4GYWA

Crystal structure of human o-glcnac transferase in complex with udp and a glycopeptide
Total Genus 281
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
281
sequence length
715
structure length
695
Chain Sequence
PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKHIYDNRIVLNGIDLKAFLDSLPDVKIVKNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/peptide
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 281
structure length 695
sequence length 715
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gywA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gywA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gywA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gywA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gywA03
5DBKA 4AM9A 4YVOA 2V5FA 2YHCA 4L22A 1NVKA 3D1JA 2AZDA 3EDTB 3JYSA 3U4TA 2QZSA 2QN9A 2FF5A 5JJ6A 3CV0A 2IEIA 5KJMA 1V4VA 1JEJA 8GPBA 2QNBA 3TG5A 1L5QA 2FO7A 5TMBA 4CGWA 2FFRA 3FFLA 2IUYA 2XA9A 4G1TA 3TOVA 3PDNA 4N2QA 1ZU2A 5IKOA 4MI6A 1WV0A 2VYIA 2G9RA 1FU7A 1UQTA 1HH8A 1L5WA 2IF4A 4RIEA 3BD8A 1WAO1 3NCHA 4X6LA 4B94A 2HO1A 4RELA 3ZCUA 4CDRA 4GZ5A 2FF4A 3AMVA 4FKZA 3MBOA 3MRVA 3DZCA 4MICA 1Y6FA 1YA0A 2IW1A 3RO2A 4HOSA 3KAEA 5FTPA 1XL0A 3AS5A 3LYAA 3G2HA 3MT8A 1Z8DA 2X0DA 1IHGA 3C4QA 2NC9A 1IYGA 2VG8A 3KD7A 4UQYA 1GPYA 2PRIA 4KBQA 2QRPA 4G25A 4GA2A 3G2LA 3RSCA 2G9QA 4EL5A 3C4VA 4N3CA 3BCUA 2GPNA 4HOQA 3VTXA 3MRTA 5G04J 3GUHA 4REMA 2HR2A 5BT1A 2WTXA 2IV7A 4WNDA 1NOIA 3PE4A 4H7YA 2SKEA 1P4GA 4BQFA 2XA1A 4KYOB 3L7BA 3CKBA 4UQXA 3BDAA 3T7DA 2C0MA 2F3SA 2GW1A 3QKWA 3Q3IA 3S28A 1P2DA 2X6QA 2XCUA 3CUUA 4I9CA 1PSWA 2ATIA 1XC7A 9GPBA 2O6LA 4EL0A 4U0SA 2L6JA 1KT1A 1M5RA 5A7DB 4RBNA 4I9EA 3CUVA 1P2BA 4AIFA 3NB0A 1W3BA 1FU8A 4AY6A 1C8KA 3OXLA 3E3NA 4Y6CA 4HORA 4UI9J 1J39A 2PYIA 3E3OA 4AN4A 3E4BA 3UQ3A 5I45A 3VDNB 1NZDA 3Q4AB 1Y8ZA 4AMBA 3UYKA 3ZCRA 5JTUA 3OXFA 2ACVA 3MEKA 3QWVA 1WW2A 2PYDA 3S2UA 3UUXA 3QWWA 5ARGA 5FZRA 3T3EA 2JLBA 2XGSA 2PQRA 1WM5A 2WQHA 4UI9K 5LCWC 2AMVA 1ELWA 3OKAA 5TMEA 4ABNA 2LSUA 5DXFA 3CVNA 1KTIA 2FETA 4HOTA 4KQMA 4M83A 2XCIA 5D00A 2IEGA 3IEGA 3CEJA 1B89A 3S7JA 1NOJA 3ESKA 3LY7A 1C8LA 3CEHA 3SYRA 1H5UA 2AW3A 4CGVA 1LWOA 4BTAA 3CK7A 3TG4A 4RG9A 4G2TA 1KLXA 3S0JA 4CTOA 1JIVA 3OXGA 1RZVA 2SKCA 4BQIA 2VQ2A 2KCKA 3RO3A 3ULQA 3Q49B 5CHEE 4GA1A 3Q47B 2H1FA 4ME2A 4EKEA 2R60A 4MHSA 3CVLA 4LEUA 4F96A 2QRGA 4GZ6A 2IFUA 5DU2A 3RU0A 3CEMA 4AMGA 3BEOA 3O48A 3Q15A 4J8DA 3QKYA 4XI9A 3CVQA 1Z62A 5BW8C 3S29A 3NP9A 4KQ2A 4GCNA 3QWPA 3DDSA 1QQEA 3O3CA 3CK8A 2OOEA 3HYMB 5G05J 1IXYA 2XCCA 1P4HA 1JIUA 1PYGA 1XL1A 4MRAA 4EKYA 3N71A 5G05C 4NRHB 4N2SA 4G26A 3OT5A 1JIXA 3BD7A 1O6CA 5D0QD 2Y4UA 1GPAA 3PE3A 3BCSA 2GJ4A 2F3UA 3NF1A 4F97A 2VSNA 3MV3B 1QZ2A 1IIRA 3VDMA 4YUAA 2QLLA 1Y6GA 3CX4A 3HBNA 1C3JA 2J9QA 2XMPA 1NA3A 5ARFA 3EBOA 2QRHA 3NPAA 1PC2A 1F0KA 2P6PA 2VGXB 4AY5A 3ZN3A 3UYLA 1YA6A 4U0ZA 4RIGA 2PRJA 3MKRA 2QN3A 3MV2B 1P5QA 3RIBA 3S27A 1NLMA 4MHOA 3RT1A 1KT0A 4WUYA 3MT7A 1WUTA 1JG6A 2X6RA 3WADA 4W9RA 1L5SA 3RKVA 1C50A 3QHPA 1YGPA 3CUYA 2IYAA 1ABBA 3GW4A 4CTNA 2QN2A 2Y4TA 5G04C 2QN8A 4WADA 2KCVA 3WC4A 5EKQD 3TSAA 3D0QA 4O6FA 1GZ5A 3NP7A 1HXIA 2Q7FA 1UZUA 2YJNA 2C1ZA 3G2KA 3MTBA 3RSZA 2HY7A 5JJTA 1FS4A 1XOIA 1PN3A 1GPBA 5HXAA 2GT1A 3IAAA 5AYWD 3BCRA 4I2WA 3T3GA 4GA0A 5FZQA 3WAGA 3ASGA 3WXXA 4G23A 5HQ8A 4XIFA 3ZCVA 4GZ3A 2VGYA 1A17A 2BUGA 5M72A 1P29A 1WUYA 3MS7A 4GPBA 4BQEA 1A8IA 1FA9A 2XEVA 3TGOA 1SXPA 3C48A 1SXQA 1FU4A 2SKDA 3T5TA 1P2GA 2KATA 4UI9C 1E1YA 3COPA 3HBMA 4LDPA 4NESA 2X0FA 2PQNA 2VGXA 3GZ1A 2ASVA 4HWGA 5D0OD 4FZRA 4M60A 4I2ZA 3G2NA 5EX0A 4U07A 3MTDA 2XPIA 2I6HA 5GPBA 1NOKA 4JL0A 2QLMA 4WHMA 3L7DA 4KXKB 3CEQA 3RJVA 2YQ8A 3ASHA 4WACA 4YI5A 2G9UA 3MT9A 2AVPA 1AHPA 3ZCTA 4Y6WA 4NQ0A 3ZCPA 4BT8A 4EQFA 2BGTA 4WNEA 1FTWA 2BISA 2VCEA 2PZIA 4N5CA 1JG7A 2C9ZA 4RIHA 4GCOA 2OFFA 1EXVA 2VSYA 4Z5XA 1LWNA 3HBJA 2ECPA 3CVPA 1L5VA 4RENA 3T3DA 5IKPA 2GM9A 2F3QA 3QOUA 4A1SA 2XGOA 2FI7A 3ZFWA 2C2LA 2C1XA 2IV3A 4QLBA 2X0EA 3Q3EA 2FEZA 5FT9A 2QN1A 1XKXA 3L7CA 1ELRA 3L01A 5FJYA 4N3AA 2P58C 2UY1B 2XCBA 2R5SA 3S7BA 2R4TA 4HLNA 4KQ1A 3GYZA 3D0RA 3AS4A 3OKPA 4RIIA 3G2JA 2R4UA 3SYMA 5TMDA 2Q6VA 2MHKA 3KS2A 1NZNA 3MA5A 3L7AA 4I1AA 3G2IA 2HYZA 3Q5MA 3TAXA 1EM6A 3MS4A 4W6QA 2UWJG 1WV1A 3OTIA 1E96B 2XGMA 2PQ6A 2BGUA 4EJ2A 2LNIA 2C4MA 4I17A 2R68A 3FWVA 4BWRA 3OY2A 3ZHEB 2PL2A 4IN3B 4BTBA 4N3BA 4WNGA 3NAZA 3NC4A 1K06A 4F3VA 1FTQA 2JJMA 2F3PA 4UQZA 4WNFA 3DD1A 3H4TA 1F6DA 3RHZA 3CUWA 5CCLA 1B4DA 4X7MA 4X7RA 4N9WA 1QKJA 1P4JA 5A6CA 1FTYA 3VUFA 4MI9A 4YVQC 2H1HA 4JHRA 3CK9A 3UPVA 1VGVA 3QDNA 2QLNA 2AV6A 2ACWA 2XA2A 4G24A 5HI7A 3CV3A 5KJKA 3CKCA 2WPVA 3VTYA 3BEEA 4XI0A 4HOUA 4APOA 3OTHA 4CTMA 5FZSA 2FBNA 1AXRA 3BD6A 2UY1A 3CUTA 1GGNA 2QRMA 3ZCQA 2ONDA 3VUEA 4H7XA 2G9VA 4YI3A 1RZUA 1OUVA 5CCMA 1FCHA 1E4OA 4RIFA 3LCAA 2GPAA 5KJLA 4PQGA 1TJCA 3LKUA 4GYYA 4M7PA 2DBAA 5DIZA 1GG8A 1XV5A 2ZB2A 3SZ7A 3OY7A 5DLDA 1RRVA 4BT9A 1K08A 3GZ2A 2GEJA 3ZHEA 2C0LA 3U3WA 1PNVA 4NC9A 2LSVA 2F9FA 3S7FA 1GFZA 3OTGA 3FP3A 4GYWA 4JA9A 4MI3A 1L5RA 4N39A 3HBFA 1BX3A 1L7XA 2KC7A 3LY9A 2BFWA 3S7DA 3MRXA 1HZ4A 2VCHA 5TVGA 3E3LA 5EX3A 4NEQA 1HLFA 3GPBA 4YNDA 4LEIA 4U04A 1NZFA 6GPBA 3URZA 5BNWA 4RG6A 3K9IA 3ASDA 5C1DA 1UQUA 4U0UA 3AS8A 4X7PA 5ENZA 3EBPA 4F9FA 5JJ7A 3MQFA 3SF4A 2GEKA 5LCWJ 5JTTA 3MSCA 3T3HA 3ZCSA 4J0UA 1L6IA 4G2VA 4J8FA 1ZBPA 3ZGQA 3LPZA 5D01A 5KJNA 3OKCA 1WW3A 3IA7A 3FROA 4J8EA 4JA7A 3H4IA 2R66A 3R9AB 1NA0A 2KS6A 1FC0A 4GYOA 1Y8MA 2GPBA 2KCLA 1QM5A 1Z6PA 1Z6QA 2QRQA 2QFCA 3Q3HA 4GPKA 5LQDA 7GPBA 3MS2A 3ASFA 3L79A 2IYFA 2JZCA 3DDWA 3T3IA 2E2EA 3LY8A 3ZPJA 3MTAA 2QN7A 4BFCA 1XNFA
