4N3CA

Crystal structure of human o-glcnac transferase bound to a peptide from hcf-1 pro-repeat2(1-26) and udp-glcnac
Total Genus 279
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
279
sequence length
716
structure length
697
Chain Sequence
b'CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title HCF-1 is cleaved in the active site of O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/substrate
total genus 279
structure length 697
sequence length 716
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3cA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3cA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4n3cA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4n3cA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n3cA03
4KQMA 3NF1A 4FZRA 3T3EA 3CK7A 4KQ1A 1JG7A 3CV3A 4BFCA 4H7XA 3S7FA 2IF4A 2G9VA 2XA9A 3NB0A 2QLLA 3T5TA 3CVPA 3Q15A 2R60A 3H4TA 2G9QA 4U0SA 2C2LA 4HWGA 5EKQD 4CTNA 4I2ZA 2YHCA 3FP3A 2ATIA 3VDMA 1WUYA 1L5SA 1FTYA 1SXQA 4O6FA 4BTBA 4EQFA 2DBAA 4I2WA 1O6CA 1YGPA 3UYKA 5EX0A 1P29A 2P58C 4RIGA 5DXFA 3PE3A 1FTWA 3ZCPA 1FU7A 5HQ8A 3MS7A 6GPBA 3RIBA 3OY2A 3T3IA 4YVOA 3MQFA 3VDNB 4BQIA 4X7MA 2MHKA 3QWPA 3HYMB 1A17A 3MBOA 5ENZA 4UQYA 2QZSA 3ULQA 3MRVA 4JA9A 1L5QA 2GM9A 4GZ5A 2FF5A 2GEJA 5CHEE 5A7DB 2XCCA 4GYWA 2C1XA 4AM9A 2UY1A 3RSCA 2GW1A 4N3CA 3U3WA 4QLBA 4WUYA 3CK9A 4NC9A 4WNEA 4HOUA 4N3BA 5LQDA 3CX4A 2AMVA 2XPIA 1GPBA 3BCUA 2QN9A 2KCLA 1FS4A 2QN8A 3CKBA 3LYAA 5IKOA 4EL0A 5CCLA 4M83A 3H4IA 1FU4A 4WACA 5FT9A 1NOIA 3MTDA 1Z8DA 2SKEA 3LY9A 3AS5A 3CV0A 3SZ7A 3ZGQA 3HBMA 3IA7A 2VCEA 3OKCA 1M5RA 5JTTA 1HH8A 2X0FA 1Y8MA 2FETA 3CEQA 4F3VA 1EXVA 3FFLA 1UQUA 2XCBA 4G1TA 2PL2A 4I17A 3Q49B 2VSNA 3HBFA 4M7PA 4RG9A 3MT9A 2BFWA 3L7DA 3WXXA 3PDNA 2AZDA 3OKAA 5FJYA 3Q4AB 3DDWA 3MSCA 1P4HA 3CUVA 1KTIA 1C50A 1NOJA 1H5UA 3CVQA 2BISA 2QRQA 2IV3A 1NVKA 4X6LA 4U07A 1HZ4A 1NOKA 4HLNA 3C4QA 2VGXB 3FROA 4WADA 2L6JA 3G2LA 2LSUA 4YI3A 1PSWA 1PNVA 4BWRA 3CEJA 4BT9A 4MI6A 1QZ2A 3EBPA 3G2JA 4G25A 3OTGA 3MEKA 3L7BA 4BQEA 4JA7A 4G26A 2IYAA 3OY7A 1SXPA 1AHPA 5ARGA 1ZBPA 4HORA 1Z6QA 2ACVA 4AMGA 3DD1A 1C8KA 3MRXA 3ZN3A 1JIXA 2NC9A 3QKWA 4UI9K 2F3PA 3ASHA 2XGOA 2ASVA 2KCKA 3S29A 3FWVA 2X6RA 3GPBA 3VUFA 2QFCA 4ME2A 3D1JA 3S27A 3U4TA 2QN3A 2R4UA 3OT5A 1P4JA 3ZCQA 3QKYA 2QLMA 3OTHA 3OXLA 3ZHEA 4F96A 2H1HA 4PQGA 3AS4A 3E3OA 2FI7A 2XA1A 3O3CA 4KYOB 3ASGA 1ZU2A 3S7JA 1A8IA 1JG6A 3AMVA 3VTYA 5BNWA 1RZUA 3AS8A 2IV7A 3Q3EA 1E1YA 1WAO1 3CUUA 3GYZA 5TMDA 2IEGA 4EKYA 1XKXA 4LDPA 3TAXA 4Y6CA 3JYSA 3BD6A 3L7AA 4G23A 4XI9A 3L7CA 3E3NA 4AY6A 2VYIA 5HXAA 3WAGA 2BGTA 3TG5A 3MRTA 4YVQC 3KS2A 2JJMA 5CCMA 3TG4A 2VCHA 4N5CA 3S0JA 2C9ZA 2C0LA 3SYMA 4HOSA 2R68A 4KBQA 5AYWD 4XI0A 5D01A 4LEUA 2Y4UA 2X0EA 3NP7A 3QWWA 1GPYA 2ECPA 3RT1A 4RIIA 2UWJG 2XMPA 1L7XA 4J0UA 2G9UA 4XIFA 4BTAA 2VG8A 2SKDA 1F6DA 2VGYA 2GPBA 2WTXA 4G24A 2QN7A 3BEOA 3ZCRA 3ZPJA 1C3JA 3MT8A 3ZCUA 1NZDA 4GPKA 1ELWA 3HBJA 5ARFA 2WPVA 1XC7A 2IUYA 3G2KA 1OUVA 2OFFA 1NA3A 3ASDA 2ONDA 5D0QD 1PN3A 2Q7FA 1IYGA 4B94A 2PRIA 4NEQA 1WW2A 3RHZA 1NLMA 2Y4TA 1HLFA 2PYDA 4RIHA 2VQ2A 3WC4A 2F3QA 1P5QA 3G2HA 3BEEA 4GA0A 1BX3A 3S28A 4GZ6A 3KAEA 4WNGA 2C1ZA 2GEKA 3EBOA 3GZ1A 3QOUA 3DZCA 2XEVA 3NC4A 1KT1A 4GYOA 5LCWC 2J9QA 7GPBA 4N3AA 5D00A 5KJKA 3WADA 2R4TA 3LY8A 1UZUA 2IW1A 1HXIA 3CUTA 4REMA 3VTXA 5C1DA 4YI5A 4F9FA 4UQXA 3S7BA 1P2GA 3ESKA 1QKJA 3LCAA 4BQFA 4GPBA 4KQ2A 1JEJA 5LCWJ 4W9RA 1NA0A 3MA5A 2V5FA 2WQHA 4JHRA 4J8DA 1PYGA 1B89A 1WM5A 4N2SA 3BCSA 1NZFA 9GPBA 4CGVA 4AN4A 1FC0A 3MV2B 3CUWA 1ABBA 4LEIA 5DIZA 1IXYA 2XA2A 1K08A 3K9IA 4RELA 4UQZA 4GA1A 1QQEA 3IAAA 4W6QA 1XL0A 2HY7A 2HR2A 1GFZA 1XV5A 2F9FA 3BDAA 2R66A 2JLBA 3QWVA 3SF4A 3LPZA 3Q3IA 2PZIA 4GZ3A 1Y8ZA 3BD7A 2FBNA 1J39A 2OOEA 3C48A 3Q3HA 3Q5MA 3GW4A 5G05C 3OKPA 2VGXA 5KJMA 2ZB2A 2YQ8A 4YNDA 8GPBA 4Z5XA 1P2DA 4KXKB 5FTPA 4G2VA 3R9AB 2GPAA 2GT1A 3PE4A 5G05J 4UI9C 3MS2A 3C4VA 3NAZA 3E3LA 5BW8C 2AV6A 4GCOA 3URZA 2Q6VA 4APOA 1WW3A 4U0UA 3T3HA 4EJ2A 5G04C 5DLDA 1YA0A 1W3BA 1K06A 1JIUA 3D0QA 1WV1A 4UI9J 1FA9A 3KD7A 3Q47B 3MTBA 2XGSA 1RRVA 2QNBA 3L01A 3NP9A 4MI9A 1IHGA 5I45A 2IEIA 4CDRA 2LNIA 5G04J 1E4OA 3CK8A 1IIRA 3NPAA 3EDTB 3COPA 1LWNA 1ELRA 1E96B 4ABNA 4AY5A 4MRAA 2G9RA 4U0ZA 4MHOA 1KLXA 2KCVA 1L6IA 5TMBA 2FO7A 1WUTA 2VSYA 3MKRA 4EL5A 1XL1A 3RO3A 1V4VA 4NQ0A 1UQTA 2QN1A 3TGOA 2PQRA 2F3SA 2SKCA 4CTOA 4YUAA 2UY1B 5BT1A 1GG8A 3T3GA 2X6QA 4NESA 1KT0A 1L5RA 2O6LA 3LY7A 4CTMA 3N71A 4WHMA 2KS6A 2QN2A 3RJVA 2I6HA 4U04A 1FU8A 2FFRA 5FZQA 4I1AA 3D0RA 4MICA 2QRPA 3MTAA 3S7DA 3HBNA 1TJCA 2PQ6A 2GPNA 5TVGA 3T7DA 1P4GA 3MS4A 1XNFA 2C4MA 3OXGA 4MI3A 3GUHA 2X0DA 2PRJA 3OXFA 5JJ6A 3CVLA 5DU2A 2PQNA 1NZNA 3ASFA 2IYFA 3IEGA 5JTUA 1P2BA 2P6PA 3RU0A 2PYIA 1QM5A 1Z62A 3UPVA 4AMBA 3CVNA 4RBNA 2FF4A 2BGUA 2HYZA 5FZRA 1L5VA 3GZ2A 2H1FA 5M72A 3TOVA 2E2EA 1C8LA 3UYLA 5FZSA 1FCHA 2QLNA 3CEMA 2QRGA 2AVPA 4WNFA 4N2QA 1VGVA 3BCRA 3LKUA 4HOQA 5KJNA 3S2UA 2QRMA 4EKEA 1LWOA 3QHPA 4I9CA 5D0OD 4MHSA 2BUGA 4WNDA 3VUEA 2QRHA 4RENA 4J8FA 4IN3B 5EX3A 4HOTA 3G2IA 4FKZA 1B4DA 1EM6A 2R5SA 4X7RA 2AW3A 2KATA 1GZ5A 3T3DA 3CUYA 5GPBA 1GGNA 4N9WA 4N39A 4G2TA 2HO1A 4F97A 3O48A 3DDSA 1GPAA 3UUXA 3G2NA 3ZHEB 2ACWA 3ZCTA 2F3UA 4Y6WA 4RIEA 5TMEA 4RG6A 1XOIA 3RSZA 2YJNA 5DBKA 1RZVA 3MV3B 4BT8A 1L5WA 5JJTA 4H7YA 3L79A 3CEHA 5A6CA 3UQ3A 3ZCSA 2FEZA 1F0KA 3MT7A 3E4BA 4NRHB 3CKCA 2KC7A 1Z6PA 4CGWA 2C0MA 4GA2A 5IKPA 1PC2A 4I9EA 2XCUA 4J8EA 3RKVA 5JJ7A 1FTQA 4JL0A 3SYRA 3TSAA 3ZCVA 2IFUA 1JIVA 4AIFA 5KJLA 5HI7A 1Y6FA 3BD8A 4X7PA 2XCIA 2GJ4A 3OTIA 3NCHA 3RO2A 4GYYA 1Y6GA 4M60A 1YA6A 2JZCA 4A1SA 2LSVA 4GCNA 3ZFWA 2XGMA 4RIFA 4L22A 3QDNA 1WV0A 1AXRA
