4GYWA

Crystal structure of human o-glcnac transferase in complex with udp and a glycopeptide
Total Genus 281
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
281
sequence length
715
structure length
695
Chain Sequence
PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKHIYDNRIVLNGIDLKAFLDSLPDVKIVKNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
total genus 281
structure length 695
sequence length 715
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gywA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gywA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gywA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gywA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gywA03
3OTGA 1JG6A 3BEOA 2KC7A 1GG8A 3G2HA 2SKCA 4NRHB 1PYGA 2J9QA 3CX4A 2XPIA 2GT1A 3PDNA 4F96A 1GGNA 3MTDA 4NC9A 1NOIA 2G9VA 3Q47B 5D00A 2VGYA 2IYFA 3QKWA 5G05J 3C4VA 5C1DA 3SYRA 3KAEA 3N71A 4WHMA 4KQ1A 2AW3A 3EBOA 3URZA 3UUXA 2AVPA 1FC0A 2QN1A 2V5FA 3CVLA 2R5SA 3AMVA 2IF4A 2F9FA 2JJMA 2PRJA 3HBMA 3RKVA 1LWOA 4BT9A 2P6PA 1OUVA 1RZUA 2F3QA 2IFUA 2YJNA 1V4VA 3SF4A 5FZRA 3ZCUA 3S29A 1C50A 1P2BA 5ARFA 5GPBA 3AS5A 2X0FA 2QLLA 5KJLA 3Q15A 1NZDA 3CUUA 3IEGA 2VG8A 2PQNA 4JA9A 4HWGA 4UI9K 3CKCA 3C4QA 3TG4A 1WV0A 1WW2A 2QRMA 2VSYA 4CTMA 4BTBA 4EQFA 3PE4A 1LWNA 5HI7A 4J0UA 3CVQA 3HBNA 3ASDA 3E3OA 4N9WA 1KLXA 4RIGA 2HO1A 4MI3A 4M60A 2XMPA 3S7BA 1JIVA 2R66A 4WNEA 2FF4A 3WXXA 2ATIA 4NQ0A 3S7JA 1HLFA 2H1FA 1ELRA 3CUYA 2OFFA 3TSAA 1P5QA 6GPBA 4FZRA 1GPYA 5A6CA 3ZPJA 1NLMA 1HZ4A 1GZ5A 2DBAA 2BUGA 2Y4TA 1C3JA 3COPA 1KT1A 4BQIA 1TJCA 3VDMA 4AIFA 4I9EA 3LY7A 2R60A 3BD7A 1XV5A 4RG9A 3CEMA 4NESA 5M72A 3HBFA 3FWVA 4G1TA 3RO3A 5I45A 4RIIA 4KQMA 2FI7A 1JIXA 4G25A 1YA6A 3U4TA 3OTIA 3EDTB 3DDWA 1FU8A 4LDPA 3S7DA 3TOVA 3TG5A 4KBQA 5DBKA 2ONDA 4N3AA 2VCHA 3Q4AB 4N2QA 4U0UA 2QNBA 2IEGA 3U3WA 2O6LA 5DU2A 4AY5A 1FTQA 2WTXA 4HLNA 1WM5A 1FA9A 3MS7A 2IUYA 3ZHEB 2ECPA 2C4MA 5IKPA 2Y4UA 1XNFA 3UPVA 4JHRA 3CEHA 3E3LA 2IV7A 1ABBA 3LKUA 2XEVA 2VSNA 2PL2A 4GPKA 4YUAA 1A17A 4GYWA 1NZNA 2VGXB 2GPNA 4BQEA 3LCAA 3T5TA 4FKZA 3CK8A 5DXFA 3FROA 4KYOB 2QRQA 2QRHA 2X6RA 4I2WA 1WAO1 4MRAA 7GPBA 2QN3A 1QZ2A 1C8KA 2X6QA 2KATA 2UY1B 1WW3A 3VUEA 3OXLA 4RENA 4H7XA 1P2DA 3QDNA 4YVQC 3L79A 4G26A 2PYIA 4YI3A 3ZCVA 4QLBA 1L5WA 1B4DA 5D0OD 3S28A 1VGVA 4LEUA 4U0ZA 2ACVA 3Q3IA 1FTWA 2C9ZA 3ULQA 3OKPA 4CTOA 2GPAA 3BD8A 2HR2A 2ACWA 4GPBA 2BGTA 4G24A 3CK9A 3OY7A 2QLNA 2LSUA 2IYAA 1NA0A 4F97A 3IAAA 4RIHA 4B94A 3ZFWA 3BCUA 2PQ6A 1M5RA 1XL0A 3FFLA 4N5CA 2KCVA 4APOA 4G2TA 3D0QA 5TMDA 4I9CA 3CVNA 3AS8A 1K06A 1WV1A 3NP7A 1ELWA 4HOSA 5JTTA 3O3CA 2QZSA 2QRGA 3D0RA 2R68A 4MI9A 1H5UA 3GZ1A 2XA1A 3QWPA 3E3NA 2XGSA 3MV3B 4N39A 4CGVA 5LCWC 1YA0A 4XI0A 2KS6A 2VCEA 1QM5A 2R4TA 3L7CA 1SXPA 3C48A 4JA7A 3CKBA 4AM9A 3VUFA 3OXGA 1E1YA 2FF5A 4MICA 2I6HA 2QN2A 3VDNB 2FFRA 4BQFA 2YHCA 2JZCA 3QWWA 5JTUA 4I2ZA 1Z6QA 1L5QA 2OOEA 1KT0A 5EX0A 1QQEA 2GJ4A 3QHPA 2GW1A 3MSCA 3EBPA 4N2SA 4ME2A 3ASGA 4JL0A 3MS4A 3MT9A 1BX3A 5HQ8A 5CHEE 3CUWA 4X6LA 3OT5A 4GZ3A 2GPBA 1FTYA 4NEQA 2WQHA 4X7RA 2JLBA 1WUYA 3T3IA 3NC4A 4WNGA 5G04J 5BW8C 2C1XA 2BISA 4CDRA 2R4UA 4CGWA 5FZSA 5IKOA 1Y6FA 2IEIA 1FU7A 1P4GA 1XL1A 4WNDA 1AHPA 2C0LA 3T7DA 3ZCTA 3MV2B 1P4HA 3OKCA 1NA3A 3LY9A 4L22A 2E2EA 3QKYA 3E4BA 5EKQD 3UYKA 3UYLA 4UI9J 4BWRA 3ASFA 2QN9A 5FT9A 1E96B 4G2VA 5KJMA 3GPBA 4H7YA 2XGOA 2F3SA 4MHSA 3L7BA 3NB0A 4AY6A 2IV3A 3CUTA 1L6IA 4KQ2A 3MKRA 5TMEA 3RHZA 5JJ6A 4WUYA 4REMA 2NC9A 4W9RA 3CVPA 1F6DA 3LPZA 2XCBA 2XGMA 2F3UA 3NP9A 3L7DA 1NVKA 3ESKA 3T3DA 1JIUA 4EKYA 2KCKA 3GYZA 3S7FA 5BNWA 2QRPA 1RRVA 4YNDA 1NOJA 2AMVA 3DDSA 3S2UA 1L7XA 3MRTA 1L5RA 2Q7FA 1HH8A 1HXIA 3MTAA 3K9IA 2SKDA 4UQZA 4U07A 1PSWA 4IN3B 2ASVA 2IW1A 3G2LA 3RIBA 3Q49B 3D1JA 4G23A 3AS4A 1RZVA 3CEJA 4YI5A 3KD7A 4EKEA 4UQYA 4J8DA 3WC4A 2P58C 3LY8A 5AYWD 3H4TA 1PC2A 1IIRA 1Z62A 4EL0A 3IA7A 3MTBA 3O48A 5D01A 1PN3A 1XOIA 3G2NA 5LCWJ 5JJ7A 3GW4A 4RIEA 3QOUA 3Q3EA 3T3GA 1L5SA 4GYOA 1F0KA 1XKXA 4WNFA 5DIZA 5ARGA 4MHOA 4ABNA 1UQTA 4LEIA 3RSZA 3CEQA 3CK7A 3S27A 4GA2A 2L6JA 5HXAA 3MT7A 2FBNA 4U04A 1FS4A 3LYAA 2QN8A 1FCHA 3TGOA 5TVGA 2QFCA 3SYMA 3GZ2A 4BTAA 1YGPA 5FJYA 3CUVA 3T3EA 1GPBA 4Y6CA 1C8LA 1A8IA 4BT8A 4M83A 3ZCPA 3OXFA 4GZ6A 2PQRA 1K08A 2XA9A 4N3CA 3ZN3A 3RO2A 5JJTA 1FU4A 3NCHA 1PNVA 3HBJA 3L01A 1Y8ZA 3SZ7A 4XIFA 1NOKA 4WACA 3ASHA 3NF1A 3WADA 3KS2A 4A1SA 2G9QA 4O6FA 3ZCQA 2QN7A 5FTPA 3GUHA 3OKAA 4N3BA 4RIFA 3OTHA 1B89A 3BCRA 2AV6A 5BT1A 3VTXA 1UZUA 3MRVA 4CTNA 4HOTA 3Q3HA 4WADA 3QWVA 2WPVA 5G05C 2C2LA 5FZQA 3R9AB 3ZGQA 3WAGA 2H1HA 8GPBA 2XCCA 1J39A 3RU0A 4UQXA 3CV3A 1UQUA 3MEKA 5KJNA 3UQ3A 3G2JA 3MRXA 1P2GA 4I17A 4U0SA 3ZHEA 1EM6A 1O6CA 4EJ2A 4Z5XA 2G9UA 2BGUA 2GEKA 2VYIA 3MA5A 2KCLA 1NZFA 3Q5MA 2LNIA 2VGXA 5EX3A 4GCOA 1SXQA 2FETA 2UWJG 4F3VA 3H4IA 2F3PA 2HYZA 3BDAA 3TAXA 4HOQA 4XI9A 3JYSA 5D0QD 1P4JA 3BD6A 1Y6GA 2UY1A 2PZIA 3OY2A 4PQGA 2HY7A 2Q6VA 3NAZA 2ZB2A 4Y6WA 1ZU2A 3BEEA 1W3BA 3VTYA 1Z6PA 3S0JA 2VQ2A 2YQ8A 4I1AA 4YVOA 5CCMA 1Y8MA 3PE3A 1JEJA 1AXRA 1Z8DA 2PRIA 1P29A 3G2KA 1GPAA 2QLMA 1GFZA 2GM9A 3MBOA 1KTIA 3RSCA 4GCNA 2GEJA 3HYMB 5ENZA 1WUTA 1E4OA 2X0DA 3MQFA 3DZCA 4EL5A 1ZBPA 2AZDA 2XCIA 1L5VA 2LSVA 3ZCRA 2XCUA 4MI6A 5KJKA 2X0EA 3ZCSA 5CCLA 2C1ZA 5G04C 5A7DB 3NPAA 4AMGA 3L7AA 4GA1A 3T3HA 2G9RA 5LQDA 3G2IA 4W6QA 1JG7A 3BCSA 1XC7A 4HOUA 4J8FA 4AMBA 1IHGA 4M7PA 2FEZA 4X7PA 2FO7A 1IYGA 4BFCA 1IXYA 5DLDA 2BFWA 1QKJA 4GZ5A 2XA2A 4UI9C 3DD1A 5TMBA 4GYYA 2SKEA 4AN4A 3RT1A 3MT8A 4KXKB 3FP3A 3CV0A 4X7MA 1EXVA 4RELA 4GA0A 3MS2A 2PYDA 3RJVA 4J8EA 4RBNA 4RG6A 4HORA 2MHKA 9GPBA 4F9FA 2C0MA
