4GYWA

Crystal structure of human o-glcnac transferase in complex with udp and a glycopeptide
Total Genus 281
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
281
sequence length
715
structure length
695
Chain Sequence
b'PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKHIYDNRIVLNGIDLKAFLDSLPDVKIVKNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
total genus 281
structure length 695
sequence length 715
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gywA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gywA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gywA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gywA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gywA03
2VYIA 2IUYA 3CK8A 1IYGA 3GYZA 3TOVA 2PQ6A 2KCVA 4MI6A 2ATIA 4HOQA 4BQIA 3G2NA 4W6QA 2VCHA 3LKUA 3LYAA 4N3AA 5KJLA 4MHSA 1L5WA 3HBMA 1BX3A 4F9FA 3TGOA 2BUGA 2FI7A 2Y4TA 2G9RA 2J9QA 4GCNA 3BCUA 5AYWD 5JJ7A 3UQ3A 2G9QA 2SKCA 5I45A 2BGUA 1NZDA 1PYGA 5DU2A 2GM9A 3S29A 1NOIA 5JJ6A 4PQGA 2QNBA 1B89A 3MT8A 1XNFA 5KJNA 1NLMA 1KLXA 3RHZA 4CGVA 2Q7FA 5FZRA 3MS7A 4AY6A 1FTYA 2XCBA 4N3BA 2HO1A 3ASDA 3MS2A 1A8IA 2MHKA 4I9EA 1Z8DA 2DBAA 2WPVA 2QN9A 4RBNA 4KQ2A 5G05J 3NAZA 1RRVA 3RT1A 3VTXA 1GGNA 2IV7A 4WACA 3CK7A 1JG6A 4O6FA 2ASVA 3CX4A 3DD1A 4N5CA 2KCLA 4YNDA 1P4GA 5JTUA 1W3BA 4BFCA 3KS2A 3OY7A 1NVKA 1Y6GA 2AMVA 4J8DA 3CVLA 4GZ3A 3DZCA 4HOUA 5A6CA 2PRIA 4HORA 2QN7A 2VCEA 4UI9K 1WV0A 1M5RA 2QN3A 9GPBA 2FF5A 4U0ZA 3EBOA 2LSVA 2XGOA 1NOJA 3CVQA 4LEUA 4YI3A 1OUVA 5ENZA 4BQEA 4MI9A 2GEKA 4I9CA 1L5RA 3S7BA 6GPBA 5HI7A 2FO7A 3BEOA 3HYMB 1WM5A 4I2ZA 1P2GA 3HBJA 1J39A 3GZ1A 1PN3A 3G2LA 5IKPA 3MV3B 1VGVA 3NB0A 5DXFA 4WUYA 4GYWA 2VSYA 2AW3A 5TVGA 4BWRA 3E3OA 4GYYA 3S7FA 1PNVA 3CK9A 2QRQA 2C0MA 3WXXA 1ZBPA 4FZRA 3T7DA 4RG9A 1H5UA 2XGMA 3BDAA 3VDMA 3MQFA 1FU4A 3URZA 2IV3A 2IF4A 2X6QA 2WTXA 3ZCRA 1YA0A 3MRTA 4HLNA 4Z5XA 1A17A 3T3GA 4U0UA 2SKEA 4GPKA 1V4VA 4NEQA 3L7DA 4M60A 5D0OD 4UQXA 4X6LA 3QWWA 2QN8A 5ARFA 4I17A 3MKRA 3D0QA 4GPBA 1JIVA 1XOIA 4GA2A 5C1DA 2JJMA 1Y6FA 5EX3A 3HBNA 2IYFA 3WAGA 2QN2A 1Y8ZA 2L6JA 3JYSA 2VQ2A 1K08A 2ACVA 2AVPA 2QRMA 2JLBA 2ZB2A 3RIBA 5FZQA 4I2WA 2VGXB 3QOUA 3CKCA 3FP3A 3TG5A 3BCSA 4LDPA 3OKAA 3PE3A 1HXIA 1RZUA 5BNWA 2GW1A 2XCCA 2GPNA 1C8KA 1L6IA 1YGPA 3CUUA 3ASHA 1JIXA 5HXAA 2YQ8A 1C8LA 1F0KA 4YI5A 3C48A 4N3CA 3FFLA 4CTNA 3AMVA 2QRPA 1XL0A 3AS8A 1P4JA 4B94A 3Q3HA 3RSZA 3E4BA 3Q47B 5D01A 1Z62A 5KJKA 1KT1A 3CKBA 1ZU2A 1GPAA 1EXVA 5G04C 4G26A 3CVPA 3SF4A 3SZ7A 3ZCPA 3LY8A 4GA1A 4AY5A 2YJNA 4NESA 1E96B 4RIFA 3NP7A 3VUEA 4N2SA 3AS4A 3PE4A 5CHEE 4J8FA 1SXPA 3S27A 2GJ4A 3CVNA 1JEJA 2X0EA 3CUVA 1WUTA 3DDWA 4AMGA 4F97A 4G25A 4GCOA 5BW8C 3Q3EA 4BT9A 2R68A 3S28A 3C4VA 5FT9A 3Q5MA 3MTAA 4M83A 1RZVA 2NC9A 2QN1A 2C2LA 3ZFWA 3T3DA 3T3EA 2LSUA 2X0FA 1WAO1 3OXFA 2C9ZA 1KT0A 4KYOB 3KD7A 5LCWJ 2GPAA 2C1XA 2GPBA 2R4UA 2AV6A 3L7BA 2ACWA 3L7CA 3UYLA 1HLFA 3CUWA 4MI3A 4I1AA 2C1ZA 2IEIA 1NA3A 2O6LA 3OT5A 4YVOA 3OXLA 1C50A 1JIUA 1EM6A 4QLBA 1UQUA 3D0RA 4MRAA 4H7XA 2JZCA 4HWGA 3Q3IA 1FTWA 5A7DB 3CUTA 3MTDA 5LCWC 4HOSA 3NP9A 4H7YA 1GZ5A 3GUHA 4L22A 1P4HA 2VGXA 1ELWA 3IAAA 5M72A 5TMBA 4AIFA 5EKQD 4WADA 3RU0A 5D0QD 2VG8A 1WW2A 3IA7A 3G2HA 2X0DA 7GPBA 5CCLA 3S2UA 4JA9A 2ECPA 1F6DA 3BD7A 3PDNA 4MHOA 4A1SA 3CEJA 3D1JA 2YHCA 3LPZA 2WQHA 3UYKA 3Q49B 2FETA 2QLLA 4EJ2A 4Y6CA 4WNFA 1AXRA 2KCKA 3CV0A 4AM9A 2KS6A 1NZNA 1ELRA 4RELA 3ASFA 1XC7A 1P29A 4NQ0A 4G24A 4ABNA 3ZCTA 4KXKB 5BT1A 1WV1A 1PC2A 1Y8MA 3ZPJA 4U04A 4U07A 4CGWA 2AZDA 3DDSA 3QWPA 3U3WA 1GFZA 1KTIA 4GZ5A 1GPYA 3TSAA 2XA2A 3S0JA 4BTBA 1JG7A 4XI9A 5D00A 3QWVA 3WADA 2FBNA 4X7RA 3OXGA 5DIZA 4F96A 5DBKA 3G2KA 1HZ4A 4EL5A 2P6PA 3EBPA 3T3HA 2ONDA 3S7DA 2PZIA 4Y6WA 2G9UA 3O3CA 4WNGA 2R66A 3QDNA 2IYAA 3TAXA 3FWVA 2GT1A 2V5FA 3LY7A 4GZ6A 2XCUA 3IEGA 3BD8A 2F9FA 3MTBA 3RJVA 2IEGA 2LNIA 2F3PA 3H4IA 3ZHEB 3RKVA 3MA5A 3NCHA 1LWNA 1O6CA 2FFRA 1FU8A 4G1TA 1Z6QA 4REMA 3VUFA 2FEZA 5G04J 1AHPA 1LWOA 2XEVA 2UWJG 3HBFA 2R60A 4UQYA 3SYMA 4F3VA 3GPBA 4WNDA 3K9IA 1WUYA 3G2IA 4BTAA 2XA1A 5JTTA 4KBQA 2HYZA 4U0SA 3T3IA 1XL1A 2OOEA 1P2DA 1IXYA 3RO2A 3ZGQA 2Q6VA 1L7XA 2BGTA 2HR2A 4RIHA 4BQFA 1QZ2A 2R4TA 5TMEA 3QHPA 2H1HA 2C0LA 5FZSA 2BISA 4G2TA 1E1YA 3GW4A 2XA9A 3L79A 4X7MA 1FU7A 2VSNA 2PYIA 3ULQA 3NC4A 4GA0A 4XIFA 3GZ2A 4XI0A 3COPA 1HH8A 3RO3A 1NOKA 4CDRA 3MT9A 3ASGA 2R5SA 5TMDA 1UQTA 2X6RA 4G2VA 4JL0A 3VTYA 1GPBA 4N2QA 2P58C 1B4DA 4CTMA 1XKXA 1IHGA 4YVQC 3CV3A 2F3UA 4NC9A 2QRGA 1SXQA 4MICA 4RG6A 1E4OA 3OTGA 1P2BA 3OTIA 2H1FA 3FROA 4WHMA 2F3SA 1YA6A 2KC7A 1NA0A 3E3LA 4J8EA 3ZHEA 5JJTA 3RSCA 3Q4AB 1L5QA 4YUAA 8GPBA 3LCAA 4CTOA 1NZFA 3ZCSA 3ZCUA 4UQZA 4EKEA 4AMBA 4NRHB 5FJYA 4M7PA 3Q15A 2C4MA 3BD6A 1P5QA 2UY1A 4KQMA 5IKOA 5DLDA 4N9WA 3MEKA 1QKJA 4RIIA 5HQ8A 5KJMA 4RIEA 4UI9J 3S7JA 3VDNB 2XCIA 2XMPA 5G05C 2OFFA 2I6HA 4RIGA 2QZSA 3CUYA 2BFWA 3OKCA 4AN4A 5EX0A 3NF1A 4BT8A 3R9AB 4EL0A 1FA9A 2E2EA 1Z6PA 4LEIA 4UI9C 2PL2A 4APOA 4ME2A 5FTPA 4IN3B 3T5TA 2XPIA 2IFUA 4HOTA 2PQNA 3L01A 1PSWA 3MRXA 1GG8A 3ZCQA 1ABBA 2XGSA 2FF4A 2SKDA 5GPBA 1K06A 4G23A 2GEJA 3CEMA 3O48A 4RENA 3UPVA 2PQRA 3MV2B 3OKPA 4EQFA 1L5VA 4JHRA 3QKWA 3ESKA 1QQEA 3KAEA 3MS4A 3MSCA 3CEQA 3OY2A 3EDTB 3C4QA 2F3QA 2HY7A 2KATA 2PRJA 3LY9A 2PYDA 2QRHA 4GYOA 1QM5A 3U4TA 3WC4A 2VGYA 3BEEA 3ZCVA 4KQ1A 1IIRA 3NPAA 1TJCA 3N71A 3L7AA 3MBOA 1C3JA 5CCMA 1UZUA 3G2JA 3H4TA 3BCRA 3MRVA 1FTQA 4X7PA 5LQDA 5ARGA 1WW3A 3E3NA 3UUXA 2UY1B 3TG4A 3CEHA 1FC0A 2QFCA 4FKZA 2G9VA 1L5SA 1XV5A 3QKYA 4J0UA 4WNEA 1FCHA 3ZN3A 1FS4A 4N39A 3SYRA 4EKYA 3AS5A 3OTHA 4JA7A 2QLNA 2Y4UA 4W9RA 3MT7A 2QLMA 2IW1A
