4N3CA

Crystal structure of human o-glcnac transferase bound to a peptide from hcf-1 pro-repeat2(1-26) and udp-glcnac
Total Genus 279
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
279
sequence length
716
structure length
697
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title HCF-1 is cleaved in the active site of O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/substrate
total genus 279
structure length 697
sequence length 716
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3cA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3cA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4n3cA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4n3cA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n3cA03
3MTAA 4KXKB 4G26A 3RSZA 1JEJA 2XA1A 3R9AB 2O6LA 3UQ3A 1J39A 3VUEA 5ENZA 5D0QD 3D1JA 5CCMA 3HBNA 3BDAA 1NA0A 3GZ2A 3Q15A 4MHSA 3AS4A 2P58C 1ZU2A 1L5WA 1VGVA 4GZ6A 1P2BA 3MT8A 3QWPA 3WADA 1HZ4A 5FTPA 2R60A 6GPBA 3MV2B 3S7JA 5G04J 4RIIA 4F97A 3OXGA 4F96A 3BEEA 2Q7FA 4BWRA 1HLFA 2DBAA 3S7BA 1C8KA 3CUTA 3S27A 4Z5XA 3MA5A 4HOSA 3OKAA 1NZNA 4GPBA 3E3LA 2WTXA 1FTWA 2C1ZA 3L7DA 2SKCA 1KT0A 3C4QA 1AHPA 2QNBA 2QRPA 1GZ5A 3ZCPA 2JLBA 3C4VA 2XGMA 4HWGA 4XIFA 3TGOA 2BISA 2YJNA 5A7DB 2JJMA 4I2WA 2VGXA 4N3AA 1E1YA 2F3SA 2C0MA 2ATIA 1B89A 1P4JA 1FTYA 3ZCVA 1C50A 3COPA 3O3CA 1P4GA 3K9IA 5FZSA 2SKDA 4NRHB 3GZ1A 2KCLA 3G2KA 2V5FA 3L7CA 4M60A 2UWJG 4BFCA 1HXIA 4H7YA 4KBQA 5KJNA 2XEVA 5BW8C 3SF4A 2XA2A 4G1TA 4WADA 3VTXA 1FU4A 1FTQA 1P2GA 4X7MA 2QLNA 3OT5A 2XGOA 4UI9K 3GUHA 4GCOA 2ACVA 4MI3A 2VCEA 4O6FA 3WXXA 2QN1A 2UY1B 2X6QA 3ESKA 3KS2A 2IW1A 3MS2A 3MT7A 4EQFA 4M83A 3RU0A 2ECPA 3NC4A 2LSUA 4RIFA 2FI7A 3E3NA 3MQFA 2WQHA 4WUYA 1NVKA 4JL0A 5DBKA 3ZHEB 1FCHA 4HOUA 3S0JA 1ELWA 4RG6A 2PQRA 5AYWD 1JG7A 5LCWJ 1RZVA 4GYYA 3CV0A 1L5SA 3L01A 1NLMA 4I17A 3T3EA 1KLXA 1GGNA 1OUVA 3VDNB 4G25A 3L7AA 1IXYA 3Q3IA 3KAEA 2R4UA 3SZ7A 1A8IA 4U0UA 4W9RA 2L6JA 3QWVA 3RO3A 4UI9C 3D0QA 5LCWC 3MRVA 2Y4UA 4J0UA 1C8LA 4MRAA 3TG4A 5TVGA 5TMEA 4HOTA 4NQ0A 2GPNA 4ME2A 3BD6A 2KC7A 5CCLA 3AS8A 2PZIA 3CKCA 2AZDA 4X6LA 1JIXA 2G9UA 3EDTB 3ZCTA 1Z62A 1Y8MA 4U0ZA 2H1HA 2R4TA 2XMPA 3Q47B 4N2QA 1Y8ZA 3URZA 3CUVA 3QHPA 1WV0A 1W3BA 2PRJA 3GYZA 1FS4A 4YVQC 3GW4A 4JA7A 3MS4A 3VUFA 4X7PA 1YA0A 1PSWA 3H4TA 3ZCQA 2IFUA 2J9QA 5JJ6A 3ULQA 4JHRA 2HY7A 1NZFA 3IAAA 4J8EA 4GZ5A 4FKZA 5D0OD 4GCNA 4GPKA 4CTNA 3AS5A 4WNDA 5ARGA 2ONDA 3FROA 1H5UA 5TMBA 3CUWA 5TMDA 1V4VA 3QKWA 2BUGA 3TOVA 4EJ2A 3ZFWA 4B94A 2SKEA 2XCUA 3CVQA 4AY6A 3DZCA 1FU7A 3MBOA 4WHMA 2KCVA 1M5RA 1JIVA 1QM5A 5DXFA 3MRTA 3LY9A 4U07A 3RHZA 4NC9A 3HBMA 2ZB2A 5C1DA 3T5TA 5IKPA 5DIZA 1LWOA 3FP3A 5FJYA 2VG8A 3QDNA 1AXRA 4X7RA 2BGTA 2IUYA 2XPIA 1WUYA 2R5SA 4AN4A 3ZN3A 3CV3A 3UPVA 2C2LA 2QN8A 4CTMA 4EL0A 3TAXA 4KQMA 4LEUA 2QFCA 1P29A 2H1FA 3UYLA 3RT1A 3VTYA 1ABBA 5DLDA 2LSVA 5ARFA 4JA9A 3PDNA 3ZCUA 3NB0A 3CEHA 2HO1A 4GA0A 1GPAA 3RSCA 3CVNA 2QN7A 2XCIA 4UQZA 2PQ6A 5JTUA 4YVOA 1FA9A 2R66A 4HOQA 2KATA 2G9QA 2BFWA 4KYOB 4BTAA 4RELA 2IV7A 1UQUA 4N3CA 3LY7A 2VQ2A 4I9EA 2X6RA 3NF1A 4RBNA 1XL1A 4WNGA 1YA6A 3ASFA 1QZ2A 2GPAA 4GA2A 2QRMA 2XGSA 2UY1A 2I6HA 2GT1A 2YHCA 3DDWA 4ABNA 4KQ2A 3BD8A 3EBOA 4AM9A 2PYIA 3NAZA 4FZRA 1Y6GA 4W6QA 2BGUA 5HI7A 2FFRA 4I1AA 5KJKA 3MEKA 1L7XA 1QKJA 5IKOA 1JG6A 1Z8DA 3RO2A 1PN3A 2R68A 4N3BA 3C48A 4AMBA 2KCKA 3ZCSA 1UQTA 4UI9J 4RIEA 2X0FA 4J8FA 1JIUA 1P2DA 3LY8A 2IV3A 3TG5A 1FU8A 2HYZA 1RZUA 2QZSA 3G2LA 2ACWA 5FZQA 2AMVA 3T3IA 3HBFA 5DU2A 2X0DA 3BCUA 3FFLA 1YGPA 4I2ZA 1L5VA 1F6DA 1NOIA 3Q49B 5I45A 2NC9A 3LYAA 2QN2A 1PC2A 1WW2A 4GA1A 4PQGA 4AIFA 3BCSA 3PE3A 3EBPA 4WNFA 3CEJA 1XV5A 1WV1A 3Q5MA 4APOA 3QWWA 1GFZA 2IYAA 1F0KA 4KQ1A 3SYRA 3LCAA 3WC4A 2E2EA 1TJCA 1WAO1 1P4HA 1P5QA 4N2SA 2IEIA 2Y4TA 2AW3A 3HBJA 4H7XA 2JZCA 3H4IA 2QN3A 1PYGA 3TSAA 2HR2A 1B4DA 4RIGA 4LDPA 3KD7A 5JTTA 1HH8A 5M72A 1L6IA 2FF5A 3CUYA 3Q3HA 3CEQA 5EKQD 3UUXA 4L22A 5D01A 9GPBA 1NZDA 2VSNA 4F9FA 2GW1A 3QOUA 1XL0A 3RKVA 4MHOA 1XOIA 4WNEA 3CK9A 1ZBPA 3L7BA 3MV3B 4G24A 2P6PA 4CGWA 4WACA 1GG8A 5KJLA 2GM9A 4F3VA 1XC7A 1BX3A 4YNDA 3U3WA 5BT1A 3FWVA 5LQDA 1O6CA 3L79A 3SYMA 1K08A 4EKEA 2XCCA 2VSYA 1NOJA 3CUUA 1L5QA 1SXPA 1GPYA 3CVLA 4YI5A 4REMA 3Q4AB 5EX3A 4Y6WA 4LEIA 2QRHA 4N5CA 5G05J 2FETA 3S2UA 4XI0A 3MKRA 3OKCA 5JJ7A 2C1XA 3T3DA 2FO7A 3G2NA 4G23A 1C3JA 1LWNA 1A17A 3WAGA 2KS6A 2PYDA 2IYFA 4BT9A 5GPBA 2VYIA 2C9ZA 4Y6CA 3GPBA 4HLNA 2F9FA 5A6CA 2FBNA 3CX4A 5G05C 4AY5A 3RIBA 3S7DA 4U0SA 2MHKA 4MI9A 3G2IA 2Q6VA 3MS7A 1WW3A 3AMVA 4RIHA 1QQEA 4HORA 4XI9A 3IA7A 5D00A 3ASDA 3O48A 1SXQA 2XA9A 4G2TA 3JYSA 2IEGA 4CGVA 5G04C 2OOEA 2G9VA 3ZCRA 3HYMB 1NA3A 4IN3B 4N39A 4NEQA 2F3QA 5HQ8A 1RRVA 3MSCA 3OKPA 1GPBA 3VDMA 1Y6FA 1ELRA 1Z6PA 3S28A 3N71A 3ZHEA 1FC0A 2VGYA 3QKYA 3RJVA 3OTGA 5JJTA 4CDRA 2VGXB 4RENA 1Z6QA 2OFFA 2XCBA 3CKBA 2QLLA 3S7FA 3T7DA 1IIRA 1E4OA 4G2VA 1UZUA 2AV6A 3BCRA 3BD7A 4QLBA 4CTOA 4RG9A 4MI6A 3E3OA 4BTBA 5BNWA 1EXVA 2QRGA 2ASVA 4AMGA 2F3UA 1XKXA 1IYGA 3ZPJA 3OTHA 4BT8A 4YI3A 4EL5A 3BEOA 4YUAA 2IF4A 3MTBA 2C4MA 1XNFA 2YQ8A 4A1SA 1NOKA 2QN9A 3OTIA 3CK8A 3DDSA 2FEZA 3DD1A 3NP7A 3CEMA 3T3GA 3U4TA 3UYKA 3S29A 4EKYA 4MICA 4GYWA 4BQIA 3E4BA 1KTIA 3OY2A 2QRQA 1IHGA 2PRIA 1L5RA 2GJ4A 3G2JA 2GPBA 1WM5A 4I9CA 4M7PA 3Q3EA 2FF4A 1EM6A 3OXLA 3ZGQA 3MT9A 4GYOA 5EX0A 4UQYA 3NPAA 3CK7A 5CHEE 2F3PA 3LPZA 4N9WA 3IEGA 2VCHA 2X0EA 3OXFA 3MRXA 4BQEA 2GEKA 2PL2A 1WUTA 2AVPA 3T3HA 2LNIA 1PNVA 5FZRA 1K06A 5HXAA 2C0LA 4U04A 2GEJA 3OY7A 1KT1A 8GPBA 3G2HA 3CVPA 2WPVA 3ASHA 3D0RA 4NESA 3PE4A 2QLMA 2G9RA 4UQXA 1E96B 4BQFA 5KJMA 2PQNA 5FT9A 3NP9A 3MTDA 3LKUA 3NCHA 7GPBA 4GZ3A 4J8DA 3ASGA