chains in the Genus database with same CATH superfamily
1XDSA 4GRIA 2D0DA 3ZLVA 1A9OA 2C4KA 1G16A 1MV8A 4JI7B 3UKRG 3A6PC 3DBRB 3HJAA 3GV0A 1PS0A 2V7PA 5F51A 3ZCUA 4B4KA 3L7JA 2XMZA 5H70A 4CT4A 1XRPA 4MVJH 2CLHB 2B35A 2XEHA 3HBNA 3LBHA 4WOCA 4D10C 4ZQEA 1O6FA 4KNWA 4ABYA 2QMOA 3W5UA 4EGFA 2EKDA 1B8PA 2PHZA 2HB6A 3L6DA 5U1PA 4M38A 1F5SA 1PD1A 4HQFA 3R5SA 4HFGA 2WRZA 2QNBA 4JB0A 4B3FX 2M6SA 4HLNA 3RB8A 4BX9A 1WL8A 1JJBA 4QGFA 4PINA 1EP2B 1KEEB 3DAYA 4AS3A 5CBPA 2W2KB 3QWBA 4BJ6A 1IWPB 1JF8A 4PWYA 5CLFA 4FR5A 1NW6A 2FPMA 3RGGA 2FF7A 4FU3A 2BGTA 2I03A 4ZAVA 2EHJA 2GERA 5KCZA 2A9PA 3Q0EA 5REQB 3D0QA 1GZVA 3N7AA 4DIDA 4AZTA 4S1PA 1CUEA 4O8CA 2KS6A 2ZSUA 3C48A 3CRMA 5JQGA 5IUJC 2XKAA 1Y6QA 2XEXA 2HTFA 5JTUA 3H65A 1MO5A 2Z1MA 1DT5A 2FW0A 3BF8A 4EY3A 4ZIRA 2Q2QA 1DXYA 1LF8A 1R4MA 1W0JA 3I04M 1HOTA 4EYOA 3BBPA 1PFQA 2OD7A 3Q15C 1Q57A 1KDRA 4P2BA 4X5OA 4C4TA 5BW4A 4S1NA 4OYYA 1M7HA 1RE1A 3O2SB 1YDFA 5BW6B 3KEZA 3VPFA 4DADA 1XCOA 2AJCA 3H3FA 3ANMA 1MTZA 3DTTA 4F85A 1VFNA 2NTVA 1HH8A 2GA9A 1PSWA 5C7OO 4Q1FA 3VR4A 3S5UA 3DVQX 2DQZA 3KD7A 3HC7A 1W4AA 1DBRA 3OIDA 2VNIA 4LFAB 3UWPA 3B6EA 4QHYA 4W1QA 1JDPA 1CNFA 5DN9A 5ARGA 3HA2A 3KQPA 4TLAA 4C7VA 4OU4A 3B7BA 1SPBS 1V1JA 2VRBA 2XXAA 2J5QA 2D7CA 3OFJA 4DX2A 3GPDG 1ZONA 2C8KA 2HU2A 2AMJA 2YYZA 1W2GA 1RAGA 2EG9A 5ADWA 3EIOA 1A8UA 3PZBA 4YRFA 3H2HA 4JBNA 1QB8A 2JANA 1KO7A 4ZVRA 4LTNA 4LI3X 1LDMA 3R7AA 1UPBA 1RYFA 3N7TA 3QMMA 2EXXA 2PLAA 3ZWQA 3MK31 3QVSA 3I2HA 5IULC 2D5IA 3T52A 1OB5A 3OKFA 2R47A 1HYEA 3IEKA 1T2DA 3DC2A 1ZSVA 4YRBA 2BLNA 2EDAA 5IP5A 2HQSA 5A5GA 4K9LA 4PR0A 2I3BA 5CTJA 4EJFA 1JJ7A 4JJFA 5ALEA 4TZTA 2HBZA 2NX2A 4PHFA 4J0JA 3V4PB 1P72A 5HJ5A 2ZB3A 2H7CA 2B2XA 4B35A 2MYTA 4OKIA 2A94A 2IHNA 1KMHA 3CLHA 4KXNA 4GPTA 4QEZA 4ZICA 1OX5A 3VKHA 4A5OA 3HB4X 1BFDA 4F2DA 1U7TA 2NZUG 4UARA 3UJ7A 4EF4A 2MHKA 3VZDA 1U5BB 4RV9A 4XYBA 3UJ9A 3E18A 4A3SA 3FDFA 5FOWA 1TM3E 3MTDA 3EWAA 5F3RA 4M7OA 1UOOA 4G41A 4XVUA 5AVSA 5ITWA 4Y1GA 3BXZA 5FZRA 2NNLD 2BE9A 1E6LA 4WLFA 3LWZA 3I34X 1Z7YA 4CMEA 3NOXA 4TOIA 1ODKA 4P0QB 3EPJA 2B83A 2GYUA 3JZAA 4L2LA 3RYIB 2ZUDA 4Y2YA 3MOIA 1GZ5A 3FOBA 2X13A 1C4WA 4D6PA 3QOXA 4JB8P 3QV1A 2E7ZA 1T15A 4RD1A 3RU9A 1E20A 1VHWA 1QHGA 2JIQA 4Q7LA 5ENDA 3BRWA 4QA9A 1EGHA 1TM1E 4MPTA 5A7HA 1DTWB 4YUAA 3PGXA 1A17A 3RIGA 3COWA 4KPEC 2AWIA 3TCNA 5HZMA 1WXFA 5TS2A 4BJ3A 3SX0A 3QLJA 3X1WA 1H2TC 4RENA 1U28C 1YQDA 4K3UA 4YRCA 4D1YA 1UT6A 5IN4A 5JISA 4A3VA 2AXNA 1UOPA 2I4MA 4BX8A 2XNDD 4HHEA 3MLEA 1L1QA 3JQBA 1XD2A 3FWHA 3N2LA 1JLKA 3VI4B 2PH3A 4JOBA 4KW7A 3ETHA 3K32A 4DCJA 4RTPA 4FFOA 4Q48A 4JELA 2VPIA 4JQSA 4OFXA 3B8HA 2IU1A 4R51A 4Q03A 5K01A 4S0XA 4IJWA 3V97A 4OQXA 4ARCA 4LNUA 4ME2A 1OCZE 3ZUPA 3UAVA 2CB9A 3E7WA 1PT9A 1NLYA 3PEUB 3OCVA 1CQJB 1K89A 4JYCA 1ZIXA 1NAHA 2XDWA 4QG3A 3WSTA 3LY9A 3TWXA 1I5OA 1PVDA 3LV8A 5ETJA 3ENEA 1OH7A 2CXUA 4Z51A 2HNAA 3GVXA 2IO3C 1V48A 5FOTA 3P96A 1UPXA 3TFWA 2KE5A 3P9NA 1ZH4A 4QBIA 3OEED 3ZWPA 3GJYA 2NN3C 2QS9A 3OCZA 2I2CA 1K3FA 2VHXA 4LX0A 4IDBA 2BGNA 2AYYA 5C1OA 2RHOA 2QTRA 4NPHA 4PRZA 3MGGA 4PCAA 1MHPA 2YOHA 2RFMA 3C87A 5GAJA 2X3MA 5IDWA 3C3JA 1X1BA 2WILA 5TVGA 4JXKA 3DQPA 5JLAA 5EHIA 1ZH0A 4F86A 2VAMA 2OAQ1 1NNUA 3K9GA 1E4VA 5JRDS 2A88A 1CUHA 1U8TA 2I78A 3ASHA 2WD8A 5HIAA 1B0PA 3OKAA 1FDVA 5SY6A 1Z0ZA 4TQGA 4LXTA 2DGDA 3R0QA 3VTXA 2ID4A 2D1SA 1WVMA 3NMUF 2OCBA 1HQDA 4XIYA 4UAGA 4BP9A 1KRWA 3INNA 1IRXA 4J0GA 3RJTA 1Y9EA 1JNYA 3RTAA 5B7PA 2MRIA 1RMTA 4E1VA 1O6ZA 3IAUA 3KEAA 3ND8A 5CHYA 1CQWA 2HXSA 3KKPA 2C3YA 1P9WA 1U3VA 4O4HB 3PNKA 5SY4A 2YIDA 2R1UA 5CVTA 3TNFA 2WG1A 3GFTA 2QB5A 2C2OA 3AHIA 3CG4A 4HZIA 2VAWA 3BRWD 4LF6B 5CMYA 1YMQA 5C7IO 3DFMA 5IBQA 1MDFA 4Y2JA 3P27A 3SQOA 4UPVA 1WU8A 5KYUB 3FVVA 2X6JA 4QBTA 4XVCA 3EPKA 1FYWA 3BQ9A 3GA7A 5J4VA 1EFTA 1WKCA 5BV2P 5F1PA 4NNJA 4NRHB 3LK7A 3F9CA 5CIYA 1MJGM 4ZTZB 3RS3A 4DILA 3PWKA 1ZICA 3N71A 3SD7A 4XZ4A 5SYAA 2R5SA 2KM4A 1UBCA 3OE4A 1OU4A 3W5AA 2Q3EA 1EUQA 1T1IA 3R7FA 1V4VA 5F9FA 2OR3A 3HA3A 2QLLA 4HNSA 1NZDA 1ZUD1 2V5QC 2JD2A 4JR0A 1IBLB 2YW2A 3RI3A 3QJYA 2YIMA 4GXNA 4CDMA 3V4SA 2P40A 5BR8B 4OUDB 3DWEX 3K73O 2PSHA 4Y1EA 1ML3A 2VDUE 4WKCA 3ZYMA 4YMSA 1VE9A 4R8LA 5L9AA 1GCIA 1M10A 4I9EA 4OKNA 3JZDA 3AJIA 2E18A 2VXYA 5ER6A 2J49A 1YS2X 4QOJA 1UINA 3DFKA 3COJA 2F7SA 3H8JA 4KXUA 4YDWA 4PAMA 4X6YA 2C4MA 1LBEA 3TLGA 3D3WB 4G5QA 3I52A 4IFIA 4HLQB 1DWPA 5KSYA 4KXWA 4HAUA 1MJ5A 3PFGA 2JGNA 2ZQ5A 3DMGA 4U0ZA 3S44A 4EBAG 1EH5A 2NSYA 3RRJA 4INZA 5K8CA 5CU7A 3OF3A 2J33A 3H3JA 2RHGB 4UUCA 1UL1X 1LNQA 3FDZB 2QOEA 1ZN7A 4WLEA 1QFJA 1EJ2A 3CS3A 3T9BA 