chains in the Genus database with same CATH superfamily
2FQXA 3EF0A 4FKBA 4HBGA 4Z4CA 2GCOA 2JB9A 3DMGA 1KNQA 4B3TB 5CVCA 3HXFA 2Y4TA 3MSXA 1BDIA 2P40A 3U7FB 4DG8A 4K8RB 3VA7A 1ZOLA 1I4LD 2IHZA 4AL4A 1B89A 1LEHA 4DQLA 5DISB 2ZGGA 3L4JA 2HO1A 1K6MA 1T5SA 4LUCA 3VR5D 2H4JA 5F5NA 4GQAA 3P2EA 2GUGA 1MRZA 1CDDA 4F1WA 2BKGA 4X63A 1NUAA 3DKIA 4PX9A 3AY3A 3RVRA 4IQFA 4C9BB 3DEHA 4E3WA 4B4DA 3FUTA 1QLWA 4TKVA 2CVPA 5AK6A 1D4AA 3DF9A 4Q3KA 3NH6A 3NRBA 3ILSA 5CA1A 4KIJA 4RVSA 3ZCXA 4UQLA 2XCSB 3E3AA 3Q2KA 2IIQA 5K8LA 4GU5A 1ZKDA 3V4FA 2G88A 4QUBA 4JXTA 3HSKA 1N9KA 4XUGB 3OESA 3D8TA 1WCIA 3F9CA 1RP1A 5KCMA 2CF5A 2XYHA 5J2UB 4N5DA 1O3YA 1JH9A 5EIFA 1ZU5A 2BGJA 3E4BA 3EXEA 3SE0A 3CVPA 4RCVA 5FD8A 1HMYA 3SKXA 4AJJA 2AIRA 4FYJA 1JCSA 4D3XA 2I4OA 1Y3HA 2BEKA 3CUVA 1A9TA 1XTQA 1OGJA 3CR3C 2HEGA 1TO2E 2CCGA 1Z7BA 1JIIA 4YJDA 3QFTA 4XQEA 2IDJA 1QAMA 1U1IA 2JVJA 5EL0A 3VLEA 1J0EA 1QRRA 2HWKA 1NW5A 5CM9C 3UXYA 3KSBC 4JH0A 5EYLA 4NX2A 5EIOA 5T8KC 3RV4A 5M5BA 4GXRA 2NM0A 2DQKA 3AKEA 3WSTA 5CCLA 3QHAA 4JOCA 3S2GA 1GOTA 2J31A 2ETVA 3CH6A 1YJBA 5BYKA 4F6RB 1LLCA 4UWKA 1MO2A 3CHRA 3W2EA 3FG9A 1LPOA 3EF3A 3PZ2A 2FQYA 3DNPA 5H5JA 1IMOA 3HVEB 3LP6A 2YDXA 5CIYA 1Q15A 4B3JA 2O50A 4RPIA 4EITA 4Q3AA 4HMPA 4R01A 3TZBA 3ANMA 3PDJA 1CZLA 5FBKA 1EBBA 2R79A 3FWKA 3QVKA 3QFCA 3PVLA 3DSUA 1XZCA 5E3IA 3ADDA 1F2UB 1PEYA 4ON9A 5F2EA 1G7TA 3BD8A 5EUBA 1TM5E 2HFKA 4YMLA 2K87A 4M36A 4G5XA 3ENEA 3LI2A 1Z4KA 1WB9A 3CF2A 4ENSA 1XNRB 1NVVQ 5D3ZA 4HAWA 2OXCA 1NY5A 3VR6D 4W9MC 3F6YA 3V7YA 3VV2A 1RWBA 2AX3A 3QIAA 1FY2A 2F6RA 3F47A 3ITDA 1K1EA 3SNKA 3NTQA 3RGGA 3AEUB 5BV2P 3EGEA 1VE5A 3TXAA 1FZTA 3NUGA 3NTRA 2V65A 4MI1A 1TQ4A 1ZMOA 5TQ2B 3NTXA 4BV3A 1OT5A 2LBPA 2Z43A 2OILA 1SN7A 3PQ7A 4NURA 4E13A 2AQKA 4MUKA 2QZJA 5DLDA 2HPAA 4X8MA 2I2OA 3GLTA 3BWCA 4PHHA 1YBHA 2PLRA 3DFIA 3ZTTA 5IFKA 1OD6A 2GMWA 3VTAA 3NNDA 1EVKA 4RTQA 3LO8A 1HDEA 1WCXA 4HOTA 5BV8A 1K3TA 4EJ6A 4MDEA 1KK1A 1Z18A 5KQLA 3ANYB 3I4FA 5K0TA 3LBYA 2ZSAA 1QG0A 1DXHA 4L8FA 1YJCA 4KQ1A 2OMKA 3NPAA 1MV5A 4K2HA 3UJ7A 1CEQA 3VTKA 1BYIA 1YJ8A 4CQMD 2QVLA 1M1YB 5BR8B 3N07A 4TLAA 4IGKA 2IH2A 3B8EA 4E3ZA 2CXOA 1O9BA 1KZ4A 1PQUA 4QFBA 2RMKA 2ZB4A 3GLRA 5EPEA 2AXNA 4RF3A 4R3NA 4JMLA 2MHCA 2QY6A 2AKYA 1LSJA 3CK8A 1BI8B 3K6RA 1SBQA 1LLQA 3HZOA 2PTGA 3UAXA 4S04A 4C87A 4DIBA 2FI7A 5AVWA 4NZPA 4JVLA 3KTAA 3I52A 4LK2A 2DK6A 1FQOA 1EESA 1P4SA 4OGLA 1RHKA 4WA8A 2GI4A 2O8EA 2BLLA 1EB9A 1JMKC 4BFUA 4RBNA 1ZLXA 1RQ7A 4ZFNA 1G66A 4O6VA 2FN8A 1IHYA 2Y2VA 1Y63A 5DEIA 3BXOA 4QGBA 3NORA 4ZO6A 1E8XA 3EZ2A 1FUIA 4DYHA 3EDRA 2CFOA 4MCHA 5JMWA 3L1UA 2D0IA 3WKCA 2IIVA 1XPUA 1NOJA 4I1UA 4HGRA 4D8VA 1KKMA 1RKVA 4QJ3A 4KO8A 3JAMA 1JFVA 1EINA 1BOFA 4AXHA 3NU1A 3W1EA 3UBMA 1PT8A 2AZTA 1YNOA 2WNHA 4PBTA 1BQ4A 2DPMA 3GCWA 3JAWB 4L15A 3OX3A 4DCTA 4BP9A 4MUFA 3AM4A 3X1XA 2P5UA 4QXOA 4O1IA 2XNKA 4FLFA 1XLUA 3HBNA 4J91A 2WF8A 1O87A 2X4LA 4J94A 1VMDA 2JGKA 1U0NA 1OU4A 4D96A 1COZA 1VYHA 5TR9A 4DG9A 3BMXA 2WIAA 3BDIA 5K03A 2NMVA 2HLDD 5B3KA 2RGYA 3EC2A 4TLBA 4DEXA 1Y3FE 3F3YA 4FEEA 2JI6A 5I8PA 1LLDA 3NRCA 2JI9A 3HADA 1TEZA 1SXPA 3ODPA 3D5QA 4JLMA 5AQ9A 1BDJA 1VCMA 4CYMD 4F97A 1DJLA 4GM1A 5FAXA 4E5VA 3U16A 3L46A 3EGCA 3JQ1A 3UZUA 3T1TA 3JQFC 2HU8A 5AICA 4ZODA 4FFNA 2P3SA 2ETAA 5E6SA 2RHMA 1TIKA 2AG0A 5J23A 1EX1A 1S3IA 4BHTA 1X6VA 1A7AA 5AXCA 4LNBA 3IEKA 4LJ4A 2OUIA 4ZAYA 5KIAA 3RUFA 2AXEA 1VMIA 4MUIA 3UMJA 2R25B 2LCIA 1AMOA 3U9SA 3HKDA 3U0BA 2FWPA 4M0DA 3C1AA 3DH0A 1GD1O 5HFAA 1Y6IA 3CV0A 4BVEA 4HVLA 3QMMA 4OEHA 1H1DA 2CLMB 3O4FA 1OYYA 3ZDAA 1P3DA 3TQRA 4RMNA 4IFIA 4IM7A 3TWSA 3ROFA 4ERNA 4R31A 4EEKA 2B7LA 5DBKA 1E2FA 3KETA 1TCAA 4QXMA 3MTBA 2DWZA 4ER6A 2J4DA 4JB2A 1A69A 3IKMB 4NBWA 4GI7A 3N0WA 4JEHA 3GLHB 3ZC3A 3S2SA 2IXBA 1XCOA 3I1IA 2X2FA 4BJ3A 5KYKA 1IM8A 3VM6A 1B8VA 1PQYA 1MJFA 5AOVA 3ADPA 2ZUUA 2FFBA 3ZV3A 2I03A 3NGXA 2ID4A 5EP3A 1EP9A 2H5EA 3W5BA 2DUUA 3CXUA 4V03A 2H1FA 2Y1LA 3AVQA 3UWKA 2OCPA 3HKEA 2P2ZA 1U0LA 1V43A 3O8QB 4K9NA 5EHGA 3F8TA 1PNRA 4TVKA 5A71A 2QX4A 4ZO8A 1ZXBA 4NYJQ 3BTVA 4BE4A 3UT0A 3CNEA 4DR4B 4I50B 5LPNA 4MV4A 1A7UA 4WLUA 1K06A 5AHXA 4DLXA 2XUZA 2P4SA 4DLTA 4P9NA 3SXPA 3PWKA 3I3NA 4TV3A 3DQQA 2FLWA 1Q1AA 4K28A 5HF5A 2HWYA 5J1TB 4HLLA 2RBKA 2O8CB 2XVYA 1HYBA 3SX0A 3KT0A 2VSXE 1O5MA 2F43B 3E15A 1JPNA 2IPXA 4HWOA 3QPDA 3Q15C 1NSTA 1NFFA 3LPLA 3S55A 3W05A 1HE1C 2XX3A 2A5LA 3EPPA 4JXKA 1THZA 1TNOA 2H52A 4L75A 2QRNA 5B7GA 3ANSA 3CW8X 2C5BA 4TTVA 2DPLA 3QWHA 4TYNA 4ND4A 3SC3A 3EQ8A 3ERCA 3ULKA 2IF2A 4MGYR 2P9PG 2Z2YA 4G41A 2ZLBA 4KQ9A 2FWAA 3WXMA 1W94A 1N5DA 2AYXA 1ESMA 