJ2A 2L42A 4Z9BA 1IHXA 5JWHA 2R7NA 1F17A 5FI0B 2VOJA 4DWJA 2J07A 2NZUG 2G6TA 4TRNA 1J0XO 1D09A 5BWBA 5ECDA 5IYZF 2PFGA 4YAJA 2WIFA 5LZ8A 1PSZA 4C4AA 3KDAA 2FJDB 2IY7A 3C6ZA 5KI6A 2BGTA 4GD3Q 2BFOA 4R98A 3ZHBA 2YIDA 5IG2A 3PJRA 4XEIG 3V4OA 5FP0A 1YZKA 4NK4A 2QTCA 5AM4A 3WHKA 4DSZA 1JALA 4JVMA 3RAEC 1GN9A 1Y8ZA 1JMYA 1E3TA 1V6AA 3IBTA 1AN9A 3UYKA 1UIRA 2R65A 2HT6A 3B1YA 3GJ8A 3LL7A 4N9QA 4X44A 5AKYA 1CRZA 3F5SA 4D9EA 1SCDA 3N3AC 3P4XA 5D3MA 1OFIA 4Z53A 2BMDA 3PEUB 2GNAA 3SZ7A 2ZUWA 3AOEA 3OY2A 3UA3A 5KU1A 1BU9A 3MMXA 2EP5A 1FMJA 3PG5A 2XRFA 3MBKA 2WU0A 1TU0A 2WU8A 4PO3X 2IWHA 3DHNA 3GJSA 1SR8A 2ZYIA 4EQFA 1EFVB 1Q7BA 1T2AA 1ZIYA 4MWBA 5CRIA 4GAEA 3RAGA 1A04A 4DIBA 5B30A 3WBFA 2GCGA 1E18A 1IHPA 4GZ3A 2Z3WA 1YQ9A 1VL1A 1P1CA 2YQ8A 4EECA 4DW8A 4K7JA 1EFCA 2Y6UA 3CLRD 4ZMRA 1JAYA 5HCUA 3V30A 3RS4A 1AK1A 1MABA 3UWKA 3QV2A 4ZMBA 3W79A 5A5VA 2QNBA 5DM2A 5HKAA 5IXSA 4ANWA 3DNMA 1IWPB 1WPQA 3OBBA 1P29A 1PLLA 1IZZA 1JAIA 1BEEA 4K9KA 4RM3A 3U1TA 3WK8A 2BUBA 4KBFA 3D1JA 4KR9A 2P1DA 1GQSA 5TQVA 5CEDB 4M1WA 1PF7E 3N2IA 4XQ0A 2ZWMA 4HV4A 3P9ZA 4JL8A 4C20A 3JCKC 1Z74A 4AO6A 3ETLA 4B35A 1KYIA 3ZV7A 3V8VA 1BXRA 4G2VA 4CLXA 2VDQB 3K53A 4EY8A 3USCS 1VL8A 2FFGA 2C9MA 4NNPA 1YO6A 4JI7B 2VGXA 5JZBA 2QTNA 4IW3B 1UAGA 2EZTA 2H1VA 4NAUA 4ONEA 1N2EA 5B3JA 5JS2A 4YV2A 4X85A 1A7UA 4AY3A 3VKGA 5CCBA 4A0GA 3RHFA 4NRDA 3E61A 4YCNA 3O8DA 3DKKA 3ELDA 5FNVB 5DSXA 4CETA 5F23A 1N6RA 1IXSB 4LKOA 2REBA 4ZOEA 3QVLA 4UUMA 2W98A 3EOZA 2LCIA 1PFGA 2I2AA 3AOEC 2HF2A 4JUDX 2IUYA 4R01A 3BXZA 1AA6A 3EB9A 2PX0A 3HU3A 5BMOA 2Q5CA 4I1MA 2WFLB 3DVLA 3PT5A 4G63A 4FZVA 3BMCB 3H1EA 3UWMA 1DIRA 5K4HA 1ZAYA 4BNWA 4IGKA 1XXHB 4S35A 5AKIA 2YWBA 1NUHA 2D8AA 1A96A 1GEEA 3LUDA 2AWNA 2QK4A 2A0WA 3VU1A 5DULA 3TAXA 1BEZA 1T9KA 3ZKWB 4NZ9A 2X7XA 3DE7X 3FPCA 1Q15A 1N4PA 4ZI7B 3DV9A 3K71B 3U16A 3PCRB 1LI5A 3EFOB 2ANBA 1I6WA 1JWBB 3U7EB 4X94A 4W7SA 2CFSA 4REMA 4EHIA 5LBUA 5MFPA 4CT4B 4ZCLA 4FXPA 4RVHA 3DC7A 3L8GA 3TG8A 3L18A 3TRKA 5JQGA 3AUTA 3UAVA 4G1VA 1BU5A 1DKLA 2XNDA 2CYBA 2YICA 3D64A 1XXLA 3EAFA 1ZDMA 2Y92A 4KI0A 3ZWXA 5LDDC 4MLCA 4V0NA 4PSUA 3CX4A 1BOOA 3HY6A 5A3JA 5HM8A 1QV9A 2AK2A 1GAQA 3C5EA 2FN9A 4QODA 4DFDA 3A1VA 3T8MA 3PDIA 4H7KA 3EASA 4KO8A 3VR4D 1II8A 4ZYUA 2IH5A 3VI4B 1DFIA 2E4XA 2A1TS 1TF7A 2OC9A 4P7GA 2CMHA 1A95A 1X42A 4JLDA 3V6LA 3BDAA 3EGDA 4G4SP 3N70A 4NATA 1VKNA 4PLGA 1DE0A 2DVMA 1SIOA 3KKOA 3LECA 4LDZA 4OQZA 3ZIAD 1ZR2A 4Y1EA 2XODA 1AK9A 2A6PA 2B8TA 1FMFA 2ETBA 2CUNA 2XVYA 1T1JA 2AOTA 5K0NA 4JBGA 4LOHA 2J5BA 4ZPJA 5EAIA 4BV9A 2E1PA 5EIAA 5HRCA 3GMTA 1H9AA 2O5RA 3ZHVA 3P0HA 4JI1B 2Q5LA 3I5YA 1QAQA 2G0AA 3UXGA 3GDWA 4D3DA 3EGCA 3JUEA 4WNEA 2CL7X 3FAZA 4GHWA 3RVJA 3CZAA 3FRHA 4NP6A 3WKDA 1SW6A 1IBMB 1IWBB 3B85A 1KY3A 3OJWA 3C14C 3HJFA 1HFAA 1E2KA 3UV3A 4J0EA 4PN7A 4WZZA 4NU5A 3AIIA 1L4MA 4RGQA 3LVRE 2RG7A 4OLBA 5BXYA 1NKTA 1PWYE 2IHTA 2PT9A 2Z1NA 3RRZA 4AS2A 1K5PA 1V5IA 5AUPB 1G3RA 4Q12A 1UXHA 2BLLA 2SECE 1T2UA 2OWDA 3AVXA 3RS0A 5F3RA 2NVUB 1P5ZB 3LY9A 3WQRA 1YR7A 4AMVA 2EDAA 1JWLA 1I9CA 4N47A 3KVRA 4BOYA 5K5EA 1LK5A 4CKBB 1LZKA 4WT7A 3UT0A 2QZSA 1GYPA 1JPNA 1AGPA 4RZSA 3M3DA 3BL6A 5T4EA 3L4EA 1U5BA 1MC1A 5F2NA 2UXDB 4IYPA 4JV5B 4S1OA 1IB0A 2WVJA 2HPAA 3KQQA 1HG5A 4NMHA 4B4VA 6REQB 3UK6A 1EM8B 3TIXB 3HWRA 2VJ8A 1TOAA 4JN6B 2OXTA 3B7RL 2OHGA 3OCVA 4UCQA 5CFMA 1S4MA 3K1AB 4UHEA 4XH9B 1ZBPA 2EFGA 2X4GA 2ZT5A 3JWEA 5ALUA 1XPRA 4P38A 1CUFA 3N2KB 4M8KA 4W63A 4GR9A 1HE2A 1I33A 2D54A 1WUTA 3OWHA 2WF8A 3KL2A 3V2IA 2IBSA 4WNCA 1JHDA 5DYYA 2EIKE 1LQTA 2FPSA 1ZYUA 2O3QA 2QE7D 4KG7A 4QHTA 1NN0A 2V5FA 4YI5A 4QOEA 3SFXA 5EMHA 3LXRA 4E5UA 1KU6A 3EBLA 3L8ZA 2PCJA 4HO1X 4YRAA 3FPKA 3DZFA 4QU0A 5KDDA 2ZGGA 4ENSA 4FYKA 1EP3B 2VJQA 1FQWA 1ODSA 4NABA 4ZJYA 1B8PA 4A6EA 4O6VA 4UTNA 2CF5A 4UFOA 1XZDA 2QN6A 1KAGA 1P4GA 1Y4AE 2IODA 3QPWA 4D97A 1VCOA 3BJEA 1OFVA 5CDSA 3OLCX 1Z2OX 3K7EA 4IKEA 3M6UA 1RHQA 1BXGA 4TKLA 4HFJA 1UF9A 4B45A 5D51S 3RBXA 5EIBD 4MQBA 5AOCA 3TE6A 2A3RA 1KK2A 1P1RA 4J7CA 4MITA 1K6EA 4EPYA 1NBME 3PGA1 1I7NA 4F6RD 1EX9A 1A9QA 1OJ7A 3E9EA 1GJRA 1FU7A 5ED4A 3NKFA 4XRGA 4QBHA 2FFAA 3N07A 5D3KA 4WWOA 1UKBA 1XPJA 4ID3A 3UAXA 3A2LA 3DZKA 1RE1A 2HV8A 3D8RA 2Z6VA 1KL7A 