chains in the Genus database with same CATH superfamily
2ZKIA 1ZK2A 4ISBA 2O52A 3LX5A 2J41A 2R60A 3CLTC 4KQGA 1X87A 5E1OA 4B93B 1FFDA 1BX1A 3OPMA 1ENOA 5F2KA 3H1GA 3AR8A 1JZSA 2YVAA 1U0HC 4Q19A 3ESCA 3UAWA 3NVMB 1INZA 2HIGA 4IILA 5JPCA 1SXJC 4R6XA 2C1EA 3EZ2A 1I1QB 1WEHA 5DSXA 2YV3A 3ZWPA 2JGJA 1SM4A 4EQZA 4C0SA 4OB8A 4ALJA 1GNLA 2XPIA 1N0IA 4YCCA 3DXMG 1N8SA 1WVGA 1ZRSA 3U31A 3MTDA 1SCUB 3ZUVB 4IICA 1G16A 1BSVA 1Z38A 1VPVA 1BVYF 2J9FA 1ZH6A 3M70A 1KGSA 4WKBA 5IXJA 2FRVA 1S02A 4PSCA 4RD0A 3CCCA 4R41A 4RK4A 5DLEA 2XGJA 3N39C 2WKRA 1V1JA 5FJJA 2XTJA 1VMKA 2HSGA 3CKLA 4YT2A 5EINA 4BQEA 1FP1D 2OC9A 4F6RA 4C05A 2R47A 4U1RA 4E5DA 1QIEA 2ESRA 3I4RB 1QRUA 3AU8A 5E6UB 4GUAA 4GMLA 5DLPA 3LHIA 2O6HA 1N2HA 3TRHA 2H2WA 4YONB 3U3OA 5KNDH 3HCBA 5CYFA 2OXCA 3BERA 2Q9CA 4DCJA 1XD2B 5CNJA 2QBYA 4B82A 3E3NA 2BGTA 5CCMA 4HQ6A 4PIMA 4OLHA 4F46A 3FUJA 1TK9A 2PUHA 5BV2P 2QG9A 1W5FA 3P20A 2YH2A 3K1ZA 5K0BA 1Z0ZA 1KS2A 2DYRE 5K8LA 1V7PC 1A97A 4KP7A 2NO9A 3VC3A 4BTEA 3OAAD 4OXKA 2POCA 3ORYA 3DOUA 1LW6E 1CW2B 2JAWA 2I2WA 4ZHSA 2XWSA 4C4AA 1I3NA 4G11A 2IWRA 3MTEA 2WHPB 3ESKA 1NW8A 5LZ7A 4E5NA 1ISMA 1O96B 2NXCA 2OD2A 2J3EA 3DBRB 3T4PA 1SZ9A 3RAGA 3N2IA 1SVIA 2D5BA 5AW2A 2WMNB 1QCZA 1QF7A 3GBPA 2LNDA 5DTIA 1UBOS 2GERA 3IPAA 2WHYA 1U8ZA 3CTMA 3QGMA 1C81A 4FJ1A 2ZYAA 3K2IA 1T9GS 3N58A 4UI9C 4J75A 2VK8A 1FVFA 2I1LA 2YFYA 1DZIA 2WP8J 2CG2A 1N5KA 3WIVA 4P0QB 1C29B 1I14A 1TVEA 4DVGA 1XNRB 5AW0A 4J0EA 4ZVUA 1RPZA 1MDBA 3DV9A 1VTKA 4C0HA 4L0DA 2GFHA 2PGNA 3QUQA 5TMBA 1GADO 2W4MA 3G17A 4QDOA 3U7QA 1X42A 3JQ8B 3HXDA 1J0CA 3UPTA 3ET5A 1FFXB 2WQZA 2P79A 4JD5A 3OQBA 3H2IA 1JHUA 1VE1A 1M3SA 3JWJA 3H5LA 4HEJA 3QMMA 3ROGA 3RARA 2ZQZA 4CMKA 1OWLA 5CFLA 3D3KA 4RPJA 5K3FA 3TOVA 1KRXA 1GQ2A 2BDUA 1EXWA 1P5RA 1RI3A 3I2YX 5K51A 4GVXA 821PA 4ZJPA 1NASA 5EX3A 2G4LA 5G2NA 1J4AA 5BWMA 1OIXA 3KDSE 1C9NA 2QTFA 3WB0A 1QPGA 2XNSA 3AV3A 1U7DA 4D6PA 1V9SA 4RD4A 1UBTS 2CLSA 2VBIA 2ATCA 4XWKA 3W5CA 1TADA 3C5WP 4FD3A 4Y2UA 3TQSA 4C88A 1KIMA 5CXQA 2WEKA 4AIFA 3NCTA 3KHKA 1DV1A 1JXOA 3NCHA 1U2ZA 4NVRA 1PDVA 1ZLYA 2I6SA 1YZVA 4N0MA 3T1OA 2EU8A 3B48A 4O8CA 1O9HA 1QKIA 3CE9A 3ROPA 3JQGA 1DKPA 1YGPA 4IQGA 3PH0C 5CMWA 1WR8A 1A96A 2VPWA 1T91A 1TVMA 2XBUA 4DMCA 1KFCB 2JZNA 4ARZB 5EIOA 4Q3OA 1JU3A 4ZI5A 1HFWA 2ZR9A 1E1KA 3IAM6 2PN1A 3GRVA 3R09A 4QARA 2ZTLA 2HWYA 4O6VA 2BMFA 3SPXA 3T95A 6PFKA 1XT6A 3TXAA 5J4HA 5HZHA 2IZ0A 4Z9YA 3ESRA 2GM5A 2OCXA 2ZWIA 1YMQA 3BXOA 3ST7A 4UMFA 4TUYF 2WP0A 4FFMA 3PYMA 1O0CA 4EB6A 2RB4A 4R8VA 2ZE7A 4OLJA 2HE0A 4EGFA 1V7ZA 1YI8A 4LF7B 2LXLA 4RTJA 2R6AA 3LCCA 1T1IA 5GWXA 3R0JA 4MGZR 4MRNA 3W3ZB 1NAHA 2WJPA 4CTJA 2EP5A 4R84A 2GARA 3TE7A 4DUGA 5HDQA 4W1SA 2XOXA 3ZJVA 5J47A 3QXXA 4CM4B 3MWGA 1GGHA 3T94A 3RNLA 5HQJA 2BSXA 2H2HA 5ALPA 2Q5IA 3MCAA 1NJSA 4AUMA 2F1RA 2G9UA 1M2NA 4G41A 3BFJA 1J0BA 2QT1A 3E7XA 1RJ9A 5ERGB 4HQDA 3EVBA 3NAMA 4HGNA 3ZKWB 4GZDA 1IAQA 3I4LA 4XPZA 4CKWB 3A04A 2VT7A 5AHKA 1MRZA 4FEAA 5D0QD 1QRDA 3BD9A 4MDYA 2PD4A 1NN3A 3OBBA 2F8SA 4TT3A 2MR5A 2RGNA 3AEQA 2VUHB 4DX6D 5L4NA 5CGQB 4TKLA 1Q2ZA 4LV5B 4MA4A 1TUBB 1CXZA 2M6RA 2Z8YM 4MYUA 5D3ZA 2PH5A 3PWTA 3PZ2A 1NVTA 4RA6A 2GPJA 3ANMA 2ZRPA 4ZDJA 4PM4A 4R5HA 1HKHA 2F37A 3NEJA 4ICIA 4RQUA 2C83A 4TL6A 1G8PA 4UTOA 2ZZKA 2W43A 1OX4B 1XTVA 4YCNA 4JT4A 2J85A 1YVRA 4DPRA 3HXCA 3IKMB 2AKYA 4L9PA 2PZBA 3L06A 3GLTA 3FHTA 3HO8A 4QU9A 1AQJA 1KZ1A 3I3SR 2G25A 2CLCX 1N2JA 4W7SA 2MOWA 3ED1A 3NEAA 1R0ZA 3EG9B 3KDPA 5KYUB 2GS9A 1PUJA 3Q8LA 4DIEA 5BVGA 1R6XA 5TS2A 2QIPA 1UJ5A 1Q1NA 1NC1A 1ULBA 5E2AA 2ZP1A 1KF0A 1B2RA 4MLZA 2QUBA 1T1SA 3IAUA 1TXGA 1CQZA 3T0IA 2FFRA 4TXLA 3DMRA 1BG6A 1L3CA 5IJ0A 3EEOA 4L1BA 2HNBA 2V0CA 2JVJA 1FE8A 4WCFA 2PKQP 2WJZB 4TTPA 4D3FA 2FW0A 2ZJ6A 5CXSA 4RFLA 3BXEA 2BLNA 4IS2A 1D2EA 2E49A 5GVRA 4EW1A 3CLJA 4LG6A 1RYHA 5KQMA 4QT0A 4J49A 1LF8A 4CKBA 2F90A 1X6VA 5FTMA 4RZUA 5I7OA 3KKLA 4KIJA 3GRFA 1B0AA 2PL3A 3HUEA 3QF4B 2GRPB 4PS8A 4L0MA 1C80A 4YWHA 4AIIA 1W4RA 3BJIC 3TNLA 4CR6A 3BGVA 4FFBA 2ADOA 3BXFA 5LYJB 1DAHA 1MC1A 3N0VA 3SYRA 4OTZA 2CHUA 1WXWA 2QL5A 3JQ7B 5B6JA 3A2LA 1LVGA 3UT5A 4W8GA 4PINA 3LWBA 3HCNA 3NM4A 4LJ4A 1OFVA 2P67A 1UK8A 3U17A 4WERA 2P9HA 1E2MA 2B1QA 1J21A 1PFYA 4Y2QA 2OZKA 1KIAA 2J5KA 3DBOB 4HTAA 3DO6A 3BWBA 1KY5A 1R6UA 2MSNA 4S1PA 3PJDA 4OHFA 2B20A 4UATA 2IL1A 1J0XO 2IDKA 1BVRA 2GYUA 2HHCA 2C5SA 4HWKA 3VDQA 3NNNA 2G4VA 3SHOA 3TMYA 4EO4A 3GXBA 3BCUA 5T6BA 5JARA 3DEZA 1RIFA 1I94B 1E8OA 4D74A 1ONOA 3H4IA 2W2NA 1N4QA 2JG3A 4UNPA 1C0KA 1VKZA 3N6XA 1TM5E 2Q2OA 2YRXA 4MPRA 1DAPA 1UEXC 4H1VA 