1IHXA 2HSGA 3HZZA 5CDHA 4QA9A 3AESB 3SLGA 5MHTA 3T8KA 3DD1A 5A4AA 1Q1EA 2FJUA 3LBNA 3UUEA 1Y6GA 1PZNA 4I1PA 1D9ZA 2IY8A 4IGEA 5DNCA 2J9XB 4AYTA 4AJOA 3DQZA 3ZS8A 4B71A 1MTZA 1N7JA 4JN6B 5EHQA 2Q8PA 5JFOA 5AOXA 1UDRA 1XMJA 4XVRA 1T6YA 1BDMA 2RDMA 5GIOE 2ZSHA 1YZYA 4JLAA 3VU8A 4FX5A 2F8MA 1YB4A 3AG3E 4IYPA 3DE5X 5C1IA 1KI9A 3MOGA 2PKWA 5EX3A 2WJ4A 4FCWA 2ACVA 3W4KA 1DAGA 4M22A 2WKSA 2HA5A 5EIHA 3ZJ4A 4EYGA 1HEYA 2FFGA 1INZA 2VUUA 2PSHA 3TLMA 2A1UB 1KAQA 2XF8A 4JOBA 1WEKA 5DTJA 1NC3A 2ZUTA 4NR0A 3TBFA 3DLPX 4BEPA 3RRMB 4CVNA 1O94D 1G8MA 3RVDA 3VJLA 1T2NA 4U2BA 3HA3A 3BK1A 3D3WA 3H83A 5FCDA 3B3AA 3LNCA 3O8OB 3AHCA 3ONWA 1MABB 2X2EA 5LCWC 3PPVA 1G8FA 4FS3A 3K9CA 3R3XA 3WAJA 2EIME 3RU0A 2VYFA 1ORVA 3W7VA 4CE6A 2JBAA 5G41A 4EAAA 2PM7A 1W5SA 3UYKA 3FHEA 3ZDBA 4MS3B 4G8BA 4W99A 3U3DA 5BW8A 1XC7A 5AT1A 4YPFA 3IBTA 2G76A 4E32A 2BE9A 2GCEA 4QPNA 2Q50A 3PQDA 1TF2A 1HFAA 2XLBA 1MN6A 1TUGA 3N58A 4YCDA 1RABA 2V5FA 2XCUA 4BNDB 2WYIA 1XPRA 2FSGA 1WXHA 4XWOA 4JITA 5DGIA 1T34A 4O8ZA 1TAQA 2DF8A 2C59A 3UN1A 4REMA 2NO4A 3PV0A 1NBHA 3TPCA 3HR8A 1DIAA 4GX1A 1CUYA 3T5GA 2LUHA 1GKIA 5EKXA 1G98A 4LRWA 1G20A 3V2GA 1DC5A 3RRUA 1FMJA 1SZDA 1V41E 5AARA 3K92A 2OBNA 2IHKA 2H1HA 3SICE 3NASA 3GZ4A 3T9FA 2D7DA 2RFAA 4F7DA 2Z83A 2QDXA 1QOZA 2Q5QA 5JXGA 2XDAA 2P41A 1JAHA 4EHIA 2XQVA 3RU9A 1R0SA 1URPA 5J5VA 2NXEA 2PHZA 3DPUA 5A4DA 2CDBA 1MKYA 1KF0A 1SA0B 3K70C 3I3SR 4I0WB 3GC6A 3WMEA 1NU6A 1G0NA 4OHWA 2JARA 1E3LA 4Q24A 4QTZA 4IZIA 3DXFA 4P35A 3UY4A 2LWIA 2R1UA 4G89A 1G7SA 3EGOA 4KO1S 2HCRA 3ZXXA 2AQ8A 1KJJA 2X3UA 4CW7A 2A33A 2C03A 1LRKA 4KR6A 4ME6A 2RBEA 4DLSA 1MDBA 3SR0A 4MR9B 1Z68A 2PQRA 3EPKA 1SBHA 3HZRA 3KAEA 4OHUA 2C2ZA 3TW6A 1QM5A 3S1AA 3U4TA 5TIIA 3PXDA 2VKQA 1TJCA 2R6FA 3E23A 5JS6A 3NOQA 1Y6QA 4MQEB 1NVMB 2G9VA 2ZUDA 3OFVA 2DWUA 2AJDA 3CIFA 3OBIA 3OQ6A 4L7TA 4MJXA 3U9TA 3TAUA 1LI7A 3HY6A 5AENA 3T5XA 4NMWA 5EJMA 3SYRA 3OTHA 1E9DA 4EUKA 5LLSA 4MUYA 2WINI 5J2UF 3QVWA 2GZMA 2PRSA 4BMNA 3HKCA 1MZCA 4B1FA 3FPKA 3I2IA 5HUQA 3GFFA 1OX5A 4Y2HA 3NBYC 3OF5A 1O6BA 1IAQA 1A2QA 3WGZA 3N59A 2Y93A 4UCQA 4AJHA 4PCAA 4Q9IA 3DZ8A 2ORWA 4BCDA 4EQZA 5GY7A 1KYWA 4YRIA 4R2WA 5KSOA 3IQGX 1JBEA 2VAPA 5A6CA 3PKZA 3SD7A 4MGIR 1XMIA 1A72A 1JNZB 4O25A 3P2KA 2BEUB 4Q66C 3TVYA 2EX4A 5EESA 5EG5A 4J0IA 3R6WA 3TI9A 2PZLA 4Q15A 4FYPA 5BN5A 4P5EA 3ZKJA 5HVNA 4O2AA 1Y3BE 3FY4A 1TO6A 2ATXA 2EP7A 3AM5A 4OV6B 1RYEA 4G97A 4KVAA 4TXHA 4EENA 3E0XA 4YV2A 1R18A 3ITKA 1LVHA 3VYRB 1M0WA 2MR6A 4L5IA 2HJHA 2ID8A 1IZZA 2FZ4A 4R3WA 3IV9A 1QQBA 3OPXA 3N5CA 1HO3A 3G79A 1J5EB 2L0TB 1VJ0A 2F9LA 1LQ2A 3DOJA 4QG3A 1LBQA 1X9HA 2QTLA 5G04C 4HNAB 4Q3CA 3HBAA 2B61A 1OH6A 2CCKA 4WH0A 3SMQA 4L4UA 3B6IA 2WU8A 1GAEO 3OSZA 5AI8A 5I4KA 3HCFA 2RG8A 3AEQB 4GAEA 3IMEA 1M54A 3IPLA 2GPBA 2W2KA 2V3WA 5A5VA 2OAEA 4Q7JB 1MC4A 4OYSA 1Z4JA 3E9CA 4JUIA 1JIJA 1S01A 3MUOA 2CDNA 3EYAA 4YJ2B 4WI1A 3AEKA 2EYUA 4KXYA 5H70A 5AVZA 1AA9A 1U8ZA 2AWOA 2BFPA 1E7YA 1GUDA 1F6DA 3L9XA 1LD7A 5DN6D 4K9MA 1FSGA 3PDUA 2O2HA 2PA3A 1G8SA 1PTJA 2Q0SA 5IBCA 5EJIA 4GZ5A 5JJKA 5IVDA 3QWVA 4EG8A 2COEA 1FLNA 2NAPA 3HVUA 2ZRHA 4UAUA 4QUKA 2OUKA 3GVHA 2WYHA 3VSCA 4R9VA 1G5FA 4ZAZA 1MORA 4IDNA 3GEMA 2GR9A 1UWKA 3IULA 4CKCB 5BSRA 5K3FB 4UVGA 4FCVA 4R5MA 1WXGA 2FZEA 4KQIA 2BGWA 4C3UA 4OAUC 1Q3HA 3RRXA 4BQNA 1X77A 5LU9A 1IXYA 6PFKA 2CMKA 2BFDB 4CFSA 2CLCX 1XZHA 2R6HA 1NHWA 4ZOLA 2COUA 4RJIA 3MZLB 4TUYB 4D10C 3OZIA 2BGLA 1RCUA 4KITB 2JCGA 3VR2A 4OP1A 1F6BA 1G17A 2C7OA 5D85A 1C9DB 3RVQA 3DMTA 1OI3A 5KPDA 3FDFA 3ZXPA 4CHTA 4EHMA 5HIJA 1M2OB 1WA5A 1RE0A 3AJRA 3UFXB 3IPAA 1OCEA 3R1IA 3A6KA 2HCJB 1GFWA 2VJYA 3E8SA 3AG6A 2PIAA 3QLUA 3TM5A 2EKDA 2UZIR 3D3JA 4XYLA 1VDYA 1BMFA 4KXVA 1FP7A 5TPWA 1V6SA 3C5CA 5JYCA 3IAS6 4G23A 2ERCA 3UPVA 4RVOA 4G5FA 4U2FA 4ILKA 1HE5A 5GOTA 1SQFA 2Q5FA 4LJYA 1DTWA 5LVAA 1JDPA 1F0NA 3F6SA 1HETA 1VHDA 3WLQA 5EYPA 1YOBA 3TBHA 3ZW3A 1IB6A 1VI6A 2DWPA 3RUDA 2FMUA 2X7HA 3D9JA 2B4QA 1ICIA 1SXIA 2V8BA 3DL0A 3QMPA 1DWQA 3DL4A 3C1TA 1UOPA 1HI9A 2ZE7A 1GQOA 1P1FA 4N3BA 3R3SA 2JH9A 2QTVA 2XMGA 1RW4A 4NI5A 1ZK4A 3UPUA 3WE7A 1E4VA 2NPIA 4I66A 2ANBA 2PCLA 3V2HA 4RS3A 5JMND 3QWBA 2YQ5A 4KYTA 4HQKA 3Q7AA 4LXIA 4UW9A 2GLTA 2WT8A 2G6TA 2HDOA 2P11A 2BBTA 3KSQA 1Y7HA 4A55A 1NXTA 2IOYA 1FLAA 2AVNA 3ISJA 3DBLB 1WVMA 2AC2A 1ZEMA 3P9RA 4PG6A 3AW9A 3L92A 4IRXA 1PL8A 1RCFA 1XBTA 2EILE 2IYVA 1PW7A 4HWPA 2HU2A 2LR0A 1DB3A 3I6IA 3BAFA 2WB4A 4ENUA 3E22B 2Q5JA 4EQ6B 2NTVA 1JJIA 3FNHA 2HRDA 1T8PA 4MJ3A 2XCQA 1I2BA 1ECCA 4G26A 4AROA 5FL7A 2Q1XA 2ROQA 1DJQA 3AS4A 1HWYA 1EK2A 5C5DA 2ECQA 5D6OA 3MFQA 5BOVA 1IJEA 4B4WA 4KFSA 4BVBA 4HTFA 2COKA 5EJAA 1JYEA 3JQ8A 1LC0A 4MGZR 2XHEA 1F1BA 1FT2A 5TY0A 5AUNB 1A1VA 5E8JA 2D1QA 4Y6OA 4E07A 4M1OA 2IHTA 1PNQA 2R11A 5A7DB 1K27A 5A5EA 2YV4A 1GZ5A 1WKBA 4OQPA 4BKQA 2B34A 4ETIA 5K51A 2GF2A 3G2HA 2NO0A 3G8DA 2LO6A 2GM5A 3C3XA 2WV9A 2DHQA 1HYHA 3TWWA 3RBZA 3CT6A 4DMRA 2Q45A 1PF7E 5IH3A 4PS0A 4DRYA 3TLBA 5BNIA 2OB2A 1DZ3A 3H5AA 2VDMB 3GJ0A 4HXGA 1G5RA 3Q1KA 1FP4A 2GAJA 1OYOA 3L7JA 1NI1A 4I50F 3ZOKA 4PQEA 4ABYA 3FVQA 1YTUA 3IEGA 1KORA 2D7CA 2NSHA 3ZGXA 3UMCA 