1R5JA 1LA2A 3IESA 4Y6GB 3AERB 4DLOA 1NV9A 1YUMA 1D09A 4J8PA 5AHRA 1RWBA 3VU9A 2OOEA 1WNFA 1XROA 1K75A 2I80A 4IVPA 3TLCA 4O5OA 5CB6A 2EJUA 2OHFA 1NMQA 2EINE 1UH5A 4KE6A 1S2DA 3JZMA 5EJ5A 3V32A 4PYQA 4GW3A 5DHUA 1PGPA 1WNTA 3D9LA 1G4AE 3JVVA 4UQOA 4ZO4A 1EQ2A 3ZW7A 3KZVA 4ER3A 2BDTA 1P45A 2FPIB 3NQ41 1AK1A 3IEIA 3VCXA 1F6DA 2IZ1A 5LP6F 4KQ9A 1EHIA 1RABA 3ACDA 3LT5A 1KFCB 4DLUA 4A7PA 3A1FA 5FR2A 5HVNA 1BWRA 1UBEA 4B3BA 4OLAA 4ZCIA 3UC9A 3NUQA 4ZP1A 2AI1A 4ARVA 3AVOA 1HLPA 5LP1A 4YMHA 4GYOA 2H3HA 2R7NA 3AHDA 1E60A 1J1ZA 3CINA 5BN5B 4RA6B 1TYZA 5CD9A 1T9ZA 1VG9B 3A4LA 5BYBA 4BLQA 3GNSA 1YU6A 4H3VA 2VLBA 3SK0A 1KWGA 1WMDA 4UHBA 4M0FA 3EHMA 1VL6A 1K08A 2FMHA 2ZKLA 4Q1BA 4XQGA 4UREA 2WXPA 5AK4A 3M6IA 2FCRA 2HHCA 2QW8A 3QU9A 1PDOA 2XVYA 5JJCA 2OPHA 1FSZA 3DVRX 2GZSA 2IEBA 5KYNA 2CV1A 2WWTA 5LOVA 1PEAA 4P7JA 4TMXA 2H63A 1N6LA 1SXQA 4UYKA 1N7GA 4F46A 2FEXA 3TAXA 2IBMA 4TTVA 4R01A 3WK5A 1GSIA 4J16A 4UUPA 1X1EA 3OZSA 1ITZA 1TEVA 1KXJA 3PNTB 5BO5A 3OMWA 1YJ8A 3SGLA 5K7SA 3FTUA 4HOYA 4KO2S 2VEOA 5ALIA 1X8XA 3MBIA 5H80A 2ERYA 4EGCB 5JVDB 1NVGA 1GA6A 1SKBA 5CXXA 4MBGA 2UZ0A 4P58A 3MM4A 2C2BA 3L16A 2PL5A 4F1JA 4TWJA 5BSKA 5FFMA 5DMXA 1U4OA 5C7LO 3REOA 1UEIA 4R9NA 5T57A 4IG4A 1RBMA 3GGCA 2LCFA 4BVBA 2DC1A 1L9XA 3JUEA 2AQ8A 4FGKA 3Q7SA 2XRYA 1SIOA 2KW5A 2Y9MB 1TN7A 4H3SA 1OUVA 4Q7EA 2AFRA 5BWLA 2ZIAA 4OBEA 4NR0A 3DSXA 1HO8A 3WV4A 2Y99A 2V9ZA 4O1HA 3SMQA 2WOOA 2YWHA 4YA6A 3VV2A 1EXNA 3C3BA 1KZHA 1ECLA 4JS0A 5JD5A 2GXAA 2C9OA 3H0EA 3T34A 4DMHA 4PF1A 4IHJB 4B6OA 4A1GA 1NM5C 2AZ4A 3TQIA 4TV9F 2XDQB 1O03A 1XZKA 2GDZA 1PVVA 3W5CA 2BEJA 3CVOA 3RYHA 2RIPA 2Q1WA 4CM4B 4Z4CA 4Q3BA 2XQGA 4L75A 2HL6A 3WDMA 1A8QA 5GJCA 4C9BA 2J1LA 5EYPB 1XVVA 4N40A 4E21A 3SK1A 4MRAA 3CWZA 5BN1A 2X3FA 3G9QA 5LIRA 4BEBA 2X5JO 1OLSB 2FGJA 1L5GB 5HYVA 3QF4A 3FWPA 2QL6A 1N3LA 4NRDA 1J09A 4FE7A 3KOUA 1A5AB 3PKZA 3NPMA 2RHWA 2X15A 4YRPA 2FSVA 1QS0B 5GOZA 4C0BA 4NOJA 4FSXA 5JSHA 2PJRA 3UH1A 1XI2A 4GLLA 3LPMA 3GZ1A 5FF9A 5CEAA 3CM0A 3JR3A 1U7ZA 4AJWA 4GECA 3K5WA 4HVLA 1RPTA 4XLTA 4FFPA 2V7TA 1W4BA 4LQDA 3C97A 3EDOA 2ILTA 4BO2A 4BP1A 3GBVA 1PR1A 4AXBA 1BG6A 1IEVA 5CVEA 4QFBA 3N0XA 3LW7A 3TGPA 3MWJA 3ABRB 3N9IA 2FSHA 1PYOA 1NU6A 3IXEA 4Q9KA 1E2MA 4FFLA 1TKCA 4M89A 4V0KA 1ZESA 3G85A 5IC6A 4WKBA 1S3FA 3PCTA 3U26A 4TUYB 4UUQA 3PXCX 4ZI7B 3EGOA 3EXHC 2XZLA 1ZZGA 1V3VA 1DIHA 3AV3A 3SM9A 4J1SA 1U2ZA 2PGDA 1JSCA 4X8OA 1MAUA 1YJQA 5AKZA 4LUCA 1QG0A 2PJUA 1E3SA 3FTCA 4PLPA 2SKDA 5FWYA 1M6EX 4TSFA 4RLSA 4WNCA 4A16A 4DQ0A 3FY4A 4M6WA 1RJWA 1T5BA 5E9JA 1XCPA 2O3QA 2EL7A 4NFLA 2ZYVX 3GF4A 3QXSA 3B1WA 3UHOA 1OAOA 3IMKA 1QTQA 2G80A 4Y6CA 4MP3A 1L1RA 2C54A 4M0EA 3DE2X 4J29A 4BLVA 1EFUA 1YZGA 4D3DA 3JQ9A 4BIIA 4WXHA 2O20A 2GZMA 5BSRA 4NG4A 4IJMA 4QBHA 3D02A 1N2BA 1JR3A 2FOXA 5DYGA 4UFPA 4EYKA 4QECA 3EQ6A 1GTJ1 3RS2A 1EM8A 3GIDA 3IPXA 3ZW3A 3UT4A 2I54A 2X9LA 4UZFA 4JOQA 3V2IA 4ALNA 2WHXA 2QYSA 3A11A 3VO8A 3Q5MA 1QYIA 5BQ3A 3V8BA 3RYTC 3NOVA 3PJEA 1UPUA 2ZTLA 2W83A 4UMVA 1F1JA 3ZWOA 1XAHA 3I1IA 4FMDF 3V1YA 2GK3A 5T3RA 4KXLA 4BNKA 3DZKA 2FHSA 4QASA 2VATA 1LX6A 1Y7LA 1CZLA 3G2IA 3NZSA 2QI9C 1Q84A 1JJAA 1JSLA 3PVSA 5E38A 3VA7A 4FSDA 4B3XA 1LLCA 1JI3A 2PXHA 4RETA 1U6IA 2ZR7A 1ACJA 1R2QA 1NW8A 3P2BA 2DERA 3BG1B 3QX3A 3UG6A 4N03A 4K9OA 1JDJA 1JQJC 1X77A 2VTEA 2I2AA 3AUUA 3U7JA 3DXMG 1AY0A 1G8KA 1K8RA 1JZSA 1MAHA 3MOGA 2JLZA 4L16A 3QFSA 5E1DA 1IG0A 4HAWA 3UB4A 1OJ7A 4WV3A 4NICA 2O1SA 4IJVA 3HKCA 1U81A 4EG3A 3KXPA 1C5KA 2GD0A 3QJ5A 3EIXA 3GPIA 4EPVA 2ZAYA 2GXSA 4PSUA 3CHRA 4XDZA 4ZEOA 1P73A 4JBYA 1ZRHA 2CN1A 4YJGA 2Q28A 4YJKA 5I7EA 4CN8A 1TA9A 3AUFA 1M1ZA 3QY9A 3N05A 1QMGA 1UZMA 2W48A 4OA8A 3LHKA 4NK5A 3R5JA 1XRLA 3HDVA 4QJBA 3UKUG 3IRUA 2OO5C 4D02A 2C61A 4YB8A 1LPMA 4NFYA 2ATEA 3GQVA 3EG9B 4IZHA 2XE7A 2VGXB 4BFUA 1JR4A 3ESYA 3BSSA 1AMNA 4DTIA 5SICE 3VNBA 3JYQA 2WJZB 3LC7O 1C8KA 4IXWA 1GRRA 1N9GA 1ADFA 1U94A 1OSNA 4WCFA 4CRWB 4YDHB 2GNOA 2ZR8A 3G2TA 1Z5WA 3CK9A 3FVRA 2HTEA 4MVJP 5CX1A 3N2KA 4I1RA 3DT9A 5E6RA 5TMDA 2QGNA 4I8IA 3QENA 4LDJA 3WRVA 5FB3A 3U7HB 2VIIA 3SBDA 3OZBA 3F1LA 1DINA 3IAS1 1JLLB 4AG3A 2XODA 1Y4DE 3WLNA 4FKMA 1E96A 4H0FA 1RQ7A 4ZK2A 1JWGA 3GXBA 1WEHA 1VPWA 4KGVA 1EP3B 4S05A 3NOQA 1PZMA 3K6RA 4R9VA 2VWGA 1JR3D 3HJGA 4CGYA 1JHRA 1OYYA 5D87A 4YCMA 4XYLA 3CLRD 1EFVA 2ZJ2A 1E4YA 3UAXA 1TU0A 3ZH9B 4WFQA 4JDPA 5ADUS 3NXSA 4LS3A 3AETB 3BYZA 3ORFA 3PGKA 2JL1A 4LF7B 3FTFA 3KYIB 1I6KA 3IP1A 4MVXA 2HGSA 1JHQA 1PJ2A 3DDSA 2CXPA 2P5SA 4PYIA 4RLQA 5FEUA 2G63A 1UBKS 1XIVA 3BQMB 3ZDDA 2QYTA 2WXFA 4NACA 3RF6A 3EULA 5GVSA 1UAYA 2J0QA 3LF1A 3GFGA 1V39A 3FCAA 2OV3A 3VR6D 2XYPA 2EWWA 1XXHE 1E3MA 1CT9A 1XKQA 3OLYA 2O3RA 1WKVA 4KKVA 5IM4F 2REXB 2VQ3A 3NAQA 1LJUA 4PIMA 2NADA 1A8IA 2GCOB 3M70A 4QJ5A 3ISTA 1UBTS 1V16B 3W5HA 4X8QA 4KXQA 3QLEA 3IILA 3ZYLA 2W93A 2WDZA 3UMRA 1RLMA 4N3BA 2JK1A 2H1OA 5EJ8A 2FP4A 4MUNA 4EG5A 1U04A 2IYPA 3VU3A 2PMDA 2FPOA 3I2JA 3DLCA 3BAFA 3JQ8A 4NDAA 4C0SA 3ZD8A 2YYAA 1OX4A 3G8AA 4EEXA 2WXNA 1NC3A 3I53A 4R71A 2RAUA 4F4JA 5AVJA 4JNKA 3FUNA 3HA5A 2VPZA 1T5TA 4PYOA 1HFJA 4F5YA 4G8DA 5CHEA 2R6ZA 3DNPA 4M22A 