chains in the Genus database with same CATH superfamily
3NWEA 3D1JA 2QRVA 2QZSA 5C1OA 1NUAA 4GZLA 4NONA 1PP4A 1ORIA 5DSXA 3AXTA 2IUYA 2MOKA 2AJTA 4UUPA 2PWPA 1ZU2A 2NU7B 5IK2D 1G0NA 3G02A 4GOLD 1XZDA 3QKRB 3QY0A 5CM8B 1KXJA 2XE6A 4WZAE 1CB0A 5CYPA 2XTZA 3ZWBA 3P9NA 1AJEA 2HT1A 4PEVA 2HTEA 4N3CA 3KL4A 3AVYA 2OWDA 3SC6A 4J75A 1PG5A 4W8GA 1BFKA 2ACEA 2FPLA 4OYLA 3L0PA 2IO3C 1E3IA 1MORA 3RGGA 4ENPA 2JC3A 2XB9A 5ALLA 2ZRBA 3LFHA 2RHCA 1B3RA 4FYKA 1VE5A 1JHRA 1U5AA 2YWXA 2XBUA 4HH0A 4WXEA 1P9LA 4L7TA 4UHHA 1CUVA 5CIQA 1BQ3A 4ARUA 4BO8A 4J7AA 3ESRA 3MJEA 2GB4A 2ZRDA 4ZPXA 2SCUA 4IYPA 3VR4A 3LRXA 1TECE 5E8JA 1MPXA 2R59A 2FEAA 3TQOA 4LNBA 2FG5A 4L8WB 3OECA 2JEYA 5CCBA 3QV1A 1J8FA 3LKZA 2IQIA 1B0UA 1K88A 2QYUA 3BHIA 3DLAA 4RQUA 3H13A 1DLIA 1JIUA 4K9MA 1HF8A 3E9DA 1C9MA 3S2IA 1IK6A 3C5VA 4Z1MA 3K92A 2CWWA 1G9XA 4OEHA 5LQJA 5JFTA 1XEXA 1K1EA 3GGOA 5DTIA 3ORRA 3IP8A 1SKYB 4RDIA 2YNMA 3PD1A 4NZPA 1ML3A 4UU0A 5H02A 3NP7A 1IY9A 3DAPA 4OI0A 3BQ9A 4BKMA 3SX2A 1IN7A 3H2KA 3L0YA 4PLPA 5LUBA 1N4PA 1G2OA 4R2XA 1PZGA 1AMOA 3F3YA 2RSFA 4B3BA 4D41A 2XZPA 1K5HA 1Q1BA 3NIDB 3R09A 4GQAA 2G5TA 2DFVA 2VDNB 2PT9A 2CLCX 1G6KA 2OOKA 3KXDA 3OJCA 2JGIA 3ZWPA 1C4KA 3TTSA 4CMBA 4HKTA 3BQMB 1DQPA 3EF1A 4TYWA 4PRYA 2TMDA 4E6PA 5I4CA 4V3IA 3LW8A 4OUDA 1AUXA 1CJCA 4A6PA 2JKVA 4AZ3A 5L3RA 5TB5A 5JT1A 1O5MA 5CVDA 3FIUA 4GT1A 2Q0XA 2PRYA 3R7FA 4M0UA 3KKPA 4Q9JA 3OKFA 1GA6A 4IKEA 4D9EA 1IWPB 4IXWA 3JD3A 3FDZB 2CBXA 1FVHA 3UHFA 3GGJA 5A0FA 3OTOB 3FI9A 1ZW6A 2NZXA 1OKKD 1AU9A 4P36A 4CXMA 2V0GA 1LPOA 2PNNA 4MV5A 5JDCC 3UJBA 2J3HA 1M8PA 4WCVA 3TCKA 4B6EA 3RFFA 4WEOA 1M2OA 1R8JA 4MW4A 4UD2A 3UI2A 5JRZA 4DUGA 1ZL2A 3RTEA 4PG7A 2ZSIA 2NTVA 1SFRA 4Q3EA 3ESXA 3GDFA 4HBGA 4NEQA 4Q48A 5LXTA 2P3QA 4YNDA 1DEOA 1XP8A 1GLNA 3HZRA 4OJKA 5AQ1A 2ZB4A 2CFOA 1L6IA 1I3MA 4J8FA 5BN5A 3AIIA 3ZGQA 5LIPA 5LMUB 1K98A 3N59A 1JNXX 4JA7A 2M6KA 3F71A 1DG3A 2IA5A 1OLSA 1QGUA 2EW2A 3Q3HA 3T3IA 3R9XA 2J3LA 1JXOA 4EVRA 1PLJA 3CA8A 2FO7A 5DBKA 4LYHA 5C5CA 3L06A 5C1PA 4IJQA 4J7WA 3HJGA 3RM3A 4ZQEA 1EBUA 5ERYA 5T67A 4RQTA 4X8HA 4RZXA 4UVDA 5K7SA 4CMJA 3DKRA 1QPGA 3FMGA 4CM9D 4Y2TA 1ZCJA 4ACBA 2AWNA 2DYSE 2D1SA 2WAAA 3ZCUA 2Y69E 3Q7IA 3DXXA 4X91A 1UT6A 4OHRA 4DLKA 4KNYA 3BMQB 4HDOB 1U8UA 5KVQA 4P08A 2BBTA 2DPLA 1Z4NA 5DXAA 5KOIA 3DSSA 2GPNA 5KVAA 2OCPA 4LDJA 5DNEA 4AQYB 3V30A 3VV3A 2ZGGA 5FQNA 1N6LA 4JUBA 2X76A 1YVPA 2N9UA 1YRBA 1MH9A 4QD3A 3ZOKA 3A8TA 3HXLA 3HB5X 1FZQA 3AEKB 7MHTA 1E2DA 4GYJA 4B8YA 2NU7A 1XDUA 5CAEB 4I4CA 3VNBA 4HXFB 1NLYA 1XNHA 1UN8A 3QFSA 2OEWA 3QKRA 1ID8A 2NNLD 1DL5A 4JLNA 1GW6A 1J0DA 3TJZA 3IGFA 1AZSC 3L6OO 3FTDA 1QHSA 2OOSA 2FN3A 2B5WA 1JIKA 2NO5A 4WXRA 4KXNA 4WT7A 1Q0HA 1Z5VA 4KQ6A 3BYZA 1XZGA 4DLAA 1G4HA 4TKZA 3N2LA 2Z58A 1E62A 3VTAA 3F1LA 2ENUA 1CEYA 1HY3A 2ZIUB 4B4VA 4DSNA 5LLDA 4DEXA 4BN0A 3DP9A 4GZ6A 5DU2A 5FCDA 1ZIPA 3BDIA 1A2BA 2XCSB 3ZVKA 4ZXFA 5CHEA 2Z4TA 3MXOA 4I5FA 1U2DA 1OPXA 2B7CA 2CFCA 2J87A 2JGJA 5JZSA 3PKZA 4B4KA 4C9BB 1PWZA 2NO7A 4Z2AA 3D64A 1QYVA 4XASA 3I8SA 2P1ZA 2G4LA 4B9EA 1JZSA 3RKVA 1K3TA 2OD2A 2DX7A 3PA6A 4PHCA 1ZG3A 3LCCA 3QE2A 3RSZA 1CLUA 5AM0A 1V7ZA 2P2NA 3M6IA 2MSNA 3GG2A 5D87A 4UPDA 4EYGA 4A0RA 4QTUB 3R1IA 2H16A 3DW3X 4FADA 5FTKA 5FIUA 4CKCB 1KO1A 1CY2A 3NC1C 2O23A 5EKTA 3GWZA 4IDQA 1U8EA 2LP4Y 1FP6A 4KGXA 4ER0A 1Z37A 2A88A 4H6WA 4PZZA 3Q8XB 3UT5A 3FKSD 4H31A 4GCOA 1HG2A 1IFXA 2I3GA 2OV6A 3E0XA 4QOIA 4FMDB 1KKUA 2ILVA 4PQFA 4DZZA 3F73A 4MVJG 4CCYB 4TSRA 4KXVA 4ZAGA 1P1KA 1IOVA 1LPMA 3EWAA 4OK6A 4DQVA 1D7OA 3G7NA 4NXNB 4HSGA 1KHTA 2DCUA 3OJFA 1E1MA 2FFAA 3H4TA 1BMFD 2HFJA 4HSEA 2AR7A 2O8FB 4QXAA 3VUFA 3W6NA 3DLHA 1U6JA 3P9PA 2HD4A 4G36A 1D7AA 4OMDA 3DL7A 1IY2A 4RVNA 1L7QA 3KZVA 2PS0A 1F4VA 4CFSA 4RK4A 4LTDA 1Y9EA 5CCMA 3A32A 4ENSA 4G5XA 1SZCA 4LHYA 4GYYA 3HB0A 5ITSA 1OC2A 4LK3A 3GZ4A 1H9BA 1PDVA 4ECEA 3S8MA 3K0HA 3E22B 3KKLA 5EHIA 2PLRA 1E8WA 3FDZA 3UM9A 5JQGF 1YUBA 3EVZA 1Z06A 1RVV1 2Q3FA 2C4TA 3D43A 1DWOA 4YEDA 1ZBPA 4QXQA 4NFSA 4YALA 1YE3A 2J9FB 2W70A 3K8OE 4JOSA 3ISJA 4OAPA 1RYBA 1ZCZA 2ZTVA 2ONJA 3F8TA 1OY3D 2IEIA 3LXMA 1JILA 3EQ7A 4JKOA 2FKAA 5JPCA 1PT9A 5FI0B 4LRWA 1BD4A 1VI6A 2WJHA 4EPWA 4TXNA 3PFWO 1GU1A 1HDEA 2IW1A 1JJFA 2X9QA 1RHMA 4JBYA 2WT9A 1R9MA 1EFDN 4QDOA 3EFOB 2XB2A 4HGPA 5JYBA 2H92A 1J0AA 2X1LA 2H5JA 3DE6X 3BXZA 4FJ0A 2OFOA 4TQ9A 3ZLVA 5LNK6 1D6MA 4ZI7A 4M1KA 1SUWA 2YINC 4YUYA 1Z7EA 2PSFA 4XZ3A 3IKMB 2ZRKA 4L9AA 1FSZA 4IIHA 3PWZA 3H9CA 3WKAA 1KFBB 2YOGA 4KRYA 4GAAA 3BMQA 5JRJA 5BW5A 5I7UA 1RBZA 1LXCA 2XSZD 4KE6A 5MFPA 5LP6F 