5KYYA 2YJ4A 1G7CA 3QEMB 3BZUA 3EZFA 4K6CA 4XYEA 1L9XA 1RE1A 5IUJC 1SXGA 2QD1A 4ATGA 3AONB 5FTNA 3BMNB 2B34A 4NMMA 4UU1A 2O19A 1WWKA 4P31A 3SN6A 1IY1A 1FLDA 3DSWA 4PO1A 1J2YA 4ADSG 3FTCA 1OW3B 5KSYA 4L2IB 3G82C 5I47A 2AWNA 1NLUA 4RM2A 5FBZA 3FU6A 3OXLA 5TXGA 1SPBS 3DZBA 3KM0A 5JXIA 2OBFA 4G4SO 2OZPA 1LLDA 3T0FA 1LNZA 3TQHA 1PS0A 3RSSA 5B2ZA 2JAQA 4F6LA 5CVVA 1RKQA 1XEWX 4FNAA 3QLVC 5FLXA 1CZKA 1N0RA 3NP7A 4W7IA 2ZSEA 3DCJA 1XQVA 4QA9A 3PGMA 1I1OA 4CGZA 5FUVA 2WAMA 7AT1A 1II0A 2L2QA 4G24A 1OLUA 5D3KA 4NBTA 4GTRA 4G0WA 1AKMA 4TXHA 1K0UA 2NG1A 3X43A 2ONDA 3TGLA 5JG7A 1TZMA 3ODGA 4G9BA 4LDAA 3ZHXA 2XBLA 2EJWA 2RK3A 1DSSG 1EX6A 1BU9A 3GJ4A 5FHQA 5EFZA 1ESZA 2R4TA 3IBGA 2OXIA 3ADBA 1NF9A 2XXBA 4LJ8A 2FSFA 2QVZX 2VA8A 2ZIWB 3O47A 4Q0MA 2X0RA 4KQXA 2DQSA 2VZEA 3ML9A 1ECCA 4AROA 2WG2A 4FQ8A 3QWVA 2C61A 3QEJA 4Y6PA 3DFZA 4GMJA 4UWKA 5B1EA 4H0NA 2XT9A 2RGRA 4RHYA 3ROKA 4Z5XA 4FCTA 3AWIA 3WP1B 3BF7A 2QXUA 3QYAA 3R6LA 1MB2A 4ESVA 4IOKA 2DCUA 4CQLB 2W2PA 4Q05A 4ZQBA 3CH4B 4I1MA 3AKCA 3CPEA 4AJ1A 3DS8A 3T35A 4POOA 2XUFA 4GP7A 2IYUA 3D6FA 1STOA 1SPXA 2VSYA 4NFHA 2NYVA 4MIKA 1FJ2A 1WQ3A 5AO9A 3PEYA 3MINA 4EHBA 4CM9A 2IUUA 2A1IA 5JHAA 1EFCA 3LW8A 1T3LA 3D0RA 3OOJA 2QRPA 4BV8A 2O8EA 1VLQA 3H19A 2G1AA 4H3VA 1NI4A 4DV3B 3LVBA 4JC8A 2JI9A 3UYLA 1V9CA 2QRGA 1ST2A 4YJDA 1QAOA 3OQVA 5ALWA 2QI9C 5D2MC 4MVXA 5EIHA 4QREA 3MSXA 2ZVPX 3WKDA 2K2QB 4XQGA 3MEQA 1ZN7A 2J3IA 5BW6B 2FUNB 3NJ8A 4BERA 1JDJA 3ZQKA 1GL3A 2YYZA 4LJRA 2DUUA 4JB8A 4QLAA 1C9EA 4FN5A 1ZAKA 3RAFC 2DYSE 2QSYA 4O4HA 3QNMA 4B5KA 3ZV6A 3TWRA 4HDNA 5IK2A 1MB4A 1T29A 3NRCA 3VHRA 1EHYA 2XCIA 2O2YA 2RHJA 3KD2A 3ESXA 4GR5A 4CDGA 3JRXA 4JYCA 4WINA 3RVLA 3FZGA 1BWRA 3NB0A 4WGGA 1PV4A 3BFVA 1HH4A 4QFCA 3A0UA 3R7WA 1PY1A 2BEUB 4MQ6A 1MABA 1AVTA 2Z5GA 3QWPA 3AFNA 1SHLA 3PU6A 3QVJA 1NRJB 4D3DA 2BN4A 2PFGA 1R0LA 4V0QA 1Z28A 4AM9A 3JARB 4OGWA 1A2OA 2G8NA 2G06A 3WHPA 4UHCA 4HAZA 2AT1A 3FSJX 3W3AH 4IRUB 2PH1A 5ITZF 3H5TA 1PT7A 4LSZE 1ZAYA 2P27A 4CMGA 3OKCA 1BOOA 4OFXA 1UBNA 2DBYA 3KOWA 4UTZA 1PO7A 5DBIA 1ILWA 5L3QB 4M0PA 2WG0A 4FINA 4YEDA 1BEEA 5KZMB 3F4KA 3Q10A 1KEPA 3F67A 1W5TA 2C4VA 3R3ZA 4U7WA 1QOZA 1EFRD 2I62A 5K03A 4C5AA 5J4YA 3FULA 1TVKA 3QE4A 4WWNA 4E2YA 1QGYA 3HFSA 4PF1A 4BGUA 1VOTA 3D1JA 3K1TA 3AIIA 1MO5A 5AARA 1U7UA 4HSEA 1MRNA 3VC7A 1QYXA 2GRRB 3BS4A 4JSTA 5F78A 1D6JA 1UWCA 3O3CA 1CIVA 3QPCA 3FJYA 5I01A 5AOVA 3P27A 2HK7A 5CNKA 1WZ2A 3GJ8A 1M83A 1JJ7A 1C9DB 3BXXA 5FFFA 1VYHA 4R98A 2JLUA 1GTL1 1UP6A 4TN5A 1O6FA 4BFYA 2J9GA 5KTRA 3RS5A 2P40A 4XCVA 2V7PA 1DRKA 1OHHA 4RTOA 1YU6A 4L7TA 1EVLA 4UPVA 3CTPA 3W8RA 2I1QA 3JSAA 2GN1A 4MNTA 1DVRA 2YZMA 3J7TA 2ZJ4A 4XDZA 1JDTA 4GPZA 1RXIA 1S70B 2GBLC 3LYLA 2YINA 4L8GA 3CW2A 3DLTA 2QTZA 1BRTA 2IP2A 2HXSA 3I1YA 2NXNA 1FP4B 5T3UA 1G55A 4N2SA 1YDEA 4NX2A 2G9ZA 1B73A 1Y9ZA 4ZAYA 4MIOA 4ER5A 2IGTA 3DEIA 5EXTA 4W1QA 2HCBA 3MCZA 2X1LA 2J5RA 2FBNA 3L84A 3HB9A 3OKPA 3V2HA 2PANA 3UWOA 4PHFA 4ZOCA 1JTVA 4H35A 1EFPB 2VQFB 3THXB 1L5MA 3FR7A 2AZXA 1QTQA 5BRJA 1FMCA 1UXGA 4NCNA 4KEAA 1WV1A 1Z13A 1VA5A 2AN1A 2FFBA 2LDXA 1J9ZA 2ZGVA 1XXHA 5EJ9A 3VSDA 4MHOA 4FZ5A 3Q15C 3QOFA 2W2KA 3MMZA 2DX7A 2ZKLA 3DPUA 4UVIA 4GUDA 3WB9A 4PZDA 4AECA 4FGKA 1MFZA 1G7SA 1FLAA 1K8YB 3LD9A 4YDOA 2RGBA 4A6DA 3NTLA 3QM1A 2EW8A 1CDEA 2Q3MA 1Y5LA 1S7CA 1L7AA 2O2SA 2WD8A 1KHHA 1U7PA 5E9WA 1KZ9A 4Y6LA 3DV0A 2DWQA 3IE2A 2PJZA 2JK0A 4MKFA 3FOEC 3OZAA 5E8RA 5A7HA 2HD4A 4G67A 2QZJA 5JD3A 4H1UA 3VNSA 1EI9A 5LA6A 2VSXE 4ZK6A 4BMNA 4KKXB 1DXHA 2XJ4A 1A7KA 3EQ8A 4X44A 5AOAA 4YV7A 3ISTA 5JS8A 1WABA 1RI2A 2J0EA 1QORA 2X4DA 2OAEA 1XK7A 3I2IA 1N8KA 2H4ZA 3EXG2 4DRZA 1VB3A 3L54A 2LDBA 5TEVA 1I13A 2R1UA 4B6SA 4DDUA 4URHA 2ZQYA 1MX2A 3JX9A 1EFLA 4Z8YA 1B7GO 4JLSA 5GVSA 4TV3A 2RHDA 3QVWA 3DULA 1N92A 4QRDA 1S2OA 4BFRA 3PUVA 3EXHB 4MUAA 5H4HA 4IFBA 4CKEB 4Q7JB 4J2TA 4RVUA 1KMHB 1LX6A 4JUIA 2QSJA 1E92A 1ZWLA 3ULYA 1BZYA 3TNFA 1KEUA 1NSTA 2PPVA 2HU5A 4HJRA 5LZ2A 1K9VF 3NXSA 4N3CA 2VH2A 1Z82A 3HN6A 4NACA 2VBGA 5AKEA 5IPFA 3DFKA 1I1NA 4US1R 1XCOA 2XMRA 3GDHA 4O2AA 3L13A 2BBOA 3O94A 1PU2A 1VJ0A 4YAEA 3HEBA 5TT1A 2BFBA 3HKDA 4F85A 3WYDA 3WK9A 2ZIEA 3PNLB 4X94A 2C2HA 1Z6XA 5F7XA 2ERXA 1C2YA 3SF8A 4AJLA 2AJDA 4U8HA 1C8KA 4XRRA 4LCTA 4P53A 4DBLC 1FFGA 3K9BA 3WOVA 3NASA 3VU3A 4Q4JA 4A16A 4G81A 1EZ1A 2BL4A 1P0MA 2CLIB 5A6VA 3J80A 3GYZA 1U4NA 4M9SA 3RUHA 2CXTA 2OBLA 4B80A 5F4BA 4ZAZA 4LQCA 1LDGA 1A5TA 5BN1A 4P3NA 5AKJA 3A8TA 4ZAWA 2CUTA 1TQHA 3MAJA 1RYZA 2BDTA 2B99A 4BEWA 3EYAA 2XMPA 2ZIXA 2QM8A 3KL2A 1ULUA 1N8TA 2HXGA 1UIRA 4AP2A 1DKRA 2VAMA 1IHDA 4I50F 2KMLA 4DRXB 1WW2A 1NVFA 1LV7A 3N0XA 8LDHA 5JSZA 1Z47A 4MTCA 1AUVA 3CUSA 3M8KA 1CJSA 3SGLA 1G3MA 1QC5B 3O21A 3S81A 5K7SA 1VIDA 3OF3A 3PV0A 3CUTA 1NVMB 1CBUA 4FMDF 5HIMA 1XZNA 3S68A 2ZWPA 1GG9A 5ALGA 2V5FA 4J1SA 3LO8A 3REQB 2P9NG 3OUZA 4OH7A 5AHRA 4NMWA 5DW3A 5H5JA 3QPVA 3JXEA 4RK5A 1E3WB 2PM8A 4JVLA 3THYA 1FLNA 4B6QA 1FUKA 3KJHA 2JFFA 4K5QA 3GCXA 4WFJA 4LJ9A 5GZ3A 3WTBA 2HI0A 3S44A 4YAIA 3JD3A 1Z2OX 4WPGA 2QRVA 3AX6A 2BGMA 1OCCE 2WVAA 2CLMB 4JR2A 2IYSA 3SYLA 5MF6A 4G09A 4CZ2A 5BURA 4NCKA 1FQOA 2QOEA 