1AN0A 2WG2A 4ZVQA 4BFLA 1NVBA 5CLJA 2BMWA 3MWDA 4UCFA 5CCLA 1IRIA 3ZHQA 2ZXWE 5DHPA 2M1ZA 1UC9A 1U65A 2GHTA 1FUUA 3MWFA 3UW1A 4AWBA 3KB1A 1H0HA 1UPCA 4M1MA 2XIQA 3EG5A 1K1BA 1EJ0A 4N9QA 1FSSA 5B3KA 3GPCA 2EIME 5JIBA 3UAZA 2R3SA 2VWHA 1O8CA 4F9FA 1CUZA 4W5RA 1WXQA 2PAFA 1E6WA 2JAQA 2J9QA 2WU4A 4LYEA 1U6JA 3C6QA 4AV7A 4HDCA 3SY8A 1KKUA 1G2QA 3WOHA 2GFIA 5G05J 3LZ6A 4N3NA 1V6CA 4QPJC 1BXZA 3TW6A 5HS0A 4GQBA 2PKEA 2HM8A 4OU5A 2R6JA 3M34A 4BFVA 4PC7A 3MWKA 3ELYA 1GWNA 1ZMBA 3CSSA 4K6GA 2W6ID 3RRUA 5A05A 4OYSA 5EIBD 2ODPA 3DFUA 3SHVA 1Z2OX 4RC9A 1C41A 4DLQA 1D9XA 4TKUA 5BURA 3LC2O 4BNYA 1NLFA 3KRTA 1R18A 5HKOA 3G8CA 2BZ1A 2XWJI 3AFMA 3K5PA 3HXMA 2Q3DA 4WL0A 3MWEB 1FNCA 4ARZB 1G63A 3OIVA 4H7PA 1U3FA 2ZGGA 3FZQA 5BV8A 3PEVA 5CBOA 1M7GA 4A8HA 2CKDA 2E48A 5ALWA 1FP4B 2HCRA 1L6RA 2X7JA 2ZW9A 4KDFA 2X6RA 3EQ9A 2BKLA 3QFHA 2BHNA 2W6ZA 5CH5A 1U3WA 2EDCA 3THXA 1UWVA 4UYJB 5KTSA 3NKFA 2Y1FA 3CEAA 4FGJA 2QVXX 3RAJA 2ZISA 4GNKA 4MWDA 3T7JA 5JD3A 1FLAA 3VKWA 2AVDA 4KI7A 1SHLA 3JD4A 2WKWA 3B85A 1FFAA 2Z3VA 3RIHA 3P5SA 4RTSA 3PHBE 2C0PA 2XMCA 3OCYA 1Z2NX 1SEPA 4HUJA 2FRXA 5C2JB 1KIFA 3ST7A 3U3OA 1PFYA 2RGBA 2WAMA 1K6JA 4U2KA 4EB3A 5JI3E 1OBOA 2K6GA 4FOPA 5EZ6B 4H1VA 4W1PA 3M3HA 1H6DA 5IXJA 5J08A 3F2VA 5DV9A 3E33A 5ALZA 2VS1A 2C0LA 3H04A 3F46A 4P5DA 3AVQA 3PWZA 3QTTA 3O1HB 4MKIA 3BB3A 1JAXA 2YHIA 2CJWB 1NKVA 2JHAA 4DHEA 3FUXA 4GQAA 3WL8A 2E85A 3OSUA 1IWBB 4QFDA 2H65A 1XMOB 3VTAA 1KZOA 1O2DA 5ESWA 1X6VA 4U1RA 3ZU6A 1QVWA 4DSNA 3ZPXA 3I37X 4MJLA 2ACEA 3LPDA 2VSXE 3CRNA 2X7XA 5KDDA 4IX9A 1CEXA 1GXSB 4ILKA 4G8BA 4ODIA 4WGFA 3L8DA 3PA6A 1U98A 2QTTA 4EGQA 5DWVA 5TDHA 4AKIA 2XNJA 3HY4A 3ZCPA 1OD6A 4BDSA 4RS4A 4ZANA 3C7TA 2H1RA 1YZVA 1XU9A 1RR6A 4Q05A 1ZHFA 2GROB 2C3MA 4L0MA 4O1MA 2ZPTX 2RKOA 4MS4A 2PEYA 4DE5A 4FFSA 1DI0A 2G1KA 1POWA 4UEJA 5H5JA 4BFWA 2Y0PA 1UJ5A 1VKOA 5I9LA 1PJBA 1NRWA 5IF9A 1PL6A 2F37A 1OA0A 3WLAA 3ZN2A 1PJCA 2ISCA 2XPYA 1U2VG 5EN4A 5ALYA 1E9CA 2FG6C 3TL2A 1Q1NA 3N2YA 3PRHA 4TQ9A 1EQAA 4AD8A 4RSGA 4EJMA 1EFRA 4UU0A 1ZEMA 4O5AA 2CLDX 1DEHA 4UZEA 2XNKA 4P22A 2W6NA 4G3XA 4EBBA 4I1UA 4OP3A 3CH5A 3AU5A 3LBAA 5I01A 2MYUA 5EE3A 3DEKA 2XJ4A 4Q15A 5ITVA 1FFCA 4J6EA 3AF0A 1O97C 5LYJB 3ONVA 2QP9X 5J4YA 2ZWMA 4RCVA 3WKEA 2JIBA 4JJ6A 2I67A 9LDTA 4ZQGA 4LOLA 4C7MA 4JEUA 1E6EA 4KL8S 1SZDA 4LJ6A 1P0PA 3EVFA 1IJBA 3E0QA 2DQSA 5HKLA 4XIIA 2Y1XA 2EFGA 4WXMA 1I94B 1Y9DA 3UCFA 4TTTS 5C31A 4ETMA 1P4RA 4HH3C 4RTJA 2FE4A 4RGBA 3EH1A 4D43A 1UXJA 3DHYA 1ZL2A 3GFRA 5HI7A 3CW8X 1U3GA 4DWWA 1ZW1A 5BOVA 5CW1A 1A97A 4CE6A 3MCZA 4HQRA 1GGVA 1EFHA 3D8UA 4UFOA 4N18A 4IMIB 4G25A 5FQ7A 4LDZA 4RL4A 1FU8A 4MRRA 3FPCA 4BX3A 3JWIA 5ALSA 4MPPA 2FE1A 1D8AA 4YIKA 4TTQA 4U7HA 1WF3A 2QTMA 4M0KA 5EHNA 3L17A 3CK8A 5TQVA 1AU9A 3GT7A 1RQNA 4NK4A 3Q8LA 4NBNA 1P7VA 1ECJA 4J7AA 5AW5A 2PV0A 6Q21A 3BIWA 3HP4A 5KJ6A 2JATA 4CM7A 3G0DA 1RI5A 3AHFA 3I28A 5LQMA 4NVRA 3KQYA 1XDBA 2WK1A 2P65A 2BTQB 3IUBA 1PAQA 4Y18A 1KORA 5C5IA 1Q7BA 3R7WA 4PXSA 3GUZA 3TOSA 1W44A 5H82A 4M7WA 2IXDA 3CKBA 2OILA 2WKSA 4CW7A 4FHJA 1Z6QA 2P69A 3SZRA 1Z3IX 3DFZA 1SB8A 1L5LA 2W22A 4EPXA 3ELWA 1Y5IA 2JKYA 3L4EA 1VKJA 2FTKE 1E9VA 3RHFA 3FIJA 5HA5A 4LJYA 1HEIA 1JJVA 2YRXA 4CMEC 2Y1GA 1VJGA 3X43A 4LC9A 2OK8A 3QKYA 4X7BA 3NDBB 1J2JA 5KSPA 2V0PA 2VKTA 1IJEA 2AX3A 4B3TB 2FWBA 2Z5VA 5JHAA 3KSMA 4MB0A 2QRNA 3EAFA 1DHTA 3EXFB 2VJAA 3U9WA 2FU5C 3AM1A 3EFBA 2BJHA 3ZZNA 3V31A 5ALDA 3BK1A 3T3MB 5GZ3A 2DR0A 1IIRA 1UJ6A 1QLWA 5B7NA 2GS9A 3CLSC 4NZOA 2ODAA 4HGQA 3F4KA 3SF8B 3ED1A 3F7NA 2JIDA 3ER8A 1KSFX 1PQWA 4XE5A 1P5JA 1TQHA 4AJ2A 1PL7A 4LFBB 2XCLA 2C03A 2F3RA 2HIMA 5CVUA 3GO4A 3FU5A 2PMCA 3FUMA 4MVJI 4F91B 3QEKA 3JQBC 2R5FA 3HZZA 3IC5A 4BUCA 3U60B 3DXZA 1R0CA 3C2QA 3IPRA 5JNVA 3K8OE 5LYYA 5AHWA 4MWGA 3T8KA 4O59O 3CPEA 2Q4TA 5JA4D 1JFRA 3OFSA 3R0VA 5DWQA 2HMVA 3T5XA 1JG1A 4ZQBA 1UFKA 2V0GA 3GCGA 5K0EA 4KN5A 4F3KA 4NAHA 2BEUA 2R96A 3HABA 4XARA 4WBNF 2GEJA 2VK1A 1XBTA 3F74A 1NURA 3S68A 4LBWA 4UM8B 3HYSA 4I2VA 3VZRA 2PGLA 3N5CA 2O2IA 2Q1TA 3CSUA 1BRTA 3WWPA 2BHRA 3L1JA 4EENA 3GAAA 1NQUA 4AO8A 4RDHA 2QZ9A 3JX9A 3TSCA 3WKAA 4EI9A 4BEPA 2V65A 4JP8A 1E6CA 3URKA 5FNVF 5K0LA 3O8NA 5F76A 2C2WA 4QT0A 1Q2ZA 1GGNA 2P9BA 1VLLA 3HQ4O 4KLZA 3C4VA 4B80A 1AKVA 3M5CA 3K1JA 2YWDA 2EG5A 1KE2A 5CK5A 3WNDA 4H17A 2OYSA 3TW0A 5H0IA 1ZC3A 2OE2A 2RB4A 3SC2B 3MCVA 5AUOB 4DYDA 3VU0A 1VYHA 3KOOA 3V7YA 3ZGZA 3KCNA 3TTSA 3P0FA 3OIGA 3A6EA 3RO7A 1O0BA 5EPEA 4W5NA 3WGQA 1N3BA 2ZT7A 3CVUA 3N70A 3ZBQA 1QYVA 4G0MA 3O4JA 4BNDA 2FH5B 5JYCA 3M49A 2Z6UA 2ECPA 2QXTA 3B1ZA 4EVSA 5AYVA 3HLKA 2XUQA 5JUWA 3LCRA 2QPAA 5CGQB 3AR4A 3L4SO 3V33A 2XUZA 4HATA 1BXRA 3RWOA 2JCXA 4AJJA 4GF5A 2QTBA 2PFSA 4CV1A 1E2DA 3S7ZA 1ZR2A 1B6RA 1OREA 3B13A 3IAEA 1KOFA 2XNDA 2CFTA 3FOWA 4YV1A 1OWPA 2ZJ8A 1ULZA 1GPLA 2E49A 4J49A 1KFJB 2O4CA 4GUAA 1BX1A 1ZYUA 3D6MA 5IUKC 4BXOB 4JNCA 1XMJA 1EP9A 4IIUA 5A3VA 3UKOA 4JJZA 3P26A 4JA7A 3ZU4A 2ZAGA 1OIVA 2Q29A 2DHEA 1DQYA 3HA7A 4FPXA 2P2LA 4DV4B 3GRKA 4F21A 3LXUX 5AJZA 1E2HA 1V47A 1BXGA 1KU6A 4U7FA 2ZYWX 2HQRA 1Y6FA 2LDBA 5FUMA 2QTLA 3TXYA 2IOQA 1HA3A 1RBZA 2J0VA 2AEFA 