1OI2A 3FTCA 4G5SA 4MAFA 1L5LA 3T1HB 4B7ZA 3D9LA 4BWYA 3K9BA 2PMEA 4V3CA 4MCAA 1D4ZA 1H4VB 2QAGB 1TTHA 1R12A 3I4CA 4BDSA 3HUTA 3ZU3A 3RT1A 1VYUA 1X2EA 3TIVA 4JHLA 1AQJA 1U9IA 1L5GB 3RVKA 5LP6F 3Q6NA 1B4DA 1L1RA 1TVKB 3BQMB 5M2QA 2IRWA 3G6KA 4P35A 4WK2B 2V9ZA 5TIIA 2ZIGA 2ZUEA 3KU1A 3CW9A 1PTJC 1J09A 2A9JA 3CEHA 3B9PA 3MUFA 3LY7A 2FRDA 4XUGB 4L9PA 3VYWA 1MAVA 3UBTA 2EEPA 2I34A 1P0CA 3ICVA 4LYJA 4LXYA 4LV6A 3WX0A 3CG0A 1LB1B 1XU7A 4JJEA 2EJWA 2ZU6B 1WXQA 5EPOA 4B46A 2GLUA 3B1KA 4G5FA 2Y2UA 4RZHA 3FB4A 3NQ41 1JHZA 4WGFA 1KO4A 4O4LF 5EWLA 5A4DA 4PYMA 5LCWJ 3ZGXA 4PLWA 4UNQA 1UM9A 2XZDG 4C21A 2WXQA 1D8TA 4NAHA 2ZYSA 4PGAA 3CQCB 3FWNA 3QWHA 4CR6A 1QLHA 4R83A 1ZU5A 4ND1A 1R3DA 1PLKA 3GLGE 1T15A 3JQQA 1VXRA 1C8BA 1CB7A 1XMJA 3ZDBA 5CGZA 2IX9A 4DV3B 1GT6A 4EBAG 1Z7BA 3HZHA 3V3KA 3AB7A 4M8LA 5E1BA 1EUDA 4DCSA 3JQ6A 3CX6A 1BIFA 4UJ5A 1EXMA 1QC5A 1OT8A 3HYTA 1A5ZA 1I4EB 3EXFA 4D0LB 3TL3A 2GRRB 3DH0A 1RAGA 4E51A 3IIEA 4LE1A 5K3AA 4LVOA 2C0QA 4MUMA 4AK9A 2I78A 3CHOA 3Q5EA 1NASA 5B3KA 1TA0A 3CSTA 1CVRA 2NV6A 2RGNA 2MHCA 2XGGA 1UXIA 3R7SA 5CB6A 1L4BA 2BE7A 1TM4E 3Q7TA 5IC5A 1AHNA 2QRVA 2WNIA 3NBMA 4V0MA 2LSUA 3I9LA 3O2QB 4CV2A 5ALLA 2V5AA 4C0AC 3ORSA 4OMFG 2OCDA 3HSKA 4U2DA 4GWKA 5H0IA 4ZOAA 3S1AA 2FGJA 4FULA 1TR4A 2GH1A 3T0GA 1GGJA 1FXSA 1UT8A 3MCWA 1CDZA 3K6JA 2WUVA 4MA0A 3VZQA 3WWPA 4BY9E 1P9RA 3UMVA 1UBCA 1N6LA 4RG9A 1WPGA 2PZJA 4IXWA 3JQ1A 1SOMA 3AINA 4MKHA 5DX8A 3WWZA 1JMKC 2D8MA 3P96A 3VGPA 4BEBA 4DAOA 1AF4A 3HVEB 1W8DA 4G09A 5CEEA 3WLTA 3QITA 2YN4A 3BB4A 3DBSA 3RF7A 1G18A 2ZIFA 4UZFA 3JVVA 4ZVUA 1E9DA 2UYGA 5AQ1A 3LBNA 5EQJB 3J5QB 4FKZA 4JY7A 2VCYA 3QYPA 4LRTB 3G0HA 1GHTA 5CJPA 1CUSA 4YAKA 2X13A 3NDBB 9LDTA 1SKMA 1PQWA 3TVDA 1OFUX 3UCFA 3ZXXA 1Z6QA 3RV3A 2QR5A 4TWZA 3DO8A 2H4WA 1W34A 2HCFA 4GNRA 2AYYA 1LLUA 1YZUA 2W11A 4Q9IA 4KN8A 3AHIA 2P2SA 3QXSA 1U4NA 1XNRB 1JXMA 2PZBA 1GKIA 3KHKA 4JOQA 3TGOA 3FCUB 1WW8A 1VCHA 1YJ5A 2CBGA 4FLEA 1GRRA 4HBZA 3S28A 4XJVA 3RE1A 3A1EA 5KX5B 1TA4A 1AGXA 5DOVA 2P9TA 1NUUA 3NHPA 3QAQA 1UK9A 1UKCA 1OH5A 1UINA 2D2FA 2EKZA 2YMQA 1NXTA 4J1TC 1I2CA 1JKFA 4B44A 3CJTA 2PUFA 4BCCA 3SX0A 4ZDJA 2OCGA 5HE9A 1DSSG 2VHUA 3LYHA 2XQJA 1E9BA 1CZNA 1SXIA 2ISCA 3PPYA 3SDBA 4OXIA 1U6KA 2WQ7A 2VSQA 3AGQA 3E9QA 4G0PA 4YPOA 2B69A 3CNLA 3MWEB 4CQJA 4MKRA 3A10A 4B5KA 1V1MB 2OR3A 3RVQA 3HKEB 5I4KA 4REQB 1DWQA 2VPZA 1J0DA 3L7MA 1P0QA 2YCLA 1JJAA 1W5FA 3NOCD 3CEJA 3D4LA 5D3MB 2FEMA 2RMKA 2NUTA 2IXEA 3N8DA 2QQ5A 2Z09A 3B3JA 1QHXA 1T9BA 3A2MA 1J1UA 1SBIA 1XVTA 2JFQA 3ZWWA 1D0SA 2EZUA 5I47A 4PG8A 1H2AS 1G291 2PUTA 1KZPA 2VGYA 2ST1A 3MA0A 2EL7A 4UUQA 1EU1A 3TGPA 3NIFB 1L5QA 4OJKA 3FUXA 4FC8A 2UZ1B 4ZEVA 1CRQA 3DTNA 4NJMA 2AX3A 3OCYA 3PDWA 3FNIA 4YIKA 4NYIQ 3WV4A 3QKRA 2IOYA 1ZB1A 3W5DA 4UBNA 3IQWA 3ZUPA 2QTLA 4YVFA 3MINB 2CGEA 2OC4A 2CVZA 2FN4A 2PKQP 3BORA 4J7AA 4UEQA 5C8YA 3RTAA 3T7JA 3D6HA 4RZIA 3P71T 1K6XA 3IO3A 4TUYB 2GX6A 2IK8A 3ADBA 1V48A 2A33A 2JGDB 3BMXA 2YOHA 3KVVA 3UKRG 1BS9A 1JG3A 2FMFA 2ZQYA 1Z37A 1TJ5A 2AV6A 1FFXB 3EBPA 1N8SA 4H2DA 4JFAA 2A7XA 4HYEA 1NURA 5ETJA 3S7TA 2FR1A 2B4QA 4FMDF 5A7HA 1CHDA 2WAMA 4B3SB 1NP7A 1OR8A 4LPSA 2FSFA 3BL8A 3NAZA 3ED5A 3LKVA 5LC1A 4ATNA 4NV3A 4YAEA 3SE0A 3UKUG 3G0BA 3REQB 4RIEA 5M7EA 3IQGX 3WA7A 1ZM7A 2MHKA 1WKVA 3SR3A 1SUBA 1V41E 1QO9A 2ESRA 3G5UA 5FTMA 5CA1F 1VE7A 3CLTC 2OSBA 2QP3A 4Q9JA 2CHWA 4BWFB 5B57C 1QV7A 3A4MA 2FEWB 1TM3E 2FPWA 3NWJA 5CA0A 4AKHA 2ATVA 1ZN9A 5ESDA 3QQPA 2HAEA 2EJCA 1DP4A 2WNSA 1T0BA 3LLCA 1XMQB 3I2GA 1D2AA 4DYDA 1JT9A 4UDOA 2UUAB 2YINC 2DFVA 3X2SA 5IVKA 2AWIA 3BXGA 1WB4A 1XQYA 2KBXA 1ECGA 2Y67A 3L4SO 4N0PA 5EZYA 1DBSA 1UG3A 1Z17A 3KLPX 1KZGB 4F1PA 3LSTA 3TRFA 3OCXA 3VH3A 4UEJA 2G09A 2WXJA 5ARCA 4AT1A 4W1SA 2BM9A 3MRVA 4M37A 4D3XA 2YNMC 4WV3A 4QA9A 3BAFA 4MRRA 2FWBA 3AR3A 4R2HA 1N8NA 2FLWA 2NO9A 1M2OB 2XJ4A 3JZAA 4U7FA 1QK5A 2MMCA 1EP1B 2VK4A 4UJ3A 4D45A 1S2NA 2QM0A 3I01A 4WNDA 1JVNA 3JATA 2F3UA 3K5HA 5EWMA 1KZ7B 2E1RA 4HQFA 1TIKA 3OQ6A 2A58A 1DIAA 3FOBA 4O2LA 3N8HA 3SS8A 2CSXA 2Q0QA 2W6OA 1VLVA 4B2LA 1X6VA 1IHYA 3AUKA 3M7IA 2OOSA 4LGVA 2WD7A 4LZOA 3KSRA 4HDAA 4NESA 3S2YA 3SHVA 4AW9A 4YAGA 4J8PA 4BRSA 1W2GA 5FJYA 1QJCA 1DWPA 1PU2A 2VG8A 4HOYA 5CCLA 