4N3CA

Crystal structure of human o-glcnac transferase bound to a peptide from hcf-1 pro-repeat2(1-26) and udp-glcnac
Total Genus 279
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
279
sequence length
716
structure length
697
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HCF-1 is cleaved in the active site of O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/substrate
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 279
structure length 697
sequence length 716
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3cA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3cA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4n3cA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4n3cA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n3cA03
4GCOA 1EM6A 5CCLA 4RBNA 3ZCRA 3TG4A 1PNVA 3TG5A 3Q15A 5FT9A 2QZSA 4NC9A 1L5VA 3S7JA 5LQDA 2JZCA 4I1AA 4U0ZA 1PSWA 3OY2A 2KS6A 4NEQA 1H5UA 2X6RA 1WUYA 3G2KA 5TVGA 3ULQA 1WUTA 2ACWA 4LEUA 3T5TA 4M60A 4G25A 2FI7A 2VGXB 1GPBA 2XA9A 4FKZA 4H7YA 4YI3A 3RT1A 1ABBA 2KCVA 5BW8C 4G1TA 2HY7A 2Y4TA 1K06A 3H4IA 4NRHB 3CEHA 3RJVA 8GPBA 3OTIA 4RELA 4WUYA 4KQ1A 1NA3A 3VTXA 3O3CA 2QN2A 4HOTA 3CEJA 3MS2A 4X7MA 3D0QA 1L7XA 1NZFA 5FTPA 3MEKA 3HBMA 4J8DA 3UYLA 1QKJA 5EKQD 4EKYA 5LCWJ 3D0RA 3CK9A 2VG8A 3ZCQA 4MHOA 1XNFA 3NP7A 4U04A 2KCLA 1KLXA 1TJCA 2C2LA 1P5QA 3GYZA 1L5RA 3G2HA 4RIHA 3BCSA 4JA9A 3L7BA 1A8IA 2QN1A 3HBNA 3SF4A 1P4GA 5GPBA 1ELWA 4WNFA 3QHPA 4N2QA 3MSCA 3JYSA 4RIIA 2BISA 3CUUA 1YA6A 1LWOA 4KBQA 3EDTB 2GT1A 3NPAA 1NOKA 1FA9A 1BX3A 2NC9A 4WNEA 4RG6A 4AN4A 4I9EA 1B89A 1P4HA 3T3HA 5DIZA 1UZUA 2C4MA 3MTAA 1FCHA 1Y6FA 1WAO1 2E2EA 2P6PA 4GZ5A 1WW3A 5BNWA 3C48A 1QQEA 3T3DA 3T3EA 1KT0A 2QN7A 3GUHA 4BFCA 1V4VA 4GPKA 1RZUA 3HBJA 2KC7A 2VCHA 1SXQA 1NOIA 4CTNA 3NC4A 2FEZA 2QLLA 3BD8A 5D0OD 1FU4A 4U07A 1L5WA 2XCUA 4N39A 3E4BA 2FBNA 1KT1A 4CDRA 2GM9A 3PE4A 3VUEA 3UQ3A 2XGOA 1JIUA 3L7AA 3GZ1A 3G2IA 2J9QA 4WNGA 3PDNA 5EX0A 3CX4A 2R5SA 4AIFA 3MRXA 1XL1A 3S29A 4GZ6A 3L7DA 3OKPA 4U0SA 3VTYA 4F96A 3ZCTA 4ABNA 4N9WA 4MI9A 4EL0A 2QRMA 3Q4AB 1LWNA 3QKWA 4O6FA 5KJKA 2UY1B 2YHCA 4KQMA 3DDWA 3CVPA 4HOQA 3L7CA 4M7PA 2IEIA 4BT9A 3IA7A 2I6HA 3G2JA 2OFFA 1IYGA 3BEOA 2F3UA 2ZB2A 4WHMA 2QRQA 3CV3A 4JA7A 1P2DA 3E3NA 3Q47B 5A6CA 3DZCA 4UI9K 2C0MA 1WV0A 3NAZA 3MS7A 5M72A 4J8EA 1L6IA 4G23A 4GYWA 1FS4A 2ATIA 4BT8A 1C50A 1FU7A 3OKCA 2R60A 4YUAA 3OXLA 1IHGA 4X6LA 1Z62A 3ZCPA 2X0DA 3MV3B 1A17A 4CGVA 4L22A 5DLDA 2GPNA 3BCRA 1W3BA 2L6JA 4N3AA 4BQIA 1ELRA 4RIGA 4CTOA 2C1ZA 1GGNA 3Q3HA 4EL5A 4YNDA 5D00A 3T7DA 1E1YA 3Q3IA 1NVKA 5FZSA 5JJ7A 1PYGA 3LY8A 5ARGA 2HR2A 1O6CA 2F3SA 3NB0A 3G2LA 3SYMA 1WV1A 1JIXA 4U0UA 3Q49B 4XI0A 3DDSA 4GZ3A 4GYYA 4I17A 4HORA 5DBKA 4RG9A 3CUWA 2KCKA 1P2BA 3CK7A 3NF1A 3OT5A 2WTXA 3CKBA 3WADA 4CTMA 1FC0A 1UQUA 2IYFA 3MA5A 4UQYA 3S7DA 3FWVA 4KQ2A 3DD1A 5FJYA 1P2GA 2H1HA 2XGSA 1UQTA 2VSNA 3CUYA 4M83A 2V5FA 3CEQA 4G26A 3VUFA 3AS5A 4N3CA 2PZIA 5G05J 4B94A 3ASFA 1P29A 1HZ4A 3ZGQA 2VGXA 1OUVA 3D1JA 1NA0A 2AW3A 2KATA 3CKCA 3RO2A 3T3IA 2GW1A 5CCMA 2O6LA 4F97A 3OY7A 3S7FA 3MT8A 3MRTA 2IV7A 3OXFA 5C1DA 4HLNA 1Y8ZA 2IYAA 4UQXA 4YVQC 2ACVA 3MT7A 1NZNA 3S27A 2VGYA 4G24A 4GA1A 1HH8A 1AHPA 1HLFA 1WM5A 1NOJA 3UUXA 4YVOA 2QNBA 2ONDA 2PRIA 4G2TA 5HI7A 2R68A 1JG6A 3R9AB 1F0KA 4JL0A 3RKVA 2XMPA 5TMBA 3CEMA 4KXKB 3KAEA 4N3BA 2FF5A 1NZDA 2Q6VA 2VYIA 2FETA 2R66A 5JJTA 2XA2A 1YA0A 3CVQA 2UY1A 4AM9A 2G9UA 5ARFA 2LNIA 1L5QA 5IKPA 2FF4A 3U3WA 2PQRA 2AMVA 2ECPA 3GPBA 5A7DB 3BEEA 4X7RA 3SYRA 2XGMA 3Q3EA 4AMBA 1C8LA 2LSVA 1K08A 3KD7A 1RZVA 2F9FA 3CUVA 1PC2A 3AS8A 5HXAA 4WACA 3CVNA 3QDNA 4I9CA 3ZHEB 4MI3A 2X0FA 3E3OA 2AV6A 4RENA 2SKCA 3RHZA 2QRPA 1IXYA 4BTBA 3MBOA 2PL2A 2SKEA 1YGPA 4J0UA 4GPBA 3H4TA 1C8KA 2IUYA 2QLMA 1ZBPA 1FTWA 2ASVA 7GPBA 3ZCUA 1JIVA 3QWWA 4MI6A 2OOEA 4UQZA 3RO3A 3MS4A 2HO1A 4APOA 5I45A 2QN3A 5TMEA 3EBOA 1J39A 3QKYA 4H7XA 3ZFWA 3WAGA 1E96B 4QLBA 3RU0A 4RIEA 6GPBA 3ASHA 5D01A 2WPVA 1QZ2A 3S28A 1NLMA 3LY7A 4PQGA 1Z6PA 4F3VA 2QRHA 1KTIA 4N2SA 1B4DA 5AYWD 4Z5XA 4CGWA 3S0JA 3G2NA 5FZQA 1XOIA 2XCIA 4FZRA 3PE3A 3WC4A 1XKXA 2G9VA 3WXXA 2BFWA 2GEKA 2X0EA 4UI9J 2YJNA 3LPZA 2IV3A 2F3PA 4I2ZA 3C4VA 1GPAA 4F9FA 5EX3A 3TOVA 1P4JA 2WQHA 3CK8A 5ENZA 3UPVA 2QN8A 4I2WA 4AY5A 4KYOB 1SXPA 3ZHEA 2XA1A 1JEJA 1Z8DA 3IAAA 5DU2A 3MKRA 2Y4UA 2IFUA 2GPAA 4WADA 4BQFA 2XCCA 3LY9A 2GEJA 3RSZA 1GPYA 1VGVA 3HBFA 2SKDA 2PYIA 3ESKA 3VDMA 1F6DA 3L79A 3MQFA 4LDPA 1C3JA 4GYOA 1AXRA 4BTAA 3FROA 3BDAA 1EXVA 2UWJG 5G05C 2C0LA 4IN3B 3FFLA 3MV2B 4EQFA 1GFZA 2QLNA 2BGTA 4MRAA 4G2VA 5FZRA 1JG7A 3VDNB 3QOUA 3OTHA 2IEGA 2VCEA 3HYMB 4HOUA 1QM5A 2R4TA 3ZCSA 2MHKA 2H1FA 3ZCVA 3LCAA 3TAXA 3Q5MA 3ZPJA 3C4QA 4RIFA 1M5RA 3OXGA 5HQ8A 3FP3A 3L01A 4MICA 1ZU2A 4GA0A 2FFRA 5BT1A 1PN3A 2FO7A 3OTGA 4GCNA 5JTTA 3URZA 3BCUA 4W6QA 3TGOA 1IIRA 4ME2A 3O48A 4LEIA 2JLBA 1FU8A 4WNDA 3BD7A 3E3LA 5KJMA 1GG8A 5KJLA 2PQ6A 4REMA 4Y6CA 1Z6QA 3CV0A 4N5CA 1WW2A 5TMDA 4UI9C 3OKAA 3ASGA 2Q7FA 3CVLA 3COPA 5JJ6A 1E4OA 3BD6A 5JTUA 3IEGA 2QFCA 4XIFA 5G04C 2HYZA 3MT9A 4HWGA 2VSYA 3RSCA 3MRVA 4W9RA 2IW1A 4X7PA 2IF4A 3EBPA 3NCHA 4Y6WA 1Y8MA 3GW4A 2F3QA 5D0QD 3SZ7A 3NP9A 4J8FA 4A1SA 3KS2A 2P58C 2XPIA 2QN9A 1FTQA 3QWPA 1XC7A 4YI5A 2BUGA 4JHRA 2BGUA 2AZDA 3ASDA 2PQNA 3ZN3A 3LKUA 2VQ2A 4GA2A 2C9ZA 4XI9A 1Y6GA 3T3GA 3MTBA 4BQEA 3AMVA 3S2UA 2JJMA 2X6QA 2G9RA 2GPBA 3TSAA 4EJ2A 1XV5A 3CUTA 4NESA 4EKEA 5CHEE 1GZ5A 1L5SA 3LYAA 4BWRA 2R4UA 3GZ2A 1FTYA 2G9QA 1HXIA 2PRJA 3UYKA 1RRVA 2LSUA 3S7BA 2XEVA 4AY6A 2AVPA 5LCWC 4HOSA 3K9IA 4AMGA 5DXFA 3N71A 3RIBA 2YQ8A 4NQ0A 4MHSA 5G04J 2QRGA 5KJNA 9GPBA 3QWVA 2XCBA 1XL0A 2C1XA 5IKOA 3MTDA 2GJ4A 3U4TA 2DBAA 3AS4A 2PYDA