3PNMA 2OBFA 1X13A 3A2LA 3Q5GA 1SCIA 4YRNA 3UW3A 5K9ZA 3ICPA 1MD9A 1Z8FA 1R64A 4OL9A 4C7JA 3CKLA 3D64A 3OEEA 4K6KA 1NNLA 1I2AA 3S2AA 1ZCAA 3HFSA 2CLOB 2OQ2A 1L7BA 3LMKA 2XB8A 4QOHA 4EUFA 1NG1A 4KI0A 3VO9A 4IN3B 3G9TA 4L2IA 2C7QA 2QRKA 2PUDA 1TM5E 1TJPB 2CXRA 4RIEA 3WL4A 4F5ZA 4LEIA 2EQBA 3DBLB 4B3CA 1AKTA 3KIPA 3ZV6A 4QX6A 4L7QA 1EKXA 3VPSA 4M2LA 1ZUHA 4OHWA 1PR3A 3BJZA 4TGLA 3QF7A 5KQPA 1HT1E 3VTFA 4BO4A 4D9GA 2Q5JA 4Y67A 3D81A 2XECA 3LH5A 1YJCA 2FSFA 1W49A 4MWSA 3RVPA 4HOTA 3OIWA 4BETA 4H4DA 2C58A 3EC7A 2EF0A 2XCCA 3CY6A 3IR7A 4EY5A 1AUOA 5TQ2A 3EYAA 5CRIA 1F60A 3HPRA 1O1YA 3R3HA 4K2AA 2CHEA 1H9AA 5L6MB 1Z29A 5HKKD 1QC5B 2JGMA 3S1SA 3H8SA 4HOQA 4IDFA 3EVEA 1EEHA 1ZU4A 3OY2A 2B94A 4YJ3A 3B7TA 4GOND 4R40A 1O08A 1XGKA 1U8EA 3LHSA 3EXEA 4ZT5A 5FPYA 5LP0A 2YCBA 1QIGA 5C34B 2CV2A 1EI9A 4QRHA 1WW8A 3WJAA 3E15A 1R9JA 3PUHA 4P08A 2QAGB 4D26A 3AG2E 1TVMA 3Q7IA 4HGNA 2WY2D 2BMAA 3RKUA 3FYSA 4W5TA 2GK7A 4GM0A 2Y0BG 1ISRA 1XP8A 1EFPB 2SKCA 1Z38A 2BFFA 3E7PA 1JVBA 3G5MA 3EXG2 1DC4A 2Y4OA 2RK4A 3PT9A 1GPJA 1P6QA 4XWAA 1MQAA 2CHZA 4IOJA 2JAXA 5KNCD 1SVXA 3K71B 1TYCA 1BLXB 3H2SA 4G5HA 4BCDA 3HJTA 1J7KA 1US8B 2PWAA 4D4LA 2AIRA 4MJ7A 4G5FA 1I0IA 3Q79A 5FBHA 1ABEA 2IIVA 5IHXA 5JSQA 3L8FA 1LFDB 1ZGCA 4NL4H 2OMKA 3ENZA 3L3BA 3N59A 4HZUB 3ZPJA 2PUJA 3MUNA 2XB4A 3VPCA 1F2VA 1E3IA 4INPA 3BD7A 2NUPB 3V3LA 2HQ1A 4G1TA 2QDXA 5B36A 3TYXA 1K1EA 3U4TA 4MQ6A 1V1MA 1U9IA 4HDKA 2BMEA 2JLUA 3PGVA 3H7IA 3S1AA 2Q0SA 2P2ZA 3CWCA 5JO0A 3FLBA 1KU0A 2OOKA 4K5AB 5CNMA 3EFOB 3D5EA 2DVMA 1E2QA 1XMQB 2PA0A 3E3LA 3ANXA 3T41A 3K0SA 1D4OA 4M1QA 4J16C 5IFKA 4FD3A 1SVSA 3I1JA 3LFTA 1O6BA 4JB8A 4YI3A 2MTBA 2QRZA 3C0KA 1OX6A 1W94A 2KZTB 3OM1A 2PR7A 1DT3A 2BCGY 3FI0A 4DSZA 5ICSA 3L13A 1Z4JA 3LRTA 5JSZA 1LGYA 4U2EA 5G0WA 1F8UA 5GM2A 5A9TA 5MFPA 2Q1SA 3EA0A 4J07A 2V1XA 3LK6A 5F23A 5H8WA 1P9RA 1H9BA 1NR1A 1E1YA 4OQPA 3BFPA 4A63B 3D6NB 2DJIA 3FMFA 1XZJA 1NXQA 1KFEB 3QHPA 4N5QA 3B9QA 3AKDA 3KOZA 4UU1A 3SCZA 3UHPA 2O5VA 2ZYIA 3ICEA 4GZ3A 3ZEAA 5KUTA 2FW7A 2XRMA 4QRDA 2RH5A 4JI1B 1TD1A 2FJAB 1TT5A 1Y9ZA 1LX7A 1XZAA 2E2EA 4QNMA 3R3SA 4KFRA 3HCPA 4Q4AA 2A4MA 4PUCA 5HUJA 2W2QA 3L7BA 4UCXA 2G4LA 1VXOA 2QZ4A 4MPRA 3HEAA 2HN9A 4U2BA 2AC2A 3PGMA 4KN8A 2QSUA 3RS0A 1U6KA 5F52A 1TAGA 3ZXYA 1N4QA 5KOJA 5I7SA 4CTJA 1YU9A 3LZDA 1E8WA 3K2EA 1AK2A 3KR1A 4EHNA 2E3JA 2VDWB 5FINA 3JXIA 2E1PA 4MAAA 3ZXSA 2CL7X 3P1JA 3I9V1 3R9KA 2EP8A 1XAJA 3VKGA 4XR4A 1MQSA 2RSLA 1RXUA 3AR9A 4RDXA 4H1HA 1SBNE 4NZ9A 4LA4A 4JJEA 5EIWA 4U3JB 3HL0A 1Q91A 5BUSA 4UTNA 4YJ2A 2F8YA 2FSVC 4HXIA 2IY8A 3IUYA 4B32A 1GUBA 2CLEB 2FJ0A 1RQRA 2BFNA 4LRZA 8GPBA 5HE9A 5CDTA 3M9XA 2AGVA 4WGGA 3RS7A 3K1YA 1JFSA 3DVAB 5EMNA 3EXIB 4ER5A 3KQNA 1M2VA 2C95A 3T5BA 4KIJA 3ASVA 3JATB 3B8EA 5EJ2A 2OCCE 1G9XA 1TLLA 1V7CA 2JBWA 5HGJA 2KLHA 3REGA 1ZGBA 3A1VA 3TKLA 3HM2A 3TMAA 1UT8A 3P1UA 2TMYA 2L2QA 1QV6A 1EG7A 1QVZA 1GFZA 1TRHA 1NYLA 4WZBE 4DA7A 3BHNA 1CJTC 5KTPA 4M55A 1OBHA 5H3HA 3GCDA 4JHLA 1FYFA 3T5DA 3IQZA 4MS6A 4O1OA 5TQJA 5B1AE 4FI3F 1OH5A 2ZTMA 2Q9AA 2YJ3A 3FNBA 1OI3A 2DULA 2FJUA 3PX2A 1GN8A 1FFEA 5KQMA 4WESB 5GGXA 2CNWD 3OI7A 5KU1A 1NPYA 2ZT8A 1KY4A 3H4VA 4HCJA 1Y81A 2G9VA 2PGAA 4NNPA 2GVZC 2HBYA 4M54A 2ZTVA 5LXTA 2ZRBA 4QM6A 2GSDA 3Q9LA 1Z5SC 4HXGA 1XZIA 2QR5A 2Q5OA 3AIOA 1OAOC 2QRMA 2MIIA 3B1KA 1QCDA 2ZGVA 1NE2A 2IODA 2GLTA 3ZYKA 4IAOA 3QKRB 2X2OA 2VPYA 3ZLTA 3CF0A 2J30A 1OXTA 1Y5MA 2JFOA 5CB4A 3JQ9C 4PIVA 2W6QA 2AXPA 1P8JA 1RQXA 3WE7A 4WK2B 4AQDA 3COPA 5E4FA 1DIBA 1DQRA 4C30A 4HSGA 1IY2A 1ONNA 4QUKA 4BWGA 3I12A 2C0QA 3T9FA 2CYCA 1XTZA 1J8FA 3WO1A 4BLWA 3G8DA 2DOKA 3AL3A 1LB1B 3OJCA 4ZT7A 3P4XA 5AAOA 3R4CA 1YI8A 3SYTA 1FDSA 2DH6A 1YFJA 5JAUA 2AI2A 3NHAA 3ZHEB 2II6A 1V5FA 3U4AA 5B3JC 3WNZA 1KGDA 3SBEA 1ZUIA 1HOXA 4GLBA 1QZ2A 2K2QB 4IDGA 4HNUA 3AF1A 2I1WA 1RC1A 4A03A 2HO4A 3EVGA 4NJMA 2WMOB 3QK0A 4KWHA 1NA0A 4CWAA 1S1MA 4RD0A 1QP4A 4YCBA 4XX1A 3RV4A 1DQNA 1HS6A 3FOFC 4HAXA 2O7QA 3VPXA 1Q3HA 1T9BA 5DKFA 5EQTA 1GSOA 2HI0A 3E3NA 3C3PA 3PFFA 2A9JA 3TX2A 4RA9B 1UMBA 5E1OA 5MN4A 2EKQA 1RDFA 3A32A 5L51A 5T3YA 3DSSA 5EX0A 4QBGB 1YXMA 3FMIA 4KGXA 2NQ8A 4ZCQA 2F3TA 3RT7A 4X41A 2JGKA 3GZ4A 3HSYA 3LBYA 4OIMA 1LZLA 4U2FA 3VKVA 2D5AA 2GZRA 4PE5B 1FU7A 4CG1A 2EYQA 3OPXA 1N2CE 1C9EA 2ZETA 2CLLB 3QA3E 2HA2A 5IPFA 4CU2A 3DM9B 3EGXB 3RGWS 1ZOOA 2ZJOA 2HK6A 4RHXA 2BKVA 4KPUA 5JV5A 4HN2A 4U0JA 2BFBB 2ZREA 2ZRIA 1XPUA 1XQXA 2W0MA 4HQNA 3TPZA 4P7GA 4ZOAA 1GGJA 2VZ9A 2F6RA 2LXNA 1FTSA 2LWIA 2WJPA 2YBEA 2DLCX 3ZKJA 3MERA 3U44A 4G63A 3GRVA 3GFVA 2BI4A 3W90A 1EFDN 3GLIE 4QO7A 3MW8A 4JJAA 4OSEA 3UB3A 4BO9A 2P77A 1SY7A 1P1FA 3L18A 2XYQA 3AILA 1I32A 2Z6QA 5M2QA 2WTEA 3EPPA 2R8ZA 4XVHA 2JFNA 5JLJA 4DR4B 4ZI3A 5KI6A 5AM0A 2JABA 4L9SA 5C3UA 2VWPA 4OF4A 4IWNA 2N9UA 1FDIA 3ER6A 4KSBA 1G55A 2M2IA 1JIKA 1CIJA 1JKIA 3LA8A 3MB5A 4QDJA 3ROZA 1O6CA 4ZVNA 4E14A 1RWWA 4NEGA 1R0LA 5JJ5A 4QJ4A 4OX9B 2WSLA 4Y2XA 2M6RA 5A02A 4GC9A 5B1SA 1R12A 2O0JA 1SA4A 3I32A 4LPSA 1CQZA 5ARBA 1Z2AA 3OX4A 5LQRA 3RVRA 3UPUA 4RK4A 3U48A 1E9AA 2YWGA 1TT7A 4RYDA 3M5WA 3CG0A 4GL4A 3DDNA 1GG5A 2ORWA 4BY6A 5CFOA 1FQKA 