1R0RE 4LZPA 1PQUA 3CZCA 3TR5A 1Z4QA 1U31A 3OEEA 4RK6A 4FQ8A 3ISTA 5JD3A 3PEYA 5C1BA 1NBIA 2GHTA 5TJHA 5C8ZA 5KVCA 1Q3HA 1T5HX 4Q1FA 4HFGA 5LXTF 2YZMA 3ZD8A 2BFBA 3L7LA 3LCCA 1MW9X 2VXOA 3C0KA 1A50B 3P32A 4FMPA 5BOVA 4K9OA 3O8LA 4X7MA 4CL8A 3LLUA 4GZMA 4HWOA 3ZHSA 5EKUA 3HI4A 4C06A 4M9ZA 3MN1A 4PHCA 1K92A 2ODEA 5DP2A 1ZM3A 4PC1A 1Z0ZA 4WAFA 2NO1A 3RKVA 3GLRA 2FZGA 3CT4A 4FW9A 3TH5A 4DUGD 2OCIA 1SKQA 4ZOQI 2BZGA 4BFLA 1AN0A 3SZOA 4HAOA 1WMBA 5CVCA 3WRWA 3R5KA 2X6JA 3H2GA 1FUUA 2ZIAA 4B4KA 4DG8A 4D81A 1E2JA 2WHEA 1RYEA 4IX9A 5DWDA 1B26A 3DZHA 5KNDA 1YBAA 3SLGA 2JI4A 4D41A 2XQ0A 3RH0A 3P94A 2APJA 2ZJBA 3NANA 5ER9A 3V7FA 1OHHD 3QC1A 1RXCA 1TN8A 1UDXA 4FX5A 3HCCA 2J0VA 3P9XA 5DEOA 4RCZA 5ILGA 4ZCTA 5AW2A 5AK5A 3JRWA 3FCCA 4HNQA 3DHEA 1AKMA 1XRPA 2AMJA 3MWDB 3EXHC 2FJPA 4MWDA 4WNAB 5ECYA 5LQKA 4RF2A 3RREA 1EEHA 3SQVA 1XNHA 1ZH0A 2FPUA 3EAQA 3P0JA 4FMBB 4LF6B 4P98A 4N3AA 1A8HA 3LW8A 3FF1A 3B2NA 2BKEA 5DHAA 3HP7A 2C20A 4FJ0A 5IARA 2QL5A 5ALXA 1U0BB 2VWGA 4RQBA 1TFRA 4K26A 2G83A 3U0VA 5CMWA 1AM4D 3C8HA 3QV1A 3VV3A 2CNWD 1P2FA 4MYUA 2EWWA 2JGRA 1ONSA 2FFRA 3ZEFA 1GR1A 3L77A 4WZAA 3TSAA 4AMGA 5I6DA 5L4LA 1H2VC 1G1MA 3JPWA 3LQRA 2R7AA 3SIPA 3P2BA 3L4BC 1J8QA 2GBPA 4CQMD 1QVZA 1W4LA 3U26A 1IBLB 1U8UA 5SY4A 3HPQA 3F4KA 3MJTA 2B4AA 1X7DA 4PBSA 3ZGYA 4MX8A 4WLUA 2F9LA 3CH5A 5CRVA 4JASB 4NEHB 4AY2A 4LNUD 2FOLA 4NTZA 2GVZC 1EWQA 1P72A 1RWPA 1ZU4A 3ROMA 3HUFA 4KWCA 4FC6A 1KGDA 4H1VA 4A03A 2W2VA 3IXMA 3MCUA 1RYHA 2FEAA 3TTUA 2OGWA 2I3GA 3W5CA 5TSDA 4OVUA 4X7RA 3UWDA 2I6UA 1ZGAA 4WDQA 1SZPA 2WYHA 4HP8A 3BEDA 3U2QA 5FLXA 4KAAA 4K81B 2P0YA 1QG2A 2EVWX 2YQZA 3EXAA 3GLUA 2CXOA 1IEQA 2VZEA 4FYIA 1NNI1 4RA9A 4X1IA 2O23A 5F77A 5TNXA 5GGXA 2J9ZB 1Z5VA 3T7RA 4GSYA 4TVKA 3FU6A 1VPVA 2FRXA 2Y27A 3DAYA 4YP0A 3DDCA 5BRNA 1FVXA 4RJTA 4FHGA 3IJRA 2G4VA 2EHDA 3L7NA 3TPZA 4BZQA 5M72A 1YQTA 2GEKA 1C3OA 2WM2A 3QTTA 4FZJA 4L74A 4EHBA 5ANLA 6YASA 1VKOA 2GZRA 4N5NA 5ALFA 5JE8A 1GR0A 1XWFA 2YNMD 2QNIA 3D1LA 1RVV1 4R68A 3W6PA 3WYNA 4BP9A 4E1BA 4A3SA 1RWMA 4F9FA 3BMNB 2VH5R 5JBIA 1OVGA 1YMQA 2P1RA 2VT2A 4QGAA 4JXTA 4XW2A 5FTKA 5BXOA 4XSGA 5JHAA 3HKDA 3WGLA 1Z5UA 2DAPA 2EJVA 2XUZA 1GEGA 4DNPA 4FW8A 4ADSG 1HRKA 2EW1A 3BIFA 2VQEB 1DRVA 4MOWA 1JU3A 4NOKA 1MPTA 3G1UA 5JANA 4OA5A 4XUDA 3KEZA 4G89A 5TMPA 4RK1A 3CINA 4FS8A 4XVCA 1REQA 2EGUA 3E9ZA 5DU2A 3PE4A 2YVQA 2C83A 2VPXA 3L0IB 1GAJA 2YHCA 1E7UA 4LNGA 1NBOA 4C30A 3WJ7A 4F8YA 3IHWA 4BB9A 4YXFA 2J6BA 2AOUA 1THZA 3FUTA 4JYBA 4O4IA 1IY9A 4FLMA 1CR1A 1E7YA 4ZRNA 2BT4A 1FLAA 4E2YA 3UGTA 3AEXA 1ISMA 5ICMA 4L0DA 3MCAA 4YONB 4GTTA 4EHMA 1JA1A 3VHQA 4Z0NA 3ZCTA 5CEJA 2QMQA 1IJBA 4FYWA 3W7BA 4EX6A 3OXGA 1F9AA 2O48X 3HJUA 4HEA1 5AM1A 2VRCD 2WY2D 3V8NA 3BRWD 7AT1A 3KSAC 3E3MA 3PH0C 2I6SA 4BMVA 4N5MA 3HACA 3SFVA 2Z43A 5CNIA 2AJDA 1YR6A 1XCPA 2D74A 4HXEB 1O6FA 4TKZA 3EIQC 4P4UA 2C03A 3O4RA 4UHKA 5IN5A 3K5IA 1G63A 2A84A 5K6AA 5KEIA 1XDBA 1JIUA 1BXRB 3R3WA 1A1VA 4EMSA 5JDCA 5CA1A 1DWUA 3L6AA 1QBQA 1OX5A 1QR6A 1U7UA 1PVDA 2R60A 1H3NA 1TZBA 3A2KA 1HTBA 1H6AA 1OXMA 3Q9NC 1RMTA 4MKXA 2E0IA 1AXEA 4FE4A 3WK4A 4L7VA 4RJJA 3DVSX 2VJKA 1ZRNA 4TWRA 1IQUA 5EWJA 1ZI6A 3IUNA 4FBGA 5JSZB 2HFKA 1C3OB 4DLKA 3QLVC 4R7ZA 3CCBA 5C7IO 4GMJA 3CRNA 4C3ZA 1PG2A 5L8VA 4M99A 3SSMA 1KWKA 3AY7A 3D5TA 3NVAA 2YJNA 3AY3A 3S7BA 2XMRA 1ZX1A 4IFEA 1Y8QB 3E05A 4DLVA 3MTGA 3FOCA 2CJYA 5CPFA 3AJIA 1MA3A 1B73A 2E6KA 3JSXA 3AEUB 3MWLA 3F90A 4FT4A 5BQ5A 3ABME 3THWB 1NBMA 3TSZA 5BUQA 5LMNB 2XVXA 1EHIA 2QZ4A 4WRRA 1HXHA 2I6XA 4XIFA 1R0CA 4YYZA 3J5PA 3M70A 1RJFA 4A7PA 3KYCA 2F00A 3IEMA 3QUQA 4NBTA 3WBJA 1BFDA 1SQFA 1O0BA 5CX4A 4QOSA 3AG1E 1GZVA 2GA8A 3KT6A 3PC7A 1MAHA 1VDMA 3HXMA 3HVEA 2JVKA 2WD7B 3IKLA 1L5JA 4YJDA 4YCCA 2WF6A 2AOUB 4LOIA 3RUFA 2QU8A 1R9GA 1GY8A 1Z88A 3STWA 5J2TB 1FDUA 4CR7A 3KQNA 4PTYA 3ICOA 2N46A 2PX4A 1QH8B 4DSAA 2I3DA 1I1HA 1THMA 3A37A 3SOZA 2XAAA 2YTZA 1JG1A 1PUJA 3MOSA 5DLQC 5LXTA 3CRRA 1LF0A 3I04M 4FKBA 4L7QA 4ZCPA 2EJUA 3MJFA 2MTBA 5ENNA 4DYHA 3M1YA 4E30A 4AVXA 1VL5A 1DO8A 1Y6JA 1Y6RA 1Z83A 1OSNA 2G9UA 1UJ2A 2I65A 2JD1A 3F3SA 3JZMA 4FSHA 2FSVA 4ZAFA 4HS2A 1EF1C 3WL4A 4OO3A 5ALWA 4C07A 4D9CA 5BT8A 4CXMA 3OPYA 2C3PA 3MLAA 3U7RA 4BAZA 