1OZFA 1SUAA 1GEGA 4EQ6B 2QVCA 1D5CA 1E4OA 2AFIE 5KVQA 2IZOA 2EXXA 3COPA 5EE9A 4ANXA 3OSZA 2RGAA 1CQJA 5IYZF 1WY5A 3OTWA 4WN3A 3NWEA 4E32A 2QJRA 1SURA 3OCXA 2FJAB 2XE6A 3I0ZA 3QOWA 4TKVB 2I4NA 2QX9A 4RQIA 3B53X 4CM8A 5AWFC 1DB3A 4YUWA 3AETA 1SU7A 2QSUA 1K27A 3ONKA 3UG7A 1TU3A 2AOUB 4JEHA 3JWGA 1Z29A 2Q4RA 1FCHA 5AAOA 5F21A 2OMEA 4ILKA 5JXJA 2QRMA 4EKEA 4FHCA 4IN3B 4FGWA 3ZE8A 3KDAA 1UZLA 3AF2A 1GGNA 1MJGA 2XKJE 1JQEA 1GEEA 3RVNA 5TMEA 5GZ6A 4EKDA 3NTOA 2JFXA 4TZ0A 2JRCA 1EHIA 4NDAA 4FWBA 4LWQA 3I4CA 4MWEA 1GJRA 2QY7A 1RADA 3M9LA 4M0LA 2CBGA 5C5CA 2WFLB 4DMUB 2Q7OE 3ZU6A 3DHEA 1T5LA 4NR0A 7YASA 4I4TA 2JJQA 2FW8A 1PF7E 1NXVA 3I9JA 3ABSB 1Z7YA 1ATIA 4EG5A 3FYUB 2H18A 1Y3CE 3MJWA 2ZJ8A 2Q3BA 1KDPA 3A2MA 4CIAA 1KI6A 1KZOA 3HB0A 3UV3A 4F5DA 2BJHA 4OHXA 1JNZB 2J4CA 5C8YB 4BSZB 1XMPA 2VHZA 1FFBA 5JCXA 5JSFA 2QPTA 2AC4A 3SLGA 1MG5A 5BNZA 1DXQA 3TWSA 1BIFA 2JANA 3M6XA 3WYNA 5AMXA 4CU2A 1FS6A 1OZ0A 4IDFA 2CHGA 2X13A 2OLJA 4XGNA 4HRLA 4YDWA 4Y1RB 5DCYA 5TQ0B 5FWXB 4XPIA 3KP1A 1AE1A 2CMDA 2OCBA 3A27A 2AX4A 4R9SA 2VP0A 3DOFA 4IIYA 4LNAA 4J9UE 2IH4A 4XDYA 3NBKA 3NDPA 2IZ6A 5BN5A 1YUBA 3TDMA 4LC0A 3NC1C 1YL6A 4EABA 4MUXA 4AVYA 1QH8A 4XX0A 1XCBA 5EP2A 5EWMB 3N8KA 1HTBA 5EZQA 1E7QA 3V1KA 5DM1A 1BS9A 4ETNA 1YTUA 4MKHA 3KPYA 1WAO1 2JFWA 4UCWA 3RGGA 4KAFA 4IFTA 2BKEA 1WA5A 1USUA 3L7CA 1SHZA 5U1PA 1WDYA 3G9QA 1JIIA 3S2ZA 3EHDA 1YL5A 3HXEA 3S0JA 5CB4F 1XK6A 4MS4B 5HE9A 1R6TA 2Q6IA 2E7ZA 3X1DA 2IYWA 4YCAA 1EUZA 3Q3VA 4HAWA 5H68A 1SXJA 4IUDS 4PV7A 4MA5A 3L1IA 4BFZA 2P11A 1LZLA 4L4SA 4F92B 3K8OE 3S1AB 2CCGA 4YMGA 1X8LA 1P44A 1OX5A 2ZYDA 3PDIB 3RK1A 1T4CB 2FN8A 4FW9A 2ODEA 3RTGA 1IM8A 3DNMA 4QT4A 5TMPA 4BX3A 2QS9A 3ZY4A 4F3NA 3DONA 3U3MA 3QF7A 4DREA 1DC3A 2WF5A 4NZPA 3OX1A 2CJWA 4LV8B 4LMBA 4E1AA 3KOUA 1HO3A 5BYKA 1DJQA 3OZFA 1J7KA 4JDPA 2BR4A 3PFIA 4ETIA 2BTQB 3PPVA 5D5QA 3LTNC 3N2KB 3ZYMA 5D5PA 3ZZ1A 3BM5A 2H5LA 3FTQA 2JCGA 3CHQA 3KQSA 2AXUA 5J63A 4EENA 3M89A 4L4XA 2QM0A 1CCWA 4XIIA 1I10A 3FSEA 3ZD6A 3FTSA 5KWJA 4TWAA 4HRMB 4GCOA 4BEBA 1OLXA 1TM2A 3M6FA 5EILA 2QKYA 1JIUA 4ZRNA 3V32A 3Q47B 4O33A 3KELA 3L41A 4WIAA 3EZ7A 5C32A 4HV4A 2J9ZB 3CKMA 4PG8A 5LQMA 4BVLA 5FOXA 4Q4AA 5T4YA 2AW6A 5TGZA 4D8XA 1OLOA 4PZLA 5BP7A 4G85A 3QXJA 4L9SA 2C9OA 1A3CA 2QP9X 3F8SA 2DU8A 4JVSA 5AK3A 4X45A 4XLTA 3NDIA 5TPZA 3MWJA 4ENWA 3UBMA 4AJIA 1MC8A 5AKXA 5CLLA 5EC8A 2ZTMA 2IY0C 2NXEA 3RU0A 3P9IA 3ZIDA 3GCWA 3X1KA 4O1PA 4N03A 4PONA 4JQZA 4OX9B 1E3LA 1NUPA 1HFJA 2PRKA 2BCEA 3ZJUA 1B41A 1VYUA 1QVRA 1KVTA 3PDWA 5CIYA 4EI7A 5FUQA 2R5SA 3E2PA 2JEKA 3LBFA 4AMVA 3G0GA 4JOQA 3N2GB 1MTOA 4RTQA 4RWZA 1MJNA 1VJGA 5LUBA 5HVNA 4PLPA 5KHAA 2J7PA 4CV2A 3TB6A 2BFNA 4JROA 1XEXB 3RAPR 2GKOA 1VL8A 1U2DC 1Q1BA 5J08A 2AEMA 1E3SA 1NNSA 1ZJ5A 1BJTA 1NN1A 3BD8A 5IKMA 2C5LA 3F8WA 5AI0A 4UNRA 1X7ZB 5BSTA 2QQGA 2DMRA 5I9BA 5HTOA 3BQ9A 4TV9B 5CNMA 1PUXA 2J3HA 4G5QA 2ZZMA 3QSGA 4IEEA 5EKQD 1M9NA 1GZDA 4FFDA 1Q1EA 1DC5A 2WJGA 3JD2A 1DIGA 1FU7A 2K7FA 3WLEA 1AV6A 4BZPA 3Q2IA 1K7SN 4ZZ2A 4XB1A 4GYWA 3IV6A 3EXHC 2Q49A 1U28A 1X74A 1DEAA 4JSYA 1R3DA 1YSCA 1JKJB 1LQUA 1FYEA 5B5SA 1KVRA 4JJIA 3HBMA 2NT3A 3BFXA 2UKDA 3IEKA 3H1FA 3IEVA 3V55A 3EOAI 1DV2A 3ABIA 5K6AC 4CIWA 5DEOA 4IOMA 5H0IA 1NV9A 1Z4MA 4M36A 3TCXB 3BRSA 1TYDE 2P65A 2QMHA 2GKSA 4TMTA 3UMSA 4R1NA 4JHLA 4NYIQ 3UGJA 2KBFA 4QBHA 2E48A 4X1IB 5DWDA 1U2VG 2DKFA 2X15A 5EAIA 5IMBA 1G3RA 3OT5A 1EVQA 4HGPA 3UWDA 1ZGHA 4X20A 1SO8A 4UYKA 5EIWA 3RWOA 3LL4A 3FR8A 5EJIA 2RGXA 4Q96A 4G23A 1X1EA 2O3SA 5I48A 1Z26A 4Q01A 4YRAA 2CK3A 1GPNA 1ZXLA 1E90A 4L3OA 3ZNNA 4BFLA 4QYIA 4QVKA 5JNRA 4LMPA 1MFPA 4X84A 3PUKA 1J09A 1QAMA 5IJ9A 4TS9A 4U7PB 4IJKA 3CVVA 2ECOA 4RMIA 2O0HA 3IRUA 4UPDA 4QYMA 1HLPA 4LPSA 3DTNA 2CLHB 3BA6A 3FSRA 2X3MA 4TKUB 2ZDHA 4UD2A 2RGCA 2REBA 4OI1A 4DR2B 1PSDA 3IS3A 3RLIA 4D0GA 2R1VA 3DEFA 3P0JA 4UOEA 4NMLA 2X0NA 1E4EB 5BNIA 1ZHFA 2C07A 2NU8A 5JYEA 1T26A 1E2HA 3HVJA 3MA5A 2JHGA 1XZQA 1RC0A 4XQ0A 5HKKA 4MCIA 5LQNA 1D6NA 1K86A 3RIGA 1KAEA 1EIZA 2XTZA 1IDN1 3QFCA 1CSEE 3UWKA 3VH3A 3AB3A 4DUIA 1MU0A 4KQJA 1H2ZA 4Q3AA 5ELLA 1RHMA 4LDQA 4V0SA 5B3SE 1DTEA 2V9PA 1F60A 5DX0A 2GR9A 4UD6A 1NSYA 1TYBE 3RU2A 3C6BA 5CA1A 4RXUA 3M6AA 5HIJA 1RRMA 4IIJF 4ABNA 4B7UA 5KOHA 1JFTA 3CLUC 3PB3A 3BRWA 2FO7A 1SQSA 2YN2A 4MW5A 5A3JA 3UATA 3E22A 1PZHA 3K9WA 5KTYA 3ACCA 1W2HA 2NV0A 2QK4A 2L19A 2ZUCA 1NMEA 1QSGA 2ODQA 5KIAA 2AC7A 5JQGA 3ZVVA 4NU8X 3E33A 4WESA 2X0DA 4R6WA 3GLGE 2GD2A 2XRFA 2I2CA 4U0KA 4URWR 1N9KA 1GARA 4KDFA 2SCUB 1KMQA 3FFTA 4R3WA 5I8PA 4N65A 2HMYB 1KK3A 1DCFA 3RFVA 3YASA 2XW6A 4AX8A 4Q4LA 4JGIA 1LWOA 3SS8A 4DQLA 3E2IA 5JVDB 4WCVA 1U5AA 3WHIA 4KXXA 5C37A 3EW9A 2OHHA 1F12A 1OFIA 4OREX 5ALQA 3GG9A 3TINA 5ESXA 1T1EA 4H27A 4W63A 5HZMA 1FNSA 3GD7A 5HR5A 4LE1A 5DV9A 3ECAA 3HUUA 1V8PA 3PXXA 3WAKA 3ZCVA 4M1YA 4B32A 3KPUA 1KK1A 1JALA 5UKDA 3KB1A 1C3EA 1NMXA 3PJGA 4UNIA 4D98A 3T38A 5KDOA 3T3EA 1Y7IA 5DULA 2X7XA 3W7BA 3QLUC 4HWGA 4PQFA 2A8YA 4MDFA 2B7BA 3SJBA 4C22A 1PL6A 3G6WA 5ED4A 1TIBA 1A0OA 2QJWA 3FYUC 3J5QB 2BRUA 2BGWA 4B81A 5ALSA 3KTAB 1ISPA 2PS9A 2JIRA 5AUQA 5C4GB 5EPEA 2RSLA 2BY4A 3TZKA 