4ROTA 2C0MA 2X41A 1IU9A 1DEXA 4I55F 1VLHA 2IUEA 4ND6A 3KQOA 4JI6B 2XCQA 1XZMA 2VWQA 1Y98A 4HR7A 3KK0A 4BFXA 3LUGA 2YFKA 1E0KA 3MILA 3VVLA 5GPBA 4HX9A 3NTVA 4GGPA 4ACBA 2PQNA 4DUYB 3IAS6 4XXHA 3L6BA 4BO5A 3AOGA 4GMFA 4A5SA 2G0AA 2CCKA 3ROXA 3DRAA 4MI3A 3T3OA 3P8ZA 4MUAA 4DCOA 2VRNA 1N2ZA 1NLMA 4ERXA 3QEMB 4MMZB 1ZQ1A 4ETIA 3WOVA 4IDQA 4WERA 4X63A 2AFHE 4QYIA 2F9MA 1W1WA 1FIUA 3GRCA 3SR4A 1IC6A 2N0SA 3AJ8A 1G18A 4Q9DA 3WLQA 1NVTA 1TEHA 3AJAA 3CEHA 3ESZA 3GLUA 2NLOA 1VB5A 2Z2JA 3FROA 4CLDA 1YJ5A 2PRYA 1VMEA 2J9FA 1WB9A 2P8SA 1T0UA 1AC5A 1WZIA 4L4RA 3U7RA 1FLVA 4JSYA 2P2YA 4TKVA 4YAGA 3D9KA 1PZNA 3ZFWA 1RI3A 3ZGNA 2GN8A 1YDMA 1RWXA 4BX0A 1P5HA 1DNPA 1I80A 5DT2A 3QK7A 1IBSA 3FTSA 2BW0A 1TYAE 3T1QA 4BYGA 5ALTA 2HMUA 4MCJA 5JCOA 2IYYA 3U5ZB 4ZVUA 1EWYA 5AMXA 3WGZA 1CRQA 5FPQA 1HPLA 3C3WA 1VBMA 2PFKA 5DLYA 1II0A 1NF9A 1ZC4A 5FNZA 1H2ZA 4KYVA 1Q0HA 3Q8MA 3W7BA 1YRLA 2ENUA 2FZ4A 4RESA 1XXHB 3Q41A 4LRSB 5DBFA 3ML8A 4R8KA 3O4HA 4UI9J 4BNHA 4HN4B 4G0NA 5E76A 1QUEA 3SNKA 3D8RA 2VGEA 3O75A 3DBHB 4REMA 4NHOA 3HXOA 3IVGA 5DNEA 4W6ZA 1XDGA 3G68A 1B00A 2P91A 1T4MA 1SCNE 3DLBA 1X19A 5DHFA 1WUKS 1M76A 1NVWQ 1NV8A 2YJ5A 3KVNA 4M36A 2I7TA 1GKLA 1YHZA 4UNPA 4J8DA 1JLMA 1D4FA 4ES6A 4F2WA 3VR6A 2FWIA 3QVVA 4OXNA 4X84A 4MOWA 2B7BA 4IDEA 4MEBA 4IIJF 1XWFA 4FFDA 1Q16A 3UOGA 1R0ZA 3OCJA 4U96D 1TQ4A 4XSGA 3B7PA 2VYFA 5AVRA 3R8CA 4KN6A 1DE0A 2Q8QA 3IP5A 3GP8A 4PSVA 4WN9B 4I8XA 1QQAA 5P8WA 2QL9A 1KFBB 4YV0A 5CA0B 4X94A 2BFPA 3UGJA 3C5CA 5D7NA 4ILGA 3KM0A 5I9NA 3PFBA 2ERXA 4QQ8A 3MTJA 3CLJA 4KPFC 2XRZA 4BB9A 3GNTA 4NCNA 3TRHA 2QUKA 3WZ2A 3A6HA 1DRJA 3D9NA 3OD5A 4K7JA 5JZMA 3WIEA 1U7XA 3EVAA 3CE6A 3KKKA 4HRNA 3PZ4A 3E32A 2H2DA 4J75A 2VK2A 1JLHA 1V5IA 1G0NA 1K7YA 5M5BA 1M67A 4V3IA 1C9YA 3GNLA 3FB4A 4QUIA 4TWAA 4NE2A 4IHKA 5A4FS 1E7QA 3Q8WA 3V2XA 1B42A 1X7YA 2XCIA 5AM1A 2WIGA 2X0JA 5T4HA 3K70B 3UAYA 4QC2A 3LP8A 3BMXA 4RJTA 2XXJA 3AL0C 3QG1A 3FPLA 3U81A 1D8DA 1IZ8A 4DK5A 2E2WA 1ZA1A 3SEQA 2BEVB 5LB2A 4ERNA 3RRBA 2P9PG 1LW7A 2HMYB 4Y2PA 3OPVA 3LDHA 3T8YA 4LQCA 2O8FA 5AVKA 4A8JA 3LECA 2X8AA 5FTKA 4M8IA 2C4UA 1TADA 1IH8A 4C3OB 3WLRA 1PQPA 1Z4NA 1KPGA 4CIBA 5CA1B 3KEQA 5IEJA 3CHYA 3SBTB 2BKAA 2F9FA 2OBXA 4H60A 4RV4A 3MJWA 4J91A 2LBPA 3TZEA 3E9MA 2W6IA 4EKDA 3USCS 5EUCA 3B5IA 3EEBA 1KETA 2R84A 5JRJA 3T15A 6PFKA 1LBHA 3ECAA 5G2OA 4WCDA 4PV7A 5EOVA 2I1VB 3V1LA 1E0JA 1E1CA 3FFTA 3OU7A 4NQ0A 2QY7A 3R20A 1E5TA 3GJXC 4D4KA 1YQUA 1ZB1A 4JJIA 3DKVA 4BVJA 3LY7A 1NHGA 2P2DA 4ANVA 5BN3B 1E90A 1KP3A 3F3MA 3FF4A 1XQYA 1SKAA 2PT6A 2H6IA 5CEDB 1E61A 3TRIA 3ZYCA 2ALJA 2QWXA 3N2ZB 4BNVA 5AXBA 2PU5A 2BH2A 4YMTA 3B6ZA 3UK7A 3SFYA 1J9ZA 2JHPA 1YFLA 2Z9BA 2HOQA 3VAAA 2H85A 1J2EA 2EF1A 3BJEA 5EWMA 1X7ZA 1U2SA 1K0UA 2AK2A 4IDOA 1U0FA 3KNZA 1SVIA 1Y3AA 3EQ7A 4P3OA 5LL6P 1QHSA 4X1YA 1OXMA 4YVQC 1Z2PX 4B8AA 3KFLA 5CTAA 3VSDA 1K6MA 1M1YA 1D2MA 1WAMA 5IKMA 4HLUA 5T64A 4M53A 4B31A 3FPAA 1A8SA 5JECA 3EGVA 4D0GA 2J9XB 1E8NA 1PSZA 2WPNA 5K0CA 4ND7A 1IB0A 3JQQA 3T35A 1P60A 4O60A 4TXQA 3OMSA 5KYYB 4N3GA 3DOCA 3QW2A 1RJ9B 2OGWA 4Y9UA 1NLUA 4DSUA 1FVHA 1LF0A 4MVJA 2GHQA 13PKA 1GHTA 4X6UA 3DOUA 1A95A 2GYWA 4BLUA 1BMQA 1YQ9A 2F00A 4DLKA 2EC5A 4N7MA 3IQHX 4ZCRA 1UXGA 2HEIA 1NULA 3LD9A 1IOLA 1U0RA 4FQ7A 5HEKA 4E6HA 5AVWA 1U7DA 3OZIA 5AVQA 2I8LA 4BB6A 2ADFA 3MJTA 4JWKA 3B7UX 4U8VD 2FRVA 2P6MA 4OI4A 3I8XA 2O8EB 5TT0A 1YI0A 2QM7A 4DX5D 1CP3A 5JXGA 2AOUA 3AM5A 2O59A 2ESRA 5FBKA 1FMLA 2IDKA 3R77A 3ADBA 3TVDA 1GEGA 1L4LA 4F45A 1M34E 2EGUA 2HT6A 4ILHB 2GKSA 2CLMB 1KYIA 2GD1O 1SCUB 2MMGA 3K0FB 3NBAA 3UUWA 1WCV1 3IMGA 3RVQA 1T4DA 2IHZA 2V0NA 5CK4A 2K7ZA 1G42A 1QIFA 2WU1A 4AO6A 1WR8A 3L0IB 3NHYA 2E21A 2O9JA 4YRMA 1PO7A 2I3GA 2O3TA 4OHKA 5G1NA 2TYSB 1YD7A 2YZ2A 4H35A 5FO1A 2IY9A 1NSFA 2OPBA 2OXEA 5WRFA 5LNK1 4BRUA 3LOUA 5G05C 2QTVB 3T7SA 3EUEA 5DTEA 3IB6A 5FPTA 1M54A 3EGIA 3WGLA 2PLNA 2ODNA 2EJWA 3CH6A 1B41A 1TNDA 3B9BA 1MCZA 4M37A 1XRMA 5C1BA 3I2IA 4B8CB 2WM9B 1FP6A 1AXRA 1N5IA 3IVMA 1C3VA 3ZCRA 2IYRA 2YC2C 5YASA 2E1RA 3I9LA 3UANA 1ZOIA 5KTKA 5I9IA 3B3QA 4WRRA 4KEAA 3AHCA 4HBDA 4NBLA 2FO7A 2IEYA 2ZIWB 3KLPX 3BU8A 4X65B 1K3TA 2I2XB 5I4BA 2ZT6A 2GPSA 3HN7A 3O94A 3ID6C 2JEOA 4URWR 4B47A 3IXQA 4DV3B 1DG1G 3QY0A 4UU8A 5D3KA 3AU4A 3BMQB 2GT1A 1PX0A 1Z18A 3P9CA 4I4TB 4I81A 4IUDS 2H2AA 5C1DA 3PQFA 4TXJA 2JNWA 1R4AA 2HZBA 3ICWA 4XWTA 4UPDA 2DB3A 3QEAZ 3UOAB 1YCDA 3LWBA 4DQXA 1B16A 1E3DA 3L0BA 3IP8A 1IUNA 4Y0AA 3BH0A 3HDTA 4JUCA 2OSBA 3FU3A 5ES3A 3KPVA 1NQ5A 1QDEA 5HQ3A 1EYHA 4HI0E 1FXWA 1UMDB 5DM4A 2GFQA 3LHIA 5LBIA 2FZWA 1RYDA 4HDSA 2AB0A 3ND9A 4MVJD 2C9BA 2J6CA 3PQEA 1VRWA 1P19A 4BV9A 3ESLA 3MGKA 1T29A 4MW9A 4O2AF 3TG5A 4WWNA 4OOEA 2HNBA 2AUNA 4I46A 4YAOA 2QSYA 3WKCA 1DC3A 3VR2D 4J7CA 3SIWA 3JQ7B 3HWWA 5KJFA 2WYHA 4PLTA 1Q1EA 1H19A 4NCAA 4C5BA 4HXFB 1XHFA 5DP2A 2O52A 5ENVA 4D92A 4M1OA 3DZDA 2EU8A 2COEA 1YCGA 1C2TA 2YWXA 4DVGA 5LZ7A 1N3YA 4YDYA 5HF9A 5FHRA 3NX4A 4RZSA 1IN7A 1GQRA 1C9DB 1EJBA 4P32A 2I55A 3VDRA 3SWWA 5ALRA 3JQAB 1IB6A 4DMCA 1IBKB 4RNCA 1AIPA 3FFLA 2FX3A 3DR5A 1WPGA 2ENWA 1V4NA 4Y6QA 4ZAGA 4ND3A 1EDUA 3I6YA 1PWHA 2F1OA 