4BO3A 2HF9A 3B1ZA 4NMMA 2UU9B 1POWA 1VCIA 1Z13A 2GJSA 2JVJA 4YP6A 2OYCA 2XOEA 1Z8NA 2DR3A 1EGMB 2FGKA 3KB8A 2BCJQ 2FMKA 5AJUA 4Z6KA 4DCGA 1D04A 1EUDB 2FZVA 4WESA 3SU8A 1PHPA 1YR1A 5F76A 4ILHB 1F0KA 1GUBA 2VDWA 2YR0A 4K6OA 1Z3IX 4YCLA 1NNEA 4EPWA 1GUAA 4RKFA 4Z9XA 5EC8A 4CKWB 2OMKA 3EVCA 2M6SA 2D1YA 1P1BA 4LZNA 3MWEA 3L0PA 2JFXA 5K3FA 1XZJA 2J6HA 1DCKA 4PZEA 1Z0IA 1BYIA 1SUFA 1C1DA 2VHVA 3FCYA 1KDYA 8ABPA 1QR2A 1A3CA 1DC6A 4CIWA 3ONLA 2XNKA 2VDNB 4J7UA 2XX3A 3ENQA 2OCXA 1PTJA 1SKUA 1FUYB 2XOKD 3HBAA 4POAA 4L0CA 4G86A 4DJEC 1X1TA 4EJSB 3OO1A 2RFMA 1ZN7A 3OLVA 5CG1A 1U8EA 3GRRA 2PSDA 1XAIA 2A8YA 4ANUA 3LPCA 3WLQA 4G2TA 1PL0A 2Q7FA 2WOOA 1P2UA 3EVEA 3WSTA 3NDIA 3I04A 4L27A 3K8YA 3O8QB 4MAAA 1ZOOA 1HUQA 1Z6YA 4NOJA 4DDKA 5LKAA 2C9YA 2Z1DA 2O2EA 5EIHA 3BXPA 1PD0A 5TPZA 4O02B 4YBZA 4E5YA 3BD8A 3PD1A 1D2HA 5ENRD 3U40A 5DTIA 3ZYMA 1NXVA 1XCMA 3H0KA 1FDWA 4M21A 1DAEA 1QH0A 3CXUA 5EJFA 4YAUA 4XKJA 2C5LA 2AN9A 3N2KA 2Y8EA 1MA0A 4BUJA 1SURA 1RPZA 5GMOA 2IUFA 3JQ9C 1O97D 3N86A 1NFFA 1QYIA 3QJGA 1WXIA 3D7LA 1UM9B 3CF0A 4O5OA 2F37A 3QVSA 3HTXA 3ASDA 1ACJA 1B7GO 2RI0A 1RXSA 2G9NA 2BHNA 1NU8A 4ZC8A 2EW2A 1KDOA 1RHMA 3D81A 4YH1A 2V7BA 3VZPA 1ZGGA 1U2VG 1YFKA 2R8EA 3UAZA 1ZONA 1S8FA 1Y48E 2DLNA 4PW0A 3N59A 2H63A 3UATA 3K0FB 1E9VA 2B2CA 2VJOA 1WZCA 1GZHB 1KY4A 4ZRDA 4CKZA 4G0VA 2VGXB 4R8KA 3LPDA 1UEXC 4BWVA 3L1HA 4L4SA 4R8LA 5CX1B 3T7DA 2J4FA 3PTAA 3ASGA 2XD4A 3L7AA 3EA5A 5D3QA 3EZXA 5ABPA 1SCBA 4M0CA 1E61A 1JHYA 1QIDA 3DLPX 3JYQA 3NBUA 3PZBA 3GLFE 1DRKA 2NYRA 3D8UA 3LFUA 3JARA 3S99A 3O9MA 3O2NA 1MB2A 3SLKA 5JXWA 3G2SA 2E4WA 5G0TA 3DLCA 5C3UA 4WCFC 3CKCA 4G0MA 3H3FA 4ZK2A 3BG1B 3BG0B 1Q0ZA 2XUOA 1MNQA 4D96A 3DEAA 2ZDHA 1E2EA 1ZCZA 2GTIA 3QE0A 3NZSA 5E4TA 4G6ZA 3CLHA 3PFKA 1Y3DE 5EE0A 2XBLA 3U0BA 2TSYB 8GPBA 3CQGB 2IYPA 3H5RA 4HNAA 1S3SA 4CU2A 1HG2A 3Q3EA 4Q1AA 2GRLA 3EDCA 4AN1A 4Y0NA 1RCTE 4V1CI 4J8YA 2AWOA 3CVVA 1DEOA 2O52A 2VT3A 3BICA 3E1KA 1SN7A 1TT5A 5J40A 4KGDA 4E6EA 2KM4A 1JG4A 1F0PA 1DXOA 1PWHA 3KCQA 4EG7A 4TYNA 5EUQB 2RKWA 5CW1A 2ZKIA 5IJ0A 5JMOA 3P4YA 4DXHA 2JHPA 5ILOA 1N0VC 5AJYA 4Q94A 3EY4A 3H1FA 3KOZA 4I7EA 3HMQA 3DBVO 1A4XA 4HDNB 2GZHA 4IJWA 3EMDA 5D00A 2H17A 5EP4A 1OYVA 2H6EA 1I24A 2I0FA 3BGWA 4YFVA 4CCSA 4J7XA 5D3ZA 4E46A 3SQXA 1F7UA 3K70D 4OL0A 3IEVA 4OQYA 2HMVA 1NA0A 2ZE6A 3C5VA 1CETA 2XT6A 5H80A 1VJGA 3RC1A 4F3KA 2X3UA 2FW6A 3F71A 4B9AA 5B4UA 3WLIA 4UAVA 1Z62A 3A7DA 3H87A 2F43A 2GB4A 2A9FA 3NIWA 4QD3A 4TS9A 5JT1A 3UW1A 5LN1A 2H59A 1L9XA 4Y2XA 3ZV5A 2PAFA 4O1HA 5C18A 3RIEA 3EIUA 2X1VA 2BI4A 1HKHA 5A04A 4XWTA 3DXFA 4BECA 1H5NA 3FTSA 4EMUA 2IXBA 2B8EA 4YY3B 2PO7A 2H6GA 2J9FA 1IIRA 2WM3A 1H2UA 3LY8A 1WKBA 1GZ4A 1JSLA 2B7CA 1GADO 3CBQA 1ZZGA 3OFKA 1C0EA 4BX2A 3M1AA 4EMTA 2P9NG 3TWUA 5CXSA 4FVTA 1L5YA 4CNBA 1P1JA 1T4CB 1RCFA 2XLBA 2YDXA 2CD9A 3AP1A 3KOXA 4M3OA 5AAOA 4U3JA 2J7KA 2B25A 3GD7A 3JYNA 3CCCA 4GPAA 4OQQA 4NOMA 2ATCA 1IK4A 1QRSA 4WIAA 2ZR9A 3HE3A 4BATA 3F1KA 1XGKA 1XCOA 3D6NB 3P2JA 4YRIA 4KVOA 3FYDA 5DXJA 4FCCA 2XCSB 3HY3A 4MPTA 5TY0A 2ICAA 3ONVA 1GA4A 3UHOA 4EO9A 2RH5A 3U4QB 1GL3A 2EP8A 2VOEA 5BUZA 5FTPA 1IPFA 4OUKX 3W78A 4WLVA 4EVRA 4DSOA 5BVGB 2FQWA 2QE7A 4DCUA 2CWDA 5HVNA 1NPYA 1IQRA 1V4VA 2JCGA 4HVTA 2QI9C 5LYJA 3B7BA 1UPBA 1ZD5A 2JBHA 4U1RA 5FEUA 2OK7A 3JD2A 1QH8A 2A92A 2PXXA 3BGOS 5EFZA 1G6HA 4RV9A 3E5NA 4ENPA 1SZDA 3PUYA 2FUKA 2RFLA 3KEAA 2ZK7A 3F74A 2E4VA 3HDTA 4LY9A 4Q03A 4UNSA 4MW1A 4D6YA 2P6OA 2YY5A 1XR3A 3VLEA 2X1HA 3GB9A 3AR8A 3QNWA 4JVOA 1ZGBA 1IULA 2GSWA 5AVOA 1H85A 2PLAA 3U4CA 1ISGA 1UBUS 3A4NA 7GPBA 3CIAA 2B6HA 5K0SA 1YQGA 5SV2A 2G07A 1SUIA 3S40A 4YP1A 4DUYB 2QLJA 4Z4FA 1XDWA 3KXIA 4F2WA 3REQA 4KIJA 4M9CA 2ZRJA 5KS2A 3LCJA 3DOCA 1NQTA 1W30A 3I61A 3QXHA 3UK7A 3QKSA 3GHYA 3KD2A 4EYEA 4KEAA 3W5JA 1HLDA 3CLJA 4TMWA 4BJ6A 2OBNA 4IFBA 2ZE7A 4US2R 1XALA 1SB8A 2D1QA 3TR0A 4H7JA 2JIPA 1OOEA 3CLSC 5ECGC 3RNOA 3ED1A 2YJTD 4U7TB 5AI9A 3PKJA 4GA0A 2AG0A 2CLEB 4EUEA 4DR3B 5A5DA 3LYLA 2C88A 2A0XA 2RKBA 4JITA 1QHHA 4NBLA 3SZLA 3ZGNA 3HKCB 3W5HA 5JECA 5SZKB 1WWKA 4PQRA 5DJ5A 2M6KA 3BSFA 2IYYA 4Y9DA 4XKBA 4LC9A 1PX2A 5TVGA 3JYOA 4Y7CA 4C9BA 5IFKA 3NC0C 2OBMA 3BXXA 4PFQA 4KI7A 1EFPB 2O07A 2D0OB 1XTKA 3HGTA 