5KX5A 4HDKA 4M2LA 4CM5A 1VDMA 2XRMA 1P1IA 4JENA 2XT9A 1E1QA 3ZVRA 1XMXA 4DJJA 3WJ1A 3VPAA 4EGCB 1RD4A 1G38A 1PG5A 4WBSA 5TEWA 2PQMA 1H2VC 1YWGO 4K9OA 4B3BA 3WL4A 1UW4B 4E4YA 1FW6A 2H7VA 4HT3B 2BKVA 1KFCB 1YBFA 2BGKA 1OH8A 1QGUA 1Z2DA 5K4HA 3KQHA 2I76A 4Q1VA 3CW9A 1XD8A 5FWXB 3DTNA 3KELA 1KTVA 5FQ4A 3RI3A 3MNFA 4INZA 4URFA 1S3SA 5INTA 3A3YA 4W9NA 1QV7A 4EWLA 1LV7A 2OHVA 1IPEA 4N0MA 2IYWA 4N5NA 4RH1A 4CKEA 5KOYA 3QG5A 2EYQA 1ZIPA 2WWRA 5KWIA 2OCBA 5KNDH 2D0PB 3RFUA 2CD9A 3RIMA 5KOJA 3AIKA 3C41J 2FZWA 4M1TA 3FTEA 3A1WA 3FOBA 2IF0A 3OPYI 5GJBA 3HVJA 1KRXA 3CEPB 4I6GA 3O48A 2RGCA 2XZOA 3MV2B 3EFOA 4U7HA 2QLFA 2XNJA 4OBXA 4MTLA 2ODTX 2NU8B 1R12A 4BMSA 1P72A 1T5TA 3AVPA 1XVAA 1DTSA 2OZKA 3OH8A 3F49S 5DHSA 3DZJA 1JHOA 2WF6A 4OKNA 1AB6A 1MG0A 5JS8A 4JBHA 3PXAA 1A4XA 4BE7B 4MVJI 1OAKA 3PPXA 2VNSA 1MC1A 2YW9A 4LYFA 4A4DA 4YB8A 2DFVA 5LWHA 3KAQA 3BJRA 2QLMA 2Y0BA 4M37A 3RUCA 2I1KA 1P7PA 1N1GA 4UTOA 2CVHA 3TCNA 2J9QA 4D7AA 1XZPA 2X6HA 1KDOA 2H06A 1VL8A 1JHVA 3RR2A 2WSBA 3LXMA 1RC0A 3HH8A 1NDHA 3B1VA 3H3FA 4L1BA 2DZNA 1II9A 1AZSC 5FDFA 3VTXA 2A1TS 1VG1A 3UWDA 1B2LA 3EFHA 3BG5A 5L3SB 1GL6A 3GGDA 1OFVA 1T3LA 3NOVA 1G4UR 4L2IB 3EQZA 3ADOA 5ED0A 3FNGA 1U2EA 4DR3B 2BM8A 3RTGA 2JATA 1MAHA 3KDPA 3GVCA 3E27A 4B84A 3HLKA 2BFAA 4BBPA 4PNEA 2B8NA 3W6UA 3SO8A 4KWEA 3MB5A 3B1JA 3AL2A 4B85A 4FOPA 4EB0A 3A6EA 3BXXA 3CMMA 2E3JA 2W9XA 4GA2A 1ABEA 1L5FA 5HK8A 3X2FA 3TG5A 3U4AA 3NG1A 1N77A 2XTMA 2QUJA 4RZ3A 2Z5VA 5HW0A 3ZK7A 3O9ZA 5HR5A 1BWSA 3OO1A 3UKUG 4V0NA 3OQNA 2C2KA 2J30A 3DOIA 1I10A 3Q0TA 1L4GA 4QFDA 2VZLA 3U7QB 3WLJA 1T36A 2NZVG 3HDYA 1J2UA 2J3EA 3JRNA 3PNQA 3WKEA 5IYZA 1JJBA 3E8MA 4OAOA 3VX4A 3K2EA 1YR9A 3TSZA 3MTDA 1UJJA 4OH1A 4YCNA 2VF2A 3DE0X 4ZHQB 4DR1B 1RXEA 1A96A 3APDA 3Q49B 3I0ZA 1UJ2A 1XRNA 1RDFA 4ESVA 2FUCA 2F8TA 1JRLA 3DEFA 1P9LA 1GUZA 1GL9B 1RPJA 3ZWDA 4A7PA 2FPGB 1S2GA 2ZDHA 4PIMA 4TWZA 4ZMBA 4JBLA 3I9OA 3MUEA 2WUWE 1E58A 4AKXB 1JEDA 2FFAA 1A9XA 5KTYA 1FU8A 2OFPA 1JAXA 3VNSA 3KSAC 2Q5LA 4A92A 1DAPA 1X7XA 2PUEA 4FGUA 3E70C 3UCEA 3GFTA 1ITZA 5FTNA 1GNTA 1UXJA 4IJQA 5FO1A 1XFDA 3WK9A 3KOXA 1JSCA 3HXOA 2GXAA 5EKTA 1EYZA 4JSTA 5TMDA 5JY1A 5J9FA 3N8KA 3SD5A 4CMJA 3ZV6A 3DYVA 4Q18A 4DLUA 2QU8A 2DUJA 2X5KO 1FCJA 2HA7A 1M2GA 2YV1A 3HDTA 2C3UA 4PSUA 2WXQA 4DZTA 4K6MA 4JC0A 3TEFA 1JDZA 3RS2A 1TCVA 2X6JA 4PZLA 2OBLA 5EMHA 4JJ8A 3LA6A 3OKCA 5EX0A 2PKYX 3LH5A 5IBQA 4MYTA 1Z16A 1FA9A 4Z7QB 1CY4A 3H4MA 3Q8XB 5IRCD 4U39A 1Z26A 3RU3A 2HQ1A 4MIOA 3PR3A 4FD3A 4ZU1X 4G1BA 2HRQA 1YS2X 3A3NA 1KEEB 3OU2A 3CEMA 4R8RA 5K0CA 1ZCJA 3I6ZA 4UBLA 1JA0A 4P32A 1I5EA 2EG9A 4IIBA 4PO3X 1QHHB 3KVOA 3QBTA 2FPXA 3TRHA 4X8LA 3DTTA 4YJHA 5JAZA 2G40A 5BWCA 5CB8A 4K6HA 4EY8A 5EQDA 1TVKB 3E9NA 1Z5UA 3N8NA 1T2DA 2QLNA 5JWHA 2I9CA 4JYAB 3P5BA 1XE3A 2DOKA 2WTBA 1GQQA 2XCRB 2B4RO 4MVJG 4EI2A 1GGHA 2RHRA 2FEMA 1BX3A 4YRDA 4KG7A 3H13A 4JLVA 1NUQA 3QVUA 4RJTA 4OSOA 3WBJA 4E85A 2VOEA 3R5TA 2I1QA 3M6FA 5FPYA 2WSYB 1YZHA 2BH2A 1ZNYA 3Q3VA 5A4JA 2P6RA 2CGEA 1Z5NA 3LDAA 1KO4A 2P9NG 3UX4A 3CRMA 4IZOA 1Z2OX 3LFUA 2GK7A 5AM0A 1SXGA 2ZDGA 4DQDA 2C2MA 1ZUNA 3QA9A 4P82A 1W1IA 4DLNA 2XPYA 3U7RA 3ZDXB 2O52A 4IMPA 1PNVA 1ZD1A 4GHWA 3KRTA 2V0PA 3DMDA 2UUOA 4GMDA 1W8DA 4P3XA 1DBWA 2O7NA 4U8VD 4MPTA 3ZQKA 3Q9UC 2BCGY 2WLTA 5JATA 4YJKA 4AIRA 5CW2A 3VFDA 3MKRA 2WWVD 4WUTA 3ZE0B 5KTRA 3MGGA 5BUCA 4WLFA 4HYQA 4BSXA 2QMOA 721PA 3EG5A 4Z8YA 3TNYA 1ZI8A 3CW2A 3LX5A 4HWSA 2Z1NA 4MS1B 3EXIA 4HH1A 4D82A 4OBWA 5BSEA 5DJ5A 4J16C 1KP3A 4G5OA 3SVZA 1SVKA 1GYQA 1I32A 2D1RA 3G9ZA 3DDWA 3PQ4A 4YNBA 4B09A 3NKVA 1MHQA 5LYJA 1KZPA 1VI2A 1YMVA 5FT9A 1P0FA 2C2LA 1ANKA 2B1JA 5I8ZA 3UYLA 1J09A 4NYIQ 4OQYA 3PWSA 5BUQA 4ZVPA 4MRAA 1RZ4A 4UC0A 3HVKA 1RJ9A 2REXB 3TRDA 4G8JA 3WGNA 1EQUA 4MOWA 2YWJA 1C3LA 3WICA 1BD3A 1HDIA 4YO7A 1JFFA 3P26A 4PV7A 4KRFA 5HYVA 3DEYX 3AJEA 2GFHA 1M1NB 4L8YA 2JAWA 2HT6A 3UMVA 4U07A 1KI2A 3DDSA 4Q7EA 4HRLA 4L3OA 4JYCA 1V1RA 1J22A 3SIXA 2BC9A 1PU2A 3BIFA 3MYRA 4PCUA 4XI9A 1O58A 1N2BA 1IXZA 3KPWA 1IN1A 1U2QA 1Z6TA 5JXHA 4IO1A 1N6RA 1WCV1 2D3TA 3N28A 3G5UA 5JDIA 4RTPA 5YASA 3TR0A 2YFYA 1N6PA 2ZT5A 4ALMA 1E3WB 2PMCA 2FW6A 5A1JA 1QFXA 4UTVA 4U0SA 4KVGA 4RL4A 2J67A 2Z9BA 5KYXA 2HHAA 4P58A 1US8B 1O6ZA 4UHEA 3L49A 3DP7A 2XA9A 4ZQGA 1TB4A 2GYVA 1RHRA 2GRJA 2DLDA 3FCEA 4UKDA 2XI4A 2X6RA 1X1RA 3LO5A 5HCIA 4EFNA 1OB2A 2ABWA 4ATGA 1CUXA 1N7HA 2XYPA 3MLAA 4NKRA 1V8DA 4B0OA 3FCCA 1VJ1A 3OZVA 3K0CC 3ZV5A 1P9OA 1MJ5A 5M34A 4FFPA 5CITA 2FDCA 1UJ5A 3A27A 3AHEA 5BQOA 3HA5A 5G05C 2O3SA 1QF7A 4V0MA 3CUSA 1Y9AA 2WKQA 4DUPA 1V5GA 1NXQA 5FJJA 2RAFA 7REQB 4G1EB 4TMYA 1H6PA 1TVMA 3HVHA 3ITNA 2XNHA 1Z29A 1Z4OA 5K8IA 1T6BY 3O92A 4GP9A 1MMFB 4NDZA 2YOGA 3A2LA 3WR5A 2P9SG 1M1YE 3ON5A 2EIXA 2ODBA 4UXIA 1MOZA 2B2XA 4PPFA 4I55A 3SPXA 6AT1A 1GFIA 3IURA 3ZVMA 4AJ1A 1UZUA 4FA6A 1C8BA 4OGWA 1OB5A 4TWRA 5EUCA 4YRBA 4ZPJA 4CMKA 5EMNA 4JEUA 1NUPA 1SD2A 1ISHA 1NW7A 3FNQA 2A3RA 4G0UA 5A06A 4YUZA 4P34A 3RTCA 1YQWA 4R1SA 4X3OA 1QR6A 2PX3A 3SDZA 3WMRA 1V5IA 3GQVA 2VYIA 2JA2A 5FUMA 3PNBA 4K5CA 1ORIA 2ODQA 2CBXA 1QGDA 4GT1A 3CR7A 1VHLA 2YVUA 5JZSA 1ZRNA 4Q48A 