chains in the Genus database with same CATH superfamily
2PS9A 5EUMA 3GQVA 2FJPA 3C7AA 2A35A 4FDVA 3A36A 3D4PA 2BEUA 3H0KA 4P5DA 3RK4A 2VPPA 2YJTD 3C8UA 4KAXA 1U7IA 5JSZB 4ZO7A 4FMPA 2EHJA 3P9PA 3TG5A 2VS1A 2YXBA 4OHXA 4GI3A 4QO7A 2ODWA 4O4HA 3WRYC 3BH6A 1XCBA 5T8IA 2XRZA 2Y0CA 1RC0A 1YZLA 1DXQA 1BN6A 3EZ7A 4KVGA 4U2DA 4KI7A 1Y6QA 1XXHE 4RJIA 3ZGYA 4EHJA 2P67A 2WUFA 5A6VA 2ZSBA 4FFRA 2F48A 4XB2A 3SNXA 2EJBA 3EE6A 2FP3A 1QBGA 4NCKA 3DLHA 1RWOA 5MGNA 3QVKA 1H85A 4PU0A 5FBKA 3VI4B 1TEXA 2XODA 1BCRB 5CVJA 1Q57A 2XA9A 5K3EA 4FKZA 4LBZA 1KK0A 1TIPA 4HX5A 1BQEA 2BLLA 2I1KA 2HSZA 3PUZA 4N65A 3RT1A 3WJAA 4ZYUA 4FWTA 4MHTA 2P4HX 3A4MA 2PQ2A 3QXCA 3ZIMA 5JSUA 3PKZA 1M8JA 4J8PA 4MVCA 1WIWA 5A3SA 1P7CA 3NBYC 1YMVA 3E0XA 2PUVA 4KJZA 3GOHA 4PHHA 1ZC4A 1KZHA 2VF5X 3ZNPA 4NNOA 5BMVF 5AVWA 4B4WA 4C03A 5HOEA 2WMOB 4TUMA 4JKOA 3UA3A 1RLUA 3CXUA 3H13A 3IAUA 2O8CB 4BO2A 5FTPA 3O82A 1G5FA 1HDZA 4INOA 2BW0A 3S1LA 4FN5A 1E90A 2NXEA 1W2HA 2DK6A 4BP1A 1B3RA 3QEOA 3AKEA 1Z6XA 4HG2A 3I9KA 4U04A 3SIXA 1LFAA 9LDBA 4OHVA 4GKVA 3PS6A 3EDOA 5IAGA 3L7BA 2OAQ1 1HFJA 3D2CA 1S3GA 4PGHA 3WB1A 2B30A 3HSKA 3B53X 2P0EA 3DP7A 1R12A 2HQ1A 2ZSDA 3V2HA 1UJ4A 1JFTA 2H1VA 2AUNA 4FW9A 4GSLA 1CETA 5DEIA 3E9RA 1RJWA 3CVOA 1F4LA 3W2HA 1YCFA 2MYOA 3KEOA 2IUTA 2NZVG 4YAIA 5C8YF 1SU8A 3VGJA 6Q21A 1OXKB 5BN1A 3V31A 2H2AA 3F49S 5EXTA 5LP6B 1L2TA 4PCLA 2PMKA 5CCBA 1D04A 1P81A 4EH1A 3H5LA 4C4YA 3RVLA 3B1ZA 3L82B 1PS9A 1B89A 1TZBA 4E31A 1UZUA 2C4MA 3W2FA 2OD9A 4H27A 2XNJA 2ZCUA 2YYYA 2W37A 3REOA 2VQSA 1LLDA 4KFUA 4AVXA 3LLUA 2JJ2A 4QUAA 5AOBA 4LECA 4BRWA 5CK4A 4TT3A 3AEXA 4ZU6X 2FSVC 5PGMA 5T4HA 2OOSA 1ZGAA 2QLLA 3PEEA 4FS3A 1JEYA 3ORHA 5BRAA 2IY8A 4I99A 2Q5JA 5HSGA 2A5UA 2XCUA 1PS0A 2QQGA 4IKPA 2YRXA 1CB7A 1HV8A 4MVJP 1G66A 4NV1A 1LLCA 5FPQA 2B35A 1GZ7A 7MHTA 1XLTA 5A0VA 2BGRA 1MX6A 1AO3A 2RKBA 4QUKA 1CUHA 1XCLA 4EHDA 1PNQA 3GLIA 4P5PA 1DU4A 1MFPA 5AT1A 4C0XA 5AVVA 4AIFA 1MC1A 1A4IA 2GDJA 5LA6F 1Z34A 4H7KA 3IEMA 1VIVA 1QDUA 1XZEA 3LVRE 2BEWB 4H6WA 5FHRA 2ZYRA 4X9XA 1SB8A 1OWMA 3UIEA 3VU3A 4F56A 3ZWAA 3FLAA 1S4QA 3HYLA 3KR1A 4KE9A 5DBEX 4INPA 1XTSA 4F5DA 2BMJA 4F4HA 5LNK6 4MR9B 3CX7A 1RYDA 2I5PO 2Z6VA 3PFNA 3QNWA 4M76B 1L5HB 5DGCA 5TRTA 4QA9A 3Q8MA 3GLTA 1CUFA 2EZUA 5A23A 1WXEA 2WB2A 2Y9MB 3NVMB 1WF3A 4ER3A 4WHMA 5JHHB 3BG0B 2MRIA 1GTVA 3L77A 4Y2SA 5HJEA 1NKSA 1XHLA 1ZSNA 4OM8A 1O89A 4I5EA 3F98A 4KTTE 1VKJA 3R0ZA 1WV0A 5BSVA 2CV2A 4K2AA 5LZ5A 4J8EA 1KKUA 1L6IA 1ST3A 1ZKMA 2K7ZA 1FS4A 4FK8A 1QK5A 4XCVA 3BQOA 4B89A 1HYQA 3T9CA 5LQRA 2C94A 3IB6A 2FUG6 5IARA 3ZVKA 1QZTA 1YJBA 3SXUA 3OU7A 4X6LA 1X1AA 2RJOA 4DFDA 1B41A 2VPTA 2DGDA 4LJSA 2I76A 4AG3A 3V30A 4QHSA 3ZGVA 1WZCA 4L22A 2NSZA 3JQAB 3G7SA 4J29A 3T9AA 2IDMA 3PB3A 2C1ZA 3K6SA 4E1VA 4TM7A 3VR4A 2I3GA 1QBQA 1G7TA 3GFVA 4GFDA 2BUAA 3IEVA 4FBMA 2B9EA 4F8EA 3DKPA 1ZL2A 1NVKA 1NP6A 3PP8A 3QLUC 1SC6A 3HB1A 3ZHBA 3ZQ6A 3SHFA 1EI9A 3HCNA 2AIRA 2HPZA 4DUZB 2OXEA 2OY0A 3N58A 3FPJA 4K6FA 1HNXB 1QQAA 3UMSA 2VAMA 5AI0A 1QYMA 3VPFA 4Z9YA 1KIMA 4MKHA 4NMWA 4TLDA 5EEHA 3TXXA 3VZSA 3WDKA 5G2NA 1XTTA 5F3WB 1ZBDA 2BOVA 1F2TA 3QPCA 4FFMA 1C8BA 1QQ6A 1CUCA 1QHHB 1RXCA 1XKQA 1ZCFA 2IC5A 2PKXA 1Q1NA 2DZDA 3EPPA 3FB4A 3O4RA 4FJ0A 4LIPD 4B76A 4F2GA 2H1CA 5IMSA 3WGTA 2F62A 4G5GA 3EHMA 5EUCA 4OI2A 4BVFA 5JXWA 4UQYA 2IUUA 2HR1A 1SOAA 2BTQB 1AHIA 3NGLA 4S24A 3EF1A 1N5DA 3R6WA 5KTYA 2XWPA 3RF7A 2DEUA 3RRYA 8ADHA 4AX4A 3BSSA 1RIIA 4QD3A 5CH8A 4B09A 1RHMA 5FTJA 4AO6A 4NF2A 2HMYB 4RQIA 4WESB 4FT2A 4IUBS 1AKMA 1I4TD 1E79A 1NUSA 4REQB 2JL1A 4JJEA 5G3ZA 4KR7A 1OZ0A 2GYYA 3DBIA 2XT6A 3GMDA 1JBQA 1NMXA 3ILVA 3LYHA 4LKRA 2PZIA 2QMQA 3AB3A 3TEFA 2X0RA 3T4XA 4G0UA 5CK5A 2RC6A 4CVNA 4YPOA 1Q0LA 4S12A 1O6GA 4TXLA 2V4LA 1E1DA 4A1OA 1U8AA 3M3PA 4RZXA 5HJ5A 1NL4A 2G71A 3EMKA 1Y8RB 1F8UA 5JFGA 3MLAA 2G76A 4CQMA 1DHTA 3IXEA 1ZI9A 3KT3A 2DETA 3G9UA 4DN6A 5IC4A 4FD3A 4DLZA 3MT7A 4IJQA 4UW9A 4B34A 5MDHA 2YXDA 2IT1A 5BSMA 5ARBA 1PHPA 3E37A 2DFPA 2W6ID 4M8LA 4TQ9A 5KKAA 4W9MC 2X14A 1H42A 3MXTA 2P5TB 3R5KA 4YX9A 5C80A 1KP9A 1WU7A 1CULC 3KP1A 3L8YA 1YZGA 3UUXA 2PFGA 4RKYA 4D3SA 4HFRA 1K1EA 1NM5A 3WI7A 5JR3A 2JI6A 2VA9A 1O0BA 3HHEA 2JBAB 3MSXA 4KQCA 4JL0A 1FXUA 2DHQA 4KDEA 5I9SA 5J2UA 4FC8A 1ZZGA 4LUNU 2X8JB 3PHGA 3T4EA 1B6TA 1UXGA 4X84A 5JYCA 1GGEA 1KC1A 2FF5A 3G23A 1KL7A 4CYMD 1QG4A 2GFIA 2FETA 3G0BA 2XA2A 3FTDA 3WLOA 1KZ7B 2O05A 1KKLA 2G9UA 5LZ9A 2X5HA 1QF6A 4LRTB 4FGJA 2DPLA 2WV9A 3GFBA 4UEOA 4IULA 2CLSA 1XDDA 5JLJA 3ND9A 5EWLA 3Q3EA 4KLCA 1P4RA 2QRZA 4AK9A 1PVDA 