3IT1A 1XG5A 1VPEA 5JHBA 2VAVA 4IEEA 4OK5A 5FBRB 3AJRA 3WC4A 2QC9A 4TLEA 5J1SB 3PF8A 5CM8B 4TMKA 4LV8B 1V47A 2FPGA 1FQKA 1VG8A 2B3TA 1RAIA 4FYJA 3OO0A 2PX3A 1GRNA 4TLBA 3VR2A 4NYMQ 3WNVA 2W6ZA 2NZXA 1JUQA 2PHZA 1Q1QA 2P9IG 3ULEG 2VQDA 2HK7A 3EZNA 3H1TA 4XUCA 2PH7A 3URKA 4MTCA 2GJ9A 3SK0A 4IIDA 4ZQBA 2WXHA 1P3JA 1QE0A 2C92A 3IHYA 1Z47A 4E32A 1DX9A 2V98A 2FWAA 4MWGA 4AY5A 1H1LB 1GFIA 1DTSA 1L3IA 4RY0A 1AUPA 4N41A 4O63O 4JJ8A 1FFXA 2C3OA 4QGGA 3FVQA 1XWWA 1OY3D 3I2YX 4PXYA 1LLCA 1Z0JA 2E49A 2J3IA 2FI1A 2OD9A 3B1WA 3IIIA 3KO8A 4GOLD 4WKBA 4B34A 4ES6A 1P19A 2OUKA 1KF0A 4K6MA 2WKSA 3ZHEA 1J07A 3WXMA 1RAEA 2FDCA 2G25A 2IPXA 4X7BA 5HKLA 2IWRA 2YWGA 4JP5A 4AY4A 5FTNA 3U7FB 2P6RA 3QVGA 3V31A 1C4KA 4DZTA 1OLOA 3GJZA 1GRQA 4MUEA 4IO1A 1AH2A 3BRWA 5EMKA 2C2LA 1ZUNB 2TRSB 1QC5B 1D5WA 1PR0A 3H42B 2DBZA 3L6OO 3AQ4A 4H3SA 4J16A 4JOCA 4PIVA 1K98A 2Z5GA 5EE5B 2XZDA 3K0CC 3DSSA 2QSZA 4FHZA 3RS2A 2J59A 2P2NA 3HRIA 4OY3A 1M2VB 1C0LA 2R8XA 3PLRA 4I2ZA 3PQ5A 4JXKA 4DC0A 3O1LA 5ITVA 5EJIA 5GIOE 3PRZA 1QFMA 1R4NA 3C5HA 4R8VA 5AXDA 3S5UA 3HVHA 5F4BA 3P9RA 3C3PA 4RKWA 1IONA 1UJCA 4ZFHA 3PEUA 3PGMA 1CC1S 1NMYA 2B2NA 4XDYA 3AEZA 5SYMA 2G9VA 4GVXA 4EZLA 5AW1A 4EJ6A 3KYCB 2V4MA 1WLYA 4ZPXA 3OKCA 3W5SA 4DM4A 4DR7B 3E9NA 1W5EA 5G0SA 3F78A 2P6MA 3DCIA 4U2CA 3DD5A 1P2SA 3A9SA 4ALNA 1L5WA 2BKVA 2HQSA 1G8AA 3R0QA 4EW1A 1T8WA 3A9VA 3INNA 4G24A 3TWRA 5HQ8A 2A9VA 3OY7A 4TTQA 4X8HA 5L7YA 2DE0X 5LZ5A 3WJ2A 1XRSB 1Q1NA 4CKEA 1DUIA 2I4OA 3KEFA 3P9SA 2XSZD 1PKEA 4EQ6A 4IX1A 3Q9LA 1E7RA 1Z0KA 4H4CA 4PZ9A 1TK9A 4RH3A 1OLUB 1JN0A 1THTA 2WWWA 4PXSA 3GMIA 1U2RA 1WY7A 5I8ZA 3HA5A 3AEQA 5C1PA 3GD5A 1FE8A 4RVBA 3I3OA 2G5CA 4N65A 5JS7A 1X7HA 5KO2A 2CB9A 1ENZA 4RCVA 2F1JA 4FE3A 2OZVA 4XDZA 3TW8A 3IP9A 3GJYA 1N2GA 1EVIA 4MXDA 5I7WA 1ECJA 4QTTB 3KVYA 1F14A 3K31A 3OX2A 3ZBPA 5KDOA 1INZA 4HBDA 1LPNA 2BMJA 3H5WA 4MWZA 4U5QA 4P2BA 3FDZA 4C4PA 3D2BA 3JU3A 1J49A 3LX6A 3FI0A 3L04A 3O75A 1N75A 4HJXA 3HZRA 4MUYA 3TTWA 3W6NA 4XM1A 4XYMA 3V8BA 5A4IS 4P54A 1SA0B 4EY4A 4O0MA 3ZBTA 3C3QA 1BXGB 1YE8A 3W3AH 4E33A 1UJJA 4A9AA 4TL8A 2IUTA 2J85A 2AEEA 4GM0A 3S6JA 4BSXA 2RKOA 4HFMA 1U0TA 1GIAA 3LT1A 2MDTA 3R9IA 1G9SA 1I3LA 1MG0A 1ZKDA 1H6DA 1OW3B 2ZB7A 1VFNA 4YVOA 5CT9A 2GRPB 3M4ZA 3NLLA 1Z25A 4YJHB 2C2WA 2C8LA 3QUBA 1DI0A 4KMSA 4PAQA 1RW2A 3Q5DA 3UJ9A 4N2QA 1JFTA 3WKCA 3SEQA 4Z7QB 5K6TA 3MUEA 3NAWA 1JPJA 2C58A 1KE1A 1Z4PX 2QN7A 5ANRA 5AICA 5JMPA 2H9YA 3QX8A 4TL9A 1O96B 1SCKA 3KPYA 2NSJA 3DSUA 1E3LA 8ATCA 3LGXA 1C9YA 5DTRA 1ESNA 2WFAA 2PMCA 1XEFA 3INTA 4L22A 5JAQA 4NXNB 3S5JA 4NBKA 4RDCA 3KUCA 1K1EA 4O60A 4RS3A 5K0JA 2WSSD 3GCZA 4OLFA 1CY6A 2GXSA 2V7PA 2JANA 3LWZA 3PNVA 1O7JA 2X58A 5AKJA 3IUYA 5HF8A 5EUBA 2I29A 4M1ZA 2XRMA 4XEHA 4ARVA 2GEDA 1V1RB 4OF4A 5G0UA 4JODA 4N3NA 4R3WA 1MJNA 4RXUA 3CEQA 2HWUA 3RHZA 4UCFA 1QGDA 3RKUA 4BNLA 4S05A 13PKA 1DZ3A 4Q24A 4UU8A 4DL9A 3W6UA 1QOQB 4XCQA 5SZHB 2W00A 3AVPA 4QXPA 2ZTSA 5BVHA 4DUPA 3MS4A 1RQPA 2AOVA 1EXWA 3QB2A 2V4UA 3N5KA 4NZMA 3U4DA 3EXHB 5HZGA 3E30A 3D6AA 1Q14A 1MW8X 5AOXB 3UH0A 3RU2A 4BVFA 4JDUA 5FLEX 2BGWA 5FWXA 2RIPA 3G49A 4RCYA 1CY1A 2COKA 3L01A 2GHIA 4V0QA 4TX1A 1K7CA 4CJXA 3OAWA 3MHTA 4LYYA 4KR6A 2J4BA 3CGGA 4FSDA 5J47A 1V37A 3C4JA 4DIDA 2PRYA 2D00A 3Q3JB 3VU3A 3J81k 3IESA 1PQ4A 3QQ5A 4MKZA 1EVLA 3BG5A 1DCEA 1GSAA 2VP6A 2FSHA 2PKWA 1IXZA 4J0KA 5ENDA 2VH1A 2VNKA 1KQOA 1EB8A 1GTRA 2WWVD 3QYFA 4EX7A 3SC4A 2P4SA 1R5NA 1E8OA 1WBJB 1ESCA 2GETA 3HDQA 4A73A 2P58C 1XLWA 2PR7A 2X19A 1ADBA 4OYLA 5EE1A 2P6UA 4RFVA 4DQLA 4D26A 4WKNA 2PQNA 1XFAA 5LOVA 1E1DA 4PWYA 1J1IA 5EHNA 1WCYA 5EZYB 3D3NA 3TD9A 3VJLA 3N71A 4AQDA 1OWMA 1IZ7A 3BK2A 5KJEA 4QUKA 3VH2A 3QLEA 2I6HA 2Y0DA 4KPUB 4Y9SA 3SC3A 2ZQ5A 3QEOA 2YJZA 4OP1A 3DE1X 3C3YA 3FUKA 2YJ3A 3HXBA 1BDMA 4C4SA 4O4IF 3QZUA 1GZDA 3FDHA 1RS0A 2YZ2A 3MT0A 4HY3A 1YQQA 2AUNA 4PC2A 1HZJA 1VRVA 1VFPA 1XTJA 2VJMA 2ZCVA 5E6UA 1F51E 1L7RA 2Q50A 5GJVC 3BHIA 2F1KA 4MRSA 2AQ8A 3IH5A 4MRNA 4MCIA 2OEVA 3OWOA 2HA5A 3G89A 3U3JA 4YCDA 2EWMA 2BMAA 3IFSA 2R6HA 4XOIA 4YJGB 1V95A 1XLTC 4LWZA 1N52A 4O2BF 1ULHA 5IC6A 3TCKA 1K7SN 5BW5A 1DIHA 4IPTA 2JLCA 1O8CA 4RVCA 3GRZA 1KI7A 1EIZA 2ZYTX 3U9TA 1GAXA 4AUMA 1I10A 3RUPA 3WLEA 4D79A 