3IT0A 2VH5R 3KDSE 2GF0A 1ONPA 2G0TA 3IP3A 3QBJA 4BO4A 1O5TA 3HVJA 2EU8A 4DIKA 4G0PA 1EYHA 4WA7A 3A11A 3HFSA 1XAIA 2VSFA 1JIVA 4HI8A 2FJPA 4YBZA 5AJYA 2GFIA 2G5GX 2W22A 4F91B 3I6ZA 3VHRA 2Z8ZA 3DHNA 3IHTA 2HQ1A 5BSUA 1B8VA 3DC2A 1PNOA 1CDZA 2HU2A 1YBHA 3DEPA 2D0OB 3M83A 3DUFB 2I4IA 4IXMA 1YBFA 3PXBA 4YC7A 1ESCA 3PZ2A 1RAFA 4WBNF 1YC2A 4ENRA 4LW8A 4MGIR 3MWGA 3IFSA 4ZARA 4GO1A 4WADA 4Z4IA 4HATA 5JJLA 1E3EA 1WSWA 3M1YA 3VMFA 4A82A 1K63A 3KWFA 2K7ZA 4EG5A 5JCJA 2AYYA 1XI2A 3T3GA 3AUFA 4XM0A 4FN5A 3SM3A 2I4OA 4GPBA 5J4KA 4K26A 3UIOC 3RJZA 3A26A 2UAGA 2UUCB 3SBSA 2PMWB 3H99A 2JFUA 4CQNA 2O7NA 2DCPA 1SCDA 3B7UX 4OHFA 5IFLA 3AUUA 4CUKA 3HY4A 3W34A 1RAIA 2SHKA 3T5VA 1W52X 2OG1A 3T1QA 5L7WA 2JBHA 1UZMA 1NHWA 4YASA 2PGJA 5C8YF 2PMEA 3L7AA 4LYEA 4KXUA 1X81A 3IAS6 3T5GA 3VDQA 1SUPA 3LDFA 3F9RA 4TUYF 4E11A 2K4MA 5CGZA 4C04A 2IPNA 2C4MA 4JQZA 3PREA 4P34A 4FWTA 4MVXA 3NAZA 2OHIA 5DBEX 3HXMA 2WIDA 4FR5A 4Q12A 1GPUA 4XIGS 1AH2A 3T4PA 2AMYA 3D4LA 3MXTA 4Q66C 3GVHA 1Z82A 1HQDA 1T1IA 5B7PA 5F4BA 2PVSA 1GKYA 2VNSA 4YECA 3U3JA 3L7LA 1HF3A 2VJYA 2X1HA 1IOZA 2J1LA 4IGFA 4FOPA 4M3OA 3H84A 3AQIA 5ECGC 2IY8A 1RXYA 3DPSA 4E32A 1XU4A 3AR6A 3FHEA 4P22A 5DSZA 2R6R1 3VVLA 1Z74A 1GG5A 4YAFA 2RCYA 1A1VA 4WWHA 5F9FA 3F3KA 1A88A 1S4QA 4YBRA 2O8FA 2NSJA 5BNWA 3W2IA 1MCZA 3WMRA 4DUYB 5ERXA 5CRUA 1Y8AA 3IUPA 1P62B 2Y8EA 3QWHA 3TOXA 1FPPA 4MWGA 3LDAA 1UN9A 4OKSA 5T8KA 5B7NA 3L1KA 3AG1E 2NG1A 2QAGC 5B12A 4DLQA 1LI5A 3O7WA 4BFCA 2JH8A 3WB2A 3UMFA 2V7EA 1W47A 3DEAA 1KYTA 4F9GA 5A4MS 2BFPA 4G63A 1YZYA 4ZFNA 5DFAA 2QU8A 3E22A 4CM3A 5ILGA 5TF0A 4J7UA 3FM9A 1KZOA 3PNTB 1RI4A 4RIEA 2VYQA 4I6GA 4B94A 3GELA 3AIOA 5EJ4A 4BNYA 3DA8A 1HLGA 3HUFA 3TIFA 1JQLB 4NMWA 3H2JA 4FW8A 3ZWNA 2YXEA 2OHGA 3K1AB 4X92A 5K8IA 3Q87B 2X0DA 2J9FA 1JFSA 2J4DA 3APFA 5FQ6A 3SU8A 3HL0A 4QVGA 3ND9A 1SPBS 4YRTA 5AHXA 2JI6A 2BM8A 1R6BX 2GN9A 4WKBA 1AKYA 1D1PA 4Z9FA 3RSHA 4RC9A 4WNDA 5EN4A 4V39A 2Z2JA 4TS4A 3WGZA 4CJXA 1YDFA 2YFQA 4A15A 3LFUA 4N6GA 2VT6A 1HYBA 3D9NA 2CVZA 1NL4A 4B0ZA 1XQ9A 2X86A 1E18A 2OSVA 5AH0A 1DP4A 4DG5A 1WW2A 2NTYC 3EFOA 4AJOA 2JASA 1Z47A 1WPQA 4OBEA 1TNUA 2JFYA 3JAWB 5HPYB 2CN1A 3EGXB 2G72A 5J4VA 2I6QA 1VBNA 4IWYA 5ERGB 3FTYA 3UBTA 3S29A 3RNOA 2I9CA 3MJFA 2B82A 1Y3BE 3I37X 2AI1A 4OXNA 1L7NA 2P9GA 1SXGA 4U2GA 3HDYA 4J0QA 2P9PG 2XKAA 3WP0A 4OI1A 2FPIB 3T0GA 1KR5A 4PHTA 1PR0A 3UK2A 1R7RA 1M1XB 2AVNA 3NO4A 3VO8A 3FPGA 5JS1A 3SNXA 4CM5A 3P9RA 4XYBA 1O97D 2AFRA 3IOYA 8AT1A 1OLOA 3R76A 3VA7A 3HK2A 4C4SA 2PMBA 1E1YA 3DUFA 3TGWA 2PJUA 4IO1A 3LCJA 5KYNA 4J4TA 1O94D 1ESDA 2XQJA 5T57A 3OIWA 1ND6A 4E3ZA 4KOEC 2A86A 3UK6A 1X42A 1SBIA 1FXUA 4FFSA 1LBTA 2WYVA 4AZVA 5HE8A 5KQGA 5DZSA 4FCTA 4DR2B 2GBPA 3C3RA 1MNQA 3FNRA 2XGJA 1QP0A 4O8CA 4G0QA 3R4CA 2WMDA 1Y0BA 3JQCA 5KSZA 4KK4A 5F5NA 3QZUA 4YQZA 3O94A 3BKXA 4RLYA 3WMXA 2HV9A 1KQOA 3OIFA 2JI8A 1THTA 4KG7A 3I0MA 4KFTA 3HJAA 3B1XA 3IKJA 3OPVA 2GI4A 4RF2A 4J7XA 3OUTA 4DIBA 4AXHA 5LD2B 2XMBA 1ZCFA 1Y4SA 2CUNA 1AN0A 2IXTA 4RAQA 1WDKA 1VXOA 5H3CA 2ZWVA 2AJAA 3KLMX 4EY5A 5HVNA 2VWQA 3PCRB 4LOJA 4YJ2F 2GA8A 4FNOA 1MC8A 2B61A 1DOZA 5DLEA 3LQ2A 4QQ8A 4AKEA 1MU0A 2LCQA 4D26A 1SVKA 3O03A 2ZDQA 4N0DA 3AUKA 4MVJH 1PNVA 2B6NA 4EO4A 3I6BA 4B3FX 2FEWB 4HBZA 1F0YA 3AP3A 5B57C 1E8DA 3TWWA 4ZRMA 4Y1GA 1ZU4A 4KTVE 3K05A 2F9MA 1E5LA 2E4ZA 3EIQA 1TN7A 4OYHA 3HLYA 1J2UA 3CN9A 5U1PA 3X1XA 2AE2A 4MDEA 5HZKA 4YRGA 1N4QA 2CHXA 2I3DA 3GLQA 4MS4B 1CF9A 1KC1A 1QQ6A 2OZKA 3L02A 3AOEC 5KPJA 1V4VA 3FPEA 4MGEA 2J8SD 1XALA 3X2QE 4NZZA 4QODA 1Z5ZA 2HQSA 2ZJAA 3O84A 2X5NA 3ZE2B 1S2NA 1CDOA 5EZ6B 3F4LA 3T1NA 2XZOA 4CMIB 1P6XA 2A8YA 5D6OA 1N7GA 2V7XA 1DMRA 4MJLA 1A69A 1PRYA 3O8LA 3RU2A 3GEMA 4UQYA 1DAMA 2ZPUA 4IKOA 2QSZA 5HR5A 4AJPA 4WOBA 2GD6A 1DVPA 4EG1A 3ANNA 1QBKC 5FBLB 2EEZA 4KAXA 1GQSA 2GXSA 3AF5A 1NN3A 4KWTA 3LHFA 1L8QA 3HBAA 2YZ7A 1P2BA 4D0RA 3NYQA 3F3SA 4IGIA 3ER8A 1DBRA 3OP1A 4BMYA 3UG6A 1KEEA 1XRRA 5B1YA 3B48A 3TDNA 2DGDA 2QK4A 5EP4A 1X7HA 5IM4F 1QGDA 1SC6A 1Q14A 3G2OA 3B6KA 2JF0A 5IVKA 1C8LA 2BEUB 2BKXA 2H08A 2BGKA 1FMCA 3UXGA 4RHCA 1ESZA 1JHQA 2IYUA 2FE1A 4ZYTA 4BQIA 3CLJA 4YXWA 4BX2A 4CMCA 4R05A 4Z9AA 1V11A 4AIIA 4H35A 1N7HA 4GI3A 4QPCA 3DO8A 4NNJA 2CL0X 2G3YA 3S55A 3KQLA 5B3LA 4F84A 1ONOA 1YACA 4C07A 1VG1A 2LV8A 4MV4A 3C6QA 1TCAA 4E31A 2OA0A 1YCSB 5LP6B 3UIPC 3CB4A 1FUKA 4YROA 5L3ZA 1YASA 5ARFA 1NMSA 2XHZA 3JYNA 4XQEA 5TRTA 2CVFA 3JAWA 1K5DA 3D5TA 3CSDA 3N3BC 3AUSA 1IHPA 3EGXA 4PYOA 4BE4A 3WTBA 4X95A 1H2BA 3WC4A 4M37A 3PI7A 2Q7FA 4HPJB 2JBAB 4BKOA 2P9YA 1OJ7A 4R01A 4D4MA 5M72A 4F6RD 1OIWA 3KIPA 4JYBA 2H5EA 4KLNA 3TBHA 2AEEA 3H7AA 1Z5NA 3TPCA 2DH6A 5BYJA 5JC8A 4QOEA 1B26A 4F3CA 2FPIA 1DUIA 5EGSA 2IXDA 2QRZA 3LVQE 5K3AA 1E0KA 1PDWA 4E33A 4ZOBA 3QF4B 4BZQA 1D9XA 3LUPA 4ZV9A 4X60A 1A76A 2VSQA 4P3YA 4R7GA 1KJWA 1Z26A 4KGVA 4EVIA 1J6UA 3IP5A 2OHXA 3DL2A 2E49A 1T5DX 2HSDA 2UY1B 4MGYR 4HTFB 1M3SA 4FIDA 4JJ8A 2H3HA 4OQPA 3SVZA 4C4PA 4E70A 5A4KA 2VHZA 3AUYA 3N87A 4RHXA 1GNVA 1F6DA 3JWHA 1TW3A 2JAWA 1K8XB 4K81B 4YVQC 2C7VA 2QGNA 4TTPA 4FM9A 1XEWY 4MR7B 3V7YA 4RJ2A 3HA5A 4GTMA 4PAGA 4U2DA 3FTQA 4ON9A 