2JB9A 4NX2A 1KFKB 4UATA 1OFIA 3MWEB 4CMEC 1BVRA 1QYRA 4RY8A 2WSSD 5HOQA 2C82A 3TWUA 2Q2OA 4F4FA 4DMCA 2XZDA 4PS1A 5ERYA 1EDBA 1DV1A 3QFSA 4LJ8A 3RYCA 1SQGA 1D4OA 3BXEA 5B1IA 4FJ1A 1WRBA 5B1BE 1ZG3A 4O02B 3ZZ1A 4GKJB 4URYR 3ICPA 1Q22A 1BU5A 4TMZA 1L8AA 4HDRA 1V1MB 3OJOA 2P2SA 3VKGA 2VWPA 4P7JA 3PNSA 1M6VA 2Z4RA 3C7DB 4FFPA 3JTMA 4HQFA 3A2LA 4NBLA 1ZGZA 3PC8A 1DCFA 2JRCA 7GPBA 3QJGA 4RANA 1I3NA 4UQZA 3K35A 3QF4A 1J9ZA 2A4KA 3MWLA 5AQ7A 1A4UA 4OVVA 1LI7A 2EYUA 2OLEA 3ANLA 2H6FA 4UU0A 4Z1MA 5U4XA 4MR9A 5TMEA 4UBNA 2GM4A 3B6EA 2DM6A 4BLUA 3UCFA 1VB5A 2KB0A 3MB8A 4E94A 5B5SA 5K6RA 1XTZA 1OZAA 1C9MA 2P9JA 4IDOA 4BDTA 1XQYA 4C2AA 3RBAA 1Y6IA 4E13A 2XB4A 1NMYA 2CKMA 2VEDA 3K72B 4L3OA 1SUCA 2GN8A 3OIYA 5IUKC 3EZ2A 1ND6A 2PRYA 1JKJA 1CE8B 4UXJA 3VDRA 5JZSA 1UOEA 2DBZA 4C7MA 2QD5A 2ZBPA 2X5XA 5I3CA 1XOIA 4Q02A 4HNRA 3SSMA 4ZTUB 3S2YA 3QVMA 1MVNA 2Y1WA 4QUGA 5E9QA 3JWPA 3JQGA 1COZA 2ZIRA 1J00A 2PT5A 2BFWA 3OEYA 3EYWA 1BE1A 4NHOA 4UM9B 3UCXA 5ADWA 2Q6KA 2JFUA 4CF6A 2ZRMA 4YPFA 4PTLA 2ERYA 5H83A 5KYVA 3CRNA 2ZUWA 4HI0E 4I2ZA 5KOJA 1C1DB 3RVQA 5BN3B 4U2FA 1MJ5A 4ZYWA 1HOXA 2VYFA 4AC9A 1NJSA 1DEAA 1GTJ1 3IUJA 4L5CA 3A6FA 4MV1A 2EINE 3ZTYA 4FNGA 3FH7A 1NU8A 1U1DA 2CDNA 3CSSA 2VI5A 2Q5QA 4MJXA 4C04A 4CI0B 2O5EA 2I1VB 1Q77A 1HBJA 2ZRJA 3PWTA 3IFSA 4E2FA 2NN3C 4BO7A 3LOUA 4IOKA 5BSWA 2VSOE 3DSXA 1Y1RA 3KL2A 4F11A 4AJOA 5C1PA 5KNHD 2CZGA 5KHOC 4CXMA 4WIAA 3PC6A 5CGQB 5HRUA 3P45A 3QG5A 4UJ5A 4ZKDA 1L7MA 2JFBA 5M2QA 1ZCAA 7MDHA 2DLCX 4YYZA 3TX6A 4GMFA 3HBLA 1AMOA 3WZ2A 3DSUA 3ZY6A 1IDN1 3RGGA 2X1MA 3ZXYA 2J3EA 5C3MA 2ZJZA 1FJGB 4UYKB 4M1OA 1C3XA 4DUIA 4G63A 2E4ZA 3P4XA 1W5AA 2PWZA 2WD9A 4TMKA 5E1MA 3SWWA 4R54A 4P2BA 2BVNA 4IIEA 4DA6A 1SULA 2FSHA 3STYA 1DGQA 2D0PB 5FZRA 2I1LA 4FULA 1NW4A 1ISMA 1XNHA 1Z28A 1G3RA 3AM3A 2LZ0A 3PRYA 4FE3A 4KRYA 5EP2A 2FHPA 4BLPA 1M34E 2ETAA 1C4WA 3Q9NA 3PVCA 1R0ZA 3G7NA 1EWYA 1EFHA 1V8BA 1P9NA 3PBKA 1DQSA 4PLHA 1BH2A 3RREA 3T7SA 4L8VA 1XQ1A 3F0TA 4DV1B 2PSFA 1ZU2A 3P2EA 4QBFA 4BX3A 2VYCA 2ZRLA 3AU8A 1PN3A 4EVIA 1M8GA 4MRUA 1C8VB 4P7BA 1HYHA 2FSIA 1E58A 4LDNA 4YAKA 5DBFA 4MAMA 4JLDA 3IR7A 4CNBA 4C7XA 2HJRA 3WA7A 3VO2A 4QLOA 3CISA 3WFJA 3EHQA 1ZD4A 3GUCA 2HU2A 3LO8A 1I01A 2ODBA 1XRQA 1D6NA 2GO7A 2O07A 1JXMA 3K09C 4GI5A 3RNLA 3SHVA 1HDYA 3D8HA 3AVPA 2ADMA 3I9V1 2JA2A 4OGKA 3BBLA 5EP4A 4B75A 2GRPB 2G77B 1E4OA 1NHWA 1ZVJA 2GRAA 1HE3A 5DM1A 3RRBA 4UBOA 3K92A 4E32A 5DNUA 5FOSA 3EISA 4LJAA 5IBRA 1C9NA 2QY6A 2PYZA 2NYRA 3QU7A 1YFKA 4HZGA 2A9FA 4JI7B 4DLBA 4D10C 1TOAA 2IYYA 4Y6GB 1T8SA 3L1HA 2ZR0A 1JYFA 3UJ3X 2O2SA 2XUZA 4DJJA 5FBZA 1MOZA 1VJ0A 1YUMA 4FEEA 3KS2A 1FDSA 2V97A 1C0IA 1N5LA 5A7FA 1W1WA 3OSUA 1LBTA 1R9MA 4X24A 1O5IA 3L1IA 1FNMA 3VZBA 4D3XA 4NG5A 1U2EA 2DWQA 3BRWD 4YI5A 2PL9A 5GZ3A 2CXOA 3EXIB 3LQ1A 3NATA 1YFLA 2P3SA 1RRCA 2VFAA 3IDQA 2B61A 2JLXA 4X93A 2H65A 2VSXE 1DX9A 3B9PA 3K20A 3KR9A 3MGGA 4TKUB 2RJNA 4RYLA 1BFUA 5CB8A 5FOUA 3Q8LA 2YW9A 4J0QA 4UUBA 1PL6A 3NONA 4QYSA 2V6JA 4XR4A 4ZANA 3STXA 1B23P 1O5MA 2LAHA 2R6CA 3K0EA 1P4AA 3TLZA 4OX9B 5C46F 4FEGA 3I9LA 1X5BA 4LOAA 4ACBA 1Q15A 1YS4A 2YICA 1HKUA 1QH8A 1LF0A 1P2SA 2HDNB 2VNAA 4H1UA 3ZYKA 5A6SB 5KOIA 2FPGA 4KPUB 5HMLA 4U8YD 3SQVA 4BWRA 4K9DA 2Z83A 3S7TA 3I09A 2JARA 2C59A 1JWFA 2PRJA 3OKFA 4X20A 3DBRB 1ZB1A 4LOHA 2PTHA 3ORRA 1JQ5A 1OAAA 2XZTG 2NP6A 3VPGA 4R1PA 2YDYA 4R1OA 1LRJA 1KEEB 3GEPA 4HDOB 5ICCA 1UP7A 1U9ZA 1AO0A 1Y8AA 2I67A 3EFEA 1IBLB 1P39A 4NU6A 4MWZA 1V9CA 2DF8A 4OJMX 4BBPA 4D4IA 4BNXA 4GMJA 1SKMA 1G1AA 1QHGA 1GZ3A 3EGIA 4D3FA 5ICEA 3ZNGA 1WHTA 4JYAB 3Q5GA 1IB6A 2YS6A 4D9GA 2OEWA 3W2EA 3GRZA 3QX8A 2ZTHA 4EOGA 3WK9A 4NXMB 2C2HA 1MP0A 1P62B 2HCFA 2V0CA 1CQXA 1A2OA 3FPFA 4KK3A 2YWFA 4DLQA 4BCDA 2XNHA 3IH5A 4BV9A 4J0GA 1TA4A 4K5QA 2NU9A 3O31A 3CCCA 1EZ1A 3Q15A 3P9CA 4TSRA 3QZUA 3KOOA 4NC9A 4ZVMA 3TMYA 4PLGA 3L1KA 3ZZNA 3E27A 4Z1MD 2GK4A 3S8EA 4U8HA 4LQLA 1RHJA 3AUJB 2ZDGA 2YNQA 1UN8A 3OBBA 1KIFA 3DFKA 1PKXA 1GG2A 1SXJD 2X6RA 3HI6A 1Z4JA 3HYSA 4BEJA 3VSDA 1BDJA 1CQIA 4QDTA 3OOSA 1H19A 2HREA 3GARA 5A5VA 4KVAA 4JITA 3ZU2A 4C3OB 1FMCA 1N0WA 4F53A 3WYGA 4L27A 4YCLA 3I01M 2GERA 5HCIA 1JEOA 2ZKLA 1KFJB 2WRZA 1UC9A 2QNIA 4GBGA 4CW7A 1D2MA 5ENNA 1PWEA 5CP8A 1N32B 4BLVA 4N0EA 4RKRA 3OZAA 4DX1A 4RULA 4MCHA 2YC4C 5GIPE 4WH0A 3D5TA 1Q12A 3IV9A 3VYUB 1M6HA 1YKSA 2UYQA 2EWMA 3S44A 3DFZA 3KQUA 1VKZA 3C3BA 3Q8WA 1R1DA 4X71A 3SHQA 3GT4A 3TFWA 3MEKA 1JKFA 1TT7A 4EPXA 3JXJA 3HNRA 4Z9FA 1DG9A 2WLSA 3SI5A 3BWVA 4R8SA 4V0SA 1A5ZA 2MT9A 3DZFA 1GZ6A 1FBNA 1MAAA 4LE1A 1Z33A 2DFLA 3D8NA 4JP1A 5H81A 4E5DA 2GJ9A 2ZB3A 3WQBA 3ZVLA 4Z3OA 2MINA 2VJLA 2P9QA 4GX1A 1VCNA 2ON6A 1FTNA 2GEDA 5BN5B 3SPXA 5C18A 4AZ0A 4NYJR 2Q28A 3PTZA 3QK7A 1T8RA 3K0CC 1D8TA 3Q9LA 1HSZA 2XDQB 5GPBA 5D1HA 3TDKA 4LVOA 2H06A 2HJWA 2RGBA 1ZMRA 3CZ4A 3UWDA 3L18A 3OETA 1K75A 1H5NA 2WJWA 4HS9A 4XZ3A 1VSUA 3IVMA 4I2NA 4ARAA 4W5QA 1TEZA 2KM1A 4H3SA 2R8RA 4JLJA 3VSEA 2H9YA 3R7NA 1Q16A 3P5SA 2EAUA 1E1CA 3L8CA 2HXSA 1ZN9A 2WICA 1X7ZB 5IM5A 4FYHA 1YB2A 3EXHC 3H1EA 1B0UA 2IZ7A 3KWMA 5G1NA 3UAXA 4WY8A 3RUIA 5K0ZA 1HURA 1WUKS 3BK1A 3EQ9A 4K86A 1QQ7A 1MGOA 