5JPDA 3R74A 3PGLA 3L7CA 3TZCA 1OT3A 3UT5B 3GMDA 3T1NA 5C46F 1QU2A 3QHPA 3P26A 521PA 3URMA 3TW6A 2XCQA 1NUTA 4EH1A 3S0JA 4YT5A 3CZPA 1G8FA 4IINA 5H68A 1F8YA 4ZJZA 2ODTX 5SY9A 4D8XA 3GRFA 4N6NA 3G9UA 2PUDA 3HKBB 3JUIA 1H22A 2V7TA 4ZVOA 2IUUA 4BRZA 2GPWA 4ARBA 3EXIA 4Z7JA 4OAUC 5KYWB 2QFCA 4FOSA 4MGIR 2V4ZA 4MVJI 3UY4A 4YT2A 1DADA 2NZ8A 4IRUB 1UFKA 1R1DA 1GNLA 2FW9A 3GGOA 4RV4A 2A14A 1YC5A 1PVOA 1BWQA 5K6RA 2D3TA 1RP7A 3FHCB 3RS8A 1PNTA 3HEAA 3OJLA 3T34A 1UWLA 1K1BA 4XVUA 2V1UA 1W5AA 5HWSA 4CRWB 2EXXA 4X66B 3GJTA 3ILHA 3T3HA 1W88B 1K8ZB 1QLJA 2BDUA 2BPOA 1GPJA 1SA5A 1NAHA 1TW3A 4NL4H 3WLHA 1XRQA 3K9NA 4UNNA 3V5NA 2OQIA 2ODWA 5EQDA 3UGQA 2F9FA 1KXZA 3E3LA 3WIEA 1DFHA 4FMDB 3ZGOA 3LPZA 4Y0AA 1EVKA 1G17A 1Q0UA 1Y89A 2CK3D 5EJMA 2PGNA 2JGEA 4TXJA 5LCXA 3UJBA 1Z56C 4GWGA 2JI7A 2GBLA 3CUUA 3EMKA 4JLSA 5KJLA 1RVDA 3RUEA 1WUKS 4R3NA 3URZA 2GF2A 4IF6A 1JJ7A 3RT9A 3M6FA 5EERA 1AUQA 1RLOA 1YA8A 5E6SA 3ND7A 4MMZB 3TQOA 1JRLA 5C9ZA 1U6IA 1USKA 2CLLB 4R0VA 4URUR 1BMFA 4I5EA 3FWVA 3DPYA 4G23A 1F5NA 5I7UA 4E21A 1AKRA 3ROKA 2CHGA 1YNOA 4UWHA 3DD1A 5GIPE 1TDJA 3A9UA 1CUEA 4TUMA 1QV6A 7MHTA 5IC4A 1VBFA 3VZBA 3ERCA 5JEDA 4Y6LA 2IYQA 1I4TD 4YHBA 1D6SA 1Q0RA 5DZSA 4F3CA 4ARCA 3PQ6A 1ETUA 1QZZA 2N3ZA 5D86A 5HGJA 4B47A 4W9MC 1WCWA 4CGZA 3ZJ5A 1EM6A 4QLAA 3JWHA 3FTUA 2Q4EA 1OXJA 3ADPA 3E7XA 4D1YA 1WE2A 4BKUA 2CLIB 4FDVA 4XARA 5SYNA 3F9RA 2VTKA 2SKCA 1UMDB 5JYDA 2D13A 4GPEA 4YTEA 3OPYB 5K99A 2IF4A 4S1TA 4O8CA 4IKOA 1UW4B 1IRIA 2FWJA 1BWPA 2GVNA 4EK9A 5FL7D 3OTNA 4OQLA 3X1DA 2VO1A 3U7QA 4EB0A 1TNDA 2CJWA 4C0SA 2JS7A 9ABPA 4TOIA 1X81A 2LAIA 1BQEA 3VO9A 1HTWA 1A0OA 1N92A 4HK4A 1WQ1R 4XB2A 4W5NA 1IOVA 1S63A 3EWNA 2PM8A 4EARA 2PNJA 2JFBA 3A6EA 4PZDA 1EQAA 2ZBUA 4CTMA 4OYYA 2DFNA 3DONA 2P9QA 4PX3A 3W7VA 4BTEA 4CPDA 5AHOA 4ILEA 3A1UA 4JC4A 1AHHA 4GAAA 2RC6A 4AYXA 1AGRA 5FD8A 1XEXB 2C95A 4MYSA 5LUBA 3TJZA 1TVMA 2CLCX 2JKZA 2VHEA 2WWFA 2AH5A 3SSAA 4U3JB 1V6SA 2J33A 3ZZNA 4NI5A 1P33A 4M0KA 3UMMA 1E3MA 1ZVQA 5DTMA 4O0LA 4MS6A 1I4OA 3G2MA 4IOJA 4ZFNA 1SCNE 2ETVA 1ZMRA 2P6NA 5HJ7A 4Q9KA 1YD7A 4EYOA 3A28A 2FMTA 4EL5A 2OCAA 2G1UA 5HXAA 1WSAA 4JJ7A 1M1YB 3F98A 4KGVA 3O8CA 2AHOA 2K6GA 1TZMA 4FQ7A 4YRTA 3A04A 4DVGA 4RO0A 2H31A 1QK3A 3HB0A 2XQFA 4NBSA 4B7UA 1OWNA 3MB8A 4JQYA 1MIOB 5JISA 2DTXA 4GDMA 2X0EA 2W7TA 4I5FA 4AUEA 4Q3KA 3K15A 5ITZA 3P5BA 1L7QA 4GS5A 1FXWF 4BC1A 1GA1A 3KQMA 3ADCA 3DBHB 3Q49B 3RGWS 2RGEA 4J2OA 3NHBA 2PNFA 2Z08A 3M2PA 1R0LA 3B78A 4PH4B 1R10A 4HN4B 4O33A 1QRTA 2ZISA 2QUAA 1X1EA 2GTPA 3OT1A 3T4UA 5JARA 3OQOA 1W36D 5BNFA 2QTFA 2QN3A 3FOEC 2GNPA 5AIAA 4AF6A 2KXPC 3D3JA 5HMLA 5CCEA 5DI9A 1N2CE 1QTRA 5EVJA 3W5IA 1R5BA 4OHFA 5DM70 1BKSB 2ERXA 3JR3A 4PONA 3WQSB 1BE6A 4HVCA 2WV9A 3G82C 1DG1G 1RPNA 3IAM6 3KALA 3LKDA 1X80A 3AFGA 1TUGA 3AUAA 5K2MA 3A6ZA 3SJCA 3TSCA 2A0YA 3FYUC 4H7DA 4JAVC 4D0SA 3EXEB 3H84A 3KZCA 4WK6A 2FFJA 3E4BA 3T7SA 4F4HA 4FOTA 3PREA 1MORA 1O9BA 4V02A 2X0DA 4DLAA 1VC2A 4M1OA 3ETDA 1SD1A 3VR5H 2L17A 3OPMA 2QMHA 3DTTA 3F5FA 2HRDA 2UWJG 4K86A 5SICE 2Q07A 4YJ2A 6GPBA 4KRFA 3FU0A 4LBWA 1O1YA 3AR9A 5JNWA 1FFGA 2IQIA 4QASA 3ICWA 1G0NA 5FBKA 4PCUA 1C7RA 2RBEA 3QPVA 5GZ3A 2AFHE 3TWQA 1R88A 1XRLA 3KAQA 3VU9A 5ENPD 4A2QA 3KJFA 4CBVA 4E2XA 3H1BA 2XEEA 3ELBA 3H0EA 4RDHA 2P0AA 1OZGA 3EHNA 1YKSA 3HZZA 5TRTA 5JQGB 2SCUA 1P77A 2V7QD 2ZIXB 3NS7A 4OQFA 1TZJA 1YA4A 2LD4A 5AW7A 3QWFA 4N39A 2GMWA 4BQQA 1TVKA 1RZVA 4OVVA 2Q8QA 1EDUA 4JB3A 4KMRA 4M46A 3GRAA 4MR7B 2D0IA 3R8XA 4H3HB 3OZCA 2HCRA 2XH8A 4QDTA 2I76A 1MVLA 2BFDB 2YZ7A 1YASA 4CKYA 1TVCA 1FX1A 3P2EA 2QEQA 1ARZA 4DSNA 1E77A 3TN7A 3DT6A 2VT6A 1E1CA 1J2YA 1KLXA 1XI2A 3O7MA 2MINB 4Q3EA 5FI3A 3KKNA 2PUCA 1O0CA 1E9FA 1NOIA 2BP7B 4LY0A 1GPMA 1QB7A 3DBOB 3LK7A 3PQEA 4R6XA 3UXMA 4DA0A 4KT6B 2LCQA 2PY6A 3AV0B 3ULKA 1GRVA 1QTIA 1W4CA 4ZTBA 5D6NA 4RTPA 2G36A 2AOTB 4MAMA 1IG3A 1CT9A 1L7DA 1I80A 1XF1A 2O7NA 5FWDA 1QRUA 3I2IA 2B99A 1FCHA 3RJVA 4RVSA 4PHFA 4MJXA 1LJLA 2HBZA 1SZJG 3ZWBA 2IOFK 1E1RA 1G2PA 1E8WA 4Y2SA 4KKXB 3VTXA 3RC9A 3VR3A 4DCVA 1W7AA 2DEUA 2ZYAA 4DLRA 4WFIA 4P9NA 1TAQA 4QBKA 5BSFA 4CF5A 5AUOB 4WFKA 1A9PA 3OQJA 2F55A 1U2GC 5HKPA 4H18A 2RH9B 3BFVA 1ZD9A 3QU2A 3O1IC 4X1YA 4ZO9A 1H3FA 