1ZGGA 4FKBA 1S70B 4LFCB 4DKXA 1DOHA 1KZ1A 5K3FA 4LSMA 3ES9A 1EFLA 1EU1A 1SG6A 2CDRA 4TTSA 4A0RA 4HDMA 5ALGA 2Z04A 3VMMA 3MD0A 2IQCA 3MJEA 1ADGA 3HXEA 3AVVA 3D9OA 1EEXB 4S1WA 3S2EA 3BOSA 5CGZA 3DEOA 2X9GA 4JLOA 3ZUGA 5IYZA 3DL4A 4GTQA 2C5HA 4CR7A 2Z6AA 2FMXA 4RF4A 4KQ6A 2DPMA 4FCVA 3BEDA 4EKYA 2IP4A 4JC4A 1R3UA 2FKNA 4F4HA 2I4TA 3ETCA 2J46A 4TTIA 2VP2A 1LF5A 2XEDA 4R68A 2FSIA 2OUIA 4Q02A 1ZD1A 4D0LB 2HADA 3OTWA 4P33A 3HCOA 3QOUA 5HF6A 4F4FA 2KLBA 2YHEA 1Z4PX 1YNSA 1YUNA 1UDAA 3C8ZA 4UVEA 5DDIP 5HZKA 1XPRA 4CYMD 1H8HD 3TGOA 1QU2A 3T3EA 3V9PA 1AKWA 1K86A 2G7MC 4ESEA 2BRUA 1HTWA 5TF4A 3FKSA 4XE0A 3MGAA 5AVZA 4UU7A 4BMPB 1I4DD 5IG2A 4FEEA 2V0CA 3EF1A 2I5PO 3QPCA 1ZD8A 1FF9A 3KV1A 1G2OA 3OP1A 4HEQA 4JLKA 4WASA 1JFFA 2G9UA 1PR9A 2VYIA 4X20A 3E9RA 4CG0A 4HB4A 2EWMA 3NYWA 1U8AA 1QG4A 1VTKA 3V7FA 4BU1A 3OH8A 3C3YA 2VEDA 3NAZA 4YACA 3RAGA 2YJTD 1RYYA 2P2SA 3C5VA 1OXJA 5JJBA 4XDYA 1VHLA 3L2OB 3SEZA 5DGDA 5KMGB 5JI2E 1PZHA 1V8DA 4RD2A 1GNLA 1A2BA 3EU5A 4RFSA 1SZJG 3D8BA 2BTDA 5B53A 3V48A 3SI5A 1LK7A 1Y1LA 1Z0JA 3VO2A 2JG3A 3AJ9A 2QXYA 2V6MA 3ROFA 3GMIA 4AX8A 2ZIXB 2AZTA 1Z0AA 5HX7A 1H85A 3AZPA 2OXFA 4FN5A 3AVTA 1SKYE 3C5EA 1BGWA 3GCZA 4Z53A 1R8YA 3UCXA 2H51A 4R1SA 3FA2A 1GTG1 4WT7A 3REQA 1V6AA 2IYFA 5IMSA 2I1QA 4J3FA 2V4LA 5LM3A 3KR2A 3FNQA 1PK7A 2I1KA 3FWNA 3DTNA 1O5MA 3IT1A 2P5UA 2JBAA 3KKMA 2HXGA 4TLCA 2EL9A 3P4YA 4CTMA 4RPHA 4BRSA 4YO8A 3DULA 5EKSA 2O8DB 3P20A 4MP8A 3ZDRA 3AH8A 3O31A 1PGOA 4GX1A 3BD9A 1XNJA 4U2GA 1ZRNA 1KI8A 5BMVB 1W47A 5AN8A 3DF9A 4QEKA 1B0ZA 1EXMA 1URPA 2DPLA 5BXQC 5E4YA 3L7NA 5ENRD 2G0NA 4L6CA 4EI8A 3FWVA 1DGQA 2XXBA 5CURA 1XKLA 4Q3LA 2JB9A 3RC2A 1JDSA 4O1PA 3F8SA 3C6XA 2D5BA 1Y7TA 5IKPA 4D98A 5JBQA 1MX1A 4OY3A 2X5OA 4YHHB 4TWZA 2EIHA 7GPBA 1AZLA 3I9MA 2YXLA 4EO4A 2AQHA 1X1DA 5CT9A 4TROA 2CFOA 4DABA 7ABPA 1OWLA 3VPDA 4BS9A 2IYNA 1GGEA 2QAJA 2WWGA 2V7BA 4KAXA 3A6GA 3ICVA 3CHPA 4TYNA 1K1AA 4RIHA 4LNAA 3WYNA 3F6RA 1SNYA 3A9WA 2WI8A 2GN2A 1NWHA 3IP9A 4G0YA 1LEHA 4QREA 3OCCA 4ATNA 2WXGA 2HPVA 1L5HB 3O9MA 1N5DA 4G5XA 3HKEB 5EMHA 1A4UA 4MV7A 2CVHA 3U31A 3BK2A 3RFXA 1IG3A 2H5IA 3FKSD 3ASGA 4F93B 3T6KA 1OMOA 2PR2A 3AEQB 1GNVA 2ZB7A 3GELA 2G8NA 4H7KA 3DEFA 3OM9A 3G7NA 1JG2A 1XVLA 1N0WA 2Z4SA 1E2FA 2RI6A 4EZBA 4B2IA 2WFZA 3CW2A 3FWZA 3B95A 1TU3A 4ZYZA 1X87A 4LJAA 3UAWA 1AF4A 5JSKA 3NUZA 2PMKA 4BMNA 4OQEA 3VLEA 2KCKA 5DTJA 1EA5A 2IGTA 3MRTA 2MDTA 1U9IC 3A1SA 1G3MA 4L5YA 1YVDA 2DKFA 2F8MA 1QIHA 2NU6A 1W4LA 3G5LA 2P6OA 1RM5A 4M3OA 4EQ6A 2NW6A 3ZGLA 1KDPA 3ZS8A 4Q66C 4FLFA 4AMUA 3I5YA 4RY0A 1CY0A 3U16A 5BSEA 3CK7A 1KDYA 5KYTA 4C08A 1V6SA 1ZH2A 3U66A 4JB2A 1H9CA 5K3OA 4II7A 4KNVA 1QV7A 4C1NA 2OXTA 3EVZA 3RRYA 5IAGA 1USUA 4RSRA 4JMLA 2MSLA 5AK0A 1SHTX 4PS3A 4GZMA 4O6FA 3NHJA 2AF3C 3IOMA 4DJTA 4P7KA 2C59A 3O9ZA 3V2HA 2H5EA 3FM9A 2D0OB 2VJMB 1UQUA 4O4JB 4BU0A 2Z1DA 1E9RA 4HUQB 3K4QA 4UTPA 1B3BA 5HKKA 4KKXB 1GDDA 1J8MF 1S8FA 1DKPA 3H5AA 4E15A 3PR3A 1RAFA 3EGDA 2FSPA 2HY7A 3DV2A 4UOZA 2BJWA 1QB7A 1ULUA 3ADCA 2CXTA 4CEMA 1B0AA 1QAOA 4G11A 2IE0A 2UUBB 4EL5A 3JCKC 4KH0A 4PX9A 1OI2A 4HJXA 3HMKA 2NU8A 1DXQA 1VJDA 4PGHA 4R5MA 8OHMA 3B82A 1PG5A 2IVFA 4BERA 4PICA 5I3CA 1OFVA 3LX8A 2WQ6A 3VX4A 4BKRA 3ORRA 2OD2A 1E4EB 5D5HA 4Y6RA 3C5HA 1YQXA 2AEJA 4DGSA 3PDNA 4KRGA 5KNCA 2QN1A 3KT0A 3SS9X 1JDNA 2EP7A 2J85A 3I9KA 4GAAA 5IDYA 1OFTA 5INTA 2XQ0A 1C50A 4MKGA 1A7JA 4PXYA 2LDXA 3P9SA 4IZ6A 2HLHA 4M9UA 3KJNA 3QE9Y 2LGJA 1GRNA 4AMZA 3IUPA 2GB4A 1VRVA 5A1JA 2P1DA 3ZJVA 2V03A 1ZBDA 5BSFA 4LSGA 5BYKA 4IDAA 1VP3A 5G0SA 1GL6A 1ZVQA 1L7DA 3QQPA 1XZNA 4BKUA 1RMYA 5I48A 4ZVVA 5I45A 3OUUA 1G98A 5HIMA 3ZDBA 4XJVA 3JAWB 1T13A 3S7DA 4LDPA 4IRMA 2X9NA 2OCDA 1ISIA 3I5UA 3A6LA 5KKAA 1FP2A 1UBRS 1YR7A 2OGZA 3BK7A 2FZLA 4GRDA 3A1DA 4ZHBA 4O2BF 4XOUA 5BUZA 5HJ2A 3DOEA 2Z30A 5FLKA 3AEKB 3U4MA 4DWOA 1FYDA 3F8WA 4OSPA 3Q73A 4IDNA 1EX6A 2BIFA 2VP5A 2XD9A 6NULA 1H6AA 1EIZA 4WNIA 5KSZA 4PCLA 3RVKA 1ETUA 3L8EA 1OXXK 4JLVA 5ALUA 3I9V6 2YZMA 1S2GA 2BY4A 1VBKA 4F2HA 4MI9A 3ENVA 1DG3A 3DDHA 2BDUA 2FG5A 4DT1B 4P8RA 4CLRB 1DAEA 2BUAA 2I7CA 4WI1A 3FSGA 4X91A 3MRSA 1DRKA 2V59A 3KT3A 1DAOA 3H5TA 3LT1A 5I5EA 2P9SG 1BOFA 2C4VA 2VL7A 2WAAA 3Q7RA 5DSZA 1NI3A 4JOSA 2C1XA 4KO8A 4ZDJA 1XL1A 2FUG1 4C7OB 4OA5A 4CJXA 2XBLA 1NA3A 2HMWA 3RRNB 2OT3B 1CC1S 5ELMA 4OMDA 1G9SA 3LKDA 1FX0B 1PG2A 3CUTA 1J4AA 4N7JA 4Q4JB 3O2NA 2TMDA 4MVYA 2QN6A 1KARA 5AW8A 4GWLA 2QG9A 2YBDA 4DJEC 3TXNA 2LV8A 4K28A 4EFNA 1NF2A 1KIMA 3PDHA 1N4DA 4P6VF 1XLVA 2YMLA 3C5RA 2NVWA 2WXLA 3WYEA 1JKJB 3UJ3X 1Y80A 2FI1A 4I5GA 3VZPA 2OCYC 4BIMA 4K3VA 2H92A 4CMKA 5AM4A 2LUHA 4MUEA 4F6CA 5FAKA 4MUKA 4BTAA 5FJYA 3CUVA 3E82A 3SD5A 4PZUA 1G5HA 4CQMB 2FOIA 2GZ1A 4WZBB 2V8SE 5ENPD 5DTQA 4M1EA 2RCNA 2IHJA 1EB9A 2ID8A 5E0KB 2L42A 4OUKX 4I50F 1SUBA 2FQQA 2C29D 1M2WA 4GZCA 1EX9A 4DWVA 2H4ZA 4O8ZA 3V4FA 5AH0A 4MZDA 1MIHA 4A2QA 3C1AA 2EKZA 1BDBA 2L82A 2PMFA 4E33A 2JI9A 2WD7A 3GUUA 3OT1B 4WNYA 1S4MA 5C53B 3K30A 1VL2A 2IKQA 5TQ0A 2Q6VA 1V25A 1L4NA 3UT5B 2R9VA 1R6AA 1Z8DA 4OHVA 1K8KG 3JQGB 3S2ZA 1PL0A 1FXUA 4V3CA 3BERA 4AG6A 4HBZA 1TE2A 4UM5A 3F73A 3WLSA 