2OB2A 4TMXA 4YJFA 3NYQA 1V4VA 5EOVA 1AKTA 3TVDA 4AWBA 3FUVA 4KREA 1KJ9A 2W70A 3RTAA 3ZS9A 1FPMA 1IBRA 1T5BA 3IAFA 1WDTA 4QQKA 4X1KB 3P2BA 2QE6A 4JI6B 3HCRA 4EQZA 2X8BA 3X1ZA 4CE6A 3CFYA 3OQIA 3PRHA 4ZV4A 2MHCA 1BEUB 1O87A 1RVDA 2HIMA 1TVMA 4FGUA 4UUQA 4A8TA 4F3TA 5NLLA 2WP8J 2A2ZA 2XJ4A 4YAGA 4YXWD 1Q0TA 1W88A 2QUIA 1UFKA 2AFVA 5TLSA 5IC6A 1IQ0A 2VZ0A 3CZMA 5HJ7A 3NCTA 1NI1A 3ASZA 1INLA 3ET4A 5EWMB 3MZLB 1E96A 1Q1QA 1QGYA 4KWEA 3GROA 1GNSA 1DC4A 1SVNA 1VZ2A 1IVYA 4EBAA 1KP2A 2F4NA 2VA8A 2JCXA 3GJ3A 4JKYA 5CPFA 1DKOA 5KQGA 3KEAA 4N0QA 4XQCA 4TLEA 1VBMA 4LHSA 4RDCA 2UUCB 4IGFA 1RWVA 1PD1A 2B5VA 1AQYA 4NONA 3G5UA 1SBCA 1E5DA 5ALTA 3UT5A 2ZSKA 4IZHA 1E3WA 4IDBA 4GU5A 1AQJA 3IAS6 2IPNA 3AOEA 3L6UA 2QG4A 4LHYA 3OZTA 3WNVA 4D43A 3NM5A 3PEFA 5CR9A 1II0A 4P3YA 3TDMA 5AVTA 4CM8A 1IBMB 3T5PA 1R27A 1HQYE 2DULA 2NTNA 2R1VB 4MVJM 3ZKWB 1MZPA 2WVHA 1HE8A 4DTIA 1V8ZA 2I3BA 5IJ9B 1M0SA 4XGQA 3TL5A 5FJIA 4FX5A 1CWUA 5A4KA 1AV7A 2AT1A 1CCWA 1EYZA 1RM5A 4IDAA 3T3PB 4C01A 4EK9A 5T7BA 1ELRA 2PH5A 3FZNA 5DWQA 1W96A 5T3UA 2X9GA 4BMPB 5AW0A 3VVBA 2N42A 5EY5B 3H1FA 4RGYA 1PHRA 2RHCA 1U0OC 1S1CA 5KHLB 2F43A 4EAQA 4ZYLA 1LUAA 1T3SA 1U3WA 5EHZA 1YZ3A 1G5QA 5CW2A 2RIPA 1OF1A 4X97A 5ARGA 2HR2A 5L7YA 3TL3A 4CN8A 5AHXA 4C4RA 4HEHA 2BEVB 4EEXA 4ND8B 2WMDA 4PLFA 3K8OE 4R1LA 2OYRA 3SMVA 1V5EA 1RAAA 3FNBA 4IEIA 4DSZA 2N47A 3TE6A 1YDWA 4H18A 2D5IA 4LTDA 3CPEA 5LA6A 1E79D 4RG9A 2R7AA 3X2QE 3RYHA 3GYGA 1Z9BA 3FRIA 4KQEA 1O9BA 1HEYA 2P9EA 2Q3EA 3FYHA 5FORA 2OPHA 4BMOB 1UIRA 4A10A 4B5LA 5KQMA 3THSA 4F4UA 4D56A 4Q4CA 4LYFA 1J2UA 2VF7A 2Y9PB 3DAGA 5BUQA 5IABA 4ZV9A 4OJNA 1B76A 1UQUA 4LSGA 4YMHA 2H7VA 3G17A 4GOJA 5B3JC 3EH1A 1DO0A 3GU3A 2JJ1A 5KWSA 2VNHA 4PICA 3N53A 1SQSA 5B30A 2VAXA 2JGRA 2BC9A 4BNKA 5FPKA 2ZUVA 3FGZA 2X0IA 4GE0A 1AKYA 1Q1EA 1PJBA 3K0FA 4WXHA 3ZX4A 1A8HA 5TPZD 4UBKA 3E5NA 3ZD9A 3SBTB 4JI5B 4B17A 1N1DA 1H2XA 1XNJA 3FLMA 3EGWA 3MQ4A 1JFFB 4O4LB 4RM2A 1RQNA 3P71T 1R15A 2OVFA 3KJGA 3Q4GA 3D1JA 5AJYA 3WAKA 4CI9A 3C98A 2I6TA 3LHIA 1QF9A 3QU5A 4JELA 5DOVA 3SBEA 3UAOA 3S7FA 3AUKA 3TSOA 5AVQA 5JAZA 1ZLYA 2YJ6A 4B33A 1IAQA 5EXSA 4YVQC 2GAOA 4DC1A 3DPUA 4CKXA 3PLNA 4YUVA 1YJXA 4IRUA 3HCPA 1W6UA 4GKBA 2EF0A 3VR2A 6PFKA 5JSYA 3DCNA 3ZW7A 3LX8A 3GLFE 4JIGA 2I7XA 2ILRA 5E2BA 1XX6A 3W3AA 4FHEA 3K71B 3SFTA 5AKJA 1YVPA 1JG6A 4HDAA 2X41A 3HXTA 5F7XA 1TD1A 3PEYA 3RKVA 5FLXA 1INZA 2QAGA 1DMRA 5E3JA 1DSSG 3RBVA 4BE4A 2WTAA 4ZYXA 2Q6LA 3GUUA 4OFWA 1SK8A 2IW3A 4HGYA 4IV5A 1DJNA 3LI2A 4KGVA 4LXGA 4Y67A 5J08A 1GCAA 3MKQA 1O3YA 1YZKA 5IDQA 2UY1A 3ACBA 4C88A 4LOKA 2UZ4A 5ARFA 1L5QA 4CUJA 2YQ5A 2PXHA 1CJTC 5E6RB 4MZXA 1SEVA 2AMVA 3FEXA 1PEYA 1YBFA 2QR5A 3TFQA 4IYPA 1KQOA 1O95D 2LDBA 5CLLA 4NK4A 1JLKA 1Z73A 3JW8A 3FVRA 3WHPA 4LX8A 5JSQA 4IGIA 1SRQA 3IP8A 3WBJA 1PL0A 2BM0A 5KWVA 4OTZA 5JJLA 1SZJG 4S3MA 1FFBA 2VPZA 4ZO8A 3WJ2A 5E6UB 3QDNA 2J0UB 1EWVA 3NEAA 1EFTA 4P54A 4CEJA 3WXBA 2TRSB 4MLZA 5HQ3A 2SKCA 4K6OA 3VKFA 4JC8A 2CNOA 2VVTA 3M81A 4G6ZA 4DVJA 4CEIA 4A92A 3HVUA 3TQCA 3IDAA 3NBQA 3I2HA 4XQGA 1BX1A 2VZLA 2C2YA 4PINA 2EBHX 4A5OA 4B4OA 4LNAA 4EY6A 1P9WA 2ZR9A 4Z8XA 1CR6A 4BFXA 4ZQGA 2O8EA 3VRHA 1PJRA 1GY8A 2SICE 2G40A 2M32A 2Z09A 1UBOS 3ORQA 1QIJA 2GZ1A 2OKGA 2V6BA 4D3YA 1ZVMA 3L0CA 4QUJA 1Z0JA 1BH6A 2DQKA 1Q84A 1K7EB 2HU5A 3C1OA 5K20A 4DB4A 3PNLB 1ORHA 4M6WB 4Z3DA 5I7HA 4L9WA 5KTTA 5GM2A 4EGJA 5FLYA 2HMSA 3SQDA 1CY8A 4QG3A 1E2IA 1PL8A 1Z5GA 4MYRA 4B4VA 4QXRA 4Y9RA 1HUQA 1KOJA 2JAUA 1GNTA 1TKCA 3A1UA 3ETCA 4LK3A 1KOLA 2PNNA 1M6YA 3L8EA 3EUVA 2JF0A 3K9GA 3RVBA 4KQGA 2WXMA 4JLUA 4ZVQA 1Q20A 4BIIA 2I7DA 1OYOA 3LRXA 3RU9A 4BS9A 1WNTA 4ZI3A 4QQRA 4PAWA 4BGEA 1E2KA 4PYRA 5FNVB 4EG1A 4NAVA 3KM0A 4YJ3F 4OREX 1M7GA 3PWKA 1ZK4A 3IP3A 1KEEA 1CRPA 2WG0A 4GYKA 4KAFA 2ZYAA 1QHXA 2IUSA 3E5HA 3GEMA 4PC3A 1SXJE 4IHQA 4XLLA 3RAGA 6LDHA 2ZJ3A 1E6MA 2BZSA 4AKSA 5MFZA 3WYNA 1RPJA 3OJEA 4B6JA 5B1YA 3EF0A 1HF3A 2G70A 3AVYA 2NACA 4DV6B 3ONNA 1AA6A 5DU2A 1CXZA 3ZUPA 1T2VA 2LIPA 4EI7A 5C7OO 2MYTA 4ES6A 3BK2A 3FUTA 4J94A 3TOXA 5DGXA 2IHVA 1B1CA 1QH9A 3LPNA 4EITA 2DYKA 5D85A 1FDRA 2QZJA 3B70A 4D1YA 4PNPA 3G1TA 2ZT5A 4Z9BA 4DQUA 2JFOA 3QK0A 1JDNA 4TXMA 5T5QA 5K0LA 4UE3S 3STHA 3TOCA 1JDVA 1DAPA 2QSZA 3ZWMA 5JASA 3MMSA 1JR3A 4B8AA 4KWHA 4AG6A 3EPKA 4P22A 1YUBA 3B48A 2GHTA 2Q5HA 3N39C 2ZU6B 4ZVNA 3GP8A 4CMEA 1IG3A 1GEGA 2BN4A 4JXXA 4NVRA 4CZ2A 1QJCA 3BDAA 2VXCA 4RSRA 4ZAZA 4BMZA 4OGWA 3A6EA 4YPVA 1PU2A 1WR8A 3WGUA 5KDDA 4MJLA 1QHNA 2XUJA 1QORA 5IEBA 3JQ0A 2WOOA 4IM7A 5CX1A 3OOJA 4GYJA 4JNKA 1AB6A 1GPKA 1Q74A 4AS3A 3KYCA 1KI1A 3H05A 1A5BB 3VDNB 3B1XA 3PLAE 1GKIA 6ABPA 3LZCA 2B0JA 1OX6A 3PFGA 4JN6B 4AMVA 3PR1A 2I2CA 2I4MA 5AR1A 5EIHA 1EE9A 2R4TA 3TLGA 3ZU6A 1K8RA 3GQBB 4UEJA 1GCIA 1TJPB 2NU7B 4R9NA 1RRGA 5AHKA 2Q1XA 2VDWA 3FP3A 3EIHA 4BUCA 2QZ4A 3E4DA 4ZVRA 3F8WA 2AUTA 4KAAA 2OBYA 2I4LA 3KJNA 1RKVA 3FKSA 4RQTA 3J5PA 3QVSA 4PM4A 4F46A 1JPUA 3Q12A 2ZUDA 1Y5LA 3BICA 1KVRA 3B20A 2HSGA 3ESZA 2HTFA 2R96A 4ZVLA 3IAS1 3ZXPA 3DKVA 1R8YA 1W4ZA 3AHDA 1VL8A 3HU2A 2OV8A 3EZXA 5G53C 1F3LA 4B6PA 3OTOB 4H7IA 4J1TA 4DLKA 3TLXA 3KB8A 3LF1A 1EQAA 