5JBNA 5JAOA 3GLGB 2XXAA 2B8JA 2CF6A 2W8ZA 5ES4B 4UBJA 2J8ZA 1QDUA 2FKAA 5IH3A 4PC7A 2QSUA 5PNTA 4A82A 3BB1A 1WX1A 3MTIA 1L1EA 1C0IA 5HK8A 4DHEA 1NHWA 1VBNA 5CVUA 2WKPA 3ZGVA 2LAHA 4C6SA 5JJTA 4BLVA 2YW9A 4WACA 1KY2A 5H7PA 2I7DA 3PVSA 2A5FA 2QNRA 4XUEA 2VZ8A 1G20E 3RRNB 5EIBE 3NBQA 1NVKA 2A4MA 2AR9A 4HEHA 2CXNA 3OP4A 4HRMB 1D1QA 3GXOA 4DR2B 1X4RA 2C7GA 2R00C 4IUCS 3V7YA 4ZVPA 3BT7A 3AKEA 2IA5A 1HDOA 2QORA 3FMGA 3D6JA 3EVBA 1GPYA 3ZHCA 1G5TA 2CHVA 1S8NA 1R50A 2Q0SA 4HMQA 3VTZA 3ZQ6A 3PRKE 4E09A 3KEGA 2J45A 1MJ0A 2BJVA 5CBNA 2GAIA 4FYYA 1HDEA 3UO8B 4IJMA 2OGTA 2KX7A 2XAUA 1L5KA 3AU4A 4F06A 1X3SA 5I9LA 3N28A 4B6QA 5KWIA 4B3HA 5IPFA 2DPHA 5C7OO 4I9FA 1OD6A 3A6FA 5JXHA 4QPNA 4XIJA 4QTUB 2Z9BA 5BUSA 1MGOA 2PZEA 3RRBA 1LKZA 3U7GA 4DDVA 4UPDA 1OB2A 3JTMA 2B0OE 3CVLA 1AY0A 2OKGA 3OEHA 4XAQA 3SK1A 2OTCA 4YXWD 4DK5A 4TXHA 4F2DA 5LPNA 2AMVA 1NTOA 3VVBA 2HX1A 4EB6A 1YDWA 1KP2A 4KN9S 4X8MA 5J4LA 4YDSA 4QRHA 2IW1A 2OD7A 4BNMA 1DQSA 2HTEA 4HOUA 2H16A 3IE0A 4QBTA 4TMTA 5DOZA 3AR2A 3CF2A 5CBPA 1M1ZA 1Z38A 4A3VA 3BHJA 2CLOB 3U3WA 2O3TA 4JA2A 1FT2A 2H9IA 3DEHA 3NEYA 1ESMA 3ID6C 4HWKA 4BFVA 1QMGA 2H4XA 2HYZA 3A8TA 1IN5A 3SAJA 4F4CA 3UK1A 2ZCJA 3PVLA 1B76A 1TQ2A 1P3DA 3H4MA 5EDSA 5KBYA 4N76A 1NE7A 1Q1AA 4TMVA 4Y9RA 4YMVA 5C5IA 2P9LG 2CKMA 4I4IA 4Y6OA 2X4LA 3RVSA 3PNYA 4KIUA 1E9AA 2EX4A 3KUXA 1MDBA 2XUJA 3GA0A 1NSYA 3OHMA 1PT9A 5L3QA 4W5QA 3KJEA 4G37A 2O2XA 1JXAA 1U8FO 4P7KA 4A1OA 2X0KA 3IT0A 3C72A 2FUG6 1U3UA 3GDGA 4JYAB 2GJKA 3U60B 5JJ7A 2WOJA 1F1BA 2GN4A 1ZHFA 1P7WA 2WFZA 1XL0A 2XNSA 2C8VA 1D8DA 1VZ3A 3L6EA 3R41A 2ZPAA 3BH0A 3IDSA 3PHHA 4JT4A 5TF4A 1OUMA 3NF1A 1FRQA 3LUGA 1FSZA 2FF7A 1EP2B 1C7IA 1CDDA 3FG9A 3IDZA 1TX4B 4LOAA 4XWAA 4WY8A 1XMIA 3RVPA 1TKRA 1SUPA 1UQRA 3N7TA 4G1FA 4ARZB 4EQ6B 1U8TA 2EX0A 2XENA 4MO9A 4QDKA 2YHUA 3U4GA 1OXBB 3STYA 1OBOA 1QWSA 3AH8A 5ISMA 1Y6IA 2PL9A 2BF4A 3GPBA 1S2OA 1G16A 5KNHD 3PHLA 4LF4B 2PKQO 4NIKA 2YVLA 3GWGA 1CLEA 3O94A 4U6NA 3ZBUA 3V97A 5JYCA 4QNMA 2OFXA 3RARA 3HXCA 4UDYX 1L4HA 3ZU5A 5AOXA 2A9OA 2I9PA 3JV7A 4LS3A 5CA0F 2NU6A 1KP9A 5HMMA 5DK4A 1OC2A 2ID9A 4ENTA 2NW6A 2BWJA 5AHKA 4GP6A 3E1GA 3WZ2A 1Q12A 3RFCA 1VJ0A 2R1TA 4RQIA 4I4TB 4K6GA 3O6VA 1XRNA 3Q0TA 3MVEA 4IRUA 3OICA 2WSYB 3SEFA 2L82A 4EI7A 4FM9A 4URXR 3PWSA 5FAKA 1T8PA 4U2GA 1Z26A 4GDFA 1O1TA 3ZLVA 1DDOA 4M1EA 2ZBRA 4X71A 3WL8A 3D9IA 2W2KB 1SHKA 5FCDA 2WPVA 1H4SA 5A5FA 3IE1A 4GKBA 1K0FA 1ZJYA 4MLZA 3UANA 1ZJZA 4D74A 2CJPA 5DM0A 4MYDA 2QJOA 3QELB 3OFVA 4YMIA 3SQNA 4IICA 3SXUA 2QAGC 4KLRA 2IPLA 3L8FA 1JFLA 1RPJA 2H0RA 1JHRA 4AM9A 3FUMA 3QWPA 2LPMA 2O7SA 3KXLA 5AI0A 2O8EA 4DMFA 2P40A 1ST3A 3EJWA 2R7MA 2CXXA 3A9RA 3M0EA 4C6HA 1HFWA 2KB0A 4O08A 5DN9A 3HV2A 2X5GA 4LWOA 3V6MA 1KFKB 2X5NA 3KVNA 3REGA 2FJEB 4MPRA 5A23A 1ZNYA 4FJ2A 3ES9A 5DVZA 1E6MA 2BE9A 1PGOA 1IEWA 2H5LA 5K3BA 3C1AA 3R9XB 5ES3A 3EQ6A 1NBWB 3FNFA 2WWHA 1JMVA 4FDLA 4REOA 1SD5A 4BKQA 5JSHA 3A6HA 5EZSA 1P39A 5FUVA 3IR7A 4UFNA 2FX3A 2XECA 3A4IA 1IEVA 4WBNB 1V5WA 4FEEA 1TE2A 2J09A 5DGXA 1KKMA 4AMZA 1VGRA 2XKAA 3F3KA 4L50A 3BD6A 1ZZEA 1DPGA 2E7ZA 3OPVA 2WIGA 4P08A 3PEEA 4FHCA 4X63A 4HWPA 3CHRA 3I53A 2AG6A 4AJJA 5JSQA 1B8NA 4QECA 2FBNA 3FUEA 1IBRA 2CFCA 4RHTA 3T5DA 3W8DA 2JL1A 4FFRA 3PC3A 3BXOA 2FEXA 2FUNB 2X9NA 3F6EX 1AKNA 1GL9B 2B1QA 2B83A 2D5AA 2RG1A 3CIFA 4KE6A 1IY8A 2V54A 1OWOA 3WP0A 5FFNA 4Q9NA 5F1PA 2WP0A 1I01A 3OSUA 1ZQ1A 2Z4RA 1A72A 3ZEAA 3CUKA 2KS6A 4CG0A 4M6WB 2WMOB 4R1QA 1KYZA 3Q2KA 4HGNA 2JGMA 2WD9A 2QB5A 3OEWA 3TNYA 1EVYA 4NXMB 3WBKA 4JCCA 4DR1B 1CYEA 2YMPA 4Q3OA 1V7ZA 1ZSVA 3QXGA 3T3IA 4CGVA 2BAGA 1XCJA 2QT1A 2W83A 3LXMA 2B1RA 3MMNA 4XCXA 3VTKA 3OLZA 4W5OA 4TV8A 2GPSA 3E37A 1EGAA 4FIZA 4EUKA 4HD8A 1G9XA 1FOEB 2ZWIA 3PZ3A 1KRHA 2Q4BA 3N39C 2AOWA 2ZTHA 3B5IA 3MCTA 4KWTA 2GVDC 3WQBA 4CIAA 1MO6A 4DY4A 3O91A 1EK6A 1C8VB 2HBRA 3W77A 4PX5A 3VNUA 2NTNA 2AVDA 4TYQA 4N4AA 1ZJ4A 5DGTA 4LHVA 3DGEC 4NNJA 4QX6A 2FW8A 4YWHA 3WP1B 2W22A 3L5KA 5I9NA 5HZMA 3JQGB 5JALA 4DX6D 1T6NA 4OK3A 4BT8A 5JA4D 3KUUA 4RVUA 1OH6A 5MDHA 4QARA 5BSWA 4F92B 5DV9A 3ZCRA 3FTVA 2ZIVB 3QKTA 1KDRA 3K0EA 4FIDA 3T9DA 1G5HA 3Q0EA 1QFYA 3GCWA 2AXNA 3VKWA 2CNNA 5KHAA 2HB6A 2DHDA 4NE7A 1G19A 3HK2A 1BXKA 1HOXA 1R5OA 