chains in the Genus database with same CATH superfamily
5J1TB 4DGQA 4ZI7B 2IV2X 3R9AB 2BHTA 3TZLA 2YJ3A 2WOOA 4FCWA 4RY0A 5KSWB 1VTKA 1JLRA 3E82A 4NBTA 1D4ZA 4YREA 3JPYA 2KZTB 3I4CA 2I4RA 3UHOA 4E03A 5LC1A 4X1YB 5AO9A 3E70C 4QJIA 1XNJA 1P1HA 4DMHA 4QDKA 5FUBA 5BQPA 4H60A 4MOWA 4NKRA 2D2XA 3LUDA 2JIQA 4KQJA 4RZ2A 3O26A 3T3NA 3MWEA 1T3GA 4OJNA 5FL7A 3IC5A 1VJ5A 4Z0HO 4GI3A 4BX0A 4B2LA 1SAYA 4LX8A 1XTTA 3F6EX 3N86A 3ZXPA 5AHOA 4YBZA 3H2KA 1IEWA 1DADA 2D06A 1O7JA 4RV9A 4BTEA 2Y4NA 3L8FA 3B70A 3Q6NA 1PDWA 2OESA 1R6DA 5EZYB 2NTNA 4UHDA 1XAHA 1W49A 4PF1A 1E8DA 5AYVA 3BSSA 3B95A 4DR2B 4M8SA 4H77A 3TJMA 3KWMA 5ENTD 4ND2A 1SQ6A 2I3ZA 5T4BA 3FTQA 6ABPA 2IOYA 5EIXA 4TMTA 4GI7A 3RG8A 3ZH2A 1WXFA 4J90A 3DZCA 1FU7A 4B6JA 2V0CA 3WWEA 3DLCA 5LJLA 1PZFA 2GRRB 5JLJA 4Z8YA 5FRDA 3EVCA 4HJRA 5FUVA 5K0JA 2PUCA 3PTLA 1UW4B 2HN9A 1DCMA 2PJUA 3R8FA 2C4HA 5ICCA 1B8VA 1XBTA 5AVTA 2TMYA 2X8JA 2C7GA 5AVSA 4ZALA 3FUXA 2B0OE 3IEPA 1GCOA 2HUNA 5B3JA 3TR6A 1VQ1A 2GT1A 3D5TA 2GBPA 4TMKA 4UPDA 2FJDB 4BVLA 2BEKA 1EQAA 2NYVA 3OT1A 4BO2A 1QKJA 1AQ6A 1XK7A 3GRUA 3DHNA 1K4YA 3GLRA 4CWAA 3E2MA 3H9QA 1SVSA 1Q0ZA 5A5DA 1RZUA 5AW8A 5FZQA 1E6WA 1XTRA 5LZ4A 1C1YA 3X1MA 1POXA 1OT3A 3OFSA 4F1JA 1TNZA 4N82A 2W0SA 2HSZA 1SBYA 1HU3A 1NW9B 4LSWA 2H31A 3BGIA 2JZCA 1ZVVA 3P20A 2R1TA 3FDZA 2F43B 3VNUA 2BI7A 1MU0A 2VR1A 1UOQA 2EZTA 3CC8A 4DB4A 2QAJA 1T4CB 2O0JA 2XMDA 4B9EA 1DJMA 1V5FA 1UXKA 1M73E 3UOGA 4G11A 2R751 4JI1B 2XUHA 3HL0A 4M1YA 2RKKA 2H1WA 4JVNA 1NJ8A 3GRCA 2G07A 5A6CA 1MH9A 3DDUA 3ZWVA 3CW9A 4NBUA 2I2WA 4EJ0A 5KNBA 1ES9A 1WJGA 3KAJA 3C8UA 4IIJA 4NYJR 3ZVLA 1W5FA 5JDIC 2J8SD 1BQEA 2JI6A 1UM8A 2VDMB 2YOGA 4YHBA 1YZVA 2VP5A 3MMSA 4C4XA 3COWA 2ZJ7A 1GCUA 4JB8P 3G8CA 1ZCFA 3HN2A 7ADHA 1JV2B 2VT7A 3EZGA 3F5FA 5AQEA 4DQLA 2C7BA 1I0ZA 3U66A 1BU5A 4ZCLA 1E63A 4MV0A 4DPMA 2H6IA 3C45A 4GPD1 3K53A 4TMVA 1OW3B 2O05A 4YRFA 4BMCA 4DJFC 5K8IA 4B44A 4KXFB 2Y71A 3T3GA 2GTIA 1LK0A 5KHLB 5AW6A 4HDQB 3CSDA 4DLOA 1TJ3A 3C5VA 3C3WA 2ZKLA 3ECCA 3ZHVA 4NZ9A 4UDXX 4DMGA 1D1QA 2WP8J 2HA7A 4HVBA 4R5MA 3TWQA 2QLMA 3T5VA 2JGLA 2VPPA 2VTEA 2GAFA 7GPBA 2I6QA 4PHFA 2WJAA 3QVXA 3PRKE 3T7CA 1J39A 3O8CA 4BO0A 3AFMA 2D0IA 4GYJA 1NMXA 2EU8A 1FXWF 5HF6A 1W0JD 3NATA 3WO0A 3ZW7A 4KWEA 3THOA 2CUZA 2FSFA 1FLVA 4CEHB 3FMOB 4RGYA 2W48A 4Q3EA 2ZPAA 4KOAA 1Q2ZA 1GQFA 4IJKA 2DUMA 5HIMA 2YWCA 4WEOA 3Q3CA 1MJFA 2UWJG 1P80A 3IT2A 3TVYA 1P1IA 1I7PA 2VCEA 3B5JA 2O2YA 2O0MA 2VBIA 5AVJA 5MGBA 1VDMA 2HRBA 3D4IA 2BELA 2BFAA 3B1KA 2G0TA 1XEWX 4GMDA 4ZCQA 4HTFA 8ATCA 3UWMA 2BY4A 3F6RA 3ORYA 3CG0A 1L5NA 4U7WA 4B3MB 3S2YA 1IUKA 2R6FA 4I9UA 1NRXA 5BMVA 5HOQA 4G8DA 1AMUA 4OLAA 3QM1A 1Q0HA 1E3JA 4B2IA 3ONFA 4LOAA 4J2HA 4LYHA 3IUMA 1SCAA 3Q47B 2NO1A 4Z6KA 1CULC 4KG7A 1EAYA 3VDRA 1UJNA 5JJ6A 4UMEA 5IZCA 5IAGA 3LZDA 2VHEA 1ARZA 3AF2A 3ROQA 4YRSA 3CQ9A 4CYMA 3PQ2A 1R6AA 1CG6A 1TT7A 1QIKA 5IAJA 1XDWA 1SD1A 2Q5CA 1TQ2A 2WMYA 3DSUA 4ID9A 4F8YA 3PF9A 3LWDA 3IA2A 3W1VA 4YVOA 2IHUA 4RK4A 3S2GA 5KJCA 2TMKA 2A84A 3LJ3A 4CFSA 1K5GA 2VQ2A 1ZNWA 3LQKA 2Z8ZA 1VJDA 7ABPA 5D6OA 1QHEA 5ELMA 1WCV1 1XNRB 3FUIA 4TKZA 1K66A 4LYJA 1KPGA 2YHBA 3UOAB 1G9SA 1R66A 3UQZA 2IELA 1V54E 3CWZA 1X87A 4PV7A 1ODCA 3G0CA 4DUYB 1X3LA 1NOIA 5B4TA 3R9WA 3LYAA 2LPMA 1WCIB 2Q3BA 3GEIA 2EL9A 4G0MA 1MO5A 1UEIA 2JFVA 4GMRA 2I1JA 5BOSB 3NBNB 1HQDA 4H7XA 4LY0A 3UCEA 2Q7OE 1MVOA 1NUUA 4JHXA 1KKLA 3MLAA 3T94A 3DBLA 2IPOA 3MV3B 1VKNA 4JV5B 5DTJA 4PXYA 1NVVR 1ZOLA 4PYNA 2ORVA 3ZY6A 3WZMA 2OY0A 4R8LA 2MRIA 3VU1A 4WKBA 2ZRPA 3L17A 2BUBA 1W9HA 1KO8A 3R7BA 4KAXA 4X60A 3AF4A 1GTL1 4F7WA 3F7MA 5DASA 5ICGA 5AW5A 1FZQA 1H0RA 3WLPA 3HGTA 5BN3B 1FXSA 4CIYA 3FEYA 3SF8A 5KTTA 2VDNB 4RS4A 2QMUA 3HK2A 5M3BA 3I6MA 5C1BA 4U7FA 3HVHA 4CTOA 3TNYA 1WP4A 2H51A 2F3UA 2X76A 5HQJA 1X1EA 5FQNA 1U3CA 5A71A 3DMPA 2J85A 2OWDA 4RWEA 1UMDA 2PIAA 3K5PA 3OSUA 2AB0A 3CVUA 3A4MA 4UFOA 3QRWA 5HZMA 4EKNB 5LA6A 1NQOA 2X4DA 3MKQB 2VZ9A 1J2JA 3A4YA 3V1TC 4K05A 5TARA 4CQNA 1VE5A 4EECA 1QX4A 1AKQA 3R9IA 3PE4A 4EYKA 5J2UA 4BQFA 5TPZD 1NT4A 3AVUA 5L51A 2PUGA 1O58A 3V4FA 2FZLA 5FUQA 4G6ZA 4LWPA 4UU8A 2V1XA 3RVNA 2JFNA 4IQ8A 1C4KA 4J49A 5AKHA 1I4LD 4OVKA 2FE1A 2XE6A 4E1VA 4V3BA 4NIMA 3OXGA 5FBZA 1QG2A 2GN1A 5A0VA 1RXYA 4HRVA 1SPBS 2CDRA 4MW0A 2PGIA 3ER8A 5FUYA 2IZ7A 2OCGA 2GK4A 3I83A 1TVKB 2HHLA 4LXGA 3QGMA 1I4WA 3STXA 2WPNA 1XU7A 1B0ZA 3EFHA 4PS8A 5DX0A 4XEHA 4QECA 4I43A 3WE7A 2SKDA 2ENUA 1ZH2A 3CNLA 3GT4A 2VDWB 4DR1B 3ND9A 4HDMB 2CLDX 3GEEA 4W63A 5BSHA 2UY1B 1U81A 4P7BA 2W93A 1ZHOA 3QVLA 4LZWA 4QYTA 2WF6A 1VMKA 2X2PA 1G63A 1UPCA 