4CQJA 3PZDA 2AJTA 1A9RA 4HS4A 3NBMA 2NO5A 4ABTA 3PQEA 3BJMA 3UK6A 2XUDA 2F4VB 1PGQA 4I1YA 2ZE5A 1PJ2A 3MGAA 1DOHA 4YTEA 3TSWA 1HI9A 4DCJA 2B9VA 5AKYA 2VAVA 2G88A 1MLDA 4URVR 2FLKA 2P5SA 3NRJA 5AW9A 4HVCA 3NP9A 1ZSVA 3KKPA 4CF3A 1F12A 4FBLA 2VRCA 4B44A 4P4GA 5BYAA 3P20A 1T1EA 3PC2A 2AR7A 3HG0D 3V6MA 5CB6A 4YAWA 4KZCA 2AG8A 3R1IA 1IK4A 5A0TA 1O57A 3GV0A 1ULBA 5DM4A 3G02A 4GI7A 5KYKA 4BLQA 1ZMTA 4FU3A 3OVMA 2GRJA 5JWRA 1G20E 1IXSB 1HE8B 1NJ1A 3RBZA 1GKYA 8LDHA 4HL6A 4DA4A 1WJGA 3CMMA 2Y1LE 4D02A 4ENWA 5FUWA 2WJ3A 4X66B 1Y6GA 4URFA 5LDDC 2IXEA 1T1SA 1BRMA 2DPHA 2HMTA 2LPMA 1TZ2A 3QVWA 4J0FA 4L07A 4L6AA 4XIGS 4TZ6A 4ZXFA 4ETMA 4JQCA 4IVNA 4PAGA 5GWXA 3W1VA 3F6CA 3SNHA 3C41J 4DUPA 2XUPA 1M0TA 4F2PA 3LLCA 4UVDA 4XOIA 4BLRA 1L5ZA 4L0QA 5F12A 2DCMA 2O2EA 2WFAA 3B2QA 4ZHQA 2CMKA 1H65A 2X0NA 2B78A 2DX7A 2GLXA 2J41A 2PL1A 4MEJA 4PCVA 3NIGB 2VDRB 1FTYA 4R69A 1HXIA 1T9AA 3CH7A 4PS0A 5C8ZA 1M2FA 2I2XB 3LFUA 4IWYA 4NZPA 3K9QO 5HPYB 2VH2A 3DYBA 1PCXA 1FPQA 4RDXA 5J9FA 1PT5A 2CSUA 2H11A 4KNVA 2I80A 4NCHA 2C9BA 2WKPA 1PQPA 1DCMA 1UBEA 3WK8A 4MUKA 2OO3A 4YLYA 1JG4A 2I66A 4JHXA 1QFMA 4DX7D 1GNQA 2OBLA 3CKLA 5DE3A 3FUCA 4BVAA 2FULA 2V3CC 1CF9A 1OWPA 1J70A 2V6FA 4G5YA 4WZ6A 4ZC1A 2QUHA 2WXNA 5BOVA 3SOPA 3HK2A 3U4TA 3FOBA 1KQGA 2NU6B 2MIIA 2X7HA 2WUEA 4IFBA 4TLLB 3KC2A 5EUQB 3KB1A 4AB1A 4K9PA 1CJCA 2WIDA 3FU0A 1BVUA 3PDIA 1N8TA 5EXDA 5AW5A 2RGNA 4D41A 3HFSA 5FFMA 5M3BA 4DCCA 3E34A 5AOCA 4AVYA 2HHCA 5FT9A 2IOQA 4TKMA 5DHTA 2B37A 3ZDBA 2ZT8A 3L0OA 4WGFA 4PGFA 4UVIA 1KPIA 4LGVA 4U8GA 2ZTVA 1JAIA 4J1NA 4B35A 4ND2A 5JCZA 1U3DA 3ZWOA 2W6JD 3MJWA 4WZZA 4UZFA 1H2ZA 2A5DA 1TNZA 3EOAI 1SPXA 3PXXA 1L4LA 1PV4A 3EIQA 1S8FA 4M38A 2BFFA 2O7SA 1PNOA 1WD5A 2W48A 3OJXA 1OVMA 4WK4B 5H82A 5IULC 2PCJA 5LZ4A 1KEWA 4Z86A 5KCZA 4B48A 4J91A 1XZAA 3EDCA 2NSDA 4MDHA 4ENPA 3JD4A 2O2JA 5CMYA 2KCVA 4RLYA 1LD3A 1UPUA 5A4MS 2FN9A 1S3IA 2WP0A 1SVSA 4PSDA 5LL6P 4Q7MB 4QDJA 4XASA 2WF6A 1TEHA 4ZRDA 1EGHA 5DCUA 1YB6A 2UZ1A 2BCJQ 5BRNA 4CL3A 3HEMA 3D3KA 5JARA 2ZSAA 3CGHA 1U0LA 5TY0A 3SZLA 4DR3B 1G0NA 2VHCA 5HKKA 3N7AA 3K8YA 1YDGA 3QV2A 3D0QA 1X9HA 1KHHA 3O95A 4MUGA 4OU5A 2IU0A 5EGNA 4C89A 4CT5A 4BVGA 4EVRA 5KVVA 3SBSA 4WAFA 2JW5A 3JAWA 1TTQB 4WCVA 3T0GA 4YMTA 3F6BX 2NVBA 3PG5A 3IUNA 2YINA 1AQ6A 4UAUA 2D5CA 3GZNA 3HU3A 1YVEI 1PY1A 3D3EA 1BOOA 3CRVA 5CLHA 1WPQA 2R47A 4ZQCB 1PZMA 3RWMB 4MYCA 4E4RA 1Z2OX 1XMQB 3RYFB 5CCDA 2V5QC 4J7AA 16PKA 4R2MA 2C7QA 3ZJUA 3B52X 1JVSA 5H1YA 3RAJA 2JEZA 3T3OA 4GQIA 3FUWA 3M6AA 4W7SA 4XGIA 1U11A 4OSEA 3CRZA 5CNIA 1WSDA 4LMBA 4TUYB 1IY1A 4RIIA 5JNTA 2ZRCA 3FIJA 5FYDA 2FWJA 1E1QD 2YWJA 2EATA 1VCHA 5ESXA 1KR2A 2X19A 1QMOE 1D2RA 2CHXA 4IIUA 3PPXA 4DMKA 1RLOA 1RXYA 1ZNZA 1BXZA 3KVRA 3OZVA 1R0XA 3VYWA 2NYVA 4KZKA 1JJFA 3DMRA 1G20B 1FCHA 1NFRA 4GZ5A 4IH9A 1XB2A 1NW3A 2RI0A 2Z30A 3PKIA 1UEIA 1VIDA 4RDIA 4CM9A 1C3OA 1YE8A 4BFCA 1RWWA 5KVSA 1KBZA 3IDSA 1G8JA 4EGCB 3U16A 4F8YA 4RHTA 4P7FA 1MBZA 1DBWA 2I2BA 2R1UA 3BD9A 4FLMA 1P17A 3A1FA 4WPGA 3SJUA 1E8OB 2H2DA 2WA1A 4GP7A 4N18A 4XWGA 1FX1A 4U07A 2FW1A 3KKKA 4EUHA 4DXDA 4QT4A 2FBNA 4EYQA 3IIKA 3JXIA 3ICEA 2FGKA 4RD6A 4RJKA 5CA1B 1JB9A 4TVKA 1MRSA 2YZKA 2CNNA 3LCVB 2O7RA 3GVXA 4CCAA 2PX3A 1NFFA 1VHLA 3A31A 3H1PA 4HYQA 1PJ4A 5K4AA 3FKQA 2EOAA 1Y8QB 2KYRA 1QLJA 4BY6A 1GGKA 4GTPA 3L7DA 2F43B 4YFYA 5ADVA 3T5XA 3ITKA 4I1IA 3RVPA 4ESVA 2CY0A 2XTNA 1NXOA 2Y1LA 5ED0A 4N9WA 4EL0A 1VL0A 3REGA 1YRWA 1LWNA 3IESA 2P5YA 4KQMA 5K7SA 3DULA 3ZDZB 4Q6WA 4WBSA 4BT9A 1CUJA 1P7PA 1ZKDA 4CODB 1B3BA 2RGUA 1T10A 1C81A 1G18A 1OKKD 4YMGA 5B6IA 3ERCA 2RK4A 1V1RA 2BR5A 4DIFA 4M21A 3KQNA 3EULA 2W6CX 5TF4A 4AURA 4X8MA 3QE4A 3K30A 1O6FA 3BXGA 1SOVA 1VECA 4Y3UA 4ZZIA 2HDWA 4WN9A 5D2CA 4EMUA 3RD5A 3AERA 3IDOA 3OKCA 1G8YA 2P69A 3OD1A 3JQFC 3K1JA 1UFVA 1XD9A 3UFXB 4BKMA 2GPSA 1R16A 3OMXA 5E2IA 3NR2A 2DTEA 4WFQA 4YCJA 3U39A 3MIZA 5THQA 3ZWYA 3HCFA 1GITA 3FTYA 2ID9A 1XHEA 4S1VA 3D6UA 3NGXA 3U9WA 3T94A 3CRMA 3BJZA 1EQ2A 1V8FA 2Q5LA 5D00A 2Y0EA 2D5AA 4ASUD 2IEJA 5EWMA 3CO5A 5DTJA 2BGMA 1NN1A 1NSTA 4H17A 3IJRA 4GWLA 5AJUA 1HH4A 3VYSB 1X81A 2XMCA 3EFBA 5CTAA 5L3ZA 2D2EA 4Q4JA 5EXEA 1N2HA 3U6BA 4DRYA 2CFTA 3R7AA 1JIXA 2A88A 3VH2A 2GRUA 4MIEA 1A71A 1QV7A 4RETA 5CDSA 4HORA 3CUWA 3GA0A 4KN9S 1J0BA 3PNYA 5ABPA 5HQJA 2BMAA 3O4FA 3ABLE 2VDLB 5DM2A 2WFLB 3N86A 5EJ5A 3UX4A 1IG0A 2WMNB 2XUGA 2QTFA 1CIJA 3WG7E 2VQ3A 3V79K 5EIBC 3SLGA 3V4PB 2RGAA 5LMNB 1XGKA 1F1JA 3TZBA 3QP9A 1W30A 4A82A 1F0PA 3EMBA 3R0XA 1YCHA 3CR3A 2YTZA 1UMCA 4HTFA 1DXHA 1TT5A 5CD1A 2NGRA 2Y3IA 3ZV3A 5FJYA 2V54A 3IIIA 4QU0A 4WBNA 4WLVA 1RXWA 5EDSA 4NYIQ 3CE6A 5KNBH 5KINB 2FG6C 3HLKA 3MZ0A 3U44A 1OB5A 2GMWA 4J1QA 3G2PA 4LSWA 4KC0A 3UQZA 4BPBA 1KZ1A 3DEJA 4H16A 2R5FA 3ISMC 3SM9A 3WDMA 4C4TA 1JCSA 3RFTA 1FFSA 4GDMA 3AU9A 4OYSA 4GBMA 4EPZA 1ML4A 4TKZA 2PO5A 2LR0A 4LOJA 1P1IA 4QU9A 3EPRA 5JOQA 2J0SA 5HE8A 3OIDA 2BE7A 2ZPTX 2V7UA 5LP1A 5JSKA 4TV8F 1EXNA 2P9LG 1KAMA 1PFYA 3I12A 3IOYA 1OH8A 4OEHA 2FMHA 3JR3A 3LX5A 5LZ8A 4AJEA 2FO1E 1B14A 3QLTA 5M7EA 3J81A 3BT7A 3KQQA 5DBGA 3I2GA 1HLFA 1ZXBA 1ZINA 2CYBA 3V46A 4PPFA 2IH2A 4Q3OA 4PYJA 