3MINA 1TECE 4KVAA 2Y0EA 3M3PA 4F38A 1LSJA 2WWRA 3V32A 5BV2P 3WMXA 4K9PA 4KTVE 3DFUA 5FWAA 2BW0A 1WDMA 4BCBA 3G0GA 3WISA 2P3LA 4WZBE 2K2QB 3HGMA 1NF8A 3TECE 4GO1A 2JAOA 2A5EA 2P91A 3A6DA 3EG9B 4N5QA 1K88A 4KJZA 1E62A 1FCJA 3TBFA 3ZVRA 4EHLA 4RF3A 4CM1A 1MUUA 1XOIA 5ALOA 2J32A 4U7DA 2ZI3A 2NPFA 1Z18A 2ABWA 1OGJA 4KPEC 3VYSB 4DNFA 1IJEA 4IWXA 1JLMA 1O54A 2D1FA 2LO6A 1YI1A 3S29A 1I51A 4KQKA 4RM2A 4CEJA 2ADFA 4MP6A 4ZVQA 2QLFA 2E48A 3IMEA 4L1KA 4DZRA 4EJFA 2DCUA 1KQFA 2ONZA 1RYBA 4JT9A 1M2JA 4HB3A 1RRMA 4RMIA 4BMOB 1NM5C 2CZQA 1OAKA 2ORED 1LGYA 4PS8A 1SBNE 3KSMA 3NBYC 4LOLA 2PE5A 1W46A 3FKSD 3HFJA 1Y6FA 4HB5A 1J1ZA 3DOEA 2QY7A 2OO7A 3QE2A 5B3SE 1G3NB 1Z39A 2WF5A 4F0JA 1QM5A 1P74A 4FYXA 4MVJA 2M6LA 1CDEA 1JCSA 2QPOA 3I09A 3JVEA 4QEZA 4XA8A 4LK2A 4MQ6A 2JAHA 3V1UA 3GT0A 4JYCA 2ZRKA 1QGUB 4ZT4A 4ZZ2A 5JOQA 4NH4A 1BDHA 2W2MA 1JQ3A 4XPIB 1KK3A 1DCMA 1FLDA 1T0IA 3KV1A 2XMCA 4L78A 3JYPA 2Y1DA 2Y4TA 2VDJA 2Q0HA 1XXHE 2B1IA 2GAFA 2GW1A 4EJSA 4F2HA 1AKWA 1GUDA 3SZ3A 3NZUA 2ENWA 3AHFA 4OXYA 4R7TA 1AHPA 1M2EA 2D7CA 3ZXUB 4RF4A 1PR4A 3DCNA 3HYCA 4P7JA 5D01A 2ODQA 2XUIA 4LHXA 3L9TA 3DOIA 3PDUA 5IX8A 1ND6A 3HL4A 3PNBA 4H59A 1EYHA 5EUMA 1XZMA 5AHXA 3UAOA 3WIOA 4EG6A 2ZYHA 5JFGA 2QGFA 1FP4A 4X91A 3UJ8A 4WBNF 1W1WA 1H0RA 1IPEA 2IYSA 4AD8A 2CW5A 5C7LO 4HADA 1L1QA 1VIDA 2VDLB 4QYWA 1TUIA 1U28C 4LWQA 2DC1A 4S3MA 4NCXA 2VP4A 3F7MA 2AUTA 3RBAA 3QHAA 4N49A 3UUEA 1BHSA 3EGDB 3VKFA 2VBIA 3SSNA 3C7KA 2CUZA 5IK2D 2VZ0A 5A6CA 4X1KB 3A2NA 1DRWA 2BMWA 1DAPA 3AV3A 4GBED 4RPCA 2QMZA 4IWNA 4EZJA 4JP2A 5ENOD 1WUYA 4EUHA 2XGMA 4WNGA 1A8UA 1OY1A 5GM1A 5KX5A 4DMKA 3H5AA 1FFCA 3CLKA 3UENA 3FH7A 4TV3A 4U07A 1SH7A 2CJWB 5IVIA 1MLDA 2Q27A 5E3JA 4B8CB 3U1BA 3DLHA 1U63A 2Y66A 4JBLA 4OQDA 3RV4A 5EYLA 3UM3A 4IIBA 4LCBA 4U7EB 4NMWA 4RYDA 3QWIA 3QSGA 1DEAA 3PC2A 4YNBA 5MGNA 4UYKA 2Y77A 5AESA 2BFMA 2IY0C 4KNWA 3ZHYA 3RAUA 3PQ2A 1A7AA 3BT3A 3I23A 4GXQA 5JBQA 2BUGA 1Y63A 4GUDA 2Q2OA 3BC1A 2O2GA 2J31A 3G9ZA 3G5TA 4BBJA 3MRSA 2NO5A 3ENKA 4YJ2B 1PGJA 1HL7A 1ZK1A 4PHTA 4DWVA 3LU1A 3OZUA 3ADKA 1IDN1 1RWXA 4IDBA 3LBIA 4OQNA 1X2BA 3WS7A 2EEZA 3I37X 5CIWA 1O1RA 1AB6A 1GPUA 4DLOA 1EWVA 1W94A 1FPMA 2G1PA 4UYJA 3O4JA 3ZCPA 3NNSA 3GK3A 2CYCA 3G2OA 4LFCB 4KXMA 2EIJE 1C0PA 4EOGA 3Q8LA 3FWKA 3ZD7A 4OKSA 5KWJA 1Y8MA 3DMDA 4BE9A 1IVYA 2FDRA 4DA4A 3L93A 1BRTA 4HDSB 3U3MA 2J48A 4UDNA 3CW8X 4WH0A 1QG6A 1HH4A 2JLBA 1R3UA 5E0KB 3Q7QA 1S96A 1AK2A 4QEDA 3T0FA 1W85B 1ODKA 3ZHUA 3DVAA 1X86B 3TM4A 1FP2A 1CNEA 4MS1A 4BPRA 2AN3A 3DEOA 2FH5B 3IB3A 1YS4A 3ONEA 5DPMA 5ER6A 3NT5A 4DJJA 2YC2C 4S04A 4BNHA 2AD5A 2GZ2A 2FUG1 1K75A 4FFBB 1WEKA 3BHMA 2W9JA 4WVFA 3W4KA 4DXAA 3V9PA 2QRJA 5LP1A 2ID7A 1E3JA 4R54A 4TRMA 4UMDA 1RDFA 3E9MA 3IBEA 3BWXA 3PQFA 4I2NA 1LTKA 1X8KA 3VLDA 1NT2A 1Y6ZA 5JO9A 4GUAA 1GTSA 2AVPA 4BB6A 2DSTA 1Z4MA 2R2AA 1WF6A 3NJRA 4NYJQ 2W42A 4BEWA 2QHXA 4YRDA 4L3OA 2C2XA 3IYLW 1YB2A 3N0XA 3UHJA 5CEFA 2IPMA 1C7FA 4DPRA 1L4GA 2P7IA 1OPXA 4TWAA 4WESB 3KR9A 3NHWA 1YQDA 3GUHA 3KKEA 3M2TA 3SZMA 4B80A 1M2HA 1HDRA 3V2HA 3THWA 4Z49A 4IS2A 2Y9MB 1HETA 4BVLA 4N1AA 4ZT7A 2V4HC 4UUCA 4FHFA 2XCOA 4MS4B 2X2OA 1QLWA 4MRVA 5HK9A 1IOZA 2IHUA 3FSRA 3K2QA 4YMWA 1M6VB 3TEMA 3ZWNA 1OBCA 1CNMA 2EKDA 4LMAA 1DT3A 5G4KB 3RD5A 3HBJA 1NW7A 3VYUB 4XI9A 2OA0A 5JROA 5CLJA 2QTZA 3RRMB 2FN8A 1IK6A 3HEBA 1BC5A 4HH3C 2HF8A 4UARA 5DHFA 4B33A 3Q73A 1Q1ZA 1VLQA 2IC5A 5GONF 1T4MA 3A1CA 5GQSA 3T9AA 5L4NA 2B0CA 5FUXA 4LGCA 5BSKA 1KMHA 3V42A 4BRUA 1FYXA 4C5BA 4TTIA 4FOOA 1ULZA 3BE8A 1SRQA 5HZHA 3KEQA 2C7OA 1Q2XA 3P0RA 3H7IA 3S2FA 2UZ1A 2Q1SA 3DKVA 2QVCA 4AXXA 2QYUA 3E32A 2ETXA 4KIGA 5IJAA 1S0PA 3DR5A 2H07A 2CJFA 5K3CA 2F8TA 3ICQB 3LRTA 1YCHA 1PJQA 2BELA 2ZRDA 1WCXA 4K5QA 1PE0A 1P45A 1YS9A 3VNAA 3RF6A 2C9CA 1X87A 4J8DA 2JAQA 4GI1A 3HJRA 1G3MA 1JLSA 3F6PA 3IMFA 3NHRA 4LNAA 3IPXA 1QKKA 1T5OA 4QBFA 4TMFA 2YOGA 3B52X 4NHEA 1HNWB 4KQHA 2BZ0A 1F2UB 5ARGA 3B1VA 1Q3TA 1JYSA 2ZAMA 2B30A 3L49A 1SULA 3VX4A 3K4PA 1OVMA 2YHIA 1E2UA 2Q62A 3O26A 1IUNA 1JWGA 1BWRA 2DWZA 4DHWA 4Q4HA 5B1DA 4R51A 1UPUA 1ZRMA 1VG0B 5EXSA 2AVNA 4PFSA 1ONPA 4F6CA 5L40A 2XUHA 3CF4A 5L53A 1IN1A 4QHYA 3GX1A 4LXTA 2BKKB 4QVIA 1A9XA 5IANA 3E2MA 1KYXA 3H75A 4ISCA 4IFIA