2VYNA 5KSOA 3EWSA 1WSDA 2AMJA 6PFKA 3K0EA 4IDCA 4QDKA 2LNDA 4Q7KA 4MS6A 4NKRA 4ZO4A 4RANA 1LBQA 2BE9A 3QVGB 3B1ZA 4TUYB 3OJ0A 4M4SA 4XGNA 5EJ7A 3CW8X 2GTHA 1EP1B 4C7MA 3FB1A 1K08A 3VTFA 2VHXA 4LNGA 3ZWQA 3ONWA 1BCRB 1BGVA 3QX9A 4P8RA 3EGWA 3CLVA 3K0KA 4F1PA 1U2PA 2GBLC 1E8OB 3ZIUA 3WSWA 3URKA 3QHQA 4MR9B 2QMQA 5C31A 1YR9A 4S1NA 2AF3C 4NVRA 1HFEL 1NQOA 1MMFB 1QX4A 5A04A 1N4RA 3I0ZA 5T7BA 4HEA1 2MSEB 2R84A 4GQIA 3TVDA 1IY0A 1V5EA 5DH9A 2PWYA 1ZQ9A 1Q22A 1D2RA 1GGMA 4OHBA 1XVUA 4NNOA 3O1IC 5JNWA 4NV1A 4CDRA 2DBYA 5BV2P 3QVVA 2EJCA 2FWPA 2GEUA 3PUWA 5LZ4A 3MKQB 2G6BA 3EOBI 3GFOA 4Z4HA 1SIUA 1C9JA 6CHYA 5H16A 4JOCA 4C4YA 3IDQA 4C5BA 4JSRA 4J0HA 2X22A 2H9AA 4LDNA 3KYCA 1U0HC 4TYQA 4MS4A 1DC8A 2MIIA 3R7BA 1SY7A 5IDYA 5KQMA 3F3MA 1EESA 4NFYA 5LKAA 4ZJYA 1UZNA 3W1WA 2HWUA 4AURA 3QKWA 1G5IA 4X71A 2O6LA 5LSAA 3JWPA 1YL6A 5BPHA 3LUAA 1M2EA 3OD5A 1Q7BA 4CMIA 2H1SA 1DCEA 4PRLA 4YRQA 1GA4A 4JSTA 1NZDA 3CINA 3L1JA 4EO9A 2WJPA 4OFBA 1Z45A 4B7UA 2CJXA 1KK3A 1NXSA 1CUJA 4FJ1A 3FOAA 3IKTA 2PUDA 3BFXA 3WGLA 3ADOA 1SU6A 5DLPA 4FQ5A 3L4EA 4IP0A 4AY3A 4FE4A 4U1RA 1GP2A 4HAIA 1DNPA 3RRXA 1C7IA 3FTCA 3ST7A 2B2XA 2YMQA 3A6GA 3LS8A 1WMEA 3ZDXB 3DR3A 1YB2A 5G05J 2IPLA 4A2PA 2KZTB 5EMKA 2I1QA 5E3JA 3WLTA 4M3NA 4I5EA 5DMHA 2VDOB 4TS9A 3FNQA 3CNBA 2BEUA 5GV8A 1RJGA 4NCXA 1W4BA 1MABB 2C7BA 4EGQA 5HIAA 1UOQA 1W48A 2C42A 1YGPA 4C0MA 4L85A 1RJFA 4OQ4A 4CL3A 1C29B 1KWGA 1JFLA 3D8SA 3JXEA 1O77A 2Q4TA 3EBLA 3EY4A 3SYKA 3RS0A 1CFJA 3E61A 4DR6B 4FC6A 4UM9B 1WKBA 1U3DA 4FHEA 4K6KA 5LP6A 1S7CA 3HVKA 5G3ZA 1P60A 3F2VA 4MMXB 1QU3A 4KL8S 5A2QA 4FP7A 2BMVA 2PVCA 3T7SA 3PUKA 2BWJA 5ABPA 3O31A 4C05A 4PC7A 3GNQA 4G1VA 1U0GA 3EGVA 2DFPA 1FYDA 3KSBC 3N0WA 2J07A 1ZITA 2Y1DA 3HFJA 1XTPA 1SVIA 2JBAA 1L9KA 1XWWA 2OEPA 3ZBPA 1AGPA 3UO8B 4GOKA 4KQ1A 3ONFA 1C3VA 3S2AA 1E7WA 4I1AA 1WO8A 4R2HA 4PXSA 1K86A 1VP3A 1YIAA 2R68A 3R5KA 1KJYA 1ZK3A 2QJWA 1H85A 3QF4A 1CJVC 4IJVA 4LA4A 2Y66A 4BWVA 4Q93A 3UTCA 4S05A 4KN5A 1XD2B 4OMFG 5AVYA 2WPDA 1WF3A 2IEYA 4WKGA 1JIQA 3IDAA 2X0NA 3I5YA 3UENA 1MG0A 5TV2A 3T52A 3DFIA 2UY1A 5KOYA 2H4ZA 4OHMA 1CQPA 5FR1A 1ODKA 4BS9A 5FOWA 4HTFA 2WHPB 4HQFA 1EM8B 3H3XA 4Z68A 2FLVA 3HGQA 2UVPB 4IEEA 1M0TA 3ZIAD 3X1WA 4DXHA 5JRDS 2H2IA 3LLUA 3HI4A 1Y8QB 3EFEA 2ZCUA 1BKYA 4WFIA 2BBSA 3F7NA 4MR7A 4BBZA 1WDTA 1H05A 4JQOA 1OREA 4Q4LA 5DNYB 2BRUA 3DTVB 4HDAA 3NONA 5BRJA 5MHTA 4TUYA 4ZCTA 3THXB 1EP2B 1VG0B 3UV3A 3QWIA 5LU8A 3OSZA 4IJMA 4C22A 1BCRA 3L1UA 4UREA 1GLVA 5CA0B 1NMZA 1P1RA 1E8OA 4P31A 3IE0A 2ZR9A 4TXMA 1KI8A 3I3NA 1QYXA 3QVLA 4LGYA 3R7WB 3KD3A 1C0LA 4AF8A 1NJ2A 2A1IA 3N2IA 5EIWA 2HR1A 3D6TB 3Q3VA 4PC3A 3SR0A 5LLTA 1UODA 3UOAB 4DVJA 4GMHA 4XWOA 3BCUA 3LT4A 1H2RS 3QXCA 4UBJA 3LLMA 1AA9A 3GVIA 1JDNA 1GG2A 4CM8B 3KSDO 5T6MA 2X2PA 4ANVA 2QQ5A 1U3VA 3AW8A 4WXYB 2QIPA 2EQAA 1KT1A 4FMDF 2PZGA 4ZTZB 1VLQA 1FDVA 2G1AA 3MKQA 1J39A 2X3UA 1J2TA 3OXFA 2A35A 4IDHA 1ZKDA 1JDPA 3VGJA 4JLWA 4WDRA 4YAIA 4JI0B 1YRLA 2VHVA 1LNZA 1L4NA 4MWOA 4EA9A 3IURA 4K86A 1KIMA 3DFMA 2XPCA 3E15A 4OHUA 1Y9AA 3QP9A 3OA0A 5F1KA 3RVQA 1R6UA 3NH6A 4NE9A 3N2KB 1EP3B 1CZLA 3D6NB 3B60A 3RADC 1IM8A 2VUUA 3FWKA 3PP8A 4BFYA 2QR3A 4J16C 1C4XA 1YE5A 1TTQB 1U2QA 1D1TA 3L9TA 4LGMA 3UUWA 2PUWA 1WCIB 3V46A 4F97A 2QI9C 3IDSA 3TRDA 3PGVA 4Q4JB 3PRKE 4OK5A 2QRHA 4BP9A 3HSYA 4DLZA 2P78A 5JHAA 2WWYA 5CFOA 3OZFA 2W8BB 2YYZA 1G8KA 1ZN2A 4D0SA 1XE3A 3Q6MA 1LVHA 1KEZA 4HLQB 1BZYA 4W5WA 3DB1A 4MWTA 1DJOA 1BWPA 3TXXA 2BUCA 3B7PA 2GNOA 3FN4A 1ECCA 3BKWA 2KZTA 2XITA 4IICA 1A17A 5C46F 5AJVB 3P19A 2QG4A 4LZZA 1TQ6A 1BI7B 1NVVR 1QQBA 2OZPA 4YX9A 1V16A 1MABA 1QHXA 2C04A 4GPEA 1ZWLA 2CNNA 3RFVA 3TL3A 2YQ8A 2QTZA 3GLIB 1AHPA 3D5EA 3OQNA 2AK3A 4KZ0A 1MX6A 3GRAA 3QSGA 2C82A 2H17A 1T0BA 1CJMA 2GRUA 3DOHA 3MMXA 3D7MA 3MQ4A 3ENQA 1Y1TA 3BC1A 5TPZA 2PKYX 3E84A 2GNAA 3L7CA 1B0AA 3FBWA 3OKPA 3WK6A 1BWRA 3H5RA 2VJDA 5FA8A 3ZDYB 1JH9A 3N6VA 4RD4A 2G1PA 5ALUA 1ZINA 2ZYDA 3PJGA 1LUAA 4OQXA 3T9EA 4AXBA 1RC1A 4IOJA 5CCLA 1BAPA 1UJRA 4RCZA 4X7RA 2HK8A 3A27A 2GUWA 1N8SA 3FPLA 1YUNA 5L3VA 3OBIA 4KB5A 4CVNA 3HC7A 3TW4A 3EXEB 4R69A 3T54A 4H15A 3SSMA 2IS2A 4PR0A 3L18A 5H59A 4ASUA 2IEAA 3GR6A 3DUWA 5DLDA 4HQRA 3EVDA 3U3WA 1O58A 4FSXA 2E9SA 1JQBA 2WNSA 2PUBA 1N5OX 2J5QA 4HX9A 1XD2A 4LEIA 5BOVA 5AM5A 3ASDA 2FNAA 4XVQA 1J0EA 1RM5A 5JECA 3GJ8A 4WZBE 4RTJA 4RPJA 5TE9A 1YS4A 4FYWA 4C1BA 1BHQ1 3DP7A 4LRYA 2Q5EA 2B20A 4N5QA 4GR9A 2QOEA 4EHFA 2WHPA 1H8HD 1EM8A 1RHQA 4CG2A 4EKGA 1PQUA 4N12A 4KSYA 2UVPA 4ABTA 3I5XA 4WZAB 2BFFB 3FWHA 2JH3A 1R6AA 3F6YA 2R1TB 3NBUA 2H51A 3X2EA 3OE7A 4P4NA 1Y8QA 3AVPA 2CB0A 3FKJA 1KI4A 1FU7A 3PTLA 3KUDA 2GVZC 3N8KA 5EJ5A 1QJCA 4OXXA 2XODA 3SY2A 2HCBA 4FFRA 4LHZA 2A0FA 4YJ2A 1N2GA 3BXOA 3DTVA 2FUCA 3ZR4B 1ZISA 2NZVG 2ZYGA 2OLJA 5FWXA 3CCBA 3THXA 3KRTA 4E22A 4QUHA 3WFJA 1S3SA 5DM4A 3TGLA 2QTHA 1G3UA 4R71A 2Z57A 1VXRA 4OLFA 5AK4A 2DYRE 1NI4B 1B1CA 3CUUA 3VPSA 2VC2B 2CLFB 1X8LA 2PV7A 5CA0A 3D9HA 4EX7A 3VX3A 3ZW3A 3G23A 5A7DB 3KT8A 3D9MA 3R7WA 3FUEA 1AM4D 3OXLA 4Y2UA 4OP3A 4ZVKA 3P2MA 5IASA 2VCYA 3DBLA 2XVYA 3IQZA 1DDOA 2PUVA 1JR2A 4V2IA 3O0TA 3I09A 4CM8A 