1CNEA 1Y37A 3N74A 1FJGB 4IUCS 2IHBA 3UTDA 2BGGA 1YRHA 3SSAA 4J9UE 5AVUA 3EMDA 2DHQA 1CJUC 1GGVA 3P45A 1DG3A 1E9BA 1IQUA 3CKCA 3KU1A 4DILA 3T7AA 4QXOA 5JZSA 4UFPA 1H4SA 3GWZA 3AG3E 3VO2A 2DFDA 1QHXA 5ALKA 3UJDA 3ENEA 4RTLA 4ZOCA 2PO7A 4BFWA 3RIHA 5AKGA 5H5JA 3RHZA 4P29A 1P7PA 1WNFA 2H2GA 4IH9A 2GUGA 1O08A 1LQ2A 5C5CA 3HCRA 3OI7A 3KOXA 3WQHA 3BJIC 3MWDB 3WK5A 4BZZA 4NHOA 1UDRA 2HK9A 3GUZA 1BHO1 3ABME 2XEHA 4Y2SA 3IUNA 5DT2A 4BZPA 4R54A 1SZCA 3V5NA 3W7VA 4XQEA 1DVPA 4H3KB 4IM7A 3NAQA 1U28C 1E9FA 5ALEA 2H9IA 4GR5A 2F48A 3UAWA 2NG1A 4A0RA 3A10A 3JXJA 2OFWA 2F1JA 4A0HA 1N2CE 1SUBA 3VZQA 1WB6A 5ICSA 3M6IA 4WZBE 1RRMA 4HLLA 3NV9A 1WF3A 3PXAA 3WK7A 3AG5A 1ZEJA 1OXTA 3GJ0A 3P1UA 4DQKA 4LF7B 3GBPA 2Q3JA 3V8EA 3TYXA 1JZTA 3BHIA 5DNCA 1T2EA 1NURA 2RGXA 2GW1A 1KMHB 3ZRHA 2DSNA 1QYVA 5KOJB 4Q02A 4BLRA 2HK7A 3NVMB 2PKXA 4PCLA 1Q84A 1G5FA 1JDZA 2CXNA 4BJ1A 1F7UA 4U8VD 4JCOA 4UBJA 3I09A 5JQWA 4G0OA 3QF4B 3Q72A 2QRKA 1XTSA 3AXSA 1XD9A 4GVPA 3CLTC 3CUKA 2PJZA 3LU1A 1N2CA 5FQ6A 1F3OA 3HNRA 4ARUA 1H2TC 5EWLA 1H85A 1Q1QA 5JZMA 5DHFA 4YAGA 1O87A 4KLZA 3RBZA 2MWMA 1YQGA 2QDKA 3T7KA 3RJVA 2EF0A 2ZRQA 3H18A 4K9KA 1WG8A 4AP5A 2GOYA 5CDFE 1RBYA 3EWNA 1XVIA 5E3HA 2HSDA 4YI3A 4EFLA 5ELLA 1DRVA 3V4ZA 5FX2A 2Z0MA 2V7QD 4E14A 1MZCA 2UYCA 2VDJA 5F2OA 1UMCB 2DY0A 2PNFA 5EKTA 1N1MA 2E87A 4M53A 4YT2A 4D6XA 1XQXA 5L3SB 4HI9A 2V7PA 4FXPA 2PMEA 3HG7A 2JFFA 5HXAA 2C8KA 1X1QA 5JWOA 1O96A 1KE1A 4UD6A 1M9NA 2RKWA 3CZ9A 4LRZA 4AWBA 4ERNA 4EA6A 5KNCD 2AXNA 1MB2A 3JYOA 4FDTA 3E7DA 1SU4A 3PEVA 2C78A 3Q7SA 3VLDA 5A5VA 2VHJA 4CMAA 4KE9A 5BN4A 2Y1EA 4C0SA 1B0AA 5HKPA 4HDSA 5CDFA 4E2FA 5AHWA 3IULA 3S27A 1RKBA 1J6UA 2I3GA 2W2NA 5FEMA 1SBQA 1EDOA 4BC1A 2DFVA 1N2HA 3HN7A 2F3SA 1DIGA 2NMVA 3TAHA 1J2UA 3O3CA 1JALA 5FZSA 3FBTA 4KXXA 3QPDA 1AGNA 4BJ6A 1IZ7A 3I6YA 2ZRFA 4QFBA 1OI3A 1HO8A 2C2ZA 4D9MA 1XLWA 1NVAA 3WBKA 2O14A 1XI2A 1OOEA 3UXYA 1THMA 4AEZC 3THXB 1YIOA 2QVBA 4TXLA 1J0BA 4RMHA 4G25A 5IHXA 5JCOC 5DULA 3ONWA 1ZL0A 1VMAA 3EPPA 2VJMA 2JLCA 1AJEA 2VDUE 1SQSA 5CAEB 4W9NA 1RXWA 5BNZA 3GW4A 1NTOA 4RCYA 5EXSA 5E8RA 4NV0A 1C9MA 3FNEA 2CDBA 4CDNA 2DT8A 4UMFA 1ZK2A 1YT5A 5L53A 3C3RA 3L1KA 2OFXA 3PJEA 1I7NA 2F64A 1PRYA 1E2PA 3O8QB 5U1PA 4N54A 2VRCD 3AUYA 3QJZA 4ZCTA 4MVCA 1E18A 2PWZA 5D7NA 4AG5A 2O8FB 4RS3A 5C5IA 5CPFA 5JNUA 3H6HA 3PDNA 1XIVA 1RRCA 1A9QA 3Q9UA 4X24A 3CRMA 1WLYA 1T9KA 2VQ6A 3IUPA 4JSTA 2J3MA 4L2IB 1QIEA 4OHCA 1TJPB 4RHEA 4K3UA 1TRKA 3ASFA 4MRMA 1CZKA 4OQYA 1HKUA 2A4MA 3PLRA 3P2MA 2GTHA 3GPCA 4YHHB 1QX3A 3EDCA 3RSOA 4GE0A 4HQNA 4FFLA 1N4DA 5IG2A 5LNK1 1F2DA 2QY9A 2UKDA 3KFVA 1ICEA 2Z5FA 1AK1A 2G72A 3QWBA 1PC2A 2K4NA 3ITNA 1WDTA 4TN1A 4OP1A 1EP1B 3K0FB 1U9YA 1SOVA 4PWYA 1XJ5A 3RRMB 3HXTA 3TZEA 3TSAA 2PL3A 5ESWA 2DY1A 3GYBA 2JDIA 1YZGA 1J4AA 1I6MA 2I1LA 4GRIA 1X7XA 4G24A 2ERYA 1H2RS 4XUEA 3K0EA 1NFQA 1LZLA 5IJ0A 4L4XA 3SI5A 3LXXA 3MYYA 3GMDA 1F8GA 3OC0A 1MHQA 3IBYA 4P8RA 1M34E 2DLDA 4Q9HA 3V33A 1CV2A 3JAWB 4ND3A 3G2IA 3PUWA 2P67A 4H16A 1V1MA 2Z2XA 3RANA 4TKUB 2VUHB 3NHKA 2ODTX 1WHTB 5CK4A 4WWNA 4G0NA 2FRDA 2I5PO 3OTGA 3VTAA 1N25A 2HM8A 4O4LF 3SC6A 3RWBA 2WJ4A 1E7WA 1C9KA 2XWQA 3DE3X 1P72A 4DLXA 1IXVA 1NN3A 3P9CA 4DZZA 3N2GA 4LJLA 1N2XA 2BM1A 2OHIA 1NW3A 1T8UA 2PRKA 3UYKA 2WV7A 1TYEB 3UENA 3BMQA 1M6HA 1ILWA 1ODTC 2W4IA 3OE7A 2DJ5A 1MG5A 3OEHD 2O3RA 3AKCA 2H16A 2B92A 4WJZA 2HHJA 3N3AC 2C2GA 2DP4E 3JQ1A 1HDGO 5I4BA 5T6BA 1KAGA 2CCJA 1X39A 3DNPA 4UYJB 3DSRA 4D0LB 2E0IA 1D2GA 3KKZA 2I76A 1ODIA 4MLPA 1DHTA 3FR8A 4K9LA 2ZYWX 4WVLA 4RIIA 4MBGA 4UZSA 4N7JA 4QARA 3TQOA 1WZUA 2B35A 1KPIA 2YASA 2BSQA 5ANRA 3L7DA 2Z30A 2E4XA 2W2XA 2A5YB 5HS0A 5AARA 1T1JA 3E35A 4C48B 1J0CA 4JT4A 2AXVA 2WM9A 2A59A 4OQ4A 2MSEB 4PDXA 3G2VA 2C3YA 1KKMA 2GD1O 1WVMA 5FTJA 4KEAA 1KXJA 2H57A 1JSZA 3IALA 4EZKA 3T61A 2HA3A 2H06A 4KXNA 4DE5A 4Q4CA 4MW7A 3ESKA 2JA2A 3BG0B 3HLYA 2CKMA 1YFKA 4R1OA 1H2ZA 4FBMA 1IXYA 4Q01A 3MF4A 3UIEA 4B3IA 3CO5A 2BFBA 3AW8A 4S1NA 1OROA 4JY7A 4PTLA 1H05A 2QF7A 3IL2A 5KNDH 1LI5A 3LRTA 4V1CA 5IM4F 3O4RA 3GYZA 4QOGA 1RQXA 2B0JA 3D81A 4Q0MA 5K0GA 4JSRA 2VYND 4AX4A 3H6KA 4R9NA 2YNMD 2ZIVB 4L0QA 4CMKA 2Q5JA 3MBOA 3U37A 1QF7A 4B4VA 4LAFA 1SC6A 3B6MA 1FVXA 1N9KA 1QBGA 4WQMA 4BECA 2VF5X 5C7IO 1Y4SA 1UWVA 1DAHA 1EFRD 4KQWA 4J94A 2M98A 1FRQA 3M6XA 1N6LA 2C58A 1NY6A 1GRQA 4TXNA 4GLBA 1INLA 3WLFA 2PKRA 5H0IA 1E9VA 5KC9A 1EK1A 3V2HA 4FP7A 3I12A 3MELA 4XLTA 3JQFC 2IPMA 5J4HA 2YHIA 3JUEA 1QAQA 1PNOA 2VQEB 2CJWA 5ECWA 1XYYA 1CS4C 3K8YA 1FLNA 2A5FA 4ACBA 5DNUA 3OIGA 3M1AA 3EMKA 4BX2A 3NRCA 1ZCAA 3FUEA 3NHLA 2FFHA 5I4KA 1T26A 2FEMA 4JASB 4UM5A 4H08A 1E79A 4GA1A 4MEAA 3QY0A 1ECPA 4IDDA 2FULA 2OCPA 3ZV7A 4EHLA 5U4XA 4JUCA 3VR3A 4G0YA 4IDEA 5EPOA 3MERA 2FPLA 2QUJA 2H6GA 5DSTA 5BN5B 3L7MA 3RLFA 1N0WA 1L2TA 3KAQA 1QJCA 3Q6IA 4BO5A 2O23A 1SWVA 3VYTB 5CH8A 4DYVA 3QYPA 1Z56C 2V3VA 3AI7A 2V3WA 4IZHA 1TAUA 1NLFA 1BG6A 4MGZR 1JKIA 4QT4A 2IUSA 3FGZA 3MGAA 1HH4A 5BR4A 3OFJA 2I55A 4M76B 4ABYA 5EXTA 3DAHA 3ELDA 4TVOA 4I2NA 4KWCA 4O5AA 2F9FA 5HQTA 2I7CA 2DBVO 4Q6BA 1U7IA 4TSRA 2JGDB 3FVWA 4C6RA 1VLQA 1G5IA 5AI5A 2FQWA 1U2PA 4MVJM 1TXGA 