2O8DA 3ZU4A 1KMHB 2A92A 1MQAA 2HPVA 3BE4A 4QXMA 3SAJA 6AT1A 1QTIA 1SH7A 2R68A 1QCZA 5CVTA 1GUAA 3HJTA 3KBBA 1Q3HA 1HQDA 2DHCA 1HMYA 5EYPF 1SBNE 1XA0A 3C3RA 1DFGA 2YNMD 3HDVA 3N05A 3PUIA 3PS9A 2D6FA 4UYJB 4PZCA 3TWOA 5ESWA 1EVYA 1DPGA 2HLDD 3AKDA 1J2TA 3THWA 1Y0BA 1P1FA 2QI9C 5TQVA 1V4NA 3PX7A 2J33A 1ZD5A 5JAUA 1Z2NX 5IP5A 1NJGA 1WSAA 1KI9A 5TT1A 5FA5A 2V9CA 3F47A 4DR5B 4TZ0A 3RC3A 2OQRA 2NO4A 4XM0A 2CHFA 5I8ZA 1N6HA 1QO0D 4N8EA 5AJLA 2JIPA 4HGRA 2F8SA 1CRZA 5HS6A 3R5JA 1YS2X 2N1BA 3SC3A 3FHEA 4JP5A 5M34A 2BGWA 1UDRA 4LE0A 5BQXA 4MI3A 5DB4A 2AV6A 3KQYA 2OTCA 2AF3C 1N6RA 4FWIB 5L4SA 3UJHA 4GL2A 5BWOA 1Z83A 1EX1A 4L02A 1K3UB 1MG5A 3NIWA 2IYUA 2AVNA 3JWGA 2H1SA 5BSGA 2H1OA 1YVRA 1JR2A 1MQ9A 2ID7A 2ZIEA 3K4HA 5BYJA 2LO6A 2F67A 2P3OA 4KMMA 4J16C 4MDYA 1X2BA 4DILA 5F21A 1B6RA 4HWSA 4PQFA 2HO1A 5EPOA 4UCWA 2J0QA 4R8RA 4BN0A 2VYVD 4RLSA 1VJDA 3EGEA 5DP1A 3A04A 4UE6A 3U7GA 1X80B 4RQAA 2GCPA 1ZUHA 1BPOA 4L1KA 4PSKA 4NOLA 3WTBA 1OV6A 1OLUB 1OXUA 4PZ0A 5NULA 2WF7A 3QU4A 3RFVA 5DNYB 3E22A 3I8SA 2RGEA 2QRHA 4IQFA 2I99A 4NBVA 3ZZTA 2NP7A 1KF0A 1XRPA 3CCBA 1N92A 1JQKA 4IFIA 1I1HA 4QOGA 3ZTTA 1W8DA 2WHEA 3I1FA 4PX3A 4BNNA 2DR2A 4DB2A 3DMGA 5HUQA 2WD8A 4GVXA 2R8PA 4QOHA 2IBSA 2QPOA 5A04A 4G65A 3G9XA 1YIOA 3NKLA 1ISJA 1W5BA 4O63O 3JTEA 1F17A 2WXFA 1GA4A 4ND4A 5HKLA 4DCVA 5BSEA 3QEJA 3L4KA 3K96A 4BVEA 3F6EX 3LPZA 3NDRA 4QYIA 1FXSA 2IV3A 4AF7A 2VWHA 4PTZA 1MB0A 5LDHA 3TNFA 2GD0A 4Q4HB 3V6LA 4AXBA 1RLTA 4CIYA 4P1ZA 4RAQA 5K6AC 3OWHA 3EWIA 1JZSA 3O4IA 2WXQA 3R7QA 2KBXA 1NSYA 2GN4A 1ENZA 3A7DA 1QHEA 1P1RA 5CIYA 4E15A 1G5RA 1RLIA 4V3CA 4YWJA 4DHEA 5IT5A 4JGIA 2J49A 2FQWA 4KYOB 1XKTA 2R2GA 5HVNA 2GK3A 3AFMA 2HN9A 4OSPA 2C7OA 3ZEAA 2JBHA 1JAZA 1U7WA 3N7UA 3BWCA 1YZYA 1TK3A 1Y7TA 2GPAA 3A28A 1AMNA 1BHSA 1IUKA 3ZKJA 1914A 2OXCA 3OO0A 2G25A 2C7RA 2RFMA 4ZICA 1AHNA 2W7TA 3BIXA 2QX8A 5DNDA 4AJPA 4DQ0A 2PYIA 1FRFS 1E3EA 4L9SA 2C4KA 2ZYUX 3HYRA 4N1AA 5SZIA 3WKDA 3WRXC 3ETHA 4BC1A 5K0GA 1DE0A 3HXDA 3CW8X 5KYYB 3EODA 2B0CA 3GGOA 3NWOA 3HZHA 3QYPA 1KSJA 1WTAA 1Z63A 2OG2A 2I62A 2I3AA 1X38A 3R4VA 5HA5A 5A05A 1Y6RA 4DYVA 5B2FA 4CM5A 3ILHA 3ZYQA 3HG7A 1VDMA 3TSZA 2G08A 2YHIB 1X1RA 5JI3E 1XZCA 4TWBA 1SY7A 4NJMA 4PRLA 4B93B 1PFGA 2JLCA 4J0HA 4S1NA 4A8JB 1J1UA 4IO1A 2B8WA 2XMSA 3ZW8A 2A1TR 2QTRA 4KGXA 4NBKA 4PZAA 2JCBA 1KVQA 1L8OA 4QPZA 5I9BA 1I0ZA 2RAFA 5AKZA 4EZKA 1U8TA 2R00A 4RK5A 9MHTA 2V4HC 1DBQA 2Q9AA 1SVMA 4JJKA 1JLLB 1KERA 4WKNA 5I9MA 3ZNQA 4K40A 1KWKA 3ND7A 1ONOA 1B0PA 2E89A 5BT1A 3JRWA 4ZVKA 1WOMA 3Q72A 4CL0A 3OJFA 3T4UA 4GCNA 2WSYB 3GJTA 3P2KA 4J7XA 3A2KA 2PG3A 1R0SA 4JI2B 2FRXA 3BA1A 3IP5A 1E7WA 5GV8A 2OCBA 4LN1A 4N01A 3RKSA 1VJ5A 4RS3A 1BGWA 3RS0A 5I7OA 1J7KA 2GA9A 2NZ2A 1DO8A 2TMYA 2ZP1A 4HUJA 2A8YA 4PFKA 4XJXA 5EJIA 1QIHA 3AUYA 1ATZA 1TCCA 2V7QA 2Y4OA 2YY5A 3KRTA 5FUVA 3IE1A 2OMEA 3E32A 1XA3A 2GKOA 3ZLTA 4KN5A 2AN9A 2YYSA 2CK3D 4YDEA 1V39A 1T1RA 2YWBA 1ID1A 3B6IA 1SCJA 3COYA 2DTXA 4MP3A 5H7XA 5SV2A 4PZLA 3SX0A 1J1ZA 1QHFA 3FTCA 3RSCA 4AX8A 3THXB 4L73A 2GH1A 2FZGA 3B3FA 2RH5A 2Q6TA 5DM60 1VPVA 621PA 1Y8MA 1RWMA 1ACLA 2PR7A 1RAHA 3AKZA 1D4AA 2G0NA 3C1TA 5JROA 3F2IA 3THRA 4J8FA 1LKZA 2P58C 4GMGA 2FJUA 1IK6A 2CLCX 2O2IA 2QD2A 3HRKA 1JLRA 1WCXA 3FLEA 4H3VA 1DCTA 2QW1A 3VLEA 3RK6A 2KMLA 3D6MA 1E5XA 1SUDA 1JTFA 2OD2A 3ZLBA 5KNBD 4DUGD 3PT5A 3TEJA 3HL4A 4G1BA 2QM8A 4NNJA 5AKLA 3E15A 4QATA 1LVGA 3D3NA 1J8MF 2GN0A 4FSHA 3L0SA 3L40A 2FFJA 3M3DA 2PTGA 3U4HA 4EYSA 3U4MA 4W8OA 1DJLA 1LI4A 5EQFA 3OLXA 5CVUA 1T4DA 1VJRA 3TM5A 1XZBA 2VYND 3LCJA 3P9SA 1XRJA 2ZTMA 4L8LA 4Y6OA 1G21E 2G9RA 1OH7A 3MCWA 3QC1A 4WK0B 1YQQA 4Z2AA 2DKFA 4EFNA 4NZNA 1M1NB 4LGMA 3C45A 3GVHA 4HQNA 4NMMA 3MUFA 5CNKA 1WXHA 1ITZA 3L0BA 1ULZA 4IVPA 1IOWA 3NM4A 3MWGA 1XQ9A 3GZ2A 1LPSA 3JYLA 4TTTS 4XDZA 5GJVC 2H4WA 4I1OB 3ESQA 4G56A 1U8FO 1DZ3A 1ZUWA 4OA8A 2NQTA 3RSFA 4TMTA 4OXYA 3V8NA 4BJ5A 1FYWA 1OFUA 3AF1A 1F8YA 4BOYA 4P3XA 2Z08A 1EFVA 1GARA 1EUCA 1KAHA 2HLPA 5DHPA 4QEDA 4Z8YA 4HYEA 1L1FA 3PYMA 3WMRA 2VDPB 1N52A 1U0FA 4FHFA 4YN3A 4R71A 1BROA 1MO6A 3NHAA 4J9UE 2WZCA 4GUAA 3RU3A 4CKEB 1XL0A 1PTJC 2UZ0A 2CYCA 1V2GA 5AM0A 3H0CA 1XWFA 2I8LA 2WXHA 4XDGA 5E7JA 1GL9B 2R85A 1U94A 3SZUA 5DW3A 3VR1A 2AL7A 3NUZA 3WV5A 4RGQA 1OZGA 2ZE8A 3DWIA 4GP9A 2Z4SA 4MQUA 3D7NA 3SKVA 1U28A 3F71A 4HLQB 5JO0A 3U7EB 1USUA 1ECGA 2J3KA 4EZJA 4ENVA 1WDKA 4GO1A 4H3HB 5DTEA 2JZCA 3V2XA 3I62A 1CNMA 2JEKA 1EB8A 5F2KA 3OY2A 1R6BX 3E0QA 3ZIAA 2PFKA 1X1BA 1WULS 4MLDA 1GW6A 3QBDA 1K97A 5ITZA 1JDBB 3EZFA 4FHDA 3WWOA 2R62A 4BQPA 5LSAA 3EUWA 1UFOA 4EZIA 2JK0A 4UYKA 2ACWA 1FUIA 3ENQA 2QD3A 1NQ5A 3A2NA 4TQAA 5F5NA 1TADA 5HIAA 2XZPA 4KIGA 4G25A 2GCNA 4ZGGA 3E6AA 2VGXB 1CLEA 4OOFA 5C5DA 4GKKB 1QHSA 4C1BA 1WMBA 3RG8A 2XDAA 9LDTA 2XYPA 3C70A 3H1TA 5I4CA 1EZ4A 1N7JA 3NTOA 5BW8C 3SIRA 4E5SA 1JDPA 3UFBA 5K8TA 3H5OA 2J5XA 2FWPA 3FGNA 1CJKC 2Y68A 3CEHA 3L4JA 1N77A 3AJ9A 1E3DA 1I51A 5AOAA 1NP7A 2C96A 2EJVA 4GZLA 4MUIA 2HFJA 1JCQA 2JVIA 4YLEA 3UI2A 2BFCA 3DCIA 2ES4A 3D1LA 1BXRB 3T7KA 4HRLA 1FVXA 2Y2VA 3DLCA 4GXQA 2WB4A 3USCS 4Q7QA 3HMKA 5J2UB 4M53A 1CUWA 1HTTA 1XNGA 2IEDA 3G2MA 