5H9VA 3FLAA 5ALHA 5CLIA 2NZUG 3IT1A 2R25B 3CK9A 2OVFA 3OHPA 3EDQA 2WU3A 5JHHB 3LYAA 4KWIA 3HO1A 4TUUA 2ZDQA 4Q3EA 5JOQA 1NRXA 4IDOA 1M5RA 2JLAA 3VTZA 4LHYA 2XOEA 1PJ3A 1IU9A 3LVQE 1L5FA 1P31A 3AERA 4JI0B 1KP2A 4Z3OA 3VZDA 1H23A 4MGEA 2OWEA 3HJRA 4PCLA 4WZBA 2R8EA 3HDTA 2FPIB 4GI3A 4J7XA 2CHFA 1G59A 4ZEVA 3DMFA 4FI3C 3S29A 3DE4X 1WD5A 4I5FA 5C46F 4ARAA 1UBSB 3DAGA 2XPCA 3OVMA 3DDHA 2IKSA 4S3MA 3FCSB 1N33B 3NRJA 3QELA 4KPUB 3AWDA 2CNNA 3H83A 2XYGA 3B1XA 2D62A 5SZJA 2DCPA 3KC2A 5HOEA 2PGJA 1QP7A 2FPPA 3DVAB 3X1JA 4ECEA 5A9SB 3RFXA 3DA8A 3OM8A 4DXHA 2M63A 3U7RA 3RYIB 1GPMA 1F6DA 1PS9A 1K8QA 3M2PA 3WV4A 4MWSA 4C08A 1QFXA 3OI7A 2GFIA 2WXNA 2DFLA 2Q5CA 3ZHSA 4I7EA 4Q7LA 3U40A 4REOA 3E7DA 2AI3A 4KV7A 4CLDA 3FVTA 1DJMA 4DNFA 3RUPA 2BSQA 1NNUA 3IEIA 2NO6A 4PWZA 3JSXA 1N3YA 1H2UA 3B7PA 4NTZA 5IAAA 3CWCA 4IF6A 1SBYA 1FRVA 1LFAA 2Q9AA 1M8GA 3UJPA 4XDHA 4P3YA 1SCUA 4EG7A 4E5PA 1WKBA 1DJOA 2PVSA 4X1YA 2HY7A 1NW4A 3BJZA 5CT9A 1ZN8A 1E1RA 3X3HA 1MVNA 2OAQ1 1SZJG 3IDSA 4N76A 3PQEA 2H7VA 1TAGA 2CNWD 5CIWA 4YP1A 3VO9A 1N6LA 2J8ZA 1E89A 2J6HA 4YFYA 4OVKA 4PO9A 4X1KB 2PJDA 3IQEA 4NV0A 4EJ2A 5E6UA 1GCOA 4UFOA 2YHIB 4HO1X 2BFFB 1NPDA 1LI4A 1U9ZA 3IELA 3QLVA 3DE0X 2I91A 4F11A 4PU0A 1QV7A 2ONZA 4UKDA 1POWA 2ZAGA 4YDYA 1DO2A 1XD2A 3BGIA 4MA0A 5H81A 5JLAA 2I6HA 1WY6A 2XYQA 3B1FA 5KC9A 2VHVA 3TLGB 5JCOC 4W5TA 3W90A 3AFHA 2CXRA 2ZBDA 8MHTA 4ECAA 1LCIA 3IEGA 5K0EA 4E6PA 3R74A 4UUMA 3SLRA 1DIHA 5IUKC 4Y2TA 2DH6A 3C15C 2GJAA 1C1HA 3E82A 3R5HA 1N2ZA 1Y6ZA 3NIDB 2EATA 3FH8A 3UT6A 3WKCA 2KATA 4FKMA 3OFJA 4DLSA 3I9V1 3NOXA 2W48A 5HJ2A 2WHPA 1OH7A 4BFWA 1O96A 1RZVA 3DBRA 1A82A 3E4BA 3QLTA 3ZXUB 2AYXA 3LUAA 2Q3DA 3OCWA 1CVLA 3ZWOA 4AY3A 1ND5A 4H3KB 4WNIA 1NW7A 2DERA 1Q19A 3TYXA 4DR5B 2ZM5A 4ND3A 2WWYA 4ENPA 2J4DA 3LG2A 1TAHA 1UT8A 2PKQO 4EI9A 1UPXA 2GN0A 4QVIA 4UMDA 3K0EA 4Z4QA 3A6PC 3EASA 4U9HS 5ALFA 4B74A 5HCIA 3SY2A 2YHCA 1JG4A 3OPVA 1OXSC 4L8FA 5A7FA 3IKVA 4IMPA 4Q9HA 3CZMA 5J5VA 1XCMA 4YY3B 1Z4OA 2NU7B 1NPYA 1SXHA 4L2YA 3HXBA 3EQZA 1CNMA 2GEJA 3OTNA 4QGGA 4RQBA 3PEUB 4CCWA 3QSYA 4HLUC 1T9DA 4QPJC 1UBKS 3JQ8A 2NU6A 1PLJA 3TOZA 3CR3C 4S24A 3UUFA 1P80A 4E2ZA 5EZYF 1D8AA 1OXJA 4F5EA 1M1YA 4BE9A 4LHVA 3GWGA 4ISCA 2ID7A 2G67A 4DIOA 2E0IA 5DXAA 2YWDA 3VC2A 1Y1TA 1S3GA 1VHTA 2UU9B 4K40A 4P5EA 3E53A 3R0IA 3PGLA 1TFUA 4C2TA 2CMKA 2EW1A 1P74A 4MAMA 2QN6A 1KBQA 1B0UA 3ILYA 2QUHA 1RXUA 2HIAA 4DMKA 5IAGA 3MWFA 3DO8A 2PA0A 2QT9A 4OLAA 3I83A 3KKPA 4AEZC 2VIIA 1EUCB 3L0YA 3TVYA 2K87A 3GLFE 4PAMA 2QP3A 4IEFB 5LP6F 3SNXA 3SBTB 1W5EA 1Z5WA 5JXWA 4RANA 4A3VA 4LHZA 5HWSA 4U9IS 5I3ZA 1X5BA 2C29D 2C57A 3QV1A 3MCXA 3BU8A 5ALZA 1MX4A 4NAUA 1VBFA 3IR7A 3FTXA 3KTOA 4OHBA 5LR6A 1A5SB 4FEEA 1LDEA 4IKPA 4JMPA 4I19A 4MRRA 1CNEA 3KETA 1UJNA 3V42A 4GTPA 3OEWA 3TJZA 2P2CP 1I6KA 3SNHA 1F2DA 4BQFA 2YIJA 4QOGA 3A4TA 1UT5A 1M1NB 5L7WA 4X6YA 4PLFA 2FEWB 1OLSB 1B93A 4JCCA 1GFZA 5FO1A 1GTMA 2HDHA 5FR1A 2AQIA 4YAWA 1XHFA 2GZSA 2Z1NA 2IUFA 1PZMA 2O2GA 3FWYA 2GPAA 2RARA 5CVEA 2IPLA 3MGAA 2OXRA 3NBUA 3UK0A 5C53B 4LDJA 1IH8A 1CIPA 3ROTA 5FOWA 2OBNA 3A0RB 5FORA 1F48A 1O6GA 1T3SA 3UXGA 1PR6A 2R8BA 2O5EA 2AGVA 1XZIA 2GRQB 1ZM4A 1FMJA 3ZUPA 3IHVA 2B4QA 2C8JA 3HBAA 2L42A 2O07A 3BIJA 4QU8A 1M33A 3EDYA 1YCHA 1KSJA 5AJTA 4PG6A 4IJ6A 3RQIA 2YZ7A 2ZRMA 2XS1A 4WHMA 1T9ZA 4BNKA 4CM4A 3AY7A 2G08A 1D2GA 2XHEA 5K8JB 2DAPA 2AYZA 3AHHA 5E1BA 2ZUBA 2Z9CA 1MZVA 5HFAA 3ZI0A 2GBLA 2PK3A 4HBDA 3ZKWA 1P0QA 3NIGB 3CVNA 4CKWA 4GTVA 1HNZB 4M1EA 2H4HA 3I9FA 4CMJA 4N3NA 1TC2A 1Z22A 4R1MA 3ORSA 3C3RA 1J9GA 2ZSIA 3JYNA 3R40A 3ITNA 5KNLA 3IKOB 4N39A 5JZBA 1TUBA 5AT1A 3O48A 4Q24A 1RAFA 3AG6A 4BN4A 1EJ6A 4A2WA 2YJNA 1E2KA 2VJPA 3NYWA 2VHTA 5LDGA 2EVWX 2Y9PB 4TUYB 1A9QA 3TSAA 4P54A 4HQ0A 2RG1A 3BF8A 1KL7A 3QX9A 3F6EX 3D1LA 3PX3A 3EARA 1COWA 1OX4A 3ADKA 3VUFA 1F0YA 2H4XA 3N53A 1P5ZB 3V8PA 1H65A 3Q15A 4AZ3A 2I55A 1IN6A 2CUKA 2YV2A 4BGVA 3EVTA 4PZZA 1T1GA 4Q48A 4YP6A 3VZSA 1P1FA 5HQTA 2AN9A 4P7KA 4NRDA 3RKUA 4S0ZA 5KYUA 3DYIA 2XENA 4PEVA 5FOUA 1EMDA 5J5AA 3DCIA 1FYDA 3TLCA 1O0BA 1CJCA 4WDRA 1GA1A 2WYWA 1T2AA 5NLLA 4EHIA 3ENKA 1FDUA 5HF9A 2Y2VA 3PTZA 4GOOD 3OT4A 4RGYA 2XYPA 2VPTA 2WHQA 1DLJA 1JR3D 3M1LA 3CLHA 1WOMA 1D7OA 3UOAB 5CLFA 5G41A 2CD9A 4Q93A 2EBWA 2HGZA 4D9HA 1IPEA 3Q40A 2BFWA 1JEDA 5HMMA 3OKAA 1JVNA 4QQ8A 3MRSA 4QNNA 4E5UA 2IV3A 3T06B 1I80A 4CI0B 4RJJA 2L6JA 5I7UA 1S5PA 3R9XB 1DI0A 1CE8A 4CCYB 2ZRFA 4AJJA 1ZD4A 1BVUA 3IOCA 5H02A 1DKUA 4NNJA 5DHAA 3EGIA 1GU1A 1N1MA 1U6IA 2ORWA 1P1KA 2VK2A 1BWSA 1S8OA 3UB2A 1J6UA 1T6NA 2X1HA 1ZBDA 3QF4A 2WAAA 3ZU3A 2DUWA 1E5QA 4YJFA 3R9MA 4OCZA 4CIDA 1PKEA 4ZVOA 2C7OA 1ISFA 1I2AA 2WKWA 3D8BA 5KYGA 1H8HA 5LYJA 3TTUA 3QWHA 4II3A 2C0LA 2NSZA 2I8AA 3JQ7A 1JH9A 5EUQB 2JGRA 4Y9DA 5KKAA 3GK3A 1E2JA 2P91A 1GTVA 2HFJA 3L9TA 1QF9A 3B5EA 3VZQA 2YASA 1L7OA 2LAIA 2PWBA 3E0QA 4B7ZA 1VHWA 1ZO8A 4C4TA 5DNUA 1FW8A 1WB5A 1RMQA 1UG3A 1YKGA 1YS6A 3ZD7A 4JOSA 2IE8A 3U9TA 1GKLA 1G3QA 4O2BB 4YAKA 2HNAA 4DIMA 5LCWC 1JXQA 1UWLA 2PAAA 4JLMA 3L1HA 2W8ZA 3QVMA 1PJCA 3NUQA 1P2GA 2IVZA 3MERA 1BC5A 3W7VA 4DX2A 4TRJA 1CUCA 1DEOA 2JGFA 4X92A 3DKKA 