2DHEA 3SNKA 1FP7A 1EGHA 1PS0A 2G0AA 5SICE 1RC1A 3BGSA 4NEQA 4TYNA 3D9HA 2WUDA 3X44A 5TMPA 1YBHA 4MWDA 1O5MA 5JFOA 2B6NA 3ZEIA 2I6SA 2VSQA 3KYCA 4LNUA 1E4OA 1QWSA 3IBEA 1XZ8A 1W4RA 3GDOA 4ZYYA 2VDVE 4L4RA 5CRUA 2X7XA 3A70A 4OB7A 4C0BA 2KX7A 4EAQA 4OH1A 1AC5A 2Q1XA 3THYA 3P2BA 1CIPA 5HRCA 2PMCA 4FC6A 3R9XB 4HYTA 4MDFA 3OPQA 2J0QA 1R37A 1WM5A 1I5OA 2ZBEA 5B6PA 2FZWA 3J80A 1XELA 1U8AA 3OTWA 2YWHA 2POCA 1UKBA 1SXJB 1XB2A 1E59A 2DRIA 5B5SA 5IT9A 1A9SA 3SGHA 1M5UA 1HTBA 4CEJA 3PRYA 1AQNA 4JLOA 1SG9A 2AKEA 1M2OB 2CXOA 2XT6A 3E9CA 3QFRA 4AROA 2NM0A 4IYPA 2AFIE 2EJVA 4HFNA 1XRQA 2UVPB 3WGNA 4Z7NB 3E3LA 2NXWA 3UG6A 1PR1A 3WDKA 2KXPC 4MUYA 1FFXB 1IHPA 2GKGA 1EVQA 3V7NA 2AMYA 3HR4A 3DBIA 4FX2A 3GZ1A 2RBKA 4ATGA 1NNI1 3JVUA 3OUTA 1YZ3A 4DMLA 1PTJA 1DJNA 1IUNA 2XXAB 4RD2A 4LY9A 5LZ8A 1CYDA 5LYJF 1TF5A 4DIFA 2SCUA 5EZ6B 3B6KA 3AP3A 3QBJA 4ZZ0A 1JSXA 3VI3B 3MWJA 4P7JA 1RYEA 3D2CA 1C30B 1V1RB 4GF5A 3EQZA 5BSTA 4KBYA 2CVQA 4MYUA 4JI3B 3UC9A 3CTMA 3B2QA 2JF0A 3KL4A 2QPAA 3FNFA 2ZVDA 3DDOA 3Q7IA 4Y7CA 1V41E 4QX6A 1VG1A 3ESYA 1MOZA 3EWSA 4CF3A 4GHWA 3DWLG 4JA7A 2Y69E 1TZKA 1JVBA 1VBFA 2OV1A 1U3GA 4BNTA 3BL5A 3LCCA 2X1MA 4V03A 2IOFA 3VVBA 3KEFA 3PUVA 4FTWA 1E8OA 1I80A 3VV2A 4D6YA 1KJJA 5BN1A 3E32A 4PPQA 2NNLD 4Y2UA 4FJ2A 2WSLA 4R7TA 2BKLA 4JLSA 1TIBA 4NATA 1GY8A 3A6GA 4ARZA 3TXXA 3KLBA 2RH4A 2J4BA 2QY6A 1J24A 2PZKA 1BVHA 5DFAA 1BMQA 1N36B 3COJA 2CBZA 4X8OA 2H59A 2DMRA 2J31A 3VKUA 1KA9H 1JPUA 1P5JA 4X62B 2R5WA 3PF8A 4AG3A 4AWXA 1UJJA 3LP5A 3BFJA 2GESA 3WTBA 2C4NA 4TT3D 1C3OB 5I45A 3T7RA 2B1RA 1C7EA 4R9VA 5JYCA 3IHYA 1ZJJA 1X1AA 3LUGA 2ZK7A 2ZJ0A 1CRZA 5H9VA 4C3VA 1LW7A 4FOPA 3CUYA 5ENRD 3PDHA 1A3CA 1Z36A 5DH9A 3R3ZA 4KWTA 3S55A 3CG4A 3SEAA 4M98A 2JNWA 4NV1A 1N9ZA 4GLFA 1JPNA 3EC1A 4OGFA 3TTVA 3H7AA 4IR7A 1LWNA 2HPHA 2FO1E 4H0NA 3PCTA 3VI4B 1VJRA 4R8KA 3GEHA 3P97A 4WWOA 1M7HA 3IEUA 3G5MA 3W4JA 3SFTA 4CCYB 3HCBA 4XZ4A 3KSZO 3JYSA 2FMIA 4F4DA 4WERA 5J47A 1KR2A 3REGA 3HYMB 1G16A 2BFMA 4KDFA 4Q9AA 2J41A 1JDSA 2XWPA 1JEYA 1UJCA 2LIPA 4F6RA 1R4ZA 4RENA 3WQSB 4AZ0A 4BMNA 2R11A 4LYEA 1Y3AA 2DQZA 4JYMA 3SC2B 3RH0A 4MH0R 3P2IA 2ETVA 1V5EA 3ANMA 5JAOA 3HJUA 1Q91A 3BWCA 1ZK1A 1J5XA 2ACKA 1OT5A 4XWOA 5A4JA 4TM7A 5EUCA 3E5HA 4LVCA 1GFSA 4DX6D 2CXUA 2HJSA 3ZIDA 2JBAB 3THRA 2UYYA 3TNFA 3AGQA 4WI1A 3FYCA 3KOOA 1Z7BA 1THTA 1K8QA 2PGJA 3CK7A 1BJTA 2PZGA 2WXKA 4L5CA 5HNKA 4B6EA 3Q9NC 1DC2A 2BTQB 2AMJA 1USIA 5IUKC 3APDA 1COZA 4X91A 1SQFA 3NCHA 1RP1A 4AIRA 5JNSA 1NLYA 1GT91 4FYXA 1II8B 1OKKD 4Y8VA 1PT6A 5J43A 4YRKA 2ZRKA 4YDWA 2BC9A 3DYVA 1IOZA 1CE8A 1GU1A 2Y93A 2H7VA 3K2BA 2J9ZB 3OD1A 4HC4A 1DJPA 1OTHA 1JWGA 3EIJA 3ZDEA 5ALZA 1YYHA 3M1YA 1EIZA 3IMEA 4IRUB 5EJ7A 1AZSC 4XCVA 1QZ3A 2WWVD 2YRXA 3QOWA 3IMFA 4HB4A 1OYWA 3KK0A 3QNWA 4MJ7A 1NDHA 2WKSA 5HCNA 3SLGA 4D1YA 3OJLA 3SWWA 2N75A 5L95A 4PAQA 2W7TA 2WIFA 1YQTA 1ZI6A 3G6WA 4ASUA 4P0TA 2LRHA 4DG5A 3IJPA 3JYLA 3PIIA 2JLYA 5A4FS 3I6ZA 1GHTA 3SZUA 3JQGB 4FNGA 1V7QA 3W5AA 4I46A 5AJVB 4HPWA 4YDRA 1RBQA 1A7UA 3T4PA 4BFTA 2ZPTX 2JFOA 4ND6A 1PG5A 1P2FA 5CP8A 5KWIA 1K63A 2ZIAA 3NIDB 4KQCA 3K70C 4J16C 4XIIA 4JI2B 5DB4A 5FFFA 4TUYB 5HQ3A 4ROTA 3HCCA 3WJAA 1JA0A 4TQAA 2ZI6A 3H86A 3P32A 3RR2A 3TW6A 1ULTA 4JU8A 4XUDA 4HX2A 8AT1A 1EX9A 1M67A 3MAJA 1JFVA 1R9MA 4J0KA 1PJ4A 2J6IA 4REQA 2C42A 5GV7A 3W6OA 1RQNA 2IS2A 4ENVA 1COWA 2P7HA 2MSWA 3GZJA 1UJ5A 3QPVA 4WFQA 5CVCA 4RACA 3RVBA 4MW6A 2J30A 2IV7A 3TEJA 4KPGA 2WIJA 4MEBA 2X0JA 1E89A 2PL5A 1WDYA 3WRYC 3A2NA 2PKQO 2RJ3A 2CJXA 3EOBI 1Y48E 5SYNA 2L18A 4GMJA 4DPRA 3C5WP 1BCRB 1OXVA 5H7XA 5EE1A 2FJAB 1CUIA 3KQLA 1PJ2A 1AUOA 3BRWA 1FF9A 2FU5C 3HHMA 1E8WA 4ETIA 3H8WA 3NC1C 1OXKB 4J1NA 2C7QA 3RV4A 3QBEA 4MQFB 5LOVB 5AXBA 2GKOA 2Q3CA 3TI9A 2BTEA 4DZTA 4ZWNA 1ZOIA 5ALWA 3RYIA 3PQCA 1Z83A 5DCYA 4DSNA 2X9LA 5KTYA 2FH5B 1YJXA 2YOFA 4J7XA 2ODAA 1RZRD 1JILA 3U4QB 2Q8NA 4I6EA 4XWKA 1NULA 4GX2A 3AT1A 1DUIA 3W78A 4MCHA 1O3YA 4S1TA 2ZSBA 3GA5A 1T9AA 4UWFA 2VK1A 1S0UA 4TPKA 4BZXA 4TS3A 3KD3A 1JWFA 3A9RA 4ZVSA 5J3JA 3MCAA 2I62A 3FTDA 1JFRA 1QANA 5H3CA 2DTDA 3FCUB 4RFLA 4MIOA 4GPEA 4OJMX 4C4TA 1SXQA 4J6EA 3QI7A 2B99A 4ML3A 4CMIB 3WMEA 4BN5A 2HMSA 1RCTE 4A91A 4N41A 3NT5A 4I6GA 3S28A 1E4YA 1P0PA 1K4KA 4BIIA 3PC8C 2ZRCA 5LL6P 1O6ZA 1EXMA 1MW9X 2XUFA 1D8DA 3KR1A 1JAYA 1C7QA 2V4HC 3UFBA 2QAIA 2ASVA 3DTVA 2GH1A 1UG3A 5ESDA 4FULA 1N2SA 2Q0HA 3KJQA 3T9CA 5ALFA 3BJRA 4GX5A 1W0KA 4KI7A 4I99A 4C0XA 3C43A 2EHJA 3B1ZA 5F5NA 2H52A 1OLXA 4LRWA 3GJ3A 5L8VA 5EIFA 3SPXA 5K3EA 3UAOA 1QOZA 2C5LA 3ZWYA 5JQGB 1LVUA 4PZ9A 4YS6A 3IUQA 1NVUQ 2XYRA 1A97A 2MINA 2JJ1A 2H7XA 4AXBA 1WF6A 1YVUA 3ZD9A 4CT4A 3PI7A 5KYXA 2G9RA 2QYUA 4KXKB 1QGED 2MOWA 4KO1S 2L6BA 5ALJA 1V6AA 3PX3A 3FYSA 4YV7A 2ZWPA 3Q8MA 2PSEA 4L7VA 1LB1B 1XHEA 3CF2A 5DM2A 1DPFA 1CY2A 2NUAA 3ZCPA 3HJTA 3RSGA 5EQJB 2P2YA 5DGHA 3X2FA 1FTYA 5EJAA 2FE4A 3DZHA 4BMYA 2D5LA 4D8XA 1WZCA 1U1IA 4E30A 5LP6B 1J42A 1YR8A 1CSEE 1W48A 4F4IA 2BV3A 4N6OA 2FI7A 4OAOA 4Z4QA 1XXHB 3ETGA 2GBLA 2P27A 3QI2A 1VGQA 5H59A 1P9OA 4FLHA 1VG8A 3SX2A 5DN6A 1XZQA 4KN9S 4IUYA 5REQA 3UGTA 2R44A 5TF4A 4M21A 4FHGA 1E3DA 1G291 