3TG4A 4Y98A 4ZTBA 5EA2A 3E35A 3PQ6A 1RAEA 1FJHA 3TQFA 5KNDH 3SZGA 3I9MA 2V4HC 4UOQA 1N0HA 3LZDA 2I7VA 2QVCA 2RHWA 3AILA 4KEAA 3UM3A 1YZKA 4XI9A 4JYPA 2ZIZA 1VBKA 1SXJD 3SWWA 2OHOA 1EFVB 3F6CA 4G5GA 3ZS8A 4GKVA 1L4LA 3FU6A 1E6MA 4L0QA 1JIXA 1P0QA 4LRSB 3VDMA 2W6JA 3S2ZA 3ESDA 4G5QA 3NUZA 4J0CA 4KNWA 1EGVB 3UTDA 4IIEA 1ZI8A 3AW9A 3QHPA 4CTNA 4G1MB 2NTJA 3N2KA 1XTTA 2YIJA 4Z49A 3KXKA 2DTXA 1Y63A 3HVRA 1Q0LA 4PNHA 1XHFA 4QYSA 1KK1A 2Y9MB 1ZUHA 3BCRA 4L07A 4WDQA 4QOGA 4GA0A 2R86A 4TKUB 1EUDB 4KZCA 4JUDX 4PX2A 4U5QA 3UAGA 3RK0A 2C9OA 2WF6A 5C1IA 5JG7A 1INLA 1WCIA 4G41A 5IM4A 3KQQA 2R00C 4QT4A 4C7OB 3GA5A 1NX9A 2WMNB 4Q4JA 4ZICA 4FDUA 4IWXA 5DK4A 3BF8A 1L1EA 3VPGA 3L7DA 4YYEA 2W8BA 3QRWA 1HOXA 4FOLA 1SD5A 4FT4A 1XXLA 3OM1A 4TSFA 2ZIVB 2H2DA 5K8TA 3IQWA 2B36A 3D7LA 3RFTA 3AKDA 4DA0A 1XHEA 4MUAA 4N6OA 4ZAFA 2PKQO 1UANA 3KSQA 2GERA 1TYAE 2HXSA 5KWEA 3MA5A 5I4BA 2GESA 2TECE 1OYWA 3AY3A 1BU5A 1PWHA 3TQIA 4N0PA 3U09A 3Q0TA 2V6FA 3GLIA 1N0QA 1UAYA 4U7HA 4ARVA 5GTDA 3PPWA 1H42A 4X24A 1V5WA 1E2LA 1G8JA 2C95A 2OAGA 3VR5D 1U65A 3DWEX 5BXYA 1DDIA 2ACWA 4RORA 4KYVA 5T3UA 5JARA 4FVTA 4HY3A 1YQEA 5IJZA 3OCUA 1GKKA 3U2QA 1I8TA 3DE4X 5T4BA 2PDAA 4WE3A 1ZVJA 3TG2A 2XE4A 2OM6A 1GZ4A 2X5TA 3CJTA 1PFGA 3BGVA 3UHJA 3LIIA 3ZTYA 1L5RA 5GV7A 4GD3Q 3RC2A 3D6FA 4PWYA 4WV3A 4QRDA 2HSZA 2CLIB 2IUEA 1V25A 5EJ9A 5EMJA 3HN6A 3A3NA 4JYZA 1T0IA 5JDIC 1OR8A 2WOJA 5AI4A 3FROA 3EXEA 4FGLA 4N47A 1GSHA 4P7KA 3A4YA 2B25A 4CF5A 3K35A 2HJWA 2H6EA 3KXIA 3IE2A 2WFZA 3BM5A 1UXIA 1YZNA 2XUPA 1NN1A 4KDRA 2QN9A 2Q27A 3PC8A 3ZK9A 2I55A 1ZQ1A 5FNZA 3W3AH 2OR3A 2QM8A 2Z8YM 4XM2A 4Z4QA 3BH7A 1EWQA 3TRFA 3HXEA 2QTCA 2IW3A 5HFAA 1S96A 4MYUA 5A23A 3ZXPA 2WTMA 1WD7A 1JIIA 2CHQA 2ZCVA 3GP3A 2QTGA 1AS2A 1RQRA 5A02A 2PTGA 4LYGA 1RAAA 3GCWA 3GRKA 3C3BA 1Q0SA 2FSVA 3G2LA 3EDMA 1JR4A 5PNTA 2HB6A 2L69A 3ZGVA 4MWSA 2GO7A 5G04J 3CX8A 5F12A 3H97A 1YR1A 3PR2B 2PPLA 4WZAA 2BFFA 3EA0A 1XPRA 1GRVA 4YYZA 4C29A 1X1RA 3DBVO 4B32A 3V8EA 3JSAA 1RHUA 5KTMA 3OUUA 5JD5A 2FWAA 1II9A 1W3BA 2L0IA 3OAWA 1LLCA 2JEOA 5DASA 2ZIFA 2AG1A 2XD9A 2FB9A 2KQUA 4FNGA 3TR6A 4EZLA 3IT1A 3AO0B 4MX8A 3T4XA 3QWWA 3GQBB 1CS4C 3NOQA 3U17A 4YP1A 2YHUA 1SKMA 1M72A 3K70C 3ZY5A 4GRAA 3TOSA 4LF7B 3AR8A 2XX3A 5B37A 1O9GA 2D4HA 3N9IA 4MVWA 3B6MA 1NI4A 3PX7A 1Z8HA 5JZVA 4OM7A 1FFXB 3NOXA 1ATIA 3GAZA 4PBSA 4R2JA 4XWGA 4KHZA 1A5ZA 1M0SA 1SN7A 4N54A 4DNQA 3ORHA 4HAWA 4JLBA 4CIDA 3OCCA 2R17C 4LRUA 3H1EA 5ILQA 1Z4LA 2R62A 1JQDA 1ZGBA 2VP3A 2F37A 1N3YA 3ACCA 1VL1A 4F2PA 5JXGA 1T4DA 1L4YA 4BY6A 2YR0A 4QTYA 2OK8A 1GEEA 5CTJA 1MN6A 2OK7A 1I4TD 3WP1B 2OCAA 3VLEA 3NRBA 2PT7A 4HYEA 3HXQA 1DCQA 2NTEA 1R15A 1M73E 4D56A 4B3JA 3ESQA 1QLJA 3FCAA 1CVLA 2F43B 1WEKA 1E5TA 4YP9A 2XNJA 1EFVA 3IEUA 2DIWA 1E5VA 4GOMD 3B1KA 1JG4A 3BICA 2FMXA 2OV2A 3C48A 1T9BA 3EVAA 4MKGA 1KQNA 4JSYA 1J42A 5C7YA 5HJ2A 5BXQC 3SHOA 2GK4A 4CUZA 3WK9A 4BNJA 1AQJA 3AKCA 4MYDA 1BXZA 1WDLA 3JYQA 4FOSA 3PFIA 1XZQA 3SC3A 5CECB 4WW0A 3OLQA 4BUJA 4UQLA 3HB7A 1HMYA 3TW0A 3A6LA 3N07A 5EFZA 5IX8A 5BSMA 5KTRA 2ZUEA 3LCRA 2V7UA 4TKUA 4HLNA 1EUDA 3L0CA 2DUWA 5AARA 3TZ6A 2F59A 3EXFB 1GXSB 4KZPA 2PZLA 2E4UA 4TTQA 4C7OA 1THMA 4BV8A 3IR6A 4IRXA 4IF6A 5CTAA 4V1CB 5IANA 4H1WA 1QK3A 4BRZA 1T29A 1TU0A 2A14A 5M3BA 5K1ZA 3H17A 4QLAA 1KI2A 4B80A 2FSIA 4PCAA 2FPXA 5GGXA 3CF0A 3I28A 3JQBA 4MW9A 1NC1A 5DHPA 1OZAA 5LLSA 3KE8A 1NP7A 4GLLA 1SG9A 1VCNA 4COKA 1PHPA 3AL2A 2OD9A 2A2ZA 4GBGA 1VSQA 5BVGB 5I7RA 4MWCA 5JHGB 1OXJA 3VR4D 1OX4B 1AC5A 4BAGA 1M2FA 1R3DA 4CRWB 4LDRA 1JN0A 3TNLA 4MINA 3JQ6A 1XP5A 3FNBA 3HHMA 2DM6A 1QU2A 4EBAA 2ATCA 4RV5A 4OQDA 3NBZC 2DKFA 3GMDA 1XMIA 2Z0MA 2IPAB 3PT5A 2H29A 4KX3A 3JD1A 1SQ6A 1J0BA 2NMVA 3TSZA 1PU2A 3MOIA 3HP4A 1Y8MA 1XZCA 1WCWA 2QRQA 3GI1A 3EGIA 3O1LA 4Z1MD 4DJFC 4QRIA 5GZ6A 3U7JA 4MUEA 2WXQA 4ZCSA 3J81k 1HNZB 2Q3MA 3P9XA 4PZDA 2EHJA 3DQPA 3HN7A 3O2SB 5JI3E 3FA2A 5MF6A 4N6NA 3AEKA 2QD2A 1XAJA 5KKAA 4MV7A 1E66A 1OA1A 1A5BB 3JATB 5CAEA 2YNMD 2ZM6B 4YDEA 4FZ3A 3QIAA 4C0SA 2QROA 4FC8A 4PO9A 4EPVA 2I6TA 3AMVA 4J76A 3H9QA 3FMOB 1XU7A 2VWHA 3PF9A 3C7CB 4OD0A 4Z2YA 4N0QA 4Y30A 5D3MB 2BMDA 4ZDKA 4RTNA 1GPYA 5ARBA 4GA2A 2WIJA 4DX6D 3M5DA 4M98A 3URMA 4HQOA 3VC7A 3OZUA 1U2GA 1BMQA 5HQJA 1V8ZA 3NBFA 3QLVC 4HNAB 3Q6NA 4M7RA 1HTWA 2G8LA 2HLDA 5CEFA 5JD3A 4FGUA 3KO8A 4LMRA 1CB7A 2OY0A 2VZ0A 4JB8P 2X5JO 1Z12A 5BWBA 1AKEA 1CR6A 1VI2A 3ZD9A 4C9BA 3A1FA 3ZDZB 3EMVA 2XLBA 3HVEB 2O48X 2W4QA 5DXFA 4C6TB 3ETNA 3E32A 2BKUA 1WVIA 3DJFA 4ZWNA 1G9TA 1FEZA 4UDYX 1JEEA 3E5HA 2WXFA 3WLKX 1VGQA 3RKRA 3W5SA 1SIBE 1P74A 2VF8A 4DHWA 3APDA 4KPGA 5TEVA 3QVXA 4WCDA 2QE7A 1HZZC 4H4EA 2XI4A 3H87A 4HH4A 4KXQA 1QDLB 1MZPA 1DRJA 3OPQA 3P9QA 3IQFA 3SR4A 4FI3C 2IOLA 4CKCA 4TRJA 2GNPA 3GQBA 4Q1EA 3U4HA 4FLHA 4UBOA 4HRVA 4ARZB 2QLLA 3DZKA 4CEJB 2R7AA 2J9QA 1E2KA 4DUGD 4DWOA 2YMLA 1NBOA 4NU8X 1II8B 4KMOA 2Z3WA 3ZQ6A 5HJ5A 1IY1A 3KU4A 5DWQA 1NUSA 4KTTE 1FFXA 2OENG 4V0ME 1XEAA 2FMFA 2P40A 1O5IA 3LCUA 4CCYA 4CL8A 3KETA 4IJUA 3W7BA 2KM4A 4H27A 1ZIYA 1FVOA 2GZHA 4YMSA 4ARIA 1LD3A 4UI9C 3FF4A 5AIJA 3BL6A 1THZA 1DUVG 1Z33A 3UWOA 3MB8A 2O8BB 