4X7MA 5F1YA 1V4BA 4GMKA 4YRLA 5ICFA 5B2EA 2ATCA 3W5JA 1E2BA 2FXIA 4G84A 2RD2A 2PWBA 3K4QA 4CEHB 3IR6A 4HB0A 3AVXA 5JD4A 2X9LA 3HCBA 3QJ5A 3KQTA 5F2NA 5ITZF 1XROA 1M34B 2HZ7A 3DB2A 1KLXA 4K9LA 2X8AA 4KXQA 1F06A 1RSZA 1CC1S 4A0GA 4CQLB 4PYLA 3QOXA 3UAVA 1WY6A 3D43A 3DC7A 4QE3A 1A9XA 1A8IA 4K9NA 3HBNA 4J9VA 2OVBA 1E6LA 2J48A 4GMDA 5AM5A 3JQBA 4YACA 4E5UA 5B53A 4A0RA 1K7FB 5JBNA 1NUHA 3IALA 1EFRA 1JH8A 3N1UA 1O96A 3LWBA 3ZW3A 4OCZA 5EMLA 3FDJA 1XTVA 5GONA 2H2GA 2J08A 1IMOA 3WRWA 4L95C 4RKEA 5BWBA 2NOAA 4DWJA 3RF6A 1X8KA 5TDHA 3TOZA 5IT0A 1IQUA 3ONLA 2C98A 3VKHA 3FTUA 2FKAA 4MPDA 1Y9EA 3QB2A 2WVGA 4L8YA 5I9IA 4CMJA 1T1GA 3ECAA 2YBDA 1Z47A 4IHAA 3LVQE 1R0LA 3LX6A 4IJUA 4HH4A 1CUEA 1STOA 1W47A 1D6SA 2PSEA 3AP2A 3G9ZA 1SHLA 3LPLA 4K6KA 5K3BA 2D7JA 4BTVA 1T5DX 3KFXA 4HBGA 4CTNA 2I3DA 4WZAE 2ZVPX 1TYEB 5KU7A 1QPBA 4UU8A 5G0TA 2I4NA 1SQFA 1UJ6A 1XMIA 2V7GA 1HDXA 1X15A 5DMXA 4X91A 5KNLA 4BERA 4U3JB 4UDXX 1NR5A 3TTUA 5HP4A 5CFQA 1A9ZA 1C0EA 1WMAA 4CDRA 2F59A 2W2VA 3NETA 4KQHA 4EGSA 5BMOA 1EUQA 3JQQA 2Z1NA 3AEKA 3G8DA 5JNSA 2XUIA 3H5RA 2WXIA 1YKGA 2PJUA 1RYYA 4NACA 3G9TA 5EIBE 1G59A 5ILOA 3PQ5A 4W1QA 1GV1A 2FA9A 2V7TA 4RFLA 4B6QA 5F23A 3I0ZA 1B8OA 2VDVE 4XTCS 3PEUB 2X2EA 3DDHA 4N54A 2EIXA 3GEEA 3WMEA 3H04A 4WWPA 1ESDA 3OAWA 3D3WA 3MJRA 4MVJI 4YALA 3PVLA 4YP6A 2C8JA 2E7ZA 3UINC 2DOKA 1PDOA 3D2AA 2H29A 2I6HA 3I58A 4N7BA 4P36A 3ZY4A 4DUGA 3MTQA 1ZSYA 4KK4A 2W93A 4DE5A 4XEIG 2ZVDA 1H0RA 3HUEA 1PR5A 3L7MA 3ADBA 3JQDA 3ANSA 3ROXA 2RBKA 4X95A 5EHGA 1ORRA 3DKIA 2FZ5A 2OGZA 3EGVA 1J8QA 4RD0A 1QAOA 2FN3A 4ESEA 3RDPA 4EHLA 4RTNA 1QP4A 2RI6A 3MLBA 1KE2A 3VO8A 2V5AA 3P9YA 1HR0B 4HGNA 5HS4A 2ADOA 1FX0B 1XRLA 1K7XB 2PNFA 1XAJA 3QUSA 1GAXA 1WABA 3NYIA 5KQSA 1MX3A 2X22A 3H9QA 5FTNA 3DFMA 4F4JA 4M7OA 1Z0IA 4DDKA 2RAPA 3G88A 1KBQA 1F7UA 2IOFA 1OBVA 2V45A 4RK1A 1ULSA 4BQIA 2AZMA 3E1KA 2PMWB 1A1SA 5TT0A 1H2EA 2P9BA 4KSBA 1GCGA 4RABA 5ARDA 4G4JA 1U2GA 4TQGA 1G55A 3QTBA 3AP1A 1N0QA 4UPDA 3VZRA 2HBYA 1SFRA 3W34A 5IXSA 3ETLA 1CF4A 2EWWA 1VQ1A 2XUOA 1QE5A 2WWFA 4M86A 5EC8A 4TWAA 3RYIB 4U0UA 2NG1A 1CY1A 3H17A 1YULA 1ZM3A 3CR3C 3WLFA 1U2VG 1IJEA 3T0FA 2OL4A 1MF7A 1C80A 1L1QA 1NNLA 3HR4A 4RQUA 3RFFA 5KQLA 2FMFA 1IJKA 1WB9A 1NXWA 3D9PA 3U0BA 3A27A 2XYHA 1QQ5A 1RI5A 1U3VA 1OWLA 3CKBA 1QH0A 4D46A 2Q3CA 4LCEA 3IIEA 3PC4A 2I2OA 1FDUA 2OESA 1Z4QA 4CMHA 4L75A 2WI8A 3C3WA 2WVIA 1RFLA 5JU6A 3G49A 5GJCA 5GJBA 4YCDA 5JYDA 2BGKA 4Y1GA 5LQJA 1N2IA 2AQKA 4GIBA 4FR0A 4HLUA 1N2CA 3G9QA 4KVFA 4UAGA 1X8LA 3VH3A 3ZGOA 1VJ1A 2JK1A 2ZT7A 4WZAB 1SUWA 2QT1A 3L6OO 4NJEB 3OEHD 1P5ZB 4ER5A 1H1LA 3AQ4A 3TN7A 4DREA 1VYUA 4RLFA 4ZVSA 5D3MA 4ZGBA 1WQ1R 3GJ6A 3DZ8A 3LHSA 4QPJC 2HLNA 1MHQA 1E94E 4IG9A 4XOUA 5CYOA 4JBXA 1RABA 4W5TA 1Y4UA 4GLFA 4U7EB 2O6LA 2IZ0A 2J7PD 4ZJYA 3O93A 3GZSA 1T0PA 4F45A 3ZXIA 2BKUA 3CPSA 4QVKA 2D1QA 4F86A 2IHUA 2AOUB 4JROA 4ARZB 3X2SA 3DSVA 2HXYA 4C78A 3GDWA 1XAIA 3QMWA 3JD3A 3SEAA 4DMGA 2PUAA 1WKCA 2H1IA 1QZZA 1IU9A 3HP4A 2JI7A 4GWKA 3ZE2B 3GCDA 4OHUA 1RRKA 2C84A 1FYDA 1F1BA 2PKQP 4G0NA 1ZHOA 1CDZA 2P41A 1QRRA 1USWA 2PAAA 1P3JA 2QNBA 2RKOA 3FR8A 3GZTB 3KHKA 3U9LA 4KH0A 3I5XA 2W9XA 4DUYB 1H23A 5A62A 3FJOA 1ZIOA 5IJ0A 1JU4A 1QO7A 1EEHA 3PFKA 4GE3A 4C0EA 3D6NB 3TW6A 1XEXA 4IG4A 2OCYC 5IBPA 4MPRA 1NZDA 4LZPA 1W85B 1YOVB 1VE9A 1JBKA 2EYQA 1HYGA 5DX8A 1RRPA 2DZOA 2RH9B 1L5HA 3QSGA 3WRYA 4IVQA 1KJYA 2ZJ6A 1KYIA 3H84A 3U7QA 4Z4HA 4FDAA 3TTSA 1K0FA 3IPXA 3TB4A 2BFDA 3HXQA 3U3WA 1KZ4A 1DUSA 3GPBA 3FTQA 4X7RA 3ZIUA 2VP6A 4XJSA 2VJQA 2W2QA 3M82A 3PD1A 4I66A 4NOJA 4RFSA 5AUQA 1OFHA 1RZVA 1E2UA 1ODTC 5TPWA 3I83A 3QVTA 5ER6A 2FPGB 4KPUA 1EFCA 4HDKA 4HNQA 4JVSB 3QKRA 4K28A 4L85A 4HLDA 4I9CA 1FFDA 1P73A 1VG9B 3R3XA 4QQIA 1K6XA 1U7DA 2VN8A 3QMVA 4QXOA 3EHNA 2XVMA 5GAJA 3OZGA 4TPKA 2CLHB 1GGVA 3QUCA 2PL2A 3UM1A 1OGJA 3I6MA 3NHMA 2SKEA 4WZBE 2ZR7A 3WB2A 4GPBA 4J0UA 4QBHA 4G0QA 2G4LA 2AJ8A 3JVUA 4KPGA 2Z9DA 2ZYVX 4UUMA 1ZBPA 4U4AA 5AXAA 3ZPXA 5B1SA 1GQYA 1O1TA 3STTA 2W2KB 3A26A 3RWBA 3RO3A 4BNDB 4JOQA 3IULA 3AG2E 3AERB 3KAJA 2PX8A 1J8DA 3MBIA 3EGDB 5J5AA 4Y6SA 4TLAA 3OOHA 1PQ4A 1PUIA 2HXGA 2W43A 3OOWA 1CDOA 2CMGA 3WLLA 1BI7B 2XZDG 3ZFWA 3EMVA 4OYLA 4YRJA 1VL6A 2ST1A 5JANA 5LP6A 4EY4A 3HM9A 1SCKA 3KT8A 1NXXA 1LK0A 2B99A 4FN4A 4XUCA 3E22B 2YXPX 3HN7A 5C5IA 3BKXA 4DI4A 3UTCA 1E2HA 1RYHA 5D5QA 4IHJB 4N2SA 4GPAA 5CDYA 5IF9A 3UJBA 1G60A 1FDTA 4M3NA 1MTZA 4XGRA 1DKNA 1R0BA 1W5FA 4RSGA 5JMWA 3FU5A 2ZYTX 4JI4B 2I1JA 4HBDA 4JY7A 1G7SA 5BR1A 5IDXA 2LCIA 3J7AC 3TW8B 4RCZA 3WXXA 2D74A 3VU1A 1IN6A 1VG0B 2YXEA 2ZZNA 4B82A 4QVIA 5CERB 3VR5A 4HPXB 2H1LA 4U96D 3U44B 1C2TA 4F9FA 5EX3A 3RT7A 2NV0A 3G89A 3L0IB 3A25A 4TUUA 2XUKA 4D0NA 1JCRA 3AYZB 2ISQA 4C7JA 2I9KA 4ZIRB 3WGZA 1TF5A 4XIYA 3HPQA 1QZUA 2WJZB 4O25A 5F76A 5AW7A 4HNHA 4B3TB 3MB5A 5K8IA 2BMDA 1NW7A 4KU4A 1ZJ6A 1A0OA 2GAIA 1AGPA 2V58A 3MOSA 5A7GA 4Z4CA 3MHTA 2GEJA 2ZWIA 1FUYB 3H1AA 3H5NA 5C1OA 1AN9A 1ETHA 1JT2A 2XYQA 3KWLA 1S0UA 2WXPA 3L79A 2I9PA 1FL9A 2JFVA 4AJWA 1WXXA 2Z5LA 1L3BA 1D2EA 1T9CA 1E60A 3ZXXA 2YHAA 4DQVA 2HQOA 4YAUA 1MFZA 4EYKA 2FMTA 1C30A 3RJ5A 3AJDA 1O7JA 