4QXAA 1GTJ1 1NBMD 2YJ5A 2RHLA 3R7DA 1UBTS 3ESCA 2AW5A 1P3JA 1DOHA 1ZQ1A 521PA 3SQLA 3LI2A 3KBBA 4OHPA 3KB1A 2QJWA 4LX0A 2A14A 1OX4B 1TM5E 1ZBQA 4P5EA 4TQ9A 5GZ1A 5IP5A 1NGSA 4XXHA 4IUDS 3UYLA 2WKQA 4AJEA 5KNDA 2Q2WA 1SOAA 3NWPA 1APBA 1O0SA 1RI3A 1Y7PA 3IAM6 2P79A 4N40A 2GCIA 2HF9A 4BE4A 4MV6A 4YAWA 4JGGA 5IC6A 2BPOA 1XL1A 1US8B 2VO1A 4TSFA 5SZIA 2AOTB 2EDAA 1BS9A 1DBQA 4ETMA 3DTTA 3NHBA 2GTPA 1XLUA 3FN4A 3LHKA 4DJEC 3EPLA 4E1AA 5K0FA 1QCDA 1P2DA 3PWZA 5FQ4A 2DCPA 2E1PA 2Z2YA 4L4UA 2JEYA 4OQFA 1G3NB 3QVTA 4PHHA 1XKQA 3CY6A 1MF7A 5I7AA 2YYAA 1UJBA 3H13A 3KB2A 2QZZA 2NXEA 2EWVA 2Q45A 1F1JA 5HJ2A 5LQNA 3AI3A 3K20A 3IAFA 2A90A 2NZUG 5AXCA 2FY8A 2ILVA 2JFXA 2EBUA 3BK1A 1ZGAA 1YZFA 4NNJA 2FFAA 3MTQA 3KB6A 5SY9A 3TXYA 1Z18A 3PNSA 3WVNA 3RS2A 2GM9A 4MKXA 4F3VA 4ONEA 3SIRA 1BOFA 1G21B 2QLBA 3EXG2 1PEAA 1LU9A 3KJZA 1E9EA 4H18A 2PMBA 2ISQA 4REMA 4C4YA 4TL9A 1Q0PA 3AR7A 2AG5A 5EJMA 5G05J 1HOTA 2G80A 4DLNA 4QTYA 2GPYA 1Y89A 2I87A 1A5AB 4YR7A 3OP1A 1P62B 3U0BA 2QW0X 3DM9B 4I0WB 5AK4A 5HF5A 1DEHA 3C3OA 4Y2GA 2OHXA 1CNFA 3M6VA 2H65A 4UPVA 4AJLA 4BXOB 2D5BA 3C3DA 4BV9A 3TS1A 1Y6FA 2HE0A 2G70A 1TMOA 5B1HA 3NYRA 1XZDA 4QUEA 5K45A 5I3ZA 1SUCA 2JLXA 2QBYA 3OETA 3ANSA 1ZIPA 3HXQA 2HUPA 4N0EA 3E3OA 3WZLA 3HZRA 5FL7D 5JA4D 3D31A 4UE6A 3PFKA 3ZNQA 4BO3A 1QK4A 1C7IA 1A88A 1SEPA 3R7SA 2WVAA 2H8GA 2G1PA 2VJYA 3ZU3A 3FNQA 2OHOA 2PUJA 2QR3A 2ZUFA 4I4NA 4FCVA 3KHKA 1O9HA 3EY4A 3HRHA 5GM1A 1G18A 3NG1A 3WBFA 3NBQA 3FHOA 1PZNA 2BW0A 1NY5A 3LQRA 4Q1AA 2XB6A 4E2YA 3HSSA 4DDUA 3SZRA 4J8DA 3NAGA 2O2DA 2PBFA 3N58A 4O3FA 2X40A 2IY8A 4BV2A 5LZ7A 1VLZA 3B6ZA 5LXTF 1UN9A 2ZPUA 2QU7A 5LZ5A 3URMA 3UAZA 1KYZA 1KT0A 2Y1XA 4TROA 4IZ6A 3FBWA 1BGWA 4XIFA 3RFCA 1OE0A 4UVIA 2CNLA 4NRHB 4RHYA 1P77A 2HWWA 2HPVA 2JCSA 3IVCA 2CB9A 3CHMA 4JELA 3D43A 5EJ6A 4RJLA 4POAA 2QS9A 2R6AA 4DM7A 1JSRA 4DLPA 1U1EA 2ZIFA 3VHQA 1K5PA 2R8XA 3PEUB 1E3WB 3RASA 3LJKA 3H1FA 4Z9XA 1D0VA 1G17A 2Q3LA 1W96A 1J1IA 1E9CA 4CI9A 3R7NA 2L6JA 3MCVA 3QVGB 3MRVA 3OJCA 2YFHA 1NKVA 3Q8WA 5J58A 2WIBA 3BD6A 5A7GA 3FNIA 3W79A 1KDOA 4MR7B 2Q3HA 5ILOA 1E2QA 1ZR4A 2UVDA 3QUTA 5JHAA 1T4DA 4G0UA 3ROGA 1AT1A 2P1RA 1ECCA 4ZHSA 4Z8XA 3KS9A 4OM8A 3ND5A 2QRVA 4RL6A 4UYKA 4RQAA 3I9V6 1QLWA 1TCVA 1L4YA 2YH2A 4K28A 1AXRA 3RPEA 4IEEA 2JS7A 3L92A 4YMSA 4TLLB 4CLOB 1OTYA 3TQQA 4G0PA 5TLSA 4CM5A 3TO5A 2PUFA 2NUPA 3WHPA 2HDWA 3Q87B 3SM9A 1VPEA 3IDFA 3ZKWB 1TO2E 4C2UA 3ZWBA 2ZUTA 4XDHA 5KNBD 3MJWA 1T2UA 1X9HA 2VDRB 3UB3A 3A2MA 2DFNA 5FF9A 3WGTA 4JXKA 5FWYB 2R68A 4Q4JB 2P2ZA 5FBLB 4TN5A 3C1AA 2ACWA 5U4QA 4EB6A 1NJSA 4JQCA 5B57C 1F6DA 5FXMA 4BLTA 2C2HA 2VPWA 4DRXB 5I47A 3I6QA 3G5LA 2E49A 2LBPA 1TJCA 4B9AA 1BEEA 4RPKA 3UJNA 3WKAA 4HH4A 4YO7A 1CRWG 2F90A 2PBLA 5JXWA 5M04A 1IHDA 3T0IA 1D9XA 3KSMA 2W6PA 3EGXB 5AKKA 4Z51A 3S1LA 3TSYA 5K5EA 2D74A 2KHZA 2V4ZA 1GUYA 5JY1A 2PX6A 4ZYLA 2Q6OA 4QUJA 1EB8A 3EUAA 1V43A 1XEAA 4OF4A 1BDJA 2H29A 4N48A 2QRHA 2ZQYA 5AKLA 1DRUA 3VC3A 2XOKA 4RPJA 3UZUA 1W4CA 4IAOA 4EEXA 1NR1A 4MPJA 4Q69A 4TLBA 4TTTS 3GARA 2X2OA 4PLGA 4GKBA 2PSHA 3H19A 4U0SA 4WASA 4Y2RA 1YS9A 3BE8A 4V3IA 2O57A 5AKZA 1TLTA 3TW4A 1914A 2C3OA 3HPQA 2IYRA 3D9MA 2B98A 4DMUB 1I3OA 2BP7A 1UPXA 4ZOEA 5GWXA 3UJ6A 2VZLA 2KQUA 1K8YB 2AIRA 4JI7B 4ZVKA 2PXHA 5KYTA 3BJMA 4K1XA 2ARKA 5A3QA 1SCIA 4B43A 1EMDA 4LDJA 2ZISA 4GTRA 3B2EA 4EHDA 5T41A 4J9VA 3HWRA 3AOEC 3B1WA 4R2HA 4RD4A 3P2EA 3UK7A 2Q4RA 5B6JA 3PZ4A 3AINA 3PJRA 4G0WA 5DHAA 1E5TA 1T5LA 5ERYA 4H0FA 3K2IA 4QEDA 4ZTZB 2V58A 4BQEA 3HCWA 4Q16A 2PMWB 3WBBA 2R6R1 5HUJA 4HNAA 5KJMA 4RHXA 3WMRA 3T54A 4QUDA 1Q7GA 4IW3B 1UFKA 4LOIA 1JBKA 3GHHA 1YJCA 3OFNA 2NU7B 5LUAA 4CYMD 3SHVA 1Y82A 3D7RA 3QIAA 4OFWA 3E9YA 4O8CA 1NWHA 4B7XA 5JJCA 4MYHA 1WUJS 3IP7A 3RRJA 1I5EA 3CE6A 1S89A 1C7FA 1SNYA 2PEYA 2FSVC 2YN0A 1KHHA 4IMRA 4CM8B 3DCJA 1ZM7A 1YMQA 3U0VA 3P9QA 1H6PA 3IAS1 2HJGA 2BR4A 2DECA 4ENUA 1VKZA 4OYHA 1H6BA 4V0MA 1OPXA 3HMKA 5BR8B 3TIVA 3NWEA 1PLKA 5CA1F 2D00A 4HOUA 5AHXA 1ELWA 1CUDA 3N1UA 2I9CA 1GQOA 3OWHA 5AVVA 4KXUA 1TIKA 4FUQA 2P77A 3QWVA 1DVRA 4CV0A 3WGMA 4CKZA 2PXAA 3DLAA 3UIPC 3ZK8A 4QTZA 4Q93A 5H8WA 1ADYA 4QGHA 4J8EA 4GCNA 3C98A 3B7SA 3DEYX 3JD4A 4XM0A 4EG6A 1G5HA 2A1TS 2CXSA 1EBUA 2CXPA 2SKEA 1QFSA 1VRCA 5FOQA 5GADl 4YYZA 1IFXA 4NMXB 4U07A 2EKDA 5DWDA 1GD1O 2JI9A 3WB9A 1OD6A 5CNIA 5J23A 3SF0A 3NBKA 4M86A 2UZ3A 3O8OB 4GVXA 4XRGA 4ALKA 1H2YA 3R7WB 2R2AA 1V8PA 3WG9A 3APFA 1IEQA 1LCIA 3V3TA 2G9QA 4YLYA 5AQAA 3W4IA 3OPMA 2W6ZA 3FCXA 3WKBA 2Q2NA 2JJ8A 1FFEA 4YALA 1ZRSA 3QEMA 2Q1UA 4A1OA 1VYHA 1K7YA 2VAVA 1TUEA 3JS5A 4MEJA 1G9XA 3DP9A 1QRTA 4PPFA 3L7KA 1TZJA 4U7JA 4HX9A 5GJWC 2OE2A 4AIFA 1L1FA 3TGWA 1B26A 4RNDB 5IZ4A 1TTHA 4PLWA 1UFVA 2Z08A 2ODBA 1H4VB 5AW2A 1GYRA 5FWXB 1CZRA 4HS4A 2HR2A 3DB1A 6YASA 1KVQA 1ZRMA 2BDTA 1FFAA 1VE1A 1AV7A 3AHEA 4YACA 2BH9A 4OQDA 3WI7A 1AA6A 2ZTLA 1I30A 1FFGA 1X80A 1IG3A 2IK8A 4JQYA 2XUPA 1W1IA 3GP8A 2O8EB 5CR9A 1SUPA 4EBAG 4EATA 4HNQA 1YGYA 2ZJ2A 3AF6A 2W6QA 2ZJYA 1GITA 3JD1A 3UK1A 3E18A 5ALPA 2A0FA 2D3TA 5CGQB 2UUCB 5JJLA 4HTAA 2K4MA 1DAOA 4CKYA 1L3BA 3UY4A 2BF0X 1H23A 1NVMB 2I2XB 1H4TA 2KSQA 3TLMA 