10MHA 3Q2OA 3RS4A 1UZAA 2X2FA 3CJQA 2Z1MA 5LJLA 5KC9A 4RENA 1V6CA 3QVUA 3LF1A 2F43A 1B8PA 2IH5A 1UMKA 4JA0A 1XCJA 5JWRA 4C43A 2XCBA 1NQVA 1XD9A 2HM7A 3A2NA 1UWLA 3MOSA 5H80A 4YFVA 3ITDA 1TT7A 4NATA 1RRCA 3SVLA 1NNUA 3AIKA 5YASA 3ONLA 4KFSA 3H1PA 5LYYA 1W4CA 2VP0A 3D9JA 1HNWB 3TZEA 1T9GS 1P4JA 5CPFA 2B7BA 4HTAA 2D1FA 1FRQA 1JCSA 1GRNA 1Z7WA 1JZQA 1M76A 3B1YA 1NVFA 4E3WA 4Y2YA 4TTAA 3WYCA 2Z8XA 4B3XA 3EXFA 3PEVB 1YQGA 1Q3TA 1GXSA 3EUFA 3NGXA 4DQ0A 3K0AB 2X6IA 5D1HA 5JH7B 4F04A 1RE1A 1E6LA 2FFGA 1P39A 1MF7A 4YMLA 3VFDA 3SI5A 5AW4A 4JX8A 3O26A 3QSYA 3LWZA 5IXYA 3IMEA 2I6GA 1MA3A 4PS8A 2H4XA 1I3OA 4RF3A 1TZCA 4IZOA 1W9MA 4OXYA 1U9ZA 4AJKA 3HG0D 3LVRE 1FUYB 4W1SA 5GM1A 4XKCA 5GONB 2XTMA 4C0XA 4II7A 1PE0A 4KO2S 3LY8A 3NMUF 3X2SA 2NZWA 1OX4A 2AW5A 4MKRA 5B36A 1PZNA 3PU6A 5AOVA 4L5AA 3JSXA 5JE8A 3CZMA 1T1JA 1CUGA 2Z8YA 3I72A 3P8ZA 1SZPA 2VZEA 4N7MA 4B2LA 3NOCD 2PK3A 1AQIA 2NP6A 1W0JA 4EGCB 4XFJA 2Y0DA 1UFOA 3QENA 4BO7A 3B8HA 1MW8X 3U16A 5CYGA 2V58A 3TYXA 1S6YA 3PWTA 4WLEA 2PRIA 4BERA 4TXRA 1XMPA 4LJ9A 1RWNA 1FBNA 5BQXA 1EDEA 3C39A 5ECYA 3UINC 2XA1A 1E9SA 4QDTA 5SZHB 5DTJA 3LWNA 4YRZA 3THOA 4JC8A 5JR3A 1I51A 3JATA 5TX7A 1RWPA 1QNFA 1P5FA 1OTYA 2H6HA 2XCOA 1W5EA 3D2BA 2Z4RA 1CUZA 4FHJA 3E3NA 4E4RA 2P6RA 5I45A 1I4OA 3QTTA 1V9SA 4JROA 5AW2A 3QMPA 3V1UA 5FA6A 3L77A 2QSYA 2WZCA 2K5UA 4EUEA 1DE0A 3CCCA 3FB4A 1FRZA 2QMYA 4EENA 4PQEA 5IKEA 5HKKA 4HEA6 3UGQA 2R85A 2H1OA 4HNAA 3JS5A 1WB9A 4AZWA 2F4NA 3TTVA 4BNMA 4WCFC 4ZT7A 2B1QA 2F62A 3HDHA 4ID9A 4UVHA 3L08A 4Z7QB 2JLYA 1NW5A 3E9NA 4K9LA 3P7MA 4CMEC 4K2HA 2RH8A 3A1SA 1O3YA 1WXQA 1NF9A 3HVEA 4UBIA 1RZ4A 1FDOA 4C6TA 2P6PA 2A5UA 4FB5A 5CD9A 1ZJ5A 1DHTA 2MMCA 3RIBA 1W7AA 3GL9A 1LLDA 1FMJA 4CLHA 4K9KA 4GKKB 3LP6A 1J23A 1FIUA 3G2KA 3WNCA 3A6JA 3J7AC 5JMND 4EECA 4IUDS 3IPLA 1D9ZA 1XMVA 2VAPA 1NM5A 4CR7A 3WWEA 4BVEA 4CEJA 2ATEA 4ERNA 5B64A 4Q34A 4HB4A 4OB8A 3DXYA 1RJDA 3SFVA 3KK0A 5CA0F 1II8A 5BXOA 3ZUPA 4OBXA 1X74A 2BISA 3MMSA 4PLHA 1L5VA 3AOGA 2DULA 2WFMA 4R8SA 3H4VA 1EZZA 3KEAA 3EYAA 1D2GA 4NMHA 5DV9A 3MVEA 3GT3A 2IYOA 3ZGLA 1AP7A 1QFYA 1KRWA 1U4NA 3KUXA 2A1TR 1K27A 3WNVA 5E2BA 4URHA 3JRWA 3WBBA 3B5IA 1HDYA 3EH1A 2O8BA 1IPFA 4B40A 4YA6A 3G2TA 3KR0A 4ETIA 1MDBA 1LS1A 3VQTA 3CH5A 5C9ZA 3VJKA 1LU9A 4ALJA 4EHDA 3OCYA 3WYAA 2NQ8A 3H2YA 4L8VA 5H82A 4BU0A 4OFXA 6LDHA 1KVQA 1HZJA 1E2HA 3WRXC 2B99A 3DAYA 3E2MA 3SMQA 2BOVA 3JQRA 3EPHA 4PFQA 2HEGA 5LBIA 4S24A 3KD2A 3L2OB 1F51E 4ATNA 4P3KA 3N05A 2DB3A 3KOOA 2DY1A 2PUHA 5FL7A 5JMTA 4RJJA 4BQOA 2IEDA 4AQ7A 3K1AA 3RIGA 4E85A 3CWCA 5DRYA 4AK9A 3AVVA 2CXUA 3BSYA 4FFNA 3DH0A 2D2FA 1UFVA 2AQKA 4L72A 5MDHA 4X97A 1FRNA 1E5DA 2NX2A 3PEVA 3K0AA 4FHGA 2PPVA 1LGYA 5JH7A 2H4JA 2WRZA 4U7PB 1MZCA 4NQRA 1PR9A 4CI9A 3ADDA 1KJ8A 3FYCA 3ZNPA 5CFPA 1PSZA 5KWJA 1S7GA 1TGYA 1RVDA 2WJYA 5G4KB 3EHQA 2PMDA 3OSUA 4KQXA 1UL1X 4CI0B 1IIBA 2QMEA 2X7XA 2XB8A 1SA0B 1TMOA 2Z09A 3SLKA 5JCJD 5HE9A 4RAOA 1PJTA 2JCBA 4EFLA 1VMIA 2IHBA 1H2HA 5GONA 4LCBA 2C3OA 3DFZA 4V1CI 2VQDA 1U11A 2HSGA 4XEIG 2PQMA 4HRLA 4MBGA 2ZGVA 4F45A 3CKBA 4L2LA 2YJ5A 2C0MA 3H8VA 1CY7A 5K8LA 2FZGA 3KHTA 1XBTA 5C81A 2W2MA 3TNDA 2FV8A 4R9SA 4UU8A 3HDJA 5BV8A 2VUIB 1YMUA 2IF0A 3NB0A 4JI6B 1ZRSA 3P96A 1I6LA 1WWKA 4L27A 4G5SA 5JAHA 1CXZA 2VNAA 2VHTA 3I0NA 1N52A 1P2VA 2OE2A 3F5SA 4HFNA 1NUQA 4AP2A 5I5EA 4KPYA 1T9DA 2QYOA 3TTUA 1UOHA 4EEXA 5ESWA 1G8YA 1NXWA 3PHHA 4MV3A 3EULA 4OJTA 3OXGA 5H70A 4JJEA 2QGZA 1BHJA 3FZEA 1NW4A 3SOPA 1V3VA 3IS3A 1J00A 3DKIA 3H3FA 5A9TA 4DPLA 4UMDA 3GZTB 3P9IA 1E2PA 5CEJA 2WPNA 6Q21A 3E8MA 3KJHA 2OP1A 5DTMA 4Q24A 2Z4SA 2JAHA 2IYNA 4RLQA 4ECAA 2H7YA 3I76A 1QIKA 2RJOA 4KFRA 3ELWA 4DUZB 3WR5A 5EXXA 2VQSA 2Y4TA 2QN8A 2WIFA 2FEMA 5E6RB 4I8IA 2C0CA 3RIMA 3LHIA 4AMYA 3K6SB 3G89A 3VC1A 4ARCA 2V0NA 4Z4GA 2ABWA 1AMUA 2JGEA 2WD9A 1N1MA 2C0QA 3BRSA 1IZ9A 1FA9A 1ORTA 4GPZA 4BNHA 2VF4X 3QPDA 1AKTA 4HWGA 4KBYA 4P3NA 1LKZA 3GLFE 1C0EA 2QDKA 4UPVA 3GJSA 3WQSB 2XEHA 2BGMA 4IVPA 2FE4A 3EUAA 3DKPA 4KFUA 4LHVA 2QVLA 2X4DA 1JAHA 2QSJA 1QE5A 2P69A 2JAOA 3OBBA 4PRKA 3GFSA 4AM8A 1O97C 1IBCA 4LHEA 4F60A 2VO1A 3AY0A 2MSKA 1JLLB 4LHWA 5BR4A 1GTRA 1FPQA 3TE7A 2HRZA 1JQAA 5F2EA 3P27A 3BRWA 4YS6A 4JYCA 3B51X 3CJRA 3EN0A 4FULA 1DKMA 3QMWA 4X7MA 2A9VA 1ZI6A 1YH3A 1TNBA 5DULA 3CK9A 1FSPA 5IN4A 3CVWA 2D2EA 3P26A 5F5LA 2PNFA 3F49S 1BXKA 3T7EA 4R1QA 4PGAA 2J4BA 4HNHA 3ONDA 3GBPA 4C4XA 3RK1A 3RPEA 3K71B 2HA5A 2C1EA 3RYTC 3MMNA 4EHBA 3SGHA 1U9CA 1SW6A 2ZT6A 3PDIB 3HM2A 3V5NA 1SRRA 5JCXA 1YQDA 3IODA 3SSOA 4QFMA 2LSVA 3NNSA 5K3BA 4ZYVA 4ADSG 5LU9A 2XWPA 4DR7B 2WKWA 5E9WA 1VL8A 5FPQA 1N6RA 4MZXA 3KKZA 2KMLA 4JJAA 3PUIA 5C1DA 1UQUA 2IXEA 3DWGA 3NVAA 1NVAA 3R6GA 4D8TA 3WWOA 4QDJA 2QORA 4U7TB 2CFSA 4MW0A 2QLBA 3RIXA 4I5GA 5H68A 1JU3A 1UJBA 4LXHA 3JQDA 2GPBA 3PQCA 3L79A 2PKRA 1YRWA 1BDHA 2I67A 4LZPA 3GJ4A 5KB3A 1S89A 5TMBA 5EDSA 1F4LA 3GO4A 2Z6VA 2P9IG 4D9KA 1JPJA 1I7LA 3UT0A 3BSFA 3UMGA 4FT2A 4I1PA 4IW3B 1X94A 1ZCBA 1I94B 4ZEMA 2KJQA 3RO2A 2J6HA 3QLUA 5TF4A 2VQEB 4YMUA 2KLHA 4IG9A 2J6BA 3UM0A 4W82A 4H0CA 3FPJA 4Q7MB 2C96A 3GUHA 2ZLBA 3TCNA 1FMTA 3AHIA 4ZHSA 2BF4A 