2GZMA 1DKLA 4FBLA 1QHGA 1KDVA 4W6QA 2BF0X 1M34B 3QEMA 5JMTA 4Z4GA 1IHXA 3C3MA 1LPOA 2L9BA 3U3ZA 3A2KA 5SY9A 2QMYA 3BMNA 5C2JB 5C34B 4FOOA 3TKAA 2Q2QA 3AUFA 3CGHA 4JYMA 5FYQA 1R8JA 3CNLA 3WMEA 2QG4A 1CUUA 2J31A 3PITA 4L2IA 5HF5A 4RSRA 4KWHA 4DHEA 4NYIR 1U1GA 4OK3A 2WKSA 4K3VA 1RT9A 4I3GA 3P9XA 3T7SA 5DM60 1N7HA 4OL9A 2QN1A 2WUGA 1PZEA 2AFHB 1AG9A 1K5HA 1V3TA 5CDSA 4QSMA 3ADPA 4R16A 1F4LA 2GCOB 2GRMA 1AQNA 2VPPA 2Q1YA 3U4GA 3HCEA 2OXTA 2WIGA 3G6KA 1I24A 2E5LB 1YJQA 3HJTA 2YXNA 4KBGA 3AUUA 4CG2A 1M8KA 3AHIA 1UZMA 4UNQA 2VH1A 1KE1A 2BJWA 1UJ4A 3S40A 5AVUA 4NDZA 3SHVA 4KR7A 5J40A 1TYCA 2D0DA 3OICA 4DABA 1FFEA 5E7MA 1M7GA 5AW4A 5IM4A 1QO0D 2DPYA 5HS0A 4Z7NB 1WP4A 1TO2E 2CHZA 5E38A 1U7WA 2AJTA 3HN2A 2ST1A 1H4QA 3HJNA 3G7UA 4IDHA 1P5JA 4TSFA 3D64A 4GAEA 2GAOA 1QUEA 1UK7A 5JJTA 1V71A 5ENTD 1RLJA 3VKFA 1L5JA 1F0KA 3B8HA 2IIBA 1T8UA 1ISJA 4NS1A 3D3WB 3DMTC 2VSOE 1ODLA 1RHKA 3TW4A 1U0GA 2OXEA 2XUZA 1Y6QA 5I7VA 2R1ZA 4OI4A 3JVUA 4N0QA 2I4IA 2XGMA 1R4AA 4JLKA 3ER6A 1RCFA 2LXMA 3F5MA 3F4LA 4BPRA 3GRUA 2VUIB 3QVUA 4U0SA 4CQLA 5MFZA 4WASA 4G37A 3LSYA 1OGYA 1YDFA 4NARA 4E4YA 5CFOA 4JT9A 1I5OA 1W34A 4FYVA 2AZMA 2C9CA 3VLEA 4GMHA 1PFQA 3LQ1A 5AI5A 1N7JA 3A3OA 4J0HA 4K46A 4ROSA 4CQMA 4A27A 4BYGA 1FDRA 2DBRA 5EHXA 3M4NA 1VKOA 4HUQB 3AU5A 2PX0A 1VHJA 3DH0A 4M37A 4I17A 1W35A 2HU8A 1PG2A 5EQFA 2PKXA 3SS9X 2NP7A 2O2ZA 1SVLA 3U62A 3UV7A 5FINA 3M49A 2A3RA 1OBOA 2QRQA 1CQXA 4YRCA 4EUFA 4QPNA 2I1KA 3HWSA 4C3VA 1IXKA 3IT2A 1JI0A 4PICA 3PPXA 3E9EA 3SD5A 1QB7A 4GE3A 7REQB 1OXXK 4XYMA 3G8BA 3OCCA 5KVSA 3ISMC 4OP3A 3D9OA 1HWYA 1SIBE 3H17A 3C3EA 5LX8A 5COQA 5TJ9A 3I6QA 2GASA 2NTVA 3CJQA 5BOVA 5AHWA 3KEGA 3LAWA 3D8TA 1BROA 4MLPA 4LRYA 3EVFA 4MP3A 1Y8QB 4N4AA 2WTBA 5KMGB 4YJ3A 2WUWE 3TSOA 3FPSA 4QBKA 2AR7A 1XPUA 4JXZA 2VGYA 1YQWA 3KOOA 1AQYA 4PS1A 1P9LA 2DPLA 3HKCB 1LK5A 4DWWA 1OI7A 2BEUA 3ZE7A 4HAVA 4TQAA 2VTVA 4UZFA 3IALA 1IK6A 2EZ8A 4EEKA 5A4MS 4B8AA 4POAA 4FOPA 2YCBA 3Q5GA 2GZ3A 4ZALA 1EE2A 4OA5A 3B7SA 1W76A 3ZV3A 1TCUA 4GS5A 2OAP1 1L4MA 1WXDA 1T5TA 2O4CA 1YC5A 3GPIA 4IRUA 1EX9A 4KJXA 3TGPA 2KM4A 3GJ5A 1P7YA 2WXLA 4YX9A 1IOLA 4DSOA 3PDHA 3GJ0A 5L3QA 1DAIA 4K9PA 2XUHA 3Q9UC 1AMNA 1WAMA 3RJTA 1G8MA 1CUIA 3X0DA 4MUFA 1YVDA 5A4JA 4BPBA 1K8KG 3T3HA 4LRTB 4UI9J 3CKYA 4JBLA 5KPJA 1MOPA 3ZWMA 5JO9A 5IVPA 3ETDA 4HB3A 4UM9D 1NZJA 4KB5A 3E8MA 3ZVLA 3EVDA 3L8HA 4MVYA 2X6QA 3FBGA 3HY4A 4B17A 5CVCA 4LNUB 5F33A 3L8DA 3WVNA 4DR1B 2OZEA 3FPEA 5I4BA 3ABKE 1Z16A 3DSVA 1ENYA 3A2NA 1JG2A 4NH4A 1YJCA 4GO1A 3CIAA 2QL6A 3G85A 3Q0EA 2IPAB 3U3DA 3FBTA 5FZRA 5DNVA 3HC7A 1FB5A 3IJPA 3SC4A 2QSZA 1KO5A 4LWPA 4HLEA 4HDSB 4K8RB 4YP0A 3F46A 3ZVKA 5ITZB 2FO1E 1T3TA 4M21A 2CE7A 4X00A 2VGEA 1FVXA 5H3CA 1ZGBA 1V5IA 4BJ6A 1RI1A 5EQTA 3AW9A 1YB2A 3I9OA 1FP4A 1O1RA 5GM1A 2SBTA 1ADJA 4I5DA 1CQIB 5DZSA 4AO8A 2C0MA 4I9EA 4JHJA 2Y92A 4BYMA 3LA8A 2BONA 3O5AA 2IOHA 2IBMA 2B5VA 3O0DA 1EFPA 3RT9A 3THXA 1UOHA 1OYOA 2ZITA 4E08A 1SWWA 4NY1A 3KEMA 3BGSA 4J8YA 4ZCLA 2H7YA 4D9JA 3SICE 4PDXA 4MJ3A 5HJ7A 1AB6A 1L5SA 1D2RA 4FPXA 1NUHA 3OFND 2CFTA 1NI3A 3BIFA 4BEJA 4YCSA 3LY5A 4GBED 4PYQA 3MBOA 5J2TB 2OCKA 4Z1MA 4M9UA 3BXZA 4F91B 4A82A 1JRLA 1HX8A 1EM8A 1KH3A 2J0UB 4JA2A 4DCCA 3FDXA 4NHEA 3WWDA 5ADHA 1Q3KA 3IE1A 3KWJA 1QH9A 4NICA 3RRJA 4WW0A 1EXVA 4BFXA 4EY3A 4O1IA 5KVAA 4LE2A 2AQKA 3K8YA 1E4VA 3ZIMA 4KQCA 4PZYA 2RHTA 1AQUA 1X38A 2ZYTX 3UOGA 2R8PA 3A4MA 1J42A 5CRUA 2FDCA 3WQQA 3ZLJA 2B0OE 5JDCA 2W4QA 1O95A 2V9ZA 3R6WA 5F9FA 4LY3A 4CR8A 2BTDA 3IQDB 4HORA 3GAZA 3DD1A 5FUMA 1KOGA 2COUA 1UKVY 5B37A 3T52A 1U2DA 4BB0A 2IDZA 2EKLA 2DUNA 4Q3NA 5CBKA 4EUKA 3N7UA 5MGBA 3LDGA 3URMA 2RH9B 2JCYA 3JYSA 3P9CA 3JTEA 4L5YA 4OL0A 3DLBA 2C94A 3QNUA 4RXMA 3LA6A 1QK3A 2P9CA 4OJYA 2YC4C 5DBGA 4B2IA 5FPSA 1O3YA 3OLWA 2VYND 1M6HA 4X24A 3VX4A 1AGPA 2X3YA 3F3YA 4BX8A 1WSAA 4XEIG 1LF0A 3TNJA 3HZRA 4MCAA 3EXHA 3T99A 1NA3A 3HJCA 4MJXA 4YIKA 3I9KA 1F8FA 3DBSA 1NLMA 5G0SA 1KMHA 3GGDA 1LB1B 2LWIA 4Q3DA 5TV2A 2F9MA 3VA7A 2ZI3A 5FO0A 1CLUA 2A0WA 1FSFA 4FFRA 5KJKA 4BV9A 2YVLA 4C7MA 2ZAYA 4JFRA 3TLAA 1C2TA 2XOKA 2IU6A 1T9CA 3COVA 5FBLB 2C9BA 2IZ1A 1BKYA 4DZTA 2O8NA 4AQDA 3AXSA 3LVFO 1TCAA 5FRDA 1ZUNB 3UANA 2AIRA 1QVWA 1U2PA 1B6GA 4G5GA 2OUKA 4F1WA 5GZ1A 1NVVQ 2ZRDA 1YIDA 4DV7B 2BIFA 3URZA 1N5JA 4Y2HA 1MAWA 3LP5A 1BRMA 4WKGA 3VHQA 3ZDCA 3E23A 2MTBA 2IU1A 3DOHA 1CR0A 1P1JA 1QGAA 2CF6A 1KPIA 4MRSA 4FX5A 1GAEO 1HETA 3OG9A 2A9PA 1R0CA 1WMAA 4MLCA 3A1UA 4ZZ0A 4CG3A 1Z2AA 3T3MB 5K5EA 2GK4A 3GLRA 3MTJA 3FFXA 1V35A 1LSSA 1RYDA 2X9QA 4FHZA 4UVHA 5JEEA 2ZVDA 3OXGA 2HL6A 4XFDA 3PNMA 5KX5F 4ZYYA 2P6PA 1KO4A 4LI0A 4PIPA 2JFQA 1KI4A 5MFPA 2YIDA 1NDQA 2OHIA 4KAXA 4BCCA 5B12A 3SKVA 4DRXA 2VJKA 2QEQA 2JIPA 1NL4A 1XMOB 4UBMA 3FUFA 4ER7A 1U0OC 3NQ41 2DR3A 3IMKA 3EUVA 4X7RA 1OT5A 1N3LA 1QC5A 4ANVA 4F38A 2Z09A 5IZCC 3IVAA 3CHYA 1IQUA 1JL3A 3DTVB 1M2EA 3HA2A 3JQBC 3L6OO 4J2HA 3REQA 4AL4A 1D1PA 5DX1A 5FKJA 3EX7C 1E3WA 4YVFA 1GLNA 4NZNA 2YNQA 4BNJA 3FNRA 4YJ2F 2C7RA 3A58B 5LFAA 3E48A 3A9SA 3I0MA 1QHEA 4CXMA 1TN6A 4EQ6A 5CHYA 3F4BA 2HHJA 4ZXPA 4YCBA 1XJ5A 2CBXA 1PNQA 4YVOA 3ZGOA 5ENZA 3STWA 