1VA5A 4AYWA 3WLMA 1JA1A 1ZGHA 1A9TA 5T64A 1XWIA 4HB5A 1NUPA 121PA 1ESCA 4BV2A 4LNBA 3HN6A 1FZTA 1E9BA 2YASA 4PSUA 3N0TA 4Q19A 4Q93A 4U00A 5K3FA 3I72A 1H4VB 2CJXA 3U3RA 4RGVA 4DW8A 3HB5X 1PK9A 2CDCA 4Z53A 1BSVA 3G5LA 3V8MA 4BNVA 4XKCA 2GQ0A 3ZCSA 1RYNA 2AD1A 2Q5FA 3Q79A 4FVTA 5FOVA 4C4XA 4HQ6A 2CLMB 2RK3A 2QZAA 4Q18A 1YMQA 1V6AA 3J81k 1KS2A 2NIPA 4TRRA 3ZQ4A 2CKDA 3H9BA 3AW8A 3TGOA 1DKQA 3NNSA 4MUJA 3A05A 4ME2A 4CM1A 4EO9A 5LKAA 1BDIA 4N12A 1UMBA 3RV4A 1QS0A 3PNOA 3LC1O 5K3OA 3HA7A 3NRCA 1A4XA 3BMCB 2ZSIA 4CV0A 3EW7A 1WW2A 4WQMA 5CJJA 2X77A 4BESA 1MT3A 4E03A 4EUEA 4JW1A 1PAQA 1XP5A 1TUBA 4K5CA 2F8MA 3KWJA 3VMFA 1HG2A 5BSHA 3OEHA 5I47A 3H8SA 5F4ZA 4ZVUA 1E1RA 5FH9A 1QH1A 4WKCA 4AQDA 1A9OA 2ORYA 3V8EA 4QDOA 4EPRA 2QHXA 3RRMB 3QELA 2ZIXA 4J2OA 1BWQA 4QAQA 4TN5A 2KI5A 4Y6WA 1F2UA 1QAQA 1Z38A 2H1RA 2P1ZA 2XRYA 2Q5IA 2UDPA 2VL7A 3BORA 3C87A 3OHPA 4KQFA 2E18A 1UXKA 1IHOA 3AJRA 3EXEB 3GN1A 3IQGX 1H22A 3WLKX 3IQFA 2CFZA 1LD8A 2DJIA 4NPHA 5EHXA 3I92A 3O21A 4D98A 3AM5A 3W5SA 2BKVA 4B4UA 4UTPA 2VJPA 3MXOA 5A3VA 4UQLA 5I5EA 3EIEA 5LQNA 4I5FA 1NRJB 1NUUA 1TZJA 3MF4A 2CFOA 4ZU1X 4YMIA 3SX2A 2X42A 4RTJA 1Y80A 3DE0X 4B6SA 4ILHB 1MZCA 4Z68A 4K5BA 1C9EA 1ZN2A 4RZQA 3LKUA 1R4ZA 4MGZR 4C4PA 5DI3A 5HIKA 5ELXA 5GVSA 3JD2A 3EXHA 4P3KA 3DBVO 2J5BA 4TMVA 1Q7RA 3T3GA 1BMFD 2UVPB 2CZQA 2O59A 3AL0C 4EUFA 3PRZA 2ACKA 1G6KA 3LV8A 2FOXA 1IUOA 2OP0A 2CNKA 4B0PA 1I4WA 2GEFA 4JK3A 4Q34A 4RMHA 4EPVA 4MRPA 2HK6A 1G6HA 1TM2A 3DDNA 1UPXA 1ACMA 1D9XA 1R6DA 1O95C 1IRXA 4IXTA 1U63A 4U63A 3QENA 5E4YA 1BD8A 3I2IA 3ZLVA 2D8MA 2GAJA 2F6RA 2PJZA 3D81A 2G9QA 3DLIA 5A5FA 3MEQA 1KK1A 2ECOA 3E58A 4NS4A 4CFZA 3BWEA 4EATA 5JI2E 3FOCA 2LIVA 2ZJ7A 2PVSA 3PCTA 1GL3A 2FOIA 5AW1A 1KY4A 3F7MA 3ORFA 3W6UA 4AMGA 1XJCA 1HDRA 3R7RA 2Q1SA 4KLNA 4D82A 5F9FA 3EQ2A 1OFUX 4D4GA 2YQ8A 3FYUA 4UCXA 3GZNB 2BFBB 4MLPA 1ISRA 4JJ4A 5BR4A 2Z8YM 4PSVA 3ZW9A 2XCBA 3RG2A 2C9MA 2C1XA 2IQCA 2XTZA 1KFCB 3MOIA 2Z57A 4Y6LA 1KJQA 3WKCA 2PYDA 3SIWA 3T1OA 5AARA 3SZ3A 1IATA 2M6SA 3M4NA 2IZ6A 3EDMA 1CY7A 4OQ4A 4I36A 2E5LB 3FF4A 2V4UA 4R6WA 1F7VA 3I2FA 2I71A 5AHRA 4V1CA 4PZPA 2P7IA 1BVYF 4MS1B 3R9MA 4BEBA 3W5DA 4MO2A 1E59A 5D7BA 1R2QA 5AM3A 4E7PA 1T9DA 2V65A 2FSGA 4IJ5A 2HKIA 2WE7A 2E55A 2XOKD 4I3FA 1A82A 3SVZA 5KC8A 2X2OA 2IHZA 4S1PA 4Z0NA 3EQ7A 3TL6A 4CCYA 2W42A 2VPQA 3K6SB 2Q0SA 4RV9A 2UXDB 3CNNA 4OO3A 5E0OA 4RJLA 3ANTA 2BAGA 4TVOA 2HZBA 3ISVA 1QNLA 1Z68A 5ITVA 3TBFA 4EJSA 4U6SA 3TUZC 2J46A 4J07A 3QI2A 2L2QA 2PPVA 4IS2A 4N41A 1QDEA 3HCOA 3KLMX 1XK6A 2WZBA 5LBIA 3ZDRA 3QLVA 1ABBA 5J4HA 1VSBA 4BBZA 1UJNA 1H9CA 2YNMA 4PDXA 3PLRA 4NRHB 1VLVA 2IHKA 3KYDB 1L7BA 3O4ZA 4FMCF 1M33A 1K0UA 1ZONA 2QS9A 2OCLA 1E20A 4HOTA 1BJTA 3HFGA 4TYMA 2QD1A 5IAAA 3RKRA 4INZA 4HVBA 1SHTX 2HYDA 3AF5A 1IQPA 4LC0A 1J7JA 3WWCA 3OZBA 4CKBB 3MA0A 4FI3F 3JWEA 2ZETA 3E81A 2LTAA 3TIIA 5G0SA 4NZOA 4QRIA 3ER9A 3F1LA 1N6PA 5EFOA 3EARA 2J5RA 2BZGA 2NLOA 3RI3A 5KYUA 2DBQA 4I9GA 4PPQA 1M1YE 3AINA 3VBCA 2JPDA 3AVTA 1N6IA 4BYMA 1E0KA 3T1VA 2ACEA 3RYFA 3BCSA 1HLDA 1G3MA 4R51A 4L1BA 4DYDA 4R68A 3ZR4B 2ZRPA 4KO1S 2C92A 4HEA1 1OWNA 5BUZA 2GVNA 4K1XA 2O8DB 1RWPA 4RM3A 5IDYA 2FPIA 2QTNA 3QLJA 4D80A 4HOYA 1CRLA 1U80A 4GMLA 1LVHA 5J40A 3FYTA 5E6SB 2QRJA 3O73A 1O94D 2FR8C 3X44A 3ZU3A 3IT3A 3EN0A 4JASB 3O1IC 2ZSUA 1AKRA 3ELDA 4GEKA 3UTMA 4BETA 1J5XA 4JGGA 4NPAA 4GMXA 4ENQA 4BB0A 4D8TA 3M4JA 4N5IX 4IIVA 3KQWA 1NT4A 4EJSC 2J45A 1P4HA 2H0QA 2EKPA 4AJHA 1Q3TA 4KVOA 4HD8A 4D42A 3HCEA 4H4EA 3FYSA 4QEKA 3HCDA 4UASA 2ZE6A 1JPVA 1UBGA 3M5DA 1C7EA 3O0TA 4FYWA 1E18A 4L3WA 4NECA 3T3DA 1JFSA 1TAUA 2XD4A 1KORA 3GUHA 3QKUA 2F37A 4YRTA 3HBJA 4KRFA 3CPHA 2ZRDA 5AW6A 2RD0A 3OPYA 3KTAA 3QARA 5C2YA 1HEIA 1EXDA 2BGJA 4Q37A 4UCFA 3UJ8A 4V0KA 5DOZA 3THOA 1YWGO 3OCVA 1C0KA 5FQ8A 3NO4A 3I04A 3Q15C 5GZ1A 1XPRA 1W36B 5JJIA 1WXFA 1EH5A 4M9ZA 2BFEA 3LZ6A 3VUEA 2AMLA 2O54A 3LT2A 2IYEA 1YR9A 1KH2A 1HTBA 1KI6B 2CFIA 4GOKA 5FPSA 4BXOA 2QT9A 3DEAA 3TWVA 2WR8A 3AUUA 3KFVA 4A2CA 4CKEA 3IMGA 3K1ZA 5CBPA 5K8JB 1L0BA 4G8LA 5JJ5A 3IR5A 5GOZA 2VXYA 4I6JA 5B58T 3QY0A 821PA 2WMNA 3RUHA 2HRZA 4BSXA 3L0PA 2G5CA 2JIBA 3OKPA 5GONB 3VTYA 5LPNA 5LLSA 1WPGA 5BPHA 4G0MA 1W4AA 3G3EA 2PS1A 1J06A 1U1EA 2HA2A 2QJFA 3Q6MA 4UE2A 4E88A 3EPLA 2V1UA 2WJAA 1WD7A 2C42A 4MK4A 3DAHA 1PSZA 1SVWA 2WU8A 2I54A 3M6VA 5HS0A 2NAPA 3DQPA 4MKRA 5I8WA 3KE8A 1JH9A 2QSUA 3TX2A 4Y1FA 1Z2EA 4CQLA 4BHTA 2VTBB 1Q7GA 1TLFA 2RHJA 4RESA 5KNDA 1QTNA 3TLBA 1UKYA 3S2FA 4P4LA 2HCJB 4UI9K 4KZPA 3MS7A 3CIAA 2W83A 2Q4TA 3FHLA 3M83A 2ATIA 2PNJA 1WBJB 2WJ4A 1VA4A 2XTJA 3JPWA 5EA2A 2AFIE 4XJTA 5EJ8A 3S8YA 4EARA 3G6KA 4KACA 2ZATA 3X1KA 1VRWA 3ZCPA 3A0UA 2X0DA 2L82A 1SUIA 5BVHB 4MI1A 2D59A 4EELA 4EUKA 5EKXA 4WESA 1W3BA 1A96A 3VCXA 1PX2A 1TMKA 2GTPA 3CH4B 4NZYA 3KB2A 1TLLA 4XA8A 5AKIA 2EX0A 1OUMA 2W0MA 3KKEA 3MCTA 3PXUA 2RC5A 2VZ9A 5AW4A 1VCOA 5D87A 1RJGA 3QF4B 1BKYA 2A58A 1USGA 5CG1A 1TQ8A 3G85A 4L3VA 3PDJA 5EG5A 5I7AA 2NXCA 1EX7A 1H9AA 3CHRA 4M9XA 3NB0A 4MRNA 3OIUA 2DHDA 3QQ5A 4W5JA 3PIIA 2GARA 1AK1A 2GZSA 3U3MA 4A3TA 3E5MA 2BKEA 1NLZA 1AUXA 2FPKA 2PKCA 3LUKA 5EJMA 2G6BA 1I0IA