1NUQA 1N6KA 3EUWA 3MBKA 5HEKA 4RMJA 4FNMA 3FPBA 4RQTA 1K6JA 4H15A 2I2OA 1M7BA 2XUZA 1FDSA 2B4KA 4LMBA 1GZ6A 4D8YA 1XTKA 4Y7DA 4XLLA 4V3CA 3ZYMA 2KWIA 4X1KA 1G8PA 1ZU4A 3HEAA 4J4BA 4L5JA 1OR8A 2VJAA 4G1UC 2D4HA 1JJVA 5BRNA 2M9MA 1XEXA 1SG6A 3G2JA 1KEWA 1Z4IA 3RRZA 3ZGQA 4UQYA 3I04A 1NUAA 3LPZA 5M34A 5BT9A 2RAFA 1Y4DE 4OHWA 5C8DA 1DXQA 2B1IA 5TS2A 1E5DA 4F8JA 3OQVA 3KYDA 5FZRA 3LA8A 1M7GA 2BHRA 3KCQA 3V32A 4KQFA 4PFQA 1MEJA 1OBCA 4F86A 1IM8A 2IRWA 2WJWA 2VXYA 5BW6B 1NXWA 3GZ2A 4E22A 4ALNA 5FOWA 3HYRA 2PFSA 1MQSA 2NTVA 1U1GA 3U4IA 3BEEA 5E4TA 3GAZA 2CK3A 5HTKA 3D6TB 4WD3A 2Z4SA 2QIPA 1E1DA 4XZ3A 3R74A 3C4QA 1OWLA 4OP3A 4L78A 5FNVB 4ENSA 1QS0A 5JARA 3UBTA 5E7JA 4DJDC 1ZH4A 5TGZA 3GT7A 5IX8A 1LS1A 1EA5A 4RPLA 1F4LA 2P5TB 3H11B 4FOTA 3E61A 2C0QA 2D6FA 2V8OA 5GZ6A 2C29D 4TV3A 2ODNA 2YZ2A 4TUMA 4GPMA 4B6QA 4YRPA 4ZQEA 3V1UA 3KQHA 1MB9A 2JARA 1DBSA 4KRFA 1NSTA 1PYOA 1CF9A 1SU8A 1YO6A 2IU1A 3RAFC 3DT6A 3GZSA 4ETNA 4E5UA 1K75A 2AHOA 4IKOA 3CLRC 4JP5A 1HDOA 3BL6A 3PFHA 4HS9A 3GF4A 3Q8KA 1CY6A 5LKRA 3KZMA 3U61B 1UL1X 5JJBA 4OL0A 4AL4A 2O52A 4X7PA 5AVKA 1XP8A 3N87A 1EFKA 3FROA 1UP7A 3DE5X 1NVGA 4TXHA 2Z6VA 1NNSA 3DWEX 3OLZA 5INTA 2KCVA 4BNDB 4XW2A 1V8FA 4Y9TA 1XDUA 2M63A 1QIGA 4BVHA 2XPIA 2JI4A 2HBRA 1X1SA 4NI5A 3VTYA 2IIVA 1QCCA 4F7DA 5LVAA 1PJ8A 4L3OA 4GVLA 1Y1QA 4JYCA 1NPTO 3ZGOA 4IDPA 1ZK0A 4S2EA 1J2RA 4CEIB 2WWWA 3ZHRA 1YRLA 2I4TA 2NAPA 4DC1A 4F12A 3MMNA 1IKND 3VPFA 1FFDA 2AYZA 3FB4A 3PUIA 3U9WA 3GCZA 3P4YA 5IKOA 2C82A 3RRXA 3NO4A 3RVQA 5ALYA 4YRZA 2HREA 3B5EA 2WB2A 4IFEA 4FM9A 2CXQA 1ECBA 1G7TA 2HYZA 2LDBA 1NE2A 6REQB 1RWNA 3AR4A 3LEWA 1UBSB 1RYBA 4AXXA 2XB9A 4GXNA 3VSAA 4ZC8A 3D6JA 2XR1A 4LCEA 1GGJA 2R1VB 4B6PA 4ZO4A 4MR9A 2OCBA 2XEEA 2PUVA 2ZI5A 1RWOA 2Q2VA 1L6IA 4ZI2A 3RKVA 2V7TA 3QVMA 4JBXA 5CW1A 2Y2VA 2ZTSA 4L15A 2Q4TA 4D4KA 4O4LA 2C3MA 3R76A 2BEDA 2Q7XA 1MABA 3R8XA 2WJGA 2A5JA 3W6PA 4YI5A 3NT4A 4DJAA 2K87A 4EQ6A 5JFTA 3DBHA 3FWNA 1FUIA 2QJTA 1DWPA 5FV7A 3U17A 4UUBA 2XS8A 3PHHA 3PC4A 3QKSA 4WPGA 1SG0A 1IN6A 1IBKB 3L7YA 2RGNA 2PUEA 2Z6QA 2UXCB 1MMFB 1X8KA 5EP2A 3B13B 4PTYA 2ZBQA 1MD9A 3HDQA 5BPFA 4WT7A 1MPXA 3JAKB 3TPCA 4WOKA 4EDHA 1PF7E 4FGUA 1T8YA 3KT6A 5IBQA 1YJAA 4KUHA 3K2EA 2H1CA 4OSOA 2FQXA 4FFBB 1QC5A 1SO8A 3ZJ5A 2RFMA 4NP6A 4BP9A 4WDRA 4DOMA 3GNLA 5K3AA 2HJ9A 1DQSA 3WX0A 1HFAA 1QTRA 4GYWA 1HQKA 1V3QE 4V24A 2IGBA 3AKZA 1CVLA 4JBGA 4UDOA 1WA5A 4F91B 4JLNA 1PDVA 3TLYA 3IPYA 2ZJ4A 1USUA 2PWBA 2B61A 5CEFA 2LNIA 2WG1A 4BCDA 3GFQA 3P0EA 2VDPB 3D0RA 1A9XA 1S64A 3KEQA 3R0QA 3HYNA 4DQUA 3UGKA 1IC6A 2ZAYA 4UXJA 3WGVA 4L1BA 3WJ2A 3TRDA 2VUSA 1CR0A 3AS4A 5KVAA 2NX2A 1D6SA 3CR7A 2J0UB 3CURA 2OV8A 2MSNA 4PS3A 3UA4A 3A7EA 1HLFA 4E46A 5I7VA 3I01M 3PA6A 1SHTX 2DGDA 1N4RA 2LO6A 2UV8A 2YOHA 2QRPA 4HWGA 5IM4A 3U1TA 1RJFA 3CLUD 4B0OA 1H1TA 3SYTA 4DDVA 2VP9A 4E51A 1XRLA 1R9NA 4BKUA 4S1PA 1BU8A 3DCIA 4CBVA 1E4VA 5HK8A 2QPTA 5C0OE 1N6RA 1PQUA 5FKJA 4RLHA 2GZHA 3MZ0A 2P5SA 4RD1A 3OOWA 3UQYS 3X1ZA 3IS3A 4DQ0A 2Z1NA 4X66B 1YI8A 2TMGA 5G55A 3W2GA 1D2EA 1TI7A 5A06A 4HLDA 3L2OB 4R8RA 2JLUA 5DNEA 4CLRB 2PZFA 5AW1A 1OAOA 2HGSA 3WRXA 5E76A 4N2QA 3CUVA 4EGSA 3L1JA 1T9BA 4DCNA 5J2TB 3VUFA 4EBAA 3R5FA 5HRUA 5ARGA 2JDID 3I4GA 4EY5A 1YZNA 2BFFB 1SULA 3ET4A 2C9CA 1BX0A 4WOPA 2O3TA 3MRTA 1G0OA 2C5SA 5A2GA 1HV8A 4S3MA 3LV8A 4B35A 1X42A 1G60A 1L8LA 3OQIA 4BX3A 3SNHA 4TZKA 1GNSA 1G66A 4A03A 2BR5A 3TN7A 3L6EA 1ZD5A 2ZRHA 5DGXA 2Z8XA 4LYGA 1J23A 3QUBA 5AI6A 1OY3D 1SVXA 1WXWA 2W9XA 1SD5A 1YONA 1VB3A 4OI1A 1ISSA 1L7MA 1X0XA 4ESEA 3WDMA 2ZR7A 3U4HA 2WXGA 1GW6A 4M7WA 3BSWA 3D7NA 4AMBA 2BEWB 5T4YA 2IU6A 1FU8A 2GCOB 2IU4A 3A1DA 2WTMA 4I2ZA 3TG2A 2Y2UA 5TPWB 4Z0TA 4E33A 5K2OA 1JSCA 4WWPA 3OA2A 1AQYA 3CRW1 4LY3A 3G1WA 3GJ4A 3S7TA 3ZVKA 4CF5A 4P4SA 2O0LA 3Q3JB 3AONB 2W83A 3RT7A 4DI3A 2WV9A 3QK7A 9GPBA 3OE7D 1J2TA 2OAP1 2VRNA 1DIBA 2GK6A 2WJPA 1U31A 4TRNA 4D97A 1XX6A 3EGVA 4XB1A 3SYMA 2RDMA 4TUUA 5H82A 2CLHB 4JVSB 3RC1A 1ENPA 5BWMA 1QGDA 5BVHA 3I2GA 5AJZA 2LV8A 4JBHA 4MIYA 3Q0EA 1RI2A 1L9KA 3PGVA 3LSTA 4MMYB 5EILA 2K5UA 5FQ8A 1X2BA 2Q3FA 2JK1A 3C41J 2IKQA 3S7DA 2JASA 3CFYA 3GGGA 1B93A 4LDQA 1R5NA 4C07A 2WU8A 2O5RA 1E2EA 1AKRA 2F0YA 4B17A 1SELA 2IEGA 1XMVA 4J0CA 5LMNB 4U95D 1SEVA 4FEYA 5I01A 3FUWA 1DWUA 2R25B 3SYLA 1U94A 3HCOA 3KZXA 1V5WA 4CETA 3OPNA 4IJQA 5DLEA 4MLZA 4ZGWA 2JKZA 3KVVA 3RRNB 2BBWA 3NXKA 2Q3MA 3WWDA 5EUBA 3GLHB 3QOXA 2Q9CA 3AB7A 4KW7A 3CLJA 2HNAA 1SQMA 1PJSA 4IQFA 4L6IA 4FONA 4NOMA 4I9NA 4A92A 3I76A 3NVDA 1JQKA 3ZYQA 4D26A 2X8WA 2RKOA 3OXFA 3EF1A 2RKBA 3GVIA 2DETA 4HYEA 4NS1A 1ZD9A 1R27A 4H17A 3QVOA 2AEJA 2ZAIA 5KTSA 2J0VA 1XZMA 1AURA 1L7AA 2EX1A 2IWRA 1CR2A 5LCXA 1T3HA 1V2GA 3RS0A 1KZPA 4YV0A 1KI1A 2ADMA 5FBWB 4XUGB 5LZ2A 3KEZA 4X20B 3KEAA 4ZJZA 3VR2A 4J3FA 4UASA 2O20A 4DAOA 4HDNB 4ID3A 1E60A 5BNIA 5JO0A 2BH2A 1Y80A 3NTRA 4KFTA 4K9SA 4X64B 5FJIA 3DA8A 4IL5A 3WK6A 1EM8A 1TQDA 5IY5E 1P2GA 2ACVA 2NT3A 2D8MA 3GQBB 1J07A 4RJIA 2Y0DA 3U7JA 3F7OA 4C2AA 1HLPA 2P1DA 1OFIA 3BJZA 2GVDC 2LVBA 4N3GA 4CLHA 2JAQA 1UJMA 4J0UA 3C3QA 4G8BA 2ZUBA 1TLFA 4DK5A 1T2CA 3TZQA 4AVYA 5AOXB 1E79D 5C80A 