4U9UA 4YUXA 5IC4A 4AY6A 3CKMA 1NQWA 4JJIA 4WPGA 2WXNA 3O90A 1JVSA 4LDAA 1TK3A 4ZI7A 4K5QA 1QB8A 3RYIA 2PKQO 5ENPD 3BOSA 5D1NA 1XVLA 2GA9A 4Y2SA 3V8EA 4RLFA 2F3TA 2JHGA 3G2TA 1J99A 1LZKA 1M5UA 5A02A 4YRKA 5LLDA 4C43A 4MQ5A 4LY9A 2MSNA 4CN8A 1BPOA 2X0RA 4PC1A 1U3FA 2PXCA 5A5FA 4Q05A 1ISMA 1N0WA 4ZOAA 3KLMX 1E0SA 5C4GB 4DGSA 4YQZA 4G0WA 1XXHB 3ZEFA 2GSDA 5BNTA 4MHTA 3CHYA 4GE0A 1ILWA 2H16A 2WJAA 4AB1A 3D9OA 1OZFA 3B53X 4J6EA 3UINC 4H6PA 2W6CX 4DDKA 2ORYA 4F06A 1XSEA 1SU7A 3JQ7A 2FZGA 3IUYA 3KWMA 3AW8A 3S27A 1NWHA 2ZT6A 3LC2O 2AH5A 1SBTA 3AY0A 2HNBA 1GKYA 5F7ZA 4OXIA 1AUXA 4FFMA 1T1GA 2TS1A 2FZCA 1PJTA 3CSSA 4CV3A 3LQQA 1BEUB 2V7TA 4C1BA 1XDBA 4OHBA 1RXWA 3UT5B 5AW4A 4N0PA 3ED1A 4R4JA 3IAAA 4MYSA 2C2OA 5MFPA 1U2ZA 4HLUC 5DP1A 4YAKA 2W6MA 4ES6A 2CLEB 2V98A 3DAHA 2JFGA 4Q7MB 2CK3D 1OIWA 1E2BA 1Q83A 5JRDS 4OAPA 2ZVDA 4BESA 4EGFA 1ZNXA 2AZDA 4DMKA 4DSZA 2OZLB 2ZAOA 2OO7A 1JG7A 2BI7A 4IDCA 4HNUA 4DJ5X 3DLCA 3MIZA 1CVLA 1FFSA 3T7SA 1N2EA 3U4CA 5DBHX 1U4SA 4DX7D 3C5RA 1NJ2A 2RARA 2UUPA 4P33A 2WWYA 4X71A 1O1TA 1SUBA 3AJAA 4GOMD 2X5TA 1UP7A 4PPNA 4XWTA 5BPFA 2XZTA 1THGA 2NOAA 4KL8S 1Y3IA 1E59A 3HP7A 3HFGA 3PD0A 3OA0A 1J97A 4GVLA 3E1KA 1OXVA 2VNKA 1OILA 1L1FA 2I71A 1TUBA 4FYWA 1E92A 1SURA 1F5SA 4AJWA 5ULLA 3W5CA 3JQBC 1VLJA 2J59A 2I2FA 3RSCA 2PMBA 4BN0A 1XDDA 3IQIX 4M89A 4PPGA 2R48A 4RFSA 3DEPA 4RIEA 2GVNA 3HJHA 4Q5IA 4DN6A 5AW1A 4O1OA 2Q07A 5IXJA 3WRYC 2AFVA 2HGSA 3B12A 3DMPA 1UFQA 3O03A 2A9JA 1SQSA 4IJ6A 1V8BA 3FU3A 2ZRBA 3BJZA 5LA6A 4LDJA 4D0SA 4FKMA 4R7LA 5CRIA 2Q27A 3CEQA 4FLEA 5C1PA 3WC4A 4YTEA 1JWBB 4FB5A 2C2WA 3FUDA 2WHEA 5LCXA 5ISMA 4OFBA 1L5SA 3LDUA 2Y9PB 1P91A 3ZHBA 3KVNA 3NHWA 4A3SA 3NDBB 1MNAA 4H60A 1X42A 1DJMA 3DNMA 1DP4A 2PT7A 2AEMA 2EINE 2IX9A 5ICEA 3JYLA 2W6ZA 4JVMA 2GAOA 1Q77A 4GD3Q 1G7CA 3IFSA 3MJSA 4Y1RA 3OZEA 4PXYA 3UCXA 1HOXA 3IUBA 3NAQA 2ODPA 2AT1A 4LXQA 1QH9A 4RJ2A 2H3HA 4G4SP 3TTSA 2OLJA 1W9HA 5AVTA 3A9VA 1PGNA 2PUTA 3OIGA 6Q21A 1PVOA 1E7SA 1CJMA 1GGNA 1NGSA 4LUNU 4DLAA 1CJUC 4EY4A 4BO0A 4UI9K 1AGNA 3T9BA 4FN5A 1K7XB 4XDYA 4ZHQF 4AKIA 3K6KA 3GG9A 4HLEA 1TYQG 4A0GA 1D9XA 3ZTWA 4DX5D 3OA2A 5DP2A 1M6HA 1RXYA 3M6IA 2ZZNA 1PBNA 4GPKA 1MENA 1CUZA 1TC1A 5AVXA 1MPTA 3W5VA 1WNFA 2XIJA 4LSZE 5JJLA 3T5PA 3P7MA 4BO5A 2PX0A 3I9MA 1R0LA 5L3RA 1ONSA 4KQ6A 1Q7BA 1NXOA 2J7PA 3W4IA 4ER0A 3MMPA 3PHBE 3NHFA 4Z7NB 4B81A 1ZSYA 3KOYA 3CH7A 2Q1YA 3HN6A 3PR2B 3OQBA 3R41A 3EJ6A 3MJCA 2NO1A 2IP4A 1VKOA 1B23P 4EK9A 3QMWA 3VU3A 1FF9A 1E60A 4DKJA 1M9NA 4H31A 3ULEG 4E88A 1N1EA 4WDQA 2ILRA 2CW5A 3EVBA 4A0HA 1Z36A 3DO6A 2BUBA 3OIWA 2DWCA 1B16A 1PG2A 4QOFA 5TPZA 4LY6A 3AINA 4HFGA 3DDUA 4RGVA 1H2HA 4M7OA 1KFJB 1PUJA 5FI5A 2FBNA 2Q1TA 4AVXA 1KKUA 2A58A 1JZTA 4MQBA 1LK5A 5AW6A 2IYAA 2C04A 1EFVB 2AI1A 1M34E 3VJKA 3T1YB 1QOQB 1RLJA 2WSSD 3D64A 2B5OA 4LRXA 4HO1X 1P7ZA 2VJKA 4PFJA 2ZWPA 3M4JA 1GLGA 4FNAA 3RO2A 2CJXA 2X0JA 3LBIA 2H2IA 4O29A 1V9SA 3PUIA 4KXMA 4RKEA 5DMHA 2I4RA 3BTOA 1Q0HA 2MOKA 4W5HA 2H54A 3IXEA 1WIWA 2EGHA 2B21A 1C80A 5EJFA 4D9GA 2C20A 4MO9A 1K66A 2EJVA 3HVIA 5LOVF 4PTZA 1RRMA 3V97A 3K09C 3ZYCA 3BH0A 2NWQA 1U65A 5GGYA 2LW7A 4M49A 5HK9A 1WHTA 3IQWA 1KZOA 3CE9A 4OLFA 5I4CA 4XEIG 1ZSNA 3QY0A 3ENWA 2H65A 1PSDA 1SB8A 3OP4A 3FZNA 1RVDA 4NEGA 1A27A 1E1RD 2GEJA 3QKRB 1KMHB 1PQ4A 4BNXA 4QEKA 4EHAA 5J1SB 3F2IA 1D4FA 1NV8A 2ZTHA 1MHPA 4UFPA 4ASUD 5HPYB 2R6JA 4DMLA 5AQEA 1FDUA 3DVRX 1UBMS 1E7MA 1JIQA 4AURA 2NYRA 1QE3A 5DCWA 3TW8B 5JAOA 3TAHA 2IH4A 4C2TA 4KDRA 3DVLA 5F35A 2DB3A 1JE0A 4H7HA 3IUPA 5KU1A 1B41A 4YP5A 1NTRA 1VHJA 4QNMA 3AL0C 2IE8A 3SKYA 2AI2A 2CFZA 4IJVA 1XZIA 4MI6A 1VP9A 1VPVA 2C9MA 4B40A 1MVOA 1EGVB 2R7MA 2VNHA 5DU2A 3SN6A 1E98A 4MP3A 1FNMA 4UFOA 3B6KA 4CGVA 1FTYA 3E2PA 4YT2A 4RZQA 2HMSA 3U5ZB 5HNKA 2HO4A 4E03A 2EZ4A 2PKQP 2IWRA 2QHXA 1T4BA 4EGJA 2Y1WA 4YT4A 4IFBA 4BL5A 4YNDA 4YO8A 4FR5A 3VR3A 4JL6A 1YBAA 1TAUA 3LAWA 2BFCA 4TTQA 3PGMA 2ZWIA 1R8YA 4PYOA 5KCZA 3O73A 4WXPA 3ACBA 1PFQA 2NO9A 5KTPA 5JEDA 3UWMA 2CBZA 3E9RA 5CT5A 3WBFA 2QLJA 1FX1A 4OIMA 4C7XA 3PF8A 4QQRA 3WMXA 3IE1A 3NTVA 5FULA 3PD7A 2H29A 4HLCA 1GPNA 1UK8A 4DBLE 1DCTA 1Y6RA 3G7NA 3ZDZB 2JLBA 1LQUA 4RHEA 3OM9A 3PE3A 3NKFA 3EXHC 3LX4A 4EUNA 5F7XA 3COZA 1SVUA 3SXJA 3AUKA 1RJGA 5TDHA 2N1MA 2XSZD 3U4QB 2K7ZA 2VDVE 9ATCA 1O0BA 4N2SA 5KYYB 1H22A 4FYIA 3F1KA 3ZIMA 3UC9A 1OVMA 4UHHA 1GYRA 1LDYA 1X1DA 4OK3A 4U2DA 2EDAA 5KEIA 2ZRLA 3OUTA 5GAJA 2YNMC 5C2JB 1QWOA 1RYZA 2DYKA 1EX7A 4NU0A 2NUPA 1V25A 3B6ZA 3SMVA 3AUYA 4C29A 1ELWA 3UOAB 3HJTA 4OUKX 2B1QA 2V7BA 2VG8A 2PSFA 3P0HA 2OBMA 4BFTA 4JZYA 4A3TA 3ZW9A 4KXWA 3OEED 3BFXA 1R37A 1LD8A 3M4XA 2A9RA 1I5RA 2EKLA 1UXKA 4N6GA 1OCOE 3ANXA 4D9CA 4C4PA 4X24A 1JLLB 1IYZA 4WT7A 2ZBDA 4PO1A 4RF4A 1LSOA 3UGTA 1L5ZA 2EBWA 1KA9H 4RQUA 1Y7TA 4Q01A 3HU3A 4TXLA 3H4IA 3GFSA 3GK3A 2OGSA 1AGRA 3ZXIA 1QHIA 2GM4A 4CEJB 3BF7A 3TIGA 3IO3A 3K9IA 4UAVA 4ZZIA 1H6KA 3JWHA 4MDYA 3N86A 1UMDB 4K46A 1YCSB 5H9WA 3H5LA 2I2BA 3RBXA 2W4IA 1XI2A 3EPLA 4CRWB 1XTPA 2IYSA 1K1BA 4RXTA 3ADBA 1Z0IA 3I58A 4BVLA 1PP4A 4D9HA 3RO3A 2A9VA 2R1VB 5L4NA 3WGVA 1NM5A 1WKVA 1X38A 1GXSA 5KVVA 1RAHA 