5GIOE 4L9WA 2RJ3A 5CCXA 4G0XA 5CPFA 1G1AA 1R0XA 4ODIA 4FHDA 2C0PA 1XZEA 3LPCA 2HYIC 4PS3A 4TKVA 4U39A 3NIBA 3NHFA 1HYBA 3LXRA 3LOPA 3SDBA 3VR6H 4I50B 2R2AA 5BVHB 2C8LA 2I9CA 3QJZA 3NBAA 1OFTA 2M1XA 1H5UA 3GJZA 4R8KA 3QIAA 3PL5A 2AOUA 2AS0A 4C7XA 4D9GA 3A1TA 2VRWA 1E2PA 3OQJA 4MVJH 3MKQB 1NY6A 3H1BA 2Z2ZA 2N46A 3APCA 4UE2A 3GFPA 4LY6A 2ZIAA 1Z0JA 3AG3E 4F0JA 1PG5A 4MV3A 5T67A 3WNVA 3ZLVA 3HLYA 5AVRA 1J2RA 3RK0A 4Z4IA 3G89A 3VPHA 2XEXA 1SUPA 1HU3A 3EMVA 4MX8A 2NVOA 2HJHA 2WFLA 3QLUA 1QVAA 3NAQA 2FX2A 4TN1A 5HUJA 3PGKA 4P3PA 4HOSA 4BFVA 3SR0A 1NKVA 2XNDD 1E6LA 3GO4A 4ETMA 2WMYA 4PYRA 1SKQA 1SUIA 1Q3TA 3FYUA 1EAMA 3EU5A 1SCNE 2JGDB 3UTMA 5K99A 3MWYW 2EQAA 2WVJA 2O7NA 3QWBA 4NZ9A 2MHCA 4JN6B 5JNWA 2IUYA 2KZTB 1PN3A 5IYZB 4JJKA 2XQ0A 4Y3UA 1XE3A 5C8YA 3D4BA 3MILA 5D7BA 4OB7A 4HGZA 2CMHA 1H8ED 3U0BA 1Q21A 5ETJA 4R4JA 4J0FA 1GPUA 1EQAA 1E3IA 2QMZA 1IPFA 5G3ZA 4K6FA 4LJAA 3BA1A 2BEJA 1D7AA 1W52X 4G1EB 1I30A 1QG0A 2WSSA 5TQ0A 4Y1RA 2YS7A 1W0KD 5FWXA 3PRZA 4B46A 3PNQA 5KWSA 2IODA 3R6TA 1F8GA 5D1HA 3VR6D 1UC5B 3ZIAA 3AVQA 2GCEA 4GRDA 1DU4A 1MEEA 3VM6A 4B3TB 2NUAB 2YXLA 4IIEA 2GWRA 2Y0DA 1KIFA 4EY5A 1EVZA 4INPA 5EWMA 2O14A 1MLDA 2P0AA 4A2CA 2BKAA 2D3WA 1OTXA 3CRVA 4MVJD 3HXOA 4IO1A 5H7XA 5JJBA 3SEZA 2COKA 3NPAA 4AZWA 2XRYA 3QPWA 1JHVA 3NHUA 3LP8A 2R44A 5U9CA 1RXVA 1DZ3A 1IXZA 4MS4A 5C7OO 1HG5A 4R2KA 3K70C 3AZQA 1SCIA 3CHOA 2VKQA 4KLNA 1QIKA 2IOFK 2ZTHA 3CVLA 4WOKA 1V96A 3LNCA 3Q9LA 4R9VA 1TNDA 2Y77A 1DG9A 4F2DA 4R2IA 3DWGA 4H60A 1JKIA 1IN5A 3PFKA 4KN6A 1ULHA 3UKRG 1T4CA 3PUIA 3TQIA 1ISGA 3O93A 3EDCA 4CQNA 1XVIA 4YUXA 1MJFA 5K9ZA 2R03A 3SWWA 2BPOA 2NM0A 3F71A 4FGUA 2ACWA 3GWZA 2PJUA 1X7GA 5B4UA 1CJBA 2QRJA 3I5AA 3ONDA 3VOAA 4YASA 3S2YA 5DLYA 2X4LA 5AI4A 4RK7A 1M1ZA 2BTQA 4H7FA 3OLZA 4GL2A 3N2KA 2OZVA 3EZ6A 3AVYA 4CMEC 2PGIA 2HLDD 4LUNU 3JQFC 4BX9A 4DLVA 4JXKA 4KIFA 2DFTA 4E22A 4B6GA 1NXWA 2WR8A 4NURA 3LRXA 4IJUA 4J0CA 2G0NA 1VPTA 3NEPX 3PRJA 4O4LF 2I67A 3ZTTA 1VGRA 3WMRA 1SOUA 4UZSA 5AW7A 4WH0A 1EGAA 5BO5A 3IXEA 1QIDA 5JS7A 1ZXBA 5JCOA 5G40A 4WZ6A 2GN4A 3RPEA 4EZIA 1NP6A 3Q3CA 1V47A 3AJAA 5CB4B 1HDRA 1D4OA 5DNEA 4H4CA 4LXIA 4JP5A 2GZDA 1SQ6A 1SC4A 5AKHA 3WJAA 4O0MA 4LGYA 1DP4A 2UDPA 3F1LA 4MRPA 1Y1RA 4ER3A 3ESAA 3MAAC 3T1QA 3I45A 4OJKA 1H9CA 2LSUA 1F9EA 2I34A 4PRLA 1ICIA 1VZ3A 4WZZA 4MKIA 1HNWB 1JIXA 3X2FA 1R9JA 2F1JA 4R1UA 1CRWG 3LCMA 3N2GA 3GLIB 3DEOA 4GI1A 3L3BA 2OBMA 5KO2A 4GP6A 1LTQA 3AS8A 2IXTA 3DR3A 3IB6A 4FLHA 1TU4A 1DUVG 2MWMA 1PGQA 1Y89A 3H0KA 1JWLA 5AXBA 5DW0A 1RZRD 4OXNA 3FYDA 3HU2A 4X64B 4B47A 1TGVA 3MQ2A 2VCHA 3QFTA 5A3VA 1RRPA 4RKYA 5IJWA 4DA0A 5CYOA 1F3OA 4YMWA 2ZI4A 5LXTB 4TV9A 3Q9NC 3MX3A 2AW5A 3TG8A 1Z5NA 3BJRA 4D56A 2K7ZA 2G7ZA 3RAJA 1KAOA 2BYTA 2AOVA 4HLUA 4BRZA 4JYZA 1QYWA 1E3EA 3LUCA 2CLFB 4A8HA 4ZV7A 3P0FA 5ER9A 3D6HA 2V7UA 4AMUA 1N6RA 4ZOLF 1Z35A 2HLNA 4H08A 4P29A 1WZIA 4I0WB 1U5BB 3JQAB 1J2EA 5J2UF 3D9HA 1UXHA 4INAA 4F9FA 3K0CC 4MUBA 1ID1A 2D2VA 3WLOA 1JKJA 1P9OA 1DRJA 3TWTA 3R0VA 4HDMB 3K53A 3PTAA 3LPZA 2AN4A 1BXGB 3LCVB 4XSGA 4FDUA 2H59A 4L73A 4YCDA 2R2LA 3A6JA 4MJLA 3RIHA 4B0PA 2VXCA 3SC3A 2OO7A 4X1IA 4CIBA 2FSVC 4KQKA 2YMMA 3NOVA 3B1VA 2G28A 4D5EA 3TR0A 2XZLA 2HPHA 5KYTA 2GNAA 2M9MA 4BQSA 4Y6RA 2OG2A 3N70A 4RDHA 5IHXA 3A10A 4EHNA 2QQFA 4WY8A 4NESA 2BZSA 2Q29A 3HP7A 3D9PA 2XUAA 3CRW1 5A7GA 4UVGA 4AS3A 3FKSD 2ONJA 4ND2A 1GCUA 5AQEA 4ITUA 4PHCA 4PQYA 2PQNA 5HX7A 5DWQA 1YACA 4UUBA 4P8RA 2FTKE 3EIHA 4HWRA 1XR3A 4WNFA 1E9EA 1U0JA 4TKUA 2BKGA 4KI7A 1H2RS 4YAGA 3EF1A 3ONLA 1T0UA 1T6XA 2VDPB 5IASA 4DTIA 1JHPA 1GT91 2NZJA 4UUQA 3U4DA 2YYYA 2IEDA 2WQ7A 1CY2A 2V3VA 3OQIB 4C5BA 1KDRA 1EBUA 1U98A 3A3KA 3WYEA 1TQ4A 2DY1A 1MJ0A 2VJYA 1P81A 3TMKA 3IOYA 4B4WA 4QPZA 4MYHA 2BVNA 2W2VA 4R01A 3KJXA 4TXRA 2O7SA 1EA5A 4TM7A 4OSOA 2PGAA 1GD1O 3ZFWA 2PUVA 4ZCSA 3CZPA 4BN5A 1LW7A 1BU8A 1UXJA 4JKOA 5F51A 3N8HA 1IRXA 1EP2B 1LDBA 1N1EA 3TKYA 4QWWA 3G1WA 3UYKA 3LGXA 3QNKA 4NL4H 5DRYA 3NS7A 2MHKA 4KVGA 1ZEMA 3DPYA 1AZLA 1F2UB 1JPLA 1SBIA 2H1WA 1JP7A 1KQPA 2WXOA 2RJNA 1VPWA 2B7LA 3FHJA 3WDMA 4BY6A 2WKPA 2KXPC 4HRXA 3TIVA 2WBLC 1U5CA 4OPMA 2IXBA 3FFLA 3O8DA 4NBRA 2XQKA 3ZOZA 1L7BA 1M2FA 3SZOA 1DLIA 1JF8A 1RTKA 3BWXA 1WL8A 3P5BA 3E1SA 1EK2A 4W82A 1LLCA 2JKZA 3IAM1 3V4LA 4ZRMA 5IMSA 5BUCA 4MWDA 4JP3A 4DVJA 2ZS9A 2PVCA 4G26A 5AJYA 3OY7A 1W46A 2D2XA 1RRKA 4LJ5A 3Q6IA 3ASHA 5JVDA 1SCQA 2FWPA 4YRRA 2AZTA 1IVNA 3VYUB 2BSAA 1P4JA 2XS8A 2Q2NA 3V9AA 3I9MA 1ZU2A 1E2UA 2YVQA 3BSWA 3GDFA 1SD1A 5TMDA 5TE9A 4A8TA 3VNBA 1UN9A 4PPYA 2P30A 1SQGA 1JXMA 1VXRA 2B6CA 5I51A 1DJLA 5FNVB 4GH5A 4P93A 1DO8A 4HY3A 4MUJA 2FR1A 3UCFA 1XTJA 4XE0A 3K9QO 1PNRA 2PM7A 1DCMA 3H5RA 4K2AA 4CEIB 2GPBA 3AI3A 4GDFA 3HBJA 3L6CA 4E2WA 1TUIA 2HF8A 4I8DA 4RD3A 4NI5A 3AU4A 2KHZA 4HX2A 1PGJA 2JH8A 3TQOA 3KTAA 1DBQA 2C1ZA 4PAOA 3AVUA 3UGQA 3JYOA 3N7AA 5TIIA 1XMQB 2OB2A 3W5AA 3IOMA 2A0FA 3JALB 3QIVA 1JU4A 1UBRS 3CG4A 3H18A 4RVBA 1E3MA 3FF4A 3UAZA 3T5CA 3JZAA 3G8YA 2FWAA 3AV0B 3SJUA 5DNCA 5EIBE 3W5SA 3ZY2A 2W6QA 4Q9JA 2PMEA 2HADA 3NHSA 1AX9A 2H3EA 2VUSA 4OHMA 2ZYGA 3HK2A 5BUSA 2PBFA 3AHFA 1K7CA 1BQ4A 1FK8A 3SJCA 