3L40A 4P9NA 4GPIB 4G1UC 3CZRA 3OMXA 5HX7A 5EJIA 3JCZA 4ZVLA 4BQSA 4TSKA 3IBCA 1XRMA 3JYLA 4N7JA 1SA0A 1JBEA 4GC9A 1WBBA 4RZIA 1R9NA 4EPZA 1E2GA 1OXKB 4JVLA 4EBBA 2AB0A 2H3EA 5HF9A 1UAGA 5G41A 2OCIA 4QU8A 3E8XA 1AT1A 2E55A 3COZA 3MWKA 3A9CA 3UA3A 4CTOA 1NVTA 2EL9A 5FV4A 5HYVA 3VNUA 3V00A 4GA1A 3ZH9B 1TCVA 2VDMB 3A9UA 5B3KA 4R98A 3Q15A 5KQLA 5JO0A 5CLFA 4QYXA 3WFIA 1T91A 3W1VA 1SCIA 2H48A 1OI4A 4E12A 2ZUDA 4QFBA 2GJ4A 5D84A 5B2EA 3PXGA 1ACMA 3J5QB 3CX4A 3ZWXA 1MUUA 4WOKA 2IGBA 5DLYA 3PUHA 1PEDA 1Y9JA 1HG0A 1JG6A 1ISHA 4ZQCB 3B7GA 2EKLA 4ZO7A 4TWBA 5A71A 2W6ZA 2IYAA 1JHAA 3UGTA 3RS8A 1X70A 2JIPA 3KLBA 5IDVA 1XOIA 3U7FB 1RI3A 3SPXA 1F48A 2YWFA 3RSQA 4PDXA 5G0TA 2I91A 5FLEX 2VRWA 4YNBA 4MUXA 1CZUA 2J5XA 3UAWA 5D0OD 1QTIA 2CNLA 4NFHA 2GR9A 4NU0A 3KEZA 1QDUA 4AMVA 4B33A 3DCYA 2WKRA 4Q69A 1PTJC 4PAWA 1CZHA 3R7QA 3H2ZA 1LWNA 5E6RA 1DSSG 5KYVA 1CUIA 3H1BA 2P4UA 2EILE 5LQRA 3L5KA 1PAQA 4LJ7A 1KU6A 3DM5A 2FEZA 4NQZA 3OHSX 2NYVA 4V02A 2FJDB 3QUBA 3FKQA 2FRDC 4C4ZA 3QVGA 1YAJA 3MG9A 5MGNA 3P0EA 4A23A 1S01A 3E03A 3IQGX 1K8YB 3G2IA 1NR1A 4MYTA 4JC4A 2I4RA 1A71A 2WXJA 4Y6PA 3GBVA 4QA9A 4W99A 4RFLA 4MR9A 3H5WA 2JFXA 1R8YA 2YS7A 5L51A 4DIOA 4F0JA 4MI9A 1X1TA 1KZ1A 2XECA 3CKCA 4EI8A 1W30A 1GPKA 5ES4B 4ALMA 3LK6A 1JCQA 1JLLA 3PEEA 4O29A 2Q62A 2PGAA 2X3YA 2RJNA 5K8JB 3OZAA 3GEBA 4D3XA 3NG1A 4D79A 4YXWD 2I54A 1PW5A 5TGTA 2ZG6A 1SU4A 1PVOA 3LQQA 4A6DA 5EIBE 5B3JA 4GGOA 1CQIB 3P97A 1TUIA 1DWPA 4RM2A 4L6IA 4XB1A 5IF3A 2NPFA 3CZ9A 2DF8A 3RLIA 1Y81A 2W4IA 2QM0A 3R8XA 2C4UA 1DQZA 3PDIA 2ID7A 4KV7A 3M82A 3KPJA 1JDZA 5IAJA 4GMKA 2VDUE 3TNYA 3TM4A 2H5LA 3CW2A 4JP8A 5BSGA 1SH7A 4N03A 1RCUA 3T7CA 1RMQA 4YWJA 1D0SA 4E09A 3SIXA 5JZOA 2Q3JA 2Y68A 2CHUA 3VO1A 3O93A 1H6OA 3MCUA 2DQYA 4OYRA 1RYDA 1XZEA 1VL2A 3TIIA 4CQJA 2ZT7A 3SIWA 1J70A 1M8GA 2CSXA 3ETHA 5B6JA 2YYAA 1ZUNB 3VAYA 2WAYA 3OF5A 5CXQA 4KE8A 2CJYA 3HACA 4FCCA 2R3SA 2HPVA 4O0LA 2HK6A 2HPZA 1UBLS 2I78A 3ZYKA 1QGYA 2IS6A 3WB0A 2WMYA 2R6JA 4L57A 4B76A 3GT7A 2AUNA 2JJ8A 3RODA 2GHQA 4HI9A 1B16A 2VJPA 3OEEA 4J2HA 1I4DD 3V2UA 4YRNA 4BBAA 5CCEA 4CPDA 1LWOA 4BTAA 4LJRA 3VSBA 2ZUVA 4PWZA 3COVA 2AX4A 1BDIA 1ODTC 3MJSA 5EE9A 1LJUA 5CVTA 4LEUA 1TJ5A 2VYND 4L7QA 4QEZA 1ISRA 2D74A 2Q3LA 4GYKA 1CRPA 1RKXA 3I9LA 3C16C 4D3DA 4RK6A 5BMOA 2YFHA 4J9UE 1C3JA 1G291 1HE4A 1YZFA 1ZHFA 3T0FA 3EJ6A 4K3UA 3UMRA 3FUFA 4DI4A 2XKJE 4QGHA 2PUGA 2TYSB 5E0KB 2XUFA 3VH1A 5EQJB 4ILIA 2PLAA 3TSAA 2G36A 5FTMA 3EE6A 2W9XA 4R3NA 1TKRA 4BNKA 4NJMB 1RPTA 4RL4A 2YV5A 2YXBA 2JFFA 3F67A 4QAQA 2KE5A 1ZSYA 4G0UA 5EHZA 1GCGA 2BW0A 3U7GA 4R1NA 1RM0A 3N2GB 4KIGA 4HJRA 4D8VA 1MB9A 4LRTB 4UUNA 3FTWA 3QWAA 2Z6QA 1ZR2A 4LWZA 3DCNA 3DTYA 2VF7A 1VA4A 4LYAA 1QFXA 4RETA 3SOZA 3AHDA 2AUTA 3IB3A 1ISFA 3FYDA 3LC2O 2CHGA 1ZGJA 4GLFA 2R4UA 3K0SA 5CVUA 2N46A 1VBMA 5IT9A 3RFCA 3IAXA 1NTOA 1WV1A 3UHAA 1STOA 2JFBA 1YZTA 4PG5A 4AS2A 2WKSA 3ICWA 4R8KA 1VDZA 3AU4A 5AYVA 1PR4A 1LK0A 1LY1A 3EUWA 3IAEA 4TTSA 1U3TA 1HXHA 4MTCA 3UX4A 1K3ZD 3FU3A 1DINA 2MR6A 1QIHA 2R6CA 3CCFA 4OHKA 1EVZA 2Z2KA 3KKMA 2RI6A 5KJKA 1RSZA 5FZSA 4HZGA 4AMUA 2GHRA 4UEWA 3TSWA 1CHNA 4C48B 4LFCB 2WYWA 3P4YA 4LI0A 2B2CA 4WZBB 4HXEB 5DP2A 4RDHA 2G67A 4TYYA 1X7DA 2HMWA 4J0GA 4DCOA 5J3JA 1L4EA 4B87A 4AX4A 3SJAA 5HS0A 4OAQA 4L4RA 1TPZA 4MUHA 4J2TA 5E9JA 3NX4A 2MYUA 1YQXA 3ZEIA 5JJ7A 3AEQB 3FVTA 3NGMA 3DAFA 4L23A 2ENWA 1CBUA 1YTUA 3W4JA 4YHHB 1KZYC 1M6WA 3MCZA 4FHCA 3I23A 1NJ8A 3TMKA 3OCWA 2NUBA 2DZNA 1WZNA 3FXAA 5DGCA 1G5FA 3GYBA 3RV3A 2Q45A 1TD9A 3WHIA 4HWPA 4MV6A 2XQGA 1CNFA 1KIAA 2P30A 1WV0A 2WVIA 3GJRA 4QG7A 3DZCA 1KGSA 3G6WA 4QTZA 1CQIA 4I81A 3ZDBA 4XGRA 4YMGA 1KNQA 3EFHA 2BSXA 1QV7A 4RPLA 5IMBA 3TKLA 1T8RA 4OHVA 1XFDA 5F9MA 3MD9A 5HUHA 1QYRA 3OMWA 2XGGA 3L7BA 2I87A 3SX4A 4G4SP 1GJRA 4WN3A 3RYCB 3AYXB 1N8NA 3S2EA 2YN2A 1DC6A 3JZFA 3W8FA 4Q3BA 3JXJA 1L7EA 1T13A 2WTEA 2WXGA 4FQ7A 4D57A 4XW2A 4DAEA 2E5LB 3KCQA 1T2NA 2ERCA 2ZUCA 2PBRA 1R16A 1M10A 1U8YA 2NAPA 4FGZA 3ZLJA 1KP3A 4E5NA 1DCTA 4OX9B 1CY6A 1EAMA 4FEEA 5HOEA 3II6X 4M1MA 1ZUNA 1CVRA 3LHDA 3WS7A 1H93A 2WPDD 1EH5A 3B5JA 2VEOA 5GJBA 1D03A 1XF9A 5EZSA 2IQ5A 4KH0A 5A2GA 4QSHA 3DAGA 3IUBA 1Z63A 3VKGA 5JH7F 1CQXA 2X2EA 3M5PA 1XZFA 4EA6A 4TX1A 3GJYA 4RTLA 2HN9A 5LIRA 1Y6IA 4JKIA 3QXSA 1M6NA 3GJ5A 3ZN3A 3WRYC 3RFXA 4BX0A 1I1NA 1GTSA 4MS3B 1U2RA 2ZJBA 3BAFA 4IV5A 1E92A 3G5MA 3ZWAA 1GU7A 2Q2QA 4EB8A 2C03A 4O6FA 1OWNA 3ZWCA 1HXIA 4P7GA 5FDFA 1A95A 2UYHA 1VE3A 1E61A 2Q3CA 4LCTA 4XE0A 1GUBA 5GONF 2FFHA 2WINI 4BJ6A 3H86A 2JFWA 2CZQA 2AC4A 1E7VA 4R7ZA 4NESA 1NWCA 4FZRA 2EWVA 4RZUA 1BMTA 2QLFA 2BKEA 2H1LA 1XMSA 2ILTA 2Y0BA 4RPHA 1U1CA 3ZCPA 4K8RB 4ZCPA 5K6RA 4OL9A 4N49A 1Q0RA 1GDDA 221PA 3NTQA 3D1LA 1S8OA 4FLMA 4JR1A 1LK7A 2YRFA 2HK9A 1NF3A 1ODJA 4Q7QA 1UP4A 4JDUA 2ROQA 4MGKR 4NNPA 5I7AA 2J85A 1LRKA 4HS4A 2UXCB 3N2GA 3OJEA 1LPAB 2G4VA 1QE3A 3PLNA 4GTPA 1P1HA 4E4TA 3X1MA 4WECA 4BRWA 3BMNB 3MT0A 1LI4A 1JDUA 1U3UA 2AV6A 2PA0A 4BMCA 1QPBA 2BKAA 1Z35A 3BD6A 4B73A 3H6GA 3F4BA 1NNEA 5JCOA 3IQXA 4MAAA 4CNQA 2OV8A 3LKUA 2P3OA 2R1TA 1OF1A 3UB4A 2QPAA 4BWYA 3CR3C 1ZJJA 3HY3A 2EGHA 2XNSA 3DSUA 