4DXAA 121PA 5H80A 3ZIUA 3VR3D 4KBGA 1H2BA 5G2OA 4FLFA 4G8CA 2XDQA 5LQRA 1RM3A 1JFSA 3V4RA 2HLHA 1CQJA 3RVKA 3KOZA 4GL2A 1QE0A 5EYPB 1LI4A 4XA8A 7AT1A 1TJ4A 1I5RA 1XCPA 4NU6A 3EE6A 3FZNA 4PGFA 2I65A 4EOGA 3JQRA 4EL0A 3LNTA 2FV8A 1E62A 4MWGA 1CR1A 2JABA 5TC4A 2ZWMA 1DV1A 4TZTA 3VOAA 4IIGA 3ZUGA 4C0EA 3BH0A 1V8DA 1DKPA 3U7FB 2J9FA 2WYVA 4PQEA 4UQPA 1Y7LA 5HBGA 2XZLA 1QHHA 1LNSA 4NZZA 2XF8A 1P2SA 4PY2A 4Q18A 2KJQA 4BX9A 2NQ8A 4O33A 4LNUD 1S3FA 1JKMA 1M8FA 1F4PA 3ZDBA 1I36A 3H9UA 2WFZA 4Y9DA 4BJHB 1GPLA 1ZCBA 2H5LA 4ZKDA 3R7FA 3NWJA 1WAO1 3EIFA 4JB3A 2JH3A 1J8YF 3VDQA 1JKJA 5EKQD 5FOXA 4F4UA 4MV4A 2HA2A 1VCOA 4LQCA 4PTZA 2EHDA 1B2LA 4FYIA 4QRIA 3SD7A 3UATA 4X1IB 1NFIE 5IVKA 4J6FA 3TRFA 3GCXA 3PEYA 3FOEC 2R5FA 1H3FA 5COBA 4AJPA 4PSCA 4G23A 1YMUA 1Z5VA 2C20A 3OQPA 1YF3A 2QG6A 3H16A 4GAEA 4E32A 4EG1A 3AILA 1D1TA 2R17C 4MI9A 1U0OC 1T4MA 3V80A 2ODQA 4OHFA 2NZWA 3BN3A 3SQWA 4MGEA 4DARA 4MCIA 3TR0A 1AUPA 1WY5A 3ZU2A 3R9KA 1Z6QA 1TEXA 4OYLA 2QLLA 5A0FA 2ICAA 4MVXA 2WK1A 1XGWA 5DJ5A 2PHZA 3NM6B 4DLYA 3BXGA 4BT8A 1XZIA 3IO3A 2OO3A 3PSAA 2C4MA 3RAGA 4A1SA 4JHKA 2NTJA 4J43A 4CG1A 1OHHA 4X90A 3ZEAA 2E85A 4R9UC 4EG8A 4RHUA 1QBQA 1ZW6A 5EX0A 4IXMA 2GRAA 4BATA 5CX1A 3ETDA 4RC9A 1E6MA 3SBDA 3DFFA 3ZX4A 4URVR 4A27A 2B1QA 5L3VA 1NP3A 5L45A 4EQZA 1A5BB 1VKOA 1ISRA 1U3FA 4YIKA 5BUZA 3ZVMA 3PNPA 3LKUA 4E2ZA 1KNQA 1IY8A 5JAZA 1G7CA 3RSHA 4G0QA 3FHTA 3U7HB 2ORED 3L4JA 1X4RA 1RT9A 2QD1A 4CM1A 1ZU2A 4K86A 4U5XA 4BNFA 4L5AA 1HM5A 2ZYAA 2H3EA 3MQ2A 4I1SA 5ILGA 4B3RB 5HP4A 4LN1A 4ZV9A 4IIXA 3GNSA 2R03A 1G6KA 1MAVA 3ISMC 2ZSFA 4J8YA 1V6SA 2J4DA 3TZ6A 2Z83A 4UAGA 3SZOA 5IT4A 4FI3F 4N65A 2X19A 1DC4A 1HNNA 3VYRB 5E95A 1RR6A 1BVRA 5BYAA 1P0QA 5EQFA 4E31A 1U0RA 1CUZA 5KTKA 4OKNA 5A3RA 2GA9A 4YRLA 1RLJA 5JYDA 3QBVA 3BH6A 4RCZA 4GYYA 3N2ZB 2DLCX 2BKVA 2MJLA 4DXDA 3TSZA 4GZCA 4L5IA 1N8SA 3QC1A 4A0FA 2VNSA 2VNJA 1GAJA 2F1HA 3NTVA 4CKWA 4XB6B 3CPEA 4BNKA 1D2NA 1NVTA 5CVTA 1A0OA 2Q0QA 3D02A 3EF3A 3GD7A 1B41A 1BQ4A 2WHPB 5CDTA 3OAWA 2BGWA 4BL5A 1JIKA 2ZR9A 3RUAA 2IH2A 4I9FA 3VNVA 2C2YA 3I30X 3Q78A 2PX5A 4ZD6A 3USZA 4ZHBA 1IRIA 1W6UA 4I1PA 4MQBA 1YZYA 9ATCA 3JXIA 2ADFA 5TDHA 3OBBA 1ZN8A 2XGGA 3EIQC 1JYFA 5ICMA 2DCMA 1P29A 1EVYA 5K1ZA 4FK8A 2H48A 3IH5A 4LHYA 1Q11A 4ZO7A 3TTXA 1JJIA 3GLSA 4D9FA 1H2AS 4D9BA 4U6QA 2Z8YA 1UQUA 2H4JA 4DCPA 3Q7EA 1K6IA 3RVDA 1OH5A 4PCAA 1MLDA 3FWZA 5M5BA 2GAJA 3R8CA 3T9KA 1P5ZB 3IP1A 3C6MA 3TLBA 3LHDA 2YX1A 2BHSA 1MQ9A 4BQQA 5TQ2A 5TT0A 1P9RA 4F6RD 3E8XA 1QYIA 2FUG1 1ZKMA 2RAPA 2LIVA 2IV3A 1JQJC 1N6IA 4E1BA 1GNLA 2SECE 3K6SA 3RDPA 2W42A 1ZRNA 1KVUA 5G4KB 2XTZA 2WJYA 1QJ4A 4FBGA 4U2GA 4DT1A 3T52A 1OA0A 4UEKA 2IYYA 1E8NA 2YICA 3UJCA 1AKVA 4HHEA 3B1VA 1WABA 1CY4A 6NULA 1GADO 3HXCA 3MXOA 2P78A 5IPFA 2V7UA 2AZMA 2RH8A 2Z2KA 5E0KB 4EPXA 4KT6B 2GUWA 2WJVA 3DS8A 1GA6A 2HD4A 5DTIA 2GMWA 4JXTA 1I7LA 4EMUA 4LRUA 3NTLA 4MR8A 5LIRA 1WSBA 4Z9YA 1OH8A 1P73A 2J67A 3SEZA 3C5CA 2CZGA 2WAAA 4AY5A 4Q3LA 4HV4A 2Q6VA 3CR3C 4D80A 4UNSA 2DPMA 1OZGA 3EJWA 3L4BC 3OLXA 1XA0A 2OHFA 1S1CA 3SCZA 4DC9A 5KMGB 2A4ZA 2OGWA 1YI1A 1LDYA 3AHIA 4CG2A 4M1WA 2AWNA 1KI3A 2ZIZA 3JRXA 1GZVA 5EIBE 3E05A 1MX3A 2W4QA 3KHSA 2JAXA 4ASUD 2EIME 3PVCA 4UU0A 3QWHA 3C5EA 4URZR 1NXVA 4E5MA 1GKKA 1R0LA 3KZCA 2OTCA 2HA5A 3V34A 3BE4A 1YWGO 1OREA 3LZ6A 2P9ZA 3P5BA 3LHIA 3KQPA 2GZAA 4B6FA 3OXLA 2I7XA 4DTCA 1GT6A 1GKYA 3O8DA 1X7YB 3I2IA 3RC3A 3C6ZA 1HTTA 2XADA 5KU1A 2VK2A 3DE7X 4FWBA 4RKRA 2CDNA 3K9HA 3F0TA 4QGFA 2NXJA 4RTKA 4C0AC 3E22A 5H4GA 2GBCA 1SKBA 4DAEA 2QGNA 3R7QA 1QF6A 5H9WA 2D2VA 3E7PA 2L0XA 1L4HA 2I7VA 1Y4AE 3S8YA 1C8KA 2QG9A 4I1OB 4HOSA 3ET5A 4BN0A 3OZSA 1CW2B 1K88A 1KQNA 1YS6A 5SYAA 3L5KA 5DEOA 2LCFA 1COWD 1W30A 5IH7A 2VDQB 4LRYA 3PD1A 3RO7A 4ZCRA 3BAZA 3LLCA 4ZARA 2UZ1A 1XJCA 4NLLA 4TV8F 2EGGA 2WR8A 2X5XA 4S1VA 3PS6A 5HCIA 2QTZA 4GI5A 2ZJ6A 5E6SA 3S2FA 4EITA 4BVGA 3O91A 2P35A 4RKYA 1N7IA 1XLVA 2IQ5A 2AN1A 1TYZA 1Z0FA 5AKJA 3U3XA 4JYPA 3M2TA 1DELA 3BRWD 1E69A 4HOTA 1KO1A 2V3CC 4GI2A 3NW9A 2XNDA 3BGOS 5A9SB 3T5PA 4MUFA 4LJ8A 2XTNA 3UFXB 1JCRA 2HHHB 3KC2A 4OREX 1P1BA 1BCSA 1BE0A 4OBEA 5HRYA 2HCBA 5JSHA 4AUEA 1YQWA 4DM3A 3ADBA 4OL9A 3WWCA 1JIVA 1UDWA 1OFTA 5KJ6A 2EFEB 4DCMA 1ZD1A 2E48A 3VZCA 2PM8A 1N3YA 2R6HA 3HVJA 4D3ZA 2BFDB 5IJ9A 2F8YA 4CTMA 1SBCA 4G5OA 3EXIA 3WLOA 3UKUG 2ZGGA 1OIVA 3L08A 1AVTA 4HS2A 4AMZA 2BTOA 2FPMA 1YHZA 2DWCA 1UC8A 4PS0A 2B8TA 3DAPA 3EX7C 2VBGA 5CVDA 3O0TA 3WWPA 4KQ2A 3VOTA 1A50B 3DF9A 2QENA 4RSMA 2XIJA 1E90A 4Q66C 4RIEA 3GCGA 2H4YA 1Z2AA 3EFOA 2OQVA 2HBYA 4WCFC 1PR2A 2QL6A 5BSUA 3T3MB 1CEYA 3K0AA 1MA3A 4EF4A 3DTVD 5CEAA 3MUFA 3FMGA 3KXLA 3CYFA 3L41A 5AUPB 1FXWA 1MFZA 3QU7A 3WTCA 1W0KD 3F9IA 1RAAA 5B3KA 4YQYA 3L1UA 4C0JA 2PLWA 4N5QA 3BZUA 3UX4A 5AVXA 4XPZA 3DEKA 3DC2A 3II6X 5DWQA 1OBVA 4MO2A 4WACA 4ZAZA 2GR9A 2JJ1D 1LS6A 1H9AA 3DPDA 2HU8A 2FPXA 3TFWA 3ABQB 3KQQA 3N07A 5LOVF 4L8YA 1UADA 1XRSB 2E7ZA 2OPHA 2JFZA 2A5GA 3L8MA 1CETA 5L3QB 1Q14A 3GPBA 1GIAA 1KR5A 2X9QA 2PX0A 3MJSA 6LDHA 4CIDA 3B7PA 1O6BA 3A7DA 1N9AA 4NMWA 1SC4A 1S1MA 5EXDA 3ZYZA 1ZIXA 2OO5A 1RAIA 4PYJA 4ZI7F 2GJAA 3ZHEA 1VIAA 