2DJ5A 2IY8A 1U8UA 1UBCA 2P9YA 1NPTO 4C0AC 5T3YA 2P5YA 3M1IA 4EDFA 2FPIA 1NXPA 4RD1A 3PXCX 2WMNA 1Q84A 1GQOA 2GESA 1Y9JA 1WNFA 4RF3A 3MTBA 3RRFA 1X8KA 2FUCA 5K3BA 4AY5A 4G3XA 1KZ4A 2PT9A 3U4CA 4EYKA 1EB9A 3PUYA 1G38A 3MMSA 3DVAA 5A9SA 3M9WA 1S7GA 3AEYA 1UL1X 2QF7A 2VQEB 3FFWA 5DHFA 3U7JA 1U2EA 1IN7A 4KACA 4QDXA 4PLHA 3IERA 4YAUA 3ASFA 1OR8A 3M6LA 2VK1A 4QBFA 1EK6A 4RWEA 3EAFA 1U2SA 5C0OE 4Y9RA 2XVXA 3SE7A 2GNOA 3RU3A 5AXAA 1FFXA 4MQ5A 1GSAA 2BEDA 4CNQA 3DWIA 2VT3A 1GXSB 2ZVJA 1ZJJA 2X8JB 4R1TA 3EB9A 2X40A 4KHPB 2ZAIA 3L4BC 6REQB 4NFLA 4P4GA 2Z4RA 2D1FA 2BM9A 3JUIA 1ULZA 2C82A 2MYUA 3SFTA 3TXNA 5M29A 3M82A 3AJRA 4HFNA 5EJ4A 1YH3A 5EJ7A 5JZSA 5L3ZA 2VJLA 2ID8A 1USKA 4QLOA 1HG0A 3OD1A 4PRZA 3H13A 2GJ4A 4I81A 4DJEC 3NGLA 1KSFX 2ENUA 3W6NA 3C0KA 1ZIOA 1XO1A 4F06A 3P0IA 3P2IA 4FZRA 1NP7A 4X1KA 1JDNA 4EHDA 1GIAA 3SE0A 3F2IA 4ESOA 2YHIA 1GAXA 3HVHA 5CM9C 2BFFA 3RTDA 4B75A 1NVVR 1HK7A 3CNHA 1IBSA 3FNIA 3FGNA 1EYHA 1QPBA 3UM3A 2DHRA 4CYMA 3D8NA 2YDXA 3ULQA 1N0VC 2IYQA 3RRUA 2PL9A 2VF5X 2YOFA 3F9CA 4JB2A 1VECA 4G5OA 5HKPA 1U3FA 2ETXA 3I52A 4HB5A 1P2UA 1QV9A 5THQA 3WWYA 3AS5A 5BN4B 2LKCA 3WSWA 4IIXA 1EEXB 4ZO9A 3DE6X 3T8MA 4ARZA 3BH6A 1MH1A 3IDQA 2BISA 3C6KA 4X6LA 4EMSA 5KTOA 2JIZD 4RDCA 4EFKA 1IYZA 1X0XA 4QGBA 3AYXB 3R5KA 5AW9A 1EQUA 3QKWA 3EVCA 1V3VA 3DMTA 2XCQA 1ECGA 1RBZA 4KPYA 3G2MA 3O2SB 3CNEA 1NX9A 2JCSA 4TSRA 1L5GB 3SYNA 3VU8A 5H3HA 1VMAA 4AG5A 2CYAA 3LQKA 3KJNA 2F8TA 4KBFA 1H6PA 4WAUA 4NZYA 3TG5A 3WXMA 3GNQA 4FSXA 1D1TA 3RRNB 1SHUX 1TM7E 2NLOA 4OIMA 2BHNA 1NR1A 3UH0A 1UIMA 5FQNA 4LXQA 4BTAA 1DGQA 2WTEA 1KKLA 1OJ7A 5BQPA 1NF2A 5ARDA 5D51S 4GPKA 1O03A 3U13A 3B89A 3GVXA 3ZY5A 1XN1A 2XYRA 3IP3A 1KYYA 3ZWQA 3B6EA 5AK5A 4QUHA 2NU7A 3WGNA 5EKXA 5JH7F 3KLNA 5EN5D 2X5TA 4MGYR 1RQRA 4MOWA 1ZESA 2IH2A 1UFKA 4OHVA 4NENB 1QKJA 5JAQA 3N28A 2BEKA 4AO6A 1P17A 1QJ4A 4ES6A 2GWHA 3EULA 1OWMA 3SQXA 4BZQA 2FR8C 2JF0A 1YULA 1D2AA 4JYAB 2R84A 3CNOA 4ZO8A 4GZ3A 2Z0MA 3AVVA 1OFGA 2Q4TA 3WIBA 1QFSA 5CTAA 1W581 2B0CA 3B13B 3UCXA 3TW0A 5EKUA 1BN7A 3FDFA 2GXQA 2D0IA 1U0NA 3ZCXA 6NULA 4ZK2A 3Q7TA 1OV4A 2VT6A 2XIJA 5AIBA 5F64A 1Z88A 4G5YA 2Y0PA 4D3YA 2PBRA 1X86B 3WLRA 4QZVA 4RS3A 4Z0TA 3NHAA 1W4ZA 5FQ7A 3DXZA 3RS7A 3IPYA 1ABEA 4DARA 1JX6A 4UU0A 1EUCA 4NHOA 1RW2A 1TMYA 3CLSD 3WL6A 4ARUA 2QR2A 4C7JA 3EG9A 3FIJA 2R02A 1QJCA 1WF3A 2FJUA 3P2JA 4KYUA 2CWWA 5E4FA 1K7YA 4FMPA 1PGOA 4WNCA 5CVDA 5LQKA 1KMNA 2VP6A 1PWHA 2IW3A 3H5IA 4RK0A 2V8OA 5KJNA 1H2WA 3GFTA 3RRXA 2W42A 3M1YA 4WNDA 1JSCA 4L5CA 5E75A 2CNKA 3B51X 4A6EA 3KZCA 3FTFA 2XDAA 3WK7A 2P9KG 3R7LA 4GW3A 2F3UA 4XUCA 2ZGDA 3CS3A 4E09A 4WXHA 4FWTA 4BT8A 5ARCA 3Q9UA 2GQ0A 1M1NA 5AM2A 1XLUA 4X8QA 3KT6A 3D3QA 2C54A 2ZPUA 4J8EA 1U6JA 2XEEA 3L04A 3DT6A 5IWCA 5JYDA 1IXRC 3WKAA 1BMFA 4JIGA 4B3SB 4GYYA 1QO7A 3NQPA 1B16A 2QD3A 4DGQA 2FJPA 1BXKA 5T57A 1XDSA 1Z18A 2PRZA 4JL6A 4D0NA 4ZJYA 4RK6A 3SKYA 2GN9A 1QP4A 4XCXA 2I2OA 1UC8A 1J0DA 1NG9A 3VLFA 3LMKA 2QU8A 1LBIA 3HPQA 4AQYB 2Y66A 2DRIA 4JP1A 1W49A 1VKRA 4XA8A 2XNJA 5LP6B 4BRUA 3TXMA 1CTQA 1OZGA 1T2DA 4PNHA 1T3HA 2ID4A 2GLTA 5ERYA 3WS7A 1PQPA 2W4IA 5HOQA 3WFIA 4U5QA 3KXPA 1MX3A 5CCLA 3EISA 1SZCA 1WULS 2JDID 2GTIA 4CMCA 4KX5A 2A0YA 3QJGA 3FUIA 3TDKA 3F73A 5JDIC 1BGWA 5SICE 2FDRA 1SVKA 3FNQA 5FQOA 3FWHA 5L6LB 2HZ7A 4X93A 2CE2X 2D5IA 3FB4A 3G2JA 1BE1A 2UUBB 3CX8A 2H9YA 1XFDA 4M54A 1SXPA 3EPPA 2HWKA 2I4OA 5K05A 1KDYA 1E94E 2A5GA 5LCXA 3E9DA 3OZTA 2JJYA 1J0EA 5BYBA 2V0PA 1TUEA 4ILGA 3X1MA 1K1EA 5KVCA 4YDHB 3OTQA 2QGZA 1Z34A 4OBXA 1K4KA 4CMIB 4BWGA 4TUYA 2PKRA 2A5YB 2K6GA 2RDMA 1NNLA 1C7FA 3QK7A 8ABPA 5JWOA 1FRQA 2ODNA 4YO7A 5D01A 2X9GA 3HRKA 1P4AA 4YRDA 4A8JB 2VHUA 4QD3A 2Y1EA 4HAYA 2JLVA 5FP0A 1PE0A 2Y1CA 2VQSA 5JCPA 2WKQA 4I9HA 4JAVC 4P4LA 2E89A 4E03A 3KZMA 4FFWA 3MELA 5EQJB 3NETA 5JFOA 4AKTA 3C39A 2XMBA 2XT0A 1XALA 1RXEA 3B7TA 1ADCA 3L49A 2BE9A 1PT5A 4OQNA 2ZULA 1NJ8A 4NAHA 5LBUA 1ADYA 2A78A 2YCLA 3CF0A 1XZGA 1Z07A 3AHEA 1T8WA 4NMHA 2NW6A 4Y2JA 2W00A 4IWYA 5AHXA 1T13A 2WFZA 2XDQB 3MN1A 5DIZA 5AUOB 1Y4AE 4RELA 4R51A 5JR3A 4V3CA 3QAQA 3OZVA 3SYKA 4PHTA 3WKBA 5EKSA 2HPAA 1XEWY 1O4WA 1ZJZA 1D1SA 4F7DA 3R9XA 4AYWA 3I4FA 4CCYA 3TO5A 2DC1A 2VWGA 2R4QA 3PT5A 4JSRA 1TTTA 5IH7A 1H85A 3HL4A 2EQXA 2PUJA 3EUEA 2RB5A 3K6KA 1XNHA 2FMXA 4CU5A 1P18A 2I80A 5DSTA 1CS0B 2C20A 4OXXA 4B8YA 2JLZA 4D9FA 4EHJA 1E1QA 1K2VN 4A0HA 4ZAFA 2X76A 2HWXA 2HT6A 1U4SA 3MKRA 1ZZGA 4LV6A 3TLMA 1VL6A 4Q4CA 3KS9A 4LN1A 1VB5A 3IO3A 1ELKA 4FYHA 3ZS9A 1G21B 3DLPX 4JI4B 4BY9E 1KTVA 4A92A 2DTDA 2VXYA 1Q20A 3RTAA 5B36A 2I54A 4XD7D 1LJLA 3L8MA 2W90A 4OHPA 3HXMA 3ZZUA 1OF1A 2NVBA 3ELBA 1HNNA 1KAQA 2WIFA 2GSDA 4DMFA 5M72A 4ZO6A 4CF7A 3EMBA 4LS3A 5I8ZA 3G79A 1OUMA 1SKYE 4O2BA 3D6AA 3IPXA 3RBVA 1TMKA 1BO6A 2MMCA 3KSZO 2FB9A 3SC6A 5AQAA 4CUJA 4I43A 3R5TA 1M34A 1A9RA 1PW5A 2IFUA 3ZHYA 1OFUA 4OKIA 4RACA 1U7HA 5DTJA 1LTHR 2PX8A 4N40A 4HQNA 4K26A 3RBXA 3K1AB 4LVUA 3N5KA 4JNCA 1GTSA 1J20A 2QYSA 1T9KA 1T2VA 4NBSA 4OA8A 3IOBA 2NAPA 1GKKA 3DUWA 1Z5OA 5GIPE 3USES 3C3PA 2N0SA 1EK5A 2YJTD 1G5HA 5EEGA 3ZGNA 1DC2A 5LC1A 2XXJA 2PDAA 1E98A 4GC9A 3OZXA 5A7DB