3JQEA 1SH7A 1YUBA 3ZVKA 5J2TB 1KYVA 3CWZA 1E4OA 1NN5A 3AT1A 1TW3A 1XKLA 1PR5A 2KC7A 5FINA 2QTBA 1GNSA 4NS4A 2AKAB 2OK8A 3EWIA 3FTVA 1C3OA 3FFXA 4DM7A 3U13A 5IEJA 5ER6A 2HLNA 4V2UA 2HRBA 1A9ZA 1CY1A 4BQOA 1KQGA 3VR5A 1B0UA 4KVZA 3WNDA 4MINA 4LHXA 1ZICA 5IZ4A 4FWIB 1I1HA 4NICA 2PQNA 1J2RA 1KJIA 8OHMA 1V8PA 4KR7A 1EKXA 1BQ3A 1OVGA 4WZAB 1HSZA 2JKYA 5T4HA 5DBEX 4IILA 5AH0A 5FLEX 3BCHA 1XU9A 3D7NA 4RQBA 3VYTB 1Y1LA 1J42A 3DM5A 4JMPA 5KREA 1SVWA 2BTQB 2XXAA 3LA8A 2YV5A 2HMWA 1O5TA 1KH3A 2A88A 2WWHA 1L7OA 4MVWA 2PS0A 3GJ5A 4IGFA 3GMIA 4LG6A 3SYTA 1KJZA 2WE8A 2OQIA 1UM9B 4A5OA 1MP0A 1BN6A 4OHRA 2ZIGA 1P5JA 4ZD6A 4R54A 2WKWA 2VDWB 3JTMA 4BLTA 2YV3A 2Z4SA 2RE8A 1M67A 1R00A 3R7BA 2EFGA 5DBIA 4IDHA 3D6AA 2VZ9A 4DTIA 1VJTA 1QRTA 2W9JA 3AEXA 1XZEA 2MHKA 3FGZA 2GZSA 1WBJB 4WE3A 4APFA 2JBWA 3RT1A 4Y0VA 5FX2A 1T5HX 5IARA 2RGGA 3V30A 1J9GA 3Q9LA 5DNVA 3B1FA 1Z4NA 3C97A 3BBPA 4QJBA 2WXPA 3TQTA 3ZDCA 1WV0A 2CJWA 3I04M 4EPWA 1JBKA 3L7NA 5JVDB 5F2KA 1XEWY 1KSJA 3V1KA 3IIJA 3KE9A 4UHJA 1E5LA 2BKUA 1X7WA 3ZZ0A 1S8OA 1GRRA 1XVTA 1T0UA 1FU4A 3LCJA 3BHNA 4KVOA 2BW0A 4RGQA 5AOAA 1XR3A 3MWGA 4C6HA 4BB5A 2IIBA 4PZ9A 1TXGA 2WC1A 3OZUA 2QSYA 1Q50A 4M1ZA 1IY8A 3O1HB 2FRXA 1SVXA 2PUVA 1XZFA 1RZUA 1K8ZB 4ZN6A 4OUDA 3C3BA 3D9PA 3V1NA 5B3SE 4Z0PA 3JRWA 3Q47B 2EWVA 1CKEA 1NYRA 3HC7A 3M7IA 1SJ9A 4O4JB 3V7FA 4ENWA 4JP3A 4DMGA 1GWNA 4ZOEA 1BXGA 2PZBA 3LT0A 4QNRA 2QY9A 3FTUA 2O05A 3V8QA 3VR6A 4F04A 4C48B 2QT1A 1QKIA 2DPGA 3K05A 5ECYA 3GAAA 2QAGC 3P2YA 4F4JA 1C50A 1LTKA 4UU0A 1GLVA 5DFAA 5AW5A 2H1IA 1L1EA 3C3PA 4GL2A 3IERA 4IUDS 1TYAE 2R7AA 5JQGB 1LB1B 5CVTA 2C29D 3KB8A 5FLYA 4HGOA 4G1MB 1Y1RA 5IT0A 3JARB 2WG1A 1FX0A 4BJHB 4LJLA 2GRAA 4OPMA 4OD0A 1DJOA 5CDFA 1XF9A 2XRYA 1P80A 3QKSB 5IM4F 2O9JA 3UJPA 3FUJA 1GDHA 1PX0A 4BLOA 4X7RA 3S70A 2O7SA 3BXGA 3F7MA 4QLAA 3VTZA 5PNTA 3OEWA 4DV6B 4YCSA 4B31A 1IZ0A 3TFOA 5SY9A 1EPUA 1DFIA 2ON6A 5IDXA 4DIMA 1N2CE 5K20A 1JG4A 1RQRA 1Y9ZA 4GAAA 1LV8A 1QUEA 1E9AA 4HQRA 5L9AA 4QPCA 2HYZA 5J4VA 1GP2A 4PSAA 1KZ6A 1W88B 4UBIA 3NM4A 4FGZA 4CQMA 2VPZA 4X7MA 2XNSA 4QFCA 5B6IA 4KAFA 5IXYA 3HXBA 4N18A 5IDYA 3CRZA 4OGGA 2QMHA 3K1ZA 4US1R 1BE8A 3BGWA 2C83A 2W6QA 2F3SA 3HUDA 2ZYHA 3R40A 2G77B 4AMUA 1WX1A 1UJ4A 3WYAA 5I9IA 5DV9A 3NAWA 1AQ6A 1SCDA 2CYBA 3S7JA 1U6KA 2WKPA 1TLLA 2C9BA 3CNQS 5CB4A 1I4WA 3N2KA 3JX9A 2CNKA 3S81A 4QM7A 4LBYA 2KLHA 4XPIA 5H80A 1H0HA 1E8MA 3FVTA 4M3OA 3WMGA 3KR9A 3C1UA 5A5DA 4RD2A 1VBNA 3I05A 4LC9A 4OXKA 2C3MA 2QZPA 4XVCA 4GR5A 3K7EA 2AMJA 3K9LA 4LHZA 2FWNA 2UV8A 2VPTA 1OZ0A 3A8TA 3D43A 1HLDA 1GPH1 4FSDA 1S64A 2GEVA 3TLJA 2DM6A 3MXOA 4LTMA 3RS0A 4TZ0A 4K6KA 5CB0A 1FRQA 3M83A 4DX2A 4F86A 3H18A 2PKRA 4KAJA 4KE9A 4ZFHA 4RPKA 5G0VA 2JFOA 3CJTA 4OVKA 4HN4B 2AFIB 3VYSB 4BEWA 1PR9A 2A7XA 3IP9A 3BAZA 2PE5A 4BLWA 3U3JA 5FTLA 1P7YA 4YR7A 2ZBPA 4UM8B 5LSAA 2HLDA 4IVRA 1KLXA 3F5DA 2C7GA 4R2LA 2C98A 3KUKA 4BMVA 4CEIB 1XIVA 2PAFA 1YRQA 5F2OA 3DJFA 1KQOA 5P8WA 2JHFA 4N5CA 4CYMA 3QZUA 2HA4A 4BO9A 2C94A 1EWQA 4DCSA 3DZCA 5FBHA 3L40A 2EW2A 4DS3A 1DKOA 2FO7A 5IDVA 5KVSA 1UAYA 4BY9E 2IP2A 2C7BA 2RAVA 5KYUB 1CS0A 3E33A 4AF8A 1ZOOA 3P20A 3CHQA 4LE2A 3WXXA 2KHZA 4KGXA 4OB8A 4EHLA 2Z1MA 3U7HB 4Q3EA 4RYLA 2QIOA 3PBKA 4JI7B 2QL5A 2FWRA 1NFQA 5DM4A 1E32A 4FYKA 1TMOA 3CCFA 5IC5A 5HIIA 4OIFA 2BFFA 4RKWA 1B00A 4O0LA 5FZQA 2VGXB 3QPWA 1EFUA 3K4QA 3LOQA 2AOTA 5CMLA 5ICFA 2IRWA 5TGZA 3LC1O 3H8VA 1H9AA 5C5IA 3TXMA 3RSZA 2OLEA 3U44B 1NPTO 2GFIA 2V7QD 2UXCB 1MVLA 5D3MB 3ELYA 2CXRA 5IT9A 3D4BA 1DV2A 2HL6A 3KD7A 2GPAA 2FPIB 3DMNA 2ACWA 3ND6A 3UQYS 5K8JB 2JKZA 5JWRA 3TTWA 3D7SA 4H7YA 4LZAA 1RM4A 4YCAA 4KPUB 1PQWA 5KOHB 1SBYA 1SXJE 1VLMA 3LUGA 1WOYA 1Z17A 3FH8A 3W5JA 2FEXA 13PKA 1ZH4A 4EYKA 5ALIA 3HB5X 4R41A 5LP1A 3ASFA 4PNPA 4W1SA 2VYCA 4XOIA 2G4CA 2FF7A 4ENVA 2O1EA 3WRWA 1EM8B 1OASA 5T3UA 5I9MA 3S7DA 4DJAA 2W6JD 1QS0A 2GBLA 3D02A 4DLQA 1HV8A 3MA5A 2BFEB 3NT4A 4DE5A 4ZGGA 3R3JA 3M6MD 4JI8B 2O5EA 4ZVVA 1M6WA 3E9DA 4D6PA 5EVJA 4EB6A 1TRKA 3MIIA 2PZJA 1PX2A 4OMCA 3W5HA 2V4HC 3KYIB 3Q1LA 2FAXA 3QXCA 4TYQA 1UEJA 2YRWA 5G2NA 1OAOA 2REQB 1EU1A 5G3YA 3GFVA 3R6TA 1XRLA 2JZOA 1AN9A 1QORA 2L42A 5FOXA 2P9GA 4QDOA 1KEWA 5IJAA 3EIXA 3RWBA 4NY1A 2ZJBA 4C01A 2R5SA 3GELA 2V6IA 2DR0A 2NZUG 1PL7A 2JFZA 3P9PA 2CG3A 3T1OA 1T0PA 2KLBA 2GILA 2O2SA 5I9NA 2VRWA 4LMBA 4KIUA 3LCAA 2XRZA 2PLNA 2IYUA 3NFYA 1OWPA 3W5UA 2W6ID 3NIFB 5BXOA 1QHFA 3MGBA 1Z6ZA 4CL0A 5IAEA 1XEFA 2QM3A 2FYTA 1EDDA 3C8HA 1BC5A 3ZI0A 2DFDA 2XPIA 3DSRA 3RVMA 3MHPA 1N3BA 4HGZA 3MTIA 2IPMA 2BEVA 2O57A 2ZP1A 3GGCA 1GY8A 1G291 2R3SA 3N2EA 4EQFA 2C77A 3BL6A 1D8EA 2VTBB 2W0SA 1XD9A 3EDTB 3CC8A 2GRPB 3ZCVA 3NIBA 4KW7A 3BXPA 5C7OO 4LE0A 1ETUA 1PTKA 2IC5A 4KXNA 3K9QO 4FDTA 2FSFA 3O6VA 4RVCA 3ZGVA 4QE3A 4UNIA 2IPNA 3KDAA 3QLEA 4ZTBA 4FR0A 3JS5A 3A11A 2D4AA 1FQKA 2OEVA 2ILTA 1BHQ1 4ANUA 3V42A 2DJ5A 3VVBA 1FDRA 3H1BA 1AQNA 2JFFA 3KJEA 1SBIA 3H99A 1I2DA 3ZE8A 4MIKA 3VKFA 1N9GA 3CLRC 3CVUA 2HJ9A 4BWFB 3LMKA 4PQYA 2OL4A 1WABA 5KMGA 1X7YB 3E61A 3ZI7A 5BNZA 3A26A 5HOQA 2IS1A 3UJDA 3OT4A 5HCUA 3L0CA 3DPDA 2PRIA 1O94A 3H84A 4U7PB 1TZMA 2CFSA 4B8YA 