3EARA 3UMJA 3PFBA 2X6IA 1TPYA 4I5DA 4AICA 2FP3A 2EKBA 3DEPA 1TCUA 4REOA 4F06A 2RI1A 3P9RA 4D56A 3P19A 4RA6A 5IJZA 4UVHA 2FTKE 1IU9A 3AERB 3D4NA 4FADA 2HIMA 3KUDA 4E70A 4EW6A 2K6GA 2VJPA 3INGA 5DN6D 2GPBA 4UVEA 3EGWA 4C20A 1TVMA 4QDZA 1QVWA 3M1IA 1D7OA 621PA 3PKJA 8GPBA 1ZMOA 1RHRA 1XHFA 2NQTA 1Q19A 2BRUA 4P83A 1LQUA 3QEJA 2QY7A 4ZVPA 2JVJA 5EZYF 3OZDA 4RYLA 4XE0A 2ZQ5A 2OKGA 2WRZA 3I73A 4P54A 3MA5A 4ILIA 1Y8CA 3RABA 3MMZA 3NAMA 3PLNA 1ZNQO 4RHTA 5B1BE 2ZAGA 3G2SA 1SVKA 3A1VA 1DKOA 3TGOA 5KNDD 1F9AA 1Z0KA 4OAQA 1TMYA 4R31A 4X5OA 4EBFA 1U7UA 1FRVA 5KJNA 3T9AA 4PH4B 3U3DA 4A6EA 4LC9A 1M2VA 4JVOA 3WNVA 3V8QA 1I4DD 3C3BA 2WJJA 4PYRA 1P44A 2AK3A 4TSFD 1ABFA 3K5WA 3R1IA 3U26A 3ROEA 2WQ7A 3VNSA 1O5OA 3CCCA 4LBVA 3FTWA 1WD5A 3ZKJA 3CHQA 3CLVA 1NVDA 2J45A 4RORA 4MS4A 3A9UA 4HFJA 5BV2P 2GPNA 3WMFA 4KU4A 1HE2A 3JQ7B 2GRUA 4U0ZA 4AF6A 1MZVA 3DG9A 1Y8ZA 1QHFA 4R8SA 1H93A 4WNCA 5CRIA 3LZCA 3IBCA 5K8UA 5I3CA 1PU2A 3H4TA 4CPDA 1T6NA 1BC5A 3AG2E 2LCQA 1KERA 2Q1YA 1N1GA 1FYEA 4PG7A 3WWOA 3HDTA 4LK3A 4WNAB 2DYSE 4DVJA 1IY0A 2B4QA 4DIBA 1RRPA 3BREA 4TTAA 3D3EA 1X7DA 4Q4HB 2IYZA 4OXRA 4Q00A 5JPDA 1GG5A 4DBLC 1XPRA 4DV7B 5JTUA 4DR6B 4JPSA 1B7GO 3G82C 1AP7A 1NAHA 1JFFA 3DTYA 2NU6B 1HG0A 3OBIA 4QQ8A 4L75A 2AFHE 4ZFNA 1UJ2A 3BD8A 1HI9A 4JS0A 2R00A 1GZ3A 1U8EA 5C5DA 4RF2A 3BQMB 5HM8A 3GUYA 3ED1A 4IDNA 1TKRA 4JH0A 1ELOA 3P5SA 3L3BA 1A8HA 4RO0A 4M9XA 4CFYA 5CG1A 1JMKC 5C8VA 4ZHQB 3RKUA 3K70B 3K73O 3MT0A 2I7TA 4DN6A 1E96A 1E3LA 2X0IA 2QP9X 3CLSC 3AB3A 3A9VA 4IV8A 2ODPA 4WNEA 1WY7A 4V0ME 4IOMA 3TOXA 4US1R 4KXLA 4QBTA 3RYFA 2OSBA 3QPWA 1SU6A 1JSLA 3CUUA 1SXPA 5L7WA 4YMIA 2AFHA 1G3UA 1RPAA 2G5TA 3A3PA 3I1FA 1GSIA 1D2AA 2QL7A 4YPFA 3WJ7A 4BNHA 3IDZA 4IHJB 3LBYA 3DPYA 1Z0ZA 4P5DA 3K15A 2XOXA 4QDTA 1B76A 2FOXA 1LD8A 4JIMA 5JPIA 1ZU5A 3W2FA 1WCXA 5CNMA 4FW9A 3IPLA 3HUEA 1IHOA 2XQVA 3IT0A 3L18A 5FPKA 3KJXA 1U0BB 3QXCA 4LXHA 2Y0CA 2YNQA 3DQPA 2B34A 5BNTA 1U99A 1DX4A 3DHEA 2CJYA 4BMOB 2QXTA 2AK2A 4G2VA 3B7WA 1Z7EA 2DUNA 3KTFA 5FJJA 1XNQB 3ZNPA 1I2AA 1YK0A 1FSSA 1WEKA 3G02A 4GKKB 2CB0A 1UOHA 3BEOA 1HFWA 1WULS 2NSJA 1UJ4A 2R8OA 4ZV7A 1TNOA 3A1UA 1TF7A 4YWJA 4JD2G 2PBZA 1RQLA 2VHZA 2FF4A 4FYPA 3QMWA 3IKLA 1JE1A 1ZM3A 3BZWA 1DDOA 3DRAA 2ZVJA 4L4SA 2NPOA 4EHBA 4F1KA 1AZWA 3AEUB 4ZYWA 3APCA 3EF0A 2QI9F 4Z54A 1RHQA 4EYGA 3BERA 1O97C 3WYBA 1CZLA 5JNTA 1QV6A 4DMCA 1CQZA 4XASA 3VKFA 3FUDA 3UMFA 3OQNA 2IITA 2XCSB 3ETHA 1DT5A 2BFPA 3LBNA 2PH7A 4E4RA 3PQ3A 1L3CA 3EDMA 4R69A 2R65A 1Y6ZA 3H2ZA 5DSZA 4B89A 3OESA 3PDUA 3EISA 3WSVA 1MW8X 1J9EA 2DAPA 1UZMA 4BS9A 2ZT6A 1FIUA 3ZUVB 3I0NA 1NVFA 2WG0A 1KK1A 3NDIA 2XA2A 3DBOB 3FGOA 1EUCB 2QYHA 3VPAA 3OF5A 4W5NA 2GEDA 2HMVA 2WXMA 2IXTA 2JIRA 3NYWA 2QN1A 3HU5A 4KPEC 1OI2A 2H85A 1IN8A 2FPPB 5A5EA 5DISB 1SRRA 3GLIE 2C0CA 5DBKA 4EGAA 4QUBA 2ZIXA 1U1CA 4ZZ1A 3K4PA 1UT8A 4AJIA 3KAEA 2JEKA 2IX9A 5FI0B 2QKYA 4J03A 1STOA 4PAMA 2V9PA 2PX8A 4MRAA 3IJRA 3EZXA 3O38A 3RC9A 3AVWA 1KDTA 1IZZA 1P4SA 2CYBA 3GDFA 4HBGA 1C14A 3DMDA 1I9GA 2A7XA 3O47A 4HZIA 4RPIA 3ZTWA 2NZJA 2K7ZA 3Q1LA 1TA4A 1RIIA 1EFVA 5EP4A 2CVPA 3D6VA 5TMBA 4HI8A 5E1DA 5JXGA 4RSYA 1Q74A 2NV6A 4EJ2A 2XLCA 3QBTA 1ZA2A 3G1TA 4I1VA 1O4VA 1A4IA 4POOA 5JDCA 5FLXA 1AMOA 1VC2A 3TAUA 3ZN3A 1YR3A 3LIIA 4K6CA 2E6KA 5IK2A 4KFRA 4C7JA 3GLIA 3MOIA 3ZCUA 2XOKD 2Z4RA 5IDQA 3GZ4A 4HH1A 2K2QB 1E58A 5FTKA 3ILVA 1KEPA 1E5QA 2OQIA 1L5OA 4Q3NA 2V8SE 3CHPA 4G4SO 1XA3A 4W1RA 2NO9A 4XARA 4HJXA 4Y6GB 3PFIA 1YIAA 1NW7A 4NQRA 4R71A 3GGCA 3PUZA 2ZZNA 4QQNA 4RX1A 2A0UA 1EK2A 2XTJA 5A3VA 2VTVA 1E1MA 5ER6A 1N4SA 1LF0A 2A88A 1Q3TA 3H1AA 3WYFA 1W8IA 5E3IA 2HQRA 4FW8A 5AW0A 3BUSA 3KTDA 3K31A 3VHXB 3C7TA 3DJYA 2AG0A 3MCUA 2QN3A 3SR4A 4LDPA 4RDCA 4G4GA 1TMGE 5H3HA 2RG7A 1FK8A 3RUPA 1RTTA 3ZYLA 5JY6A 2QTFA 2DPXA 3ZI4A 2VXOA 3GP3A 1J33A 3R0IA 4PPNA 4HNAD 2KW5A 1O1YA 1QZUA 4ADSG 2WU0A 3EZFA 5EFOA 1RRGA 2AC2A 3LXUX 3GJQA 5EIEA 4LYFA 2L0IA 3OFND 4TRMA 2D5IA 1L3IA 5I7WA 2FUCA 1G8FA 3PP8A 4WE3A 3ZV6A 4IX9A 3LX5A 2I66A 2IP4A 4XUCA 2CHVA 5BPHA 3CNBA 2QR2A 2Y27A 3JASA 1YVDA 3MN1A 4GTMA 5LOZA 1KY4A 3KT0A 3MWLA 4XQGA 4YXWA 3E34A 2G6BA 3PV0A 4DL9A 3QXJA 3K32A 3TU3B 1L7OA 2X13A 4BB6A 5CPBA 2LW7A 4NY1A 4EMSA 1SC1A 1UM9B 4D46A 2PFKA 1W1WA 1KK3A 4TWZA 5HWSA 2G28A 1ISHA 4QOFA 3MW8A 5DBIA 1M0EA 3RWOA 3Q12A 1FOEB 1DEXA 4O6VA 2ZROA 3E4BA 4ND8B 3A1NA 1YDFA 4AYTA 2B37A 1UFRA 1J90A 3RFVA 1XN4A 3DMNA 2EJUA 4KTVE 4OQNA 5TV2A 5I7UA 1R4NB 4QQRA 5CEJA 3WB1A 1U65A 4K03A 5LQAA 3DO8A 2V1UA 2B1JA 4CMEA 2HA6A 3HFGA 2VWPA 1U2DA 5IU6A 1BWPA 2QL5A 5DBHX 3AJRA 3DFUA 4KNYA 4FFDA 1ZEMA 3OSZA 4Q3BA 3DYBA 4PVCA 1V71A 2O48X 1KC3A 2YKGA 1YDWA 2NSZA 2H2WA 1HE8A 5TGTA 4TWIA 4LY6A 4DR4B 3L54A 4LCTA 1C80A 4OBXA 1N6NA 1HTWA 5HE8A 3WLMA 3AYZB 4ACAA 2I29A 1BFUA 1AHPA 2FUKA 3F5QA 2QIOA 1FS5A 2AVNA 3KYIB 4N3NA 2CYAA 3R3UA 3UK6A 1KFEB 1B1CA 3RYCB 2AN5A 3TFOA 2X6QA 2V5UA 3Q5DA 1E1KA 3WK4A 1XN1A 6CHYA 2P3SA 4RG6A 4PYQA 1Z16A 1N8TA 4IVRA 3M5DA 4HZGA 1F6BA 2X4LA 3L7AA 1QHSA 4PG4A 5KIAA 1I1NA 2OZKA 4FFSA 5D51S 5BSGA 3EQ7A 4FFRA 4R9SA 1BI8B 1XP5A 1K3FA 3R6WA 2PZIA 2IQIA 4U9HS 4FMDB 3UK2A 4GOOD 2WSBA