5IYZB 3BMCB 4E21A 1WXDA 1CU1A 1YVEI 4YN3A 4JMPA 3IR7A 4IZHA 4L2IB 9LDTA 3HWSA 2HJ9A 4QGFA 1Q5PA 1RTKA 1J0CA 1RQ7A 5KQRA 4J8EA 2PGLA 4WASA 3GFVA 1N0RA 5SZJA 3O90A 4HVAA 4WZBA 4A63B 2NVBA 3AI1A 5EAIA 1ZVKA 2WOOA 4B6QA 4TWIA 5DCUA 3G2MA 2BVNA 3I2YX 4B4DA 5IC5A 5A3QA 4UAVA 1L1FA 2GKOA 1R8XA 1L8XA 5DTRA 1V2GA 3CKLA 1AKMA 1P9RA 1BWQA 3AEQA 4MPTA 2NZUG 4UDXX 1BGWA 1VI5A 2XZDA 3GVCA 4NEHB 3EEQA 5ALQA 4QPZA 1ZMRA 2O3RA 3PDUA 2A5YB 2O0KA 5FWNA 3GFRA 1QF6A 3UF0A 2P3SA 2VG8A 3RF6A 2CHWA 4IUCS 2HOQA 3A25A 2BM0A 1RXVA 5CCDA 1IVYA 1EBBA 4TL9A 2J0EA 1K6MA 4PS1A 4WWPA 1ZXXA 2OORC 3U9SA 5TPZD 1Z28A 1EJ2A 2G1JA 3IXEA 2PZMA 3T0IA 5I9LA 1U6KA 4JZYA 5IZ4A 1J9ZA 4UM9D 1BE8A 4DMCA 4BMDA 4V0LA 1EE9A 5EGNA 1GPWB 3N1UA 1VQ1A 3D4OA 3GNTA 2EFYA 2ES4A 3DVQX 1I0ZA 5EZYF 4F2HA 3VMMA 4C01A 5FOVA 1WSAA 3AJAA 2SKCA 3KC2A 5C1BA 1Y8CA 2JFHA 2D54A 3U5ZB 2X4IA 1Z17A 5BSHA 4W5HA 4TXHA 1JVSA 3CW9A 1NRXA 4V3BA 1NF8A 3QKYA 1RBQA 4MUJA 4ZGGA 1KZGB 1B0ZA 3L9WA 3HJUA 1U8FO 2AIRA 4B47A 5FL3A 1I3CA 1QCZA 2WMNA 3N71A 4J1SA 1PFWA 4B44A 1Y42X 4ASUD 1JBQA 4R2IA 3CRMA 2CYCA 2ZRHA 3TK1A 4MP3A 2EQBA 3BVPA 3D0QA 4QRHA 2ID9A 4TLCA 1SXJC 3RS9A 3OU2A 2C59A 4JUCA 3R0ZA 3LGXA 3G0HA 3CRNA 3SBDA 3WWYA 3OZEA 5L40A 5ES3A 1NBHA 3Q0EA 1WTCA 2XMRA 2PL1A 4ZD6A 2RH4A 4ESHA 3O8CA 3B78A 4MS3A 2NV0A 4RD1A 3OE7D 5BVHB 3Q85A 4CCSA 3LQKA 4EJ0A 2PGIA 2Q5OA 4QJ5A 1W73A 1KOLA 3TX6A 2VUHB 4D3FA 5JZ9A 3ZXXA 2NVWA 3KKOA 1KPHA 4YUVA 2ZJ4A 3R5HA 1H65A 3TX2A 3E6AA 2R5SA 5F2OA 2V7VA 3E1KA 3DTVD 5ICSA 2WG1A 3TVTA 2FOIA 1DARA 2DBZA 2KHZA 5JBQA 3W77A 4NCBA 3VH3A 4CZ2A 1H23A 2A4KA 3PNQA 5B7QA 1H22A 4LJYA 6AT1A 4I17A 1RXSA 3NJ8A 5DN6A 1I0LA 4LUNU 3SQVA 3NIGB 4N9WA 2Q7DA 3AB3A 4LOAA 4DUIA 1DOHA 4G0MA 3SICE 1UP6A 5CPBA 5CXXA 1ADJA 3DWFA 1PBNA 2Z04A 5BNIA 1KP2A 4U0KA 2DTEA 3R23A 3IIEA 3M6XA 1LDBA 4D9MA 2WIAA 4NS1A 5FINA 5LA6B 3R6DA 4HN4B 5CNKA 3H2BA 2A92A 4MI3A 4O08A 3U37A 4TT8A 1B23P 3KKNA 3B6EA 1WPRA 3BMNA 1NAIA 4WESB 2J3QA 1OT8A 2RCNA 3GPDG 3IBSA 3K2IA 1RR6A 3KZKA 1CP3A 5JEDA 2AN9A 4N5LA 4ND6A 3RU7A 5F1OA 2W6JD 5K05A 5LQDA 3Q8KA 5LP0A 5JALA 3MA0A 4A1OA 4FKBA 1M1YE 1EDUA 2DBQA 2ZYTX 5IYZA 1Z29A 3BMCA 4MK4A 4DGSA 3LX8A 3TI7A 3BBLA 4OP2A 4LOIA 2Q5HA 4CIAA 2DCMA 4AY4A 2FR8A 1SB9A 1XKQA 1CWUA 1JSCA 3DZGA 4YXFA 4ONEA 4JLUA 4Y2RA 3FOEC 4BLOA 2YIVX 1CUFA 1TZKA 3B38A 1JXAA 1U2VG 2IU3A 1JTVA 3DS8A 3ZWVA 4L76A 5AAOA 3H5OA 1Y5MA 3TM5A 2H4YA 5CDFE 1Z08A 3ZEFA 3OLYA 3QBDA 4D9GA 3UMJA 1HE1C 4TSFD 3FJYA 5EP1A 3GN2A 4KPFC 1YI1A 1L7PA 2R87A 2Q1SA 3R77A 4UW9A 1GR1A 3UXMA 3Q79A 4JOBA 1Z2AA 4X90A 1HX7A 2RHTA 1MT0A 2CXOA 2G71A 3J7TA 1HKHA 1YCGA 4Q02A 1S3FA 1IBLB 1Z22A 5TGDA 1KJZA 2XH8A 3ENWA 5L9AA 2O3QA 2QTLA 2RC5A 4YH1A 3PUZA 1QVRA 4FA6A 2IXAA 4E5DA 4F53A 3KOUA 2AC7A 4LGVA 3QJYA 3HDTA 3ZDAA 4KQHA 1W9HA 3ZGNA 3QXJA 2PSSA 3ENKA 1EF1C 1OT3A 1IJFA 4A8JB 3OWOA 2WI8A 1Z39A 1F6BA 3NF1A 4QULA 4A8TA 2VH1A 4HG2A 2ZW9A 2UXDB 1MX4A 1NA3A 3D4NA 3DE3X 5I01A 3M2TA 1YMVA 3V9PA 1D6SA 4WFKA 2TMGA 3AP1A 3FFTA 2FPWA 3D3KA 2GSWA 4I4TB 4BQPA 3BG5A 1TL7C 4MULA 1DLJA 2CXTA 1CETA 1QRSA 4TXLA 5D3KA 5LZ8A 1RPAA 1NR5A 4UEKA 4YRJA 1ND5A 2XEVA 4R3WA 3RVKA 3W9GA 4V1CA 3I5PA 2FWIA 1QYIA 4F21A 4L4SA 1WCYA 1XKLA 3NJ4A 4R6WA 2H6FA 4XJVA 3NS7A 4CIYA 4LPSA 5H81A 2ZITA 1W5FA 2XLCA 4RY2A 2OFFA 4MEJA 3ZH2A 4DX5D 3IXMA 3T3PB 4LF5B 4IWNA 4DNXA 5DT9A 2C2LA 4URKA 4AU1A 3GGGA 1WABA 1F7VA 1TW2A 2V3WA 1VJTA 5JXJA 2WTUA 3G8AA 4ALKA 3VKHA 3WAKA 3WY9A 5BVGA 3PPYA 3CH6A 1JNYA 2Q28A 5JIBA 2A9PA 2W11A 2P2CP 2HYZA 4DKXA 3MS4A 2UWJG 5CNMA 4CRWA 3GGCA 4TLMB 1CUBA 1N7IA 4D43A 2HMVA 4LDAA 5AENA 5BVHA 4NMXB 2DFTA 3B36A 1MEOA 4GVLA 2Q2WA 1XPOA 3QPUA 2VDVE 2AQHA 4BVKA 1QK5A 5ED0A 3VTYA 4Q4CA 2ECOA 2FZ4A 3ZCQA 3CNQS 5FOXA 2V4MA 4NYIQ 2MYOA 2GPWA 1SZ9A 4G0ZA 4RIFA 4C4RA 3EMDA 3EAGA 2WWFA 4PINA 3E9EA 4HFJA 3BQNB 5ALFA 4DN6A 2P6UA 2YVLA 2P9LG 3ER6A 4JI2B 2OGTA 1HSZA 3R0VA 3TEJA 1M5TA 3K6KA 3RW9A 2NP7A 4AL4A 2EKZA 3T15A 4FGSA 2VZ8A 4XM1A 2EZ9A 3WLMA 4ZZ2A 4FHZA 5D3MA 2I34A 5FA5A 3N53A 1Z7GA 1ZOLA 1W0CA 1YB4A 5TDHA 2MRIA 3TMYA 5KIAA 2J9ZB 1BH2A 5J58A 4I4IA 2IYWA 2IHKA 3FPHA 2OPHA 4HWRA 3NEJA 3PL1A 1ZM3A 2MU1A 4XGIA 1HH8A 4WESA 1MZVA 5IDQA 4NZYA 1D8EA 4RFSB 3RHSA 4EFNA 1F9EA 1R1DA 1VHDA 3AU5A 3KBBA 4ND1A 5IKXA 4WUVA 5IJXA 1Y48E 1XL0A 2X9VA 4MS1B 1X1SA 2WM2A 2V9CA 4K5BA 3W04A 4JIGA 4DPRA 1YQQA 3T06B 1UPTA 1KEVA 1O54A 2C5FA 1DV2A 3PD0A 1KPIA 3RAJA 1EUZA 1EQUA 2HBZA 3AB7A 3JQGB 2J8ZA 2HX1A 4AWAA 2ZRQA 2YY6A 2YHAA 1GAQA 2YNMC 4W5NA 1WHSB 2P5TB 3PKJA 1OY1A 1G3QA 1DVRA 4L3WA 2ATIA 5BURA 2FZLA 1GAXA 1U7PA 2RE8A 1P6QA 4S1OA 3S1SA 4AIFA 4CODB 2CBZA 3HWRA 5C32A 1N2HA 2DG2A 4TRNA 1JA1A 4P81A 4ARZA 3T7IA 3E82A 1ENZA 3LGAA 2XUJA 3VAZA 2XCRB 3SZOA 4TRMA 1UKEA 1XJ0A 4NV0A 4PGMA 2P9BA 4IDAA 4UQPA 3BERA 2BIFA 3S7TA 1F14A 3ESKA 4BY9E 1T26A 4M7OA 1H3EA 3NFRA 3FFWA 4ABYA 3B3JA 4L0MA 3Q47B 2FSSA 4ZCIA 4LXXA 1AO0A 1OWOA 2ZU0C 3VSDA 1NJFA 3D9PA 3R7AA 5JNVA 4GI2A 4ZRNA 1G1MA 3LLCA 2JGFA 5LFAA 1B6TA 5F7JA 2VHYA 3W6UA 1XL1A 3WIUA 4KAJA 2GJ8A 5FBQB 4W1QA 4URYR 4R9VA 3U4MA 4JP3A 2WJIA 4G5FA 2O06A 3CF4G 5IM5A 2R8BA 4GAEA 5EZYB 2YJ4A 1VPDA 3G1TA