3CKLA 5EXXA 1E2PA 3SR3A 3ZBUA 3AL3A 3AB7A 1Z0JA 4MS6A 2XDQB 1AUPA 1TMGE 3HWWA 3GXBA 3GLKA 2NTNA 3ZWWA 3ZY6A 4LF6B 3QVVA 4MVJM 2WTNA 5FWNA 1C1HA 1GNPA 1N2HA 5BVHA 4M1WA 2W2XA 1VKJA 2WU1A 5HCNA 1RWXA 4FCTA 3AIOA 4WRRA 1QRAA 3QLTA 2YRFA 3NHAA 3CUUA 4Q93A 3IUJA 1JIXA 1Q84A 5FIOA 2YXPX 4B33A 4MKFA 5AYVA 3ZKWA 1NBME 3G5LA 1YCGA 4YIKA 3RB8A 1H4TA 3I9KA 1XZNA 3VR4H 1YL6A 1X1QA 4K6CA 4AEZC 2Q41A 4RDIA 4D3YA 4E6EA 1VE7A 1WHSA 2Y1EA 3B7TA 5CFOA 4GUAA 3T3DA 1KO7A 1KVSA 2F1IA 3FVWA 2O6LA 1UMKA 5BQFA 1R88A 1Z45A 2Z8XA 1CZRA 4G5YA 4H1TA 2CXQA 5J2TF 5FUQA 4D6YA 1TD1A 2I5PO 5JBNA 1DO2A 1NNUA 4WADA 1IM5A 3PS6A 4EJSC 1T9ZA 3UOWA 1N92A 2DTDA 2PT9A 2WUVA 3DYIA 1UWCA 1U4NA 5B2EA 4O4HB 4FTWA 4LZLA 3U81A 2MSEB 2RHCA 2ZJ2A 4Z54A 1SUAA 4XFJA 1JI0A 1WAMA 1YBVA 2ATCA 5I8WA 1YBMA 4QWMA 1KVUA 3RC8A 4ACAA 2PVPA 1CY8A 1XELA 1NQVA 4ARSA 2O0LA 3KQNA 2GTHA 4F96A 3EA4A 3MFYA 1N2ZA 3OEEA 2ZJ8A 1DT3A 5AUPB 2ZKIA 1LPBB 3BGDA 4JLSA 3IQEA 4DAOA 3EVZA 2XUJA 2QV7A 4KGDA 2QVCA 3JWEA 2UUAB 4ND2A 3ONLA 5DIFA 4DNOA 2DEUA 4XGQA 3NDRA 2JFQA 2ZPTX 1DKMA 4QVGA 1ODLA 3HM2A 1NI3A 3GARA 1P2TA 3EW9A 4CLRA 2HV8A 1TQ2A 4Q4JB 3CZ4A 3F96A 2WMOA 5LXTA 2P6NA 4BRUA 3LT4A 5B58C 1MAAA 4CCSA 1QYWA 2PUJA 2ODEA 4FDUA 4XIJA 3IOBA 3EHQA 2VAMA 3WQRA 3EXG2 5AHRA 4WTOA 2C0QA 2UUCB 1SC3A 1N32B 1Q1GA 1V7CA 3TOXA 1MJHA 4YONB 1HM5A 2CZCA 5AI6A 4ZXPA 5J40A 1RYYA 4YAGA 5H9VA 3Q4AB 1G1AA 4G4SO 2CL6X 4GEKA 4H7KA 1RRFA 4ND7A 3KLBA 4AJKA 3U4DA 2Q46A 3KX2A 2PGDA 5AVYA 2JG3A 4R2HA 4YCLA 3GD7A 4YJ2F 4CUJA 1RQ2A 2NUTA 2E1PA 4EBAA 1ADJA 4J90A 4R1LA 4TTPA 4AX4A 1LFDB 2PSEA 1DS6A 1FJXA 4I9NA 1K7CA 3DEJA 1RWKA 3L84A 3H2HA 2WMDA 2ZBVA 2KE5A 4ZYUA 2PRJA 4LJ7A 3EH1A 2PJRA 2VT6A 4GTPA 3PGJA 5BUZA 3K0AA 3WHKA 4RHXA 4C06A 1JHYA 4URWR 1TQ6A 3TL3A 4LYYA 1CE8B 4RZ2A 4O3MA 1Y8RA 3HXQA 1IPHA 5EHNA 1QQ6A 2RGAA 5E1BA 3APCA 3NKLA 5BXQC 3DOFA 2R85A 2DG2A 3O3OB 4Q1BA 5JXWA 3LKUA 2FTKE 4H0FA 4G4IA 3BA6A 4JLOA 1PUIA 4O4JF 1QX3A 2A86A 4NJOA 1FTGA 2PSDA 3HA7A 1SWWA 4WXYB 4H1VA 3ZY5A 4TUYF 3LXRA 1KE2A 3LL4A 3DWFA 4NCNA 2XODA 2DETA 4FFDA 4N47A 4UVEA 1M83A 1IQUA 2FEAA 3U62A 4CUZA 3DDZX 5FEMA 1HF8A 4ZI5A 5BSTA 1UJCA 3PHJA 2SICE 4JFRA 3BYZA 2YIVX 4IIYA 2ZYDA 4Y98A 1L7NA 3LPNA 2JHPA 3ICCA 3RJ5A 5ELXA 5JD3A 4JNKA 1JFSA 5K0ZA 3SZUA 3FJ1A 3V8VA 3GGSA 4B35A 4J3JA 3DPSA 3RT9A 4CMIA 4H3HB 5DN6A 4Z9AA 1PNTA 1XQXA 1SCQA 3ESAA 1DIOB 2PMFA 2FVXA 3WO0A 2BH9A 4Y0AA 4LZOA 5EQTA 3KJFA 4U7FA 5DPMA 2I4IA 2IYRA 3V7WA 3HUTA 4X85A 1W9MA 1H0RA 5M7EA 2Y1CA 4B74A 1X7GA 3VKGA 4V39A 2B92A 3RUAA 3DBRB 2I4MA 3OU6A 1TQ8A 3M81A 2GVZC 1UPBA 2WHQA 4XDGA 2LRHA 1RYNA 3FDZB 1EFCA 4QUGA 5IJWA 4KR3A 1PS9A 5LDHA 1PFVA 3K31A 1CS4C 1JR2A 5H0IA 3DUFB 3ETCA 3L7CA 1XCMA 3T34A 3FLEA 2EL7A 4RD3A 5HM6A 1UBNA 2I6QA 1SCJA 3PHCA 2J0UB 4GNKA 5FPKA 1SG6A 4EFMA 4HFRA 1SWVA 2P0EA 4TZ6A 2YZMA 1QWSA 5KAPA 5K8CA 2Q6OA 2QSUA 1ICEA 1L5OA 2R84A 4JU9A 2PWYA 2X0IA 3U7IA 2Y0BG 1M2VA 4DV4B 1DAIA 1EBUA 1PZXA 2O3TA 3LK7A 2V7PA 2ISSD 3FYDA 4GKBA 3PNTB 1KPGA 1YU6A 2CXNA 1RSZA 4YJGA 4UDYX 1MNQA 3RK6A 4B8ZA 2Z3WA 4CT4B 1N8TA 3A6JA 3H5VA 5BWOA 4LDRA 4ZCQA 3CO5A 1XNHA 4KMMA 3JQAD 1LFAA 3IUQA 1KXJA 4UQOA 2Y71A 2BHRA 1XJCA 4GXNA 4PWZA 1K7YA 4M86A 1V1MB 1E3IA 1MDFA 1E1CA 1MU0A 4WXHA 5IX8A 2YS6A 3OCYA 2PBRA 4TKMA 2ZATA 5CTAA 4ZXFA 1G5HA 3BXFA 4A23A 3WOHA 1XTSA 4G01B 5AI4A 4MR8B 3V7NA 2G1KA 3CLSD 1T91A 1P75A 1E6CA 4XRRA 2FMKA 5KU7A 2GZHA 2WD7A 4RA9B 2VJDA 5AHOA 2ZQZA 2Q8NA 2X3FA 3TWXA 2FPSA 3ED5A 4ZK2A 4QOJA 1UKZA 1XZQA 3AI7A 4RHCA 3FBWA 4CDGA 3W5DA 3SXUB 3VTFA 5ALTA 3BN3A 4MMZB 2ZU0C 3VZBA 2Q2NA 4CKXA 4EA8A 1ETHA 3PTLA 2HD4A 3NI2A 3BG1B 2QPOA 5JJIA 1PT5A 1JP7A 4MMYB 4UDXX 4E2ZA 3D4NA 1Y1TA 4BMPB 4P4SB 1TF7A 4MRUA 5IUJC 1XEWX 4X1KB 1R0WA 5FV7A 3W9GA 5CFNA 4APOA 3W1WA 2XKKA 2A5GA 3OPMA 3L82B 5FB3A 4CM4B 5ENRD 4K05A 3M34A 1BZYA 3ZWBA 2MIIA 1YQ9A 3IUEA 2IQ5A 1YR7A 3OQIA 3FNEA 4DV2B 5DTRA 4LHEA 4OLAA 5IJZA 4EHJA 1NP7A 1YK0A 4PRZA 2XE4A 3BCRA 2RD2A 4YH1A 1IN6A 1U9IC 1U5BA 4FGWA 4HYTA 1EDEA 3J7AC 5AJWA 4E22A 2V3VA 2EIJE 3NWJA 2C5AA 2A5EA 1HG2A 1O08A 1VG8A 1QVVA 4J1QA 1EMDA 1IATA 4MW7A 3GQBA 1QZZA 2GAIA 1OXUA 1PZEA 2FR8C 2VIIA 1WM1A 2VZ8A 3AO0B 3FHOA 3QG1A 4LF4B 3KV1A 3DLIA 4IRMA 4C14A 4IIVA 3PFBA 4C7OA 5BVGB 3CK7A 4BFCA 3JASA 1J5PA 4GB9A 1XG5A 3NT2A 3JYPA 3COWA 1WO8A 1BXRB 5HRYA 4LEUA 3CB4A 1B73A 2D0DA 3QWFA 4I2ZA 4RVGA 2A4MA 1PN3A 2VN8A 3K0FB 3KXPA 1P7CA 1X80B 1KYQA 4EARA 1AT1A 5I7UA 4QUIA 4K0KB 4IIJB 3DFZA 3CVJA 4ONEA 3WQHA 1XLTA 3BZWA 3L8HA 2WM2A 3OFJA 4CI0B 2C5SA 2Z2KA 1P5FA 2L18A 3V8BA 1KI6B 4JBNA 1EVYA 4ZDWA 4HAUA 2QN2A 3EIUA 5B30A 3QOUA 1ZH8A 1R8JA 4EVSA 4OY3A 3GLHE 5SZKB 1YACA 3HRKA 2D54A 5FPHA 4B79A 3T7CA 1SHUX 3JQGA 1SO8A 4JL5A 3P0IA 2HLHA 3EZYA 1OLSB 3KYJB 2YN4A 2V7WA 4F1KA 3F6CA 1OREA 2QVZX 3PK0A 4QFMA 6REQA 3QRWA 1E77A 2GUWA 1S1CA 3JU3A 3ZFWA 3L17A 2V4UA 2RFMA 4J7XA 2R2AA 1Y5LA 1BQEA 1FDIA 2V7QA 1U6IA 2PWBA 4XD7D 3UIEA 5GZ6A 1IXKA 1F7VA 2IZOA 2VQ6A 4OXYA 3NYIA 2X4GA 4RKRA 2VSXA 1YJXA 5HKAA 2A0FA 3SM9A 4QGGA 1X9IA 4IX9A 1JH8A 1QP0A 3WWZA 1UM8A 2GCGA 2FW0A 2OC4A 4MQ6A 3D8BA 4MUBA 3EGDA 4US0R 3RANA 3T6KA 3QWPA 4QAQA 