1JCSA 4KMSA 1TVCA 4YREA 3B3AA 5AVVA 3Q5EA 1M8GA 3CLTD 4F1SA 1NSYA 5AQ7A 1IHOA 5CXQA 3ZXIA 5K09A 4DIUA 3B89A 4GR9A 3L05A 2CNWA 4TRJA 1NXWA 2GFHA 3VHRA 5LJLA 3U4CA 2WIKA 3O0TA 5AW3A 4NZYA 3D2AA 5E3HA 1J5EB 4OHUA 3F90A 4YCSA 3PUXA 1TYDE 1PT8A 2OBNA 1X0XA 5JBNA 5EMJA 1BO6A 1SCBA 4PQFA 2AEMA 1HE8A 4CKCA 3AR3A 4BNUA 3UFBA 5EWJB 1J0XO 4JY7A 1SOUA 4IH1A 3CHOA 3PE4A 2FJBB 3WLJA 2LE0A 2ONJA 2BBSA 1WSAA 2RGXA 1WDKA 3KOXA 2J41A 3OFKA 1OLOA 3FSGD 1E3LA 2J4CA 1VKNA 4CL0A 2RBGA 3ETDA 5G0VA 4JGIA 4ME6A 2ZRLA 4FZVA 3TOVA 3IIKA 2ZJ4A 3BJRA 2LIVA 4FBGA 3MS7A 1E1RD 2BR4A 4CM8B 2A9VA 5C4IA 1HL3A 2PNJA 1QFSA 2IEZA 2BFCB 2GVDC 1CUVA 2RB5A 4O4LB 2IF0A 3KUKA 4G0XA 2NU7B 3BZWA 3NM5A 2NV6A 4HUTA 4H7XA 1CUAA 3E2IA 2ACVA 4NABA 4KXMA 1YJAA 2ZFUA 3GOHA 5T7BA 2IHYA 3BXFA 1VJ1A 1E1NA 4PHTA 1LTHR 3BRSA 1R4ZA 2FPWA 3M4JA 3AS8A 1U1GA 3AZOA 5CVDA 1DXOA 1W1UA 1PJRA 2IU6A 1Z5NA 4IH9A 4XPIB 1OYOA 3FPJA 2DZOA 4QOEA 1P0FA 3EF3A 1L0BA 4TXPA 4K5CA 3JAKA 5FTJA 2I9CA 1HFWA 5I7OA 4NHEA 5F5NA 3FSRA 3SFXA 4P35A 3EIFA 2JLBA 3GLIB 1XMIA 3A58B 1XZCA 3A9RA 2QVBA 1C9MA 1JSRA 1AHPA 3M6UA 4HN9A 1OI4A 1XO1A 2BKXA 2Q2VA 3HCCA 1MPXA 2PL9A 3DJFA 4DR2B 3TWUA 4GYJA 3MXOA 1WU7A 2H9AA 3MAGA 2GPWA 1E3TA 1MB0A 4QUHA 1D8EA 2AR9A 1T6YA 3E23A 3ZUVB 4TT8A 1M1XB 4MKTA 1YZNA 1F06A 3BFKA 5DXJA 4EZJA 1JEQA 4B2YA 1Z33A 1VE5A 3UBMA 5KOHB 1Y9AA 2D4AA 1RWKA 3MG9A 2VHEA 4ZXPA 1E32A 2VTBA 1J49A 3BG0B 3EXAA 4RY9A 1E69A 4N47A 4RTMA 4AT1A 3QOYA 4KWTA 5FBZA 4YCCA 1X80B 4KR9A 2I3DA 3L5OA 3KZXA 3ZZTA 3EASA 4GZ6A 4MCIA 3TB6A 2QKYA 3G2PA 1ISMA 5BORA 5CAEA 5KB3A 3NASA 1SXJD 4LHVA 4I6EA 1TVKB 3W7AA 4EB8A 3ZHVA 2BV3A 3CVJA 5LC1A 4WDQA 1L3BA 3ZK7A 4QVKA 1KI7A 3ZV3A 3ZGXA 3QZUA 3KLNA 2HAEA 3U6KA 3RRZA 5AOAA 3WLIA 2F43B 2VSOE 1D5CA 4CEHB 2XT6A 5JCOC 2P9CA 4DCMA 3HGMA 2WFAA 4XGRA 5E9WA 2OZLA 2W0SA 2XVMA 4HX5A 4FHFA 4XOIA 3LXRA 1R8QA 5ITZF 3TLKA 4V0QA 3X2QE 4BZZA 2X4GA 5D86A 2HA4A 1TJYA 3GR6A 5EHXA 1TCAA 3GHYA 3BEEA 3H97A 1JEJA 3CLRC 1AO3A 3RNLA 5KEIA 2F59A 1VB3A 2I1JA 4WOJA 4ZMBA 3VZSA 1HI9A 1ZXXA 3ZDEA 4RZUA 4HNRA 2BM9A 4R1LA 1AS0A 3QIVA 4GZ5A 2I76A 4RL6A 1T1SA 2J3JA 1TN8A 3WYAA 2QI9F 3R3UA 3IUSA 4M4SA 4JU9A 5ILQA 3ZWYA 2D2VA 3K4PA 2GBGA 4YDQA 2Q5CA 2W7TA 1CY6A 4DCPA 3CVLA 2YV5A 3UV6A 3ZE1B 2RFLA 1CCWA 3NV7A 4NULA 3R6TA 5KVSA 1JDTA 4DPRA 5B7GA 4OYHA 3CR3A 1A2OA 2P4HX 1TF2A 1Z3XA 2I29A 4PTYA 5JS1A 1DELA 2MU1A 1UMCA 2VQFB 1KT1A 3EHQA 4V2IA 4KYUA 2WJ6A 1OZGA 2HW8A 2WT9A 3CEMA 4ARBA 2C9MA 5AM2A 1MIOA 3HKBA 3QXGA 1IE3A 5EINA 1AF7A 4PZYA 2AWOA 3HPQA 3KFXA 1S89A 1T9CA 5JQWA 2J45A 4PGGA 4OFWA 1RJFA 3G23A 4V1CB 3GWZA 3LCAA 5DXFA 1IPHA 4D4JA 5BSHA 4A6PA 2Q5LA 5EIXA 3B53X 5DHRA 4REQB 1YBFA 1OGIA 1BU9A 3ZY3A 4DMUB 3K20A 1QRSA 2GRAA 2Q2WA 1Y1KE 2PKWA 4B94A 1KS2A 4JIMA 4EP1A 3KBOA 2ZUWA 1QIKA 3QPVA 1ODSA 2O2HA 4RU1A 3VC7A 3W5JA 4ISCA 2BMDA 5AESA 4JD2G 2CNNA 4A8JC 5LD2C 4WCFC 2K4NA 3VC1A 1THTA 2VP6A 3QRWA 4WY5A 1O5TA 1SQFA 3AEUA 3ZTYA 2OSVA 4R5HA 2F1JA 4GS5A 1F4VA 2ETXA 4EDFA 4CKEB 2Q5FA 1NJ2A 3KYDA 4X7RA 2C99A 5EIBC 3OF5A 1G3QA 1DDOA 1ZL0A 4JPSA 1DKUA 2OG1A 3COSA 2FWJA 2CWWA 1I4OA 2XH8A 1RKVA 4NENB 3ZHRA 1R50A 4TV8A 4KOAA 3KWJA 2I6TA 1XT6A 3ETJA 4F7WA 3H5IA 1U1FA 3ZNOA 4OK3A 4RABA 3E22A 1H1LA 1OC4A 4ZQCB 3SEAA 2NIPA 2O8VA 2VOJA 4JSTA 4A73A 1L7XA 4NEHB 4PAQA 4HS9A 4E51A 5CMLA 5DNAA 4LK2A 3WB1A 3AKEA 3GZNB 1NF3A 5DTIA 1CS0B 1RWVA 2FP3A 4N1AA 1PC2A 1CU1A 1JWBB 4EL0A 4E46A 4IMJB 3THYA 3D9PA 3BSFA 5EZYA 2EX1A 1GDTA 3KFVA 4JV5B 4GA2A 1KXZA 1H0RA 4AS1A 3DEAA 3R75A 3UENA 1TPZA 5CCXA 2B4RO 3ZI4A 1DJPA 1UODA 1XP5A 4Z9YA 4FQ5A 1G41A 2A1UB 4IFBA 2A3NA 4MSUA 3WZLA 4OJQA 1HO3A 4C20A 1XZBA 4JBIA 2XZOA 5BPPA 3L9TA 3VAZA 2PFGA 5ENSD 5LVAA 1NA5A 1EK1A 2VDRB 3W2FA 1KEZA 4XGNA 4NU6A 4HLUC 2QW1A 3OIYA 3U4DA 2TS1A 4S1VA 1Z06A 3SR3A 2C2LA 1WETA 5U4QA 4UVIA 1J06A 1A9SA 5BWCA 2O5EA 2FPKA 5DRTA 1W48A 3B6KA 4X24A 2JH9A 5G41A 1K3UB 3CCBA 4WUVA 1KVUA 1CD5A 2H48A 4QULA 3RHSA 2VQEB 3ODGA 1IULA 1I2MA 2OP1A 5I6DA 3V1NA 2IONA 4Q3NA 3PQ8A 3L43A 4FNOA 5GVRA 3K6KA 3UQZA 3NYQA 3ASNE 5HP4A 4MX8A 4C6TB 1R0SA 1A9TA 3LQ1A 4IRUA 3THWB 4AY4A 1CB0A 2J4BA 3TLMA 1WJGA 4B3RB 2VUUA 4PYMA 3ABKE 3QPUA 1DX9A 2DPXA 1CVIA 3PP8A 2J7PA 1WXXA 5J4LA 3A4IA 2HJVA 1YQWA 2Z5GA 4BMXA 5IK2D 2ID7A 2FZVA 3KUCA 2Z83A 4MRMA 3UCEA 1E66A 3PPWA 2OAGA 4LISA 1WXIA 2DQ4A 4WECA 2ZG6A 1JEYB 1DBVO 1N9ZA 1IYZA 1U2DA 1CUDA 3ANYB 4BLSA 4MJXA 2DBQA 4ACAA 3EU9A 3KT6A 1CQIB 2FF4A 2ATIA 4RHYA 2WJGA 1I5EA 3TJPA 1TFUA 2HD4A 3MSXA 1N32B 3R9XB 4L5BA 4IBOA 3SP1A 3ITNA 4NWIA 4P4SA 4Y9SA 3FGZA 3LI2A 3KSRA 2BELA 3B7RL 4J0KA 3ZK9A 5EPOA 1ZAYA 1T10A 1M5UA 1HH4A 2I1LA 3MHPA 3UZUA 4HEHA 3G7UA 1JT9A 2AXVA 3LKUA 3OMLA 5JAPA 3HZHA 5A3JA 2PX8A 2ZU0C 2YJ6A 5B57C 5AQEA 1XCGB 1RPJA 4DXHA 3RTEA 5BQOA 1GNQA 1DJQA 4IM7A 2ZZKA 1QPBA 2JLYA 1JNRB 1B4DA 4HTFA 4KVZA 2WDPA 3J80A 1RP1A 3TD6A 1JHOA 1JQ5A 1ZGAA 1H3EA 1EP1B 2IPLA 3IP7A 4G9GA 2ACWA 1N25A 1GZSA 1EBFA 2WYIA 3CXRA 1SRQA 4QDUA 3WG9A 5ITSA 1G4HA 4A55A 4MAMA 1VFPA 3PLNA 5LQJA 4MQEB 5FWNA 2WKPA 3IP3A 3UN1A 3OJ0A 4KPGA 4Z4QA 2HIGA 3TQOA 3SI7A 4MV1A 3TMYA 3AWIA 4D4IA 1WHTB 4JVSB 3HB5X 1NVFA 1OV4A <