3IP6A 1IRIA 2XWBF 1Q19A 5EKSA 1GU1A 3R23A 1ND5A 4N4AA 1LTXA 3GUYA 5KDOA 2TMKA 5BV1A 3SZGA 1HE8A 4I43A 1MC5A 2F9FA 3LTEA 4UUMA 3LDHA 2IEGA 3STHA 3AHFA 4Q00A 1G5TA 4IYRA 2BFNA 5EXSA 3DLAA 1DEKA 1ZAYA 2FK8A 3U3MA 3T1QA 3NDPA 1FB5A 1GL3A 1B2RA 2GF9A 3IBSA 2ZYGA 3AKDA 4MWDA 1NUSA 2RGNC 4DARA 2NQ8A 2X9VA 3LU1A 1JEYA 1LLUA 2D4HA 4KODA 4KUGA 1S7CA 5D51S 4K9SA 1UT6A 1WZEA 2GZ3A 1RHMA 1O8BA 3KQLA 4MEAA 4L0CA 1V47A 1S0UA 4DOMA 2R87A 3QVGA 1B4DA 1QX4A 4LC0A 5C7IO 4WW0A 1TM3E 1T26A 4JVNA 3IEPA 5E9WA 3ROKA 4PLTA 3DZBA 1FJHA 2Z2JA 1G9XA 3AFHA 1XJWA 2PLAA 1KI3A 3QWIA 2O8DA 1MGOA 2O2ZA 5IAOA 1SU8A 4MWOA 5L45A 4G5GA 4G67A 4QGAA 4D98A 4FEYA 2QLBA 4KKVA 2E89A 3OLZA 2XE7A 1UKCA 5KJFA 3I76A 4RIGA 4DDTA 1IWPB 3AGQA 1JECA 2AX4A 1JEEA 3B6JA 4BYGA 4GOOD 1IQRA 4D44A 5FWAA 2RB5A 4F45A 2P27A 3TINA 1VE1A 4CBVA 3E9ZA 4JP5A 3FU5A 1HRDA 4KR0A 1RM0A 4GH5A 4DAEA 3U9LA 5E7MA 2WXRA 3GNTA 3B48A 3UUGA 3F7TA 1DFGA 1AK2A 1FC0A 1CDZA 1XV5A 1ZD9A 5KJEA 4W9NC 3NBFA 4L5YA 4CF5A 4EI9A 3RC9A 4LHWA 5JCOA 1JBQA 2IHNA 4HQOA 4QM6A 3PJDA 1NMYA 3NANA 1UMCA 3DMFA 2QYSA 2AG6A 1NMZA 1NI4A 3KEQA 4ACBA 5HZHA 3QPVA 1WMEA 3UPTA 2YXLA 2H9YA 3QE9Y 3VZPA 3IIIA 3KD2A 3WKDA 4NBKA 1NE2A 5IF9A 3EQ2A 3JQRA 1ZH0A 3NAZA 1U0RA 1IK4A 1NVTA 3N7AA 3HWRA 3KKQA 1I7LA 2B8EA 3K5HA 2A84A 4M8NE 4L1KA 3PHHA 3WSWA 3CVLA 3OKFA 4XQGA 5A7FA 2NXWA 3M3HA 2MWMA 3RRFA 2H4FA 3PDHA 3LJKA 3J81A 1DPGA 4C6RA 3GLGA 4NHOA 4ZV7A 3JATA 4MKXA 2W2VA 1TCUA 3AOGA 4O4HF 4QYSA 2X0NA 2IU6A 1G3MA 2HLPA 3PKJA 4JZKA 3P94A 5CYGA 4E33A 5EE1A 3RRNB 2C4WA 5JZVA 1AUOA 1K4MA 1P0CA 2JFYA 2YIMA 4UQXA 4BKPA 1MO3A 1CQIB 5GZ1A 5CFZA 4NJMB 4QQFA 3OAWA 4DVJA 3L8YA 1AKUA 1HNXB 1IY1A 3OLCX 4X1YA 3O74A 4BTLA 4YP1A 4CU5A 1KMCA 2WIDA 3GAFA 4Z9YA 1EB8A 3AZPA 1U2DA 3CIOA 4J9UE 2AEEA 3PICA 4MYDA 3IV6A 1HXHA 5BSWA 1GZVA 4FLMA 1RZVA 2H1OA 4CM7A 3FZEA 1FXWA 4YFYA 4NJEA 5AJDA 1A98A 3IV7A 3NHSA 1W44A 1PJSA 2C9OA 2FUG1 1QO0D 4TV9A 3DAGA 2PJZA 4N7JA 2F37A 3EX7C 2UVDA 4ER3A 1L4MA 3EHDA 4L51A 3A1FA 4A03A 4KREA 1BN7A 1E2DA 4ANFA 2I8CA 5BSGA 2FEKA 1ORTA 2JI7A 3UENA 3WLRA 4HDNA 4OI0A 4ECAA 1HC7A 221PA 1T4GA 2XA2A 2P5TB 2RHWA 3MINB 1ZRHA 1L5JA 3AI3A 5KYNA 2LNIA 4LGVA 4KLZA 1LZLA 2J9FB 3FXAA 4B75A 2VS1A 3VR0A 4ARZB 3TI7A 1JSRA 2QGZA 4KAXA 4ZV9A 2RHBA 3ABOB 3FTDA 3NEJA 1G41A 2JGIA 3RD5A 1U04A 2PNNA 5A4KA 2E7ZA 2V5AA 2O19A 3EDQA 3KCQA 2QMYA 4J1TC 2FWBA 1YTLA 2DKFA 3ULQA 1DQRA 4OXXA 2NQ2C 2DAPA 3DO8A 1YZUA 3N8DA 4J03A 1KC3A 3N70A 3JXJA 1UQRA 2VR1A 3NM6B 6ADHA 1T2FA 1AC5A 1BX0A 4AM8A 4MRRA 5AXAA 1WY6A 3TFQA 2FZVA 1PCXA 4YAOA 4JBXA 2YJZA 3WGTA 1UIRA 1J1ZA 2JH8A 2CLHB 4DNFA 2E4XA 1SC4A 5B1YA 5I9BA 3TUJC 1RR6A 2J9GA 1I6LA 2Y1DA 1ISIA 3OE4A 3BX1A 3ZU4A 1FK8A 4Z0NA 3VX3A 3D3NA 1NVUQ 3GLUA 3LDGA 4P3NA 4RWEA 1AKTA 3OZWA 1A8HA 5D3KA 5DW3A 1L4NA 3FCAA 2OGUA 1PS8A 1X86B 2YIDA 1DMRA 3MW8A 4HDMB 2FULA 1W85A 4Q9AA 3MAJA 1ADBA 2R4QA 2FP4A 2UXDB 1W2GA 1TEVA 3NO4A 1G5PA 1M3SA 3A6PC 3OF2A 2VDRB 3ZI4A 1YHYA 3URMA 4MPRA 2RHDA 2A30A 1VL1A 1MJGA 3PYXA 3T5BA 4RD6A 4BLVA 2FWMX 1YIOA 5KJ1A 4GC9A 4TRMA 4BP1A 1XPOA 2F1HA 3WQSB 1Y1KE 1L4BA 1ILEA 5JC8A 2G9RA 4XX0A 4WAFA 2D2IA 3IAEA 2JFHA 4G37A 2QZ4A 1RI1A 3WGGA 1HPLA 4H0NA 3QUQA 4R1UA 1CR1A 1JDSA 4MQMA 4HN2A 1K5GA 3VYUB 2XMDA 2FY8A 3LBFA 1J06A 3QKUA 4HS4A 2BGGA 4EG4A 1G4AE 1A9RA 4K5AB 4BQRA 3FZQA 1WP4A 2FZLA 2DZOA 3OCXA 3S4YA 2IHUA 4B4OA 2XZTG 4CF4A 3A6DA 3PHLA 4DR2B 3OZ7A 2Y0CA 4BX0A 4L6AA 3W04A 2Y2UA 2W48A 3G68A 2D5CA 3ROPA 2H4HA 4LJKA 4J0JA 5DXFA 3ZXYA 4Q0MA 4BV2A 4M9UA 4G2NA 5P21A 4E51A 3GRAA 1K98A 3NNNA 3CZPA 3V8PA 4RTLA 4ER5A 1BFKA 2Z58A 3W06A 3KZOA 1U0BB 3ACCA 1WTAA 4BP8A 3WK6A 3PD1A 4CKBB 4BP3A 4IR7A 1NX9A 3ES9A 1FFEA 3UBTA 1I14A 1WB5A 5FLXA 2Y67A 2ZBFA 1QC5A 1KYTA 3D9HA 3T0FA 2ZCVA 1KQFA 5CU7A 1IVSA 2WABA 2QTNA 1U0FA 1Z62A 3TB4A 3I5UA 4GWKA 1QGAA 2ZRNA 3EIJA 1VLVA 4WGFA 4G25A 3HEAA 1OI7A 2DCMA 4D3FA 4CR8A 4M83A 3EIQA 2VNAA 2BMAA 3C6MA 2VJPA 2YS7A 4PFKA 4G5QA 3DBOB 3HMQA 3PC8A 1CB7A 4PRLA 4C7VA 2ZEJA 3SBDA 2XMQA 3RYHB 3CUTA 2W8BB 3FULA 3BWXA 2JAUA 1II8A 1K3ZD 3BEDA 2X0DA 3ICOA 5B64A 2SECE 1JFLA 3A0UA 3W5AA 1UWVA 1KY2A 1ELRA 2GJAA 3ICVA 5AKGA 3EZ6A 3FM9A 3HU5A 5JE8A 4LERA 4R2IA 5BMVA 2JLAA 1K4KA 6ABPA 3PVCA 3QE0A 1OZAA 5JQWA 1S8NA 4BZZA 2F8LA 1WKCA 4O2BB 3QBDA 1MPXA 1C9YA 3BFPA 2P35A 3OCZA 1P45A 3H0KA 1BU8A 3RJVA 3FUUA 3ZHEB 1VSVA 2M6RA 1O6CA 1RMQA 3EC1A 5ALDA 2ZXUA 1G3IA 4E46A 3C4JA 2FW9A 3NXKA 2N46A 4KQCA 1A9YA 3WTCA 3CGHA 1RI5A 3TIVA 4YCCA 2P8SA 3P2OA 2CJFA 3NEAA 5C9ZA 1AGYA 2IBSA 2Q2QA 4PS3A 3VZRA 1S63A 4ZTUB 4HDSB 3FNFA 4JQSA 3IJEB 4FGSA 1RZ3A 1IXVA 3QVOA 3PT9A 1C0IA 5FWYB 2X9LA 2BMDA 3PLRA 2QJWA 2GD0A 4P5DA 1JNYA 3GH1A 4RPCA 4MW6A 4OK5A 3AF1A 3DPYA 1XQVA 3KR1A 3RHTA 1N9AA 5KWEA 1ESEA 2NUAB 3R9XB 1JJFA 1WMDA 3FR7A 2VH1A 2H7CA 5L6MB 3FPAA 4RD0A 1SVMA 1FFYA 4R84A 3G0CA 4MRNA 4CLXA 1HSOA 3IS3A 1EP1B 4YMVA 3U1TA 1PSWA 1YDEA 1U3WA 4GI3A 3VCXA 4BLSA 3SKVA 2E4ZA 3V00A 3HCCA 1KR2A 3GPLA 3MSCA 5A9TA 3DZGA 1Z3XA 1GAWA 3CSUA 3OPQA 1MH9A 4XSHA 1WXQA 3UUXA 3UKRG 3RTAA 4CMHA 1LDBA 1SEVA 4I1YA 4IVNA 4JBIA 3PC6A 2RKOA 1H6DA 3ZJ5A 5LNK6 2DE0X 2Q62A 2ZZKA 3JZIA