4N3CA

Crystal structure of human o-glcnac transferase bound to a peptide from hcf-1 pro-repeat2(1-26) and udp-glcnac
Total Genus 279
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
279
sequence length
716
structure length
697
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HCF-1 is cleaved in the active site of O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/substrate
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 279
structure length 697
sequence length 716
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3cA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3cA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4n3cA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4n3cA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n3cA03
5DBKA 2IUYA 3ZPJA 4BTBA 2JJMA 3LKUA 2IFUA 2GT1A 2R68A 3OTGA 4MRAA 1K06A 3MRTA 1XKXA 3RSCA 5D0QD 3E3LA 3GZ2A 4I9CA 4O6FA 2Y4TA 4G2TA 1C8LA 4JHRA 3CEMA 5GPBA 4U0UA 3U3WA 2IV7A 5FZQA 3HBNA 1Y6FA 2IEGA 4AM9A 4I2ZA 4LEUA 3QDNA 4BQIA 4ME2A 4KQMA 4HOQA 3RJVA 4I1AA 1LWNA 3UPVA 2YQ8A 4AMBA 3MRVA 3OKPA 3ZN3A 4BT8A 3BD6A 1TJCA 4X7RA 1GGNA 3MV3B 2AV6A 3MBOA 4BT9A 2QLMA 2X0FA 3T3HA 1PN3A 2VGYA 3RHZA 3NP7A 2F3PA 1IXYA 4AY5A 3U4TA 4X7PA 3G2LA 3AS5A 1GPYA 3QKWA 2QFCA 4MICA 3NC4A 1M5RA 1Z8DA 1P2BA 3OXGA 2C1XA 3CV0A 1BX3A 1H5UA 2ACVA 4AIFA 2FF4A 4F97A 3GUHA 4GPBA 3VUFA 1IHGA 5G05C 3G2KA 2IEIA 4N5CA 2QZSA 3R9AB 1NZDA 1A17A 3KAEA 4X6LA 3N71A 4UI9K 4EKEA 1PC2A 3S0JA 2C1ZA 1Y8ZA 2XA2A 1KT0A 3ZHEA 1YA6A 4J8DA 4KYOB 5CHEE 2FETA 2QNBA 3D1JA 2IV3A 2GPNA 1UZUA 3RKVA 5M72A 2X0DA 2XCIA 1JG7A 4YI3A 2P58C 5HQ8A 5TMBA 3T7DA 2VGXB 2R4TA 2KCKA 1E4OA 4MHSA 2QRPA 4RENA 3PE3A 4APOA 2SKDA 3CKCA 3TG4A 3PE4A 1GG8A 2G9RA 3MV2B 1NOJA 4EJ2A 4G24A 1GPBA 1Z6QA 1FTYA 1JIVA 3OKAA 1FA9A 2QN7A 4WACA 2C0LA 1VGVA 2LSVA 2SKEA 1YA0A 3CUUA 2VGXA 3Q3IA 2R66A 3T3DA 5JJTA 4GA2A 4FKZA 3MS2A 4XIFA 2VYIA 2XCCA 3RO3A 4M60A 2X6RA 1A8IA 2R5SA 2F3UA 4RBNA 3TG5A 1YGPA 5JJ6A 1UQTA 1WW2A 5EX0A 1Y6GA 1NOIA 3NPAA 4WNEA 3CVQA 2L6JA 4XI0A 3QWVA 3S7FA 3Q5MA 4GYOA 1C50A 2MHKA 3CEQA 3MA5A 3Q15A 3OTHA 4G1TA 1SXPA 3VDMA 5ENZA 1XV5A 3BD8A 2PQ6A 3QOUA 3E4BA 3WADA 1WUYA 5LCWJ 4L22A 3RSZA 5AYWD 2QN2A 3ESKA 2FF5A 3FFLA 9GPBA 2PQRA 4GYYA 3L7DA 5BNWA 2OOEA 3Q49B 3VTYA 1P4JA 4KBQA 1L6IA 3ZCUA 1GPAA 2FEZA 3CK7A 4Z5XA 3O48A 4REMA 3SZ7A 1HH8A 3LCAA 4CDRA 3OXFA 4YI5A 2GPBA 5KJNA 3Q3HA 4ABNA 4YUAA 1EXVA 5D0OD 4MHOA 3Q47B 4I17A 2PRIA 2QRMA 3HYMB 2G9VA 3OY2A 3QHPA 3CK9A 3KD7A 2G9UA 2F9FA 3MSCA 2Y4UA 3CEHA 1B89A 4I9EA 4H7XA 3S7DA 1Z6PA 3MT8A 1SXQA 1ELRA 3FP3A 4J8EA 3AMVA 5TVGA 2BGUA 2C2LA 4G25A 3S7BA 3NB0A 1FS4A 4EQFA 4XI9A 4H7YA 2JLBA 1C8KA 3G2HA 1AXRA 5JJ7A 2KCVA 1FU7A 3AS8A 5DIZA 1J39A 2AZDA 2DBAA 4UQYA 4PQGA 1JG6A 3ZCSA 5FZRA 4RIGA 1QKJA 4HORA 5CCLA 1L5QA 4X7MA 3SYMA 1WV0A 5FZSA 4IN3B 2HY7A 3IAAA 1WUTA 4UI9C 4YNDA 3MTDA 1E96B 5CCMA 3CVPA 3OY7A 2OFFA 4F96A 2GEJA 3MS7A 1RZUA 1XC7A 3BD7A 2O6LA 3ZCTA 4U0SA 4N3BA 5A7DB 2WTXA 2XGOA 4WUYA 4G2VA 5DXFA 5DU2A 3CUYA 3L79A 3MRXA 2YHCA 2C4MA 3CEJA 2QN3A 4RG6A 5D01A 5KJLA 4GA0A 5G04J 2QRHA 2XCBA 2JZCA 1F6DA 1L5RA 1JIUA 3MTAA 1FTQA 3COPA 1ABBA 1QZ2A 5G04C 5ARGA 2VCEA 2G9QA 1AHPA 1QQEA 4WADA 2PL2A 4N3CA 4MI9A 3HBJA 2AVPA 3ZCPA 2XA9A 2Q6VA 2NC9A 2PZIA 1OUVA 3EDTB 1HLFA 2H1FA 2VCHA 2FFRA 1RRVA 1ZBPA 4J8FA 2R4UA 5FTPA 3AS4A 2WQHA 2HR2A 4UI9J 3BEEA 4BTAA 1L5VA 4CGWA 1NOKA 1FC0A 2XGMA 1XL0A 2ECPA 3ZCQA 4RIIA 3QWPA 4RG9A 1B4DA 2E2EA 4I2WA 4BFCA 5LQDA 4GZ3A 2XCUA 1QM5A 5ARFA 3C4QA 5LCWC 5JTTA 2FBNA 4GCNA 3BCSA 3TOVA 2ATIA 1HXIA 2H1HA 2P6PA 3L7AA 2ZB2A 3DDSA 3ZCVA 4NQ0A 1LWOA 4GZ5A 5KJMA 4KQ1A 5BT1A 3L7BA 2VSYA 1NA0A 3GYZA 3NCHA 4G26A 3ZGQA 4N3AA 1NZFA 2SKCA 4B94A 5D00A 5JTUA 4WNFA 3D0QA 4YVOA 4CTOA 1WM5A 1C3JA 3K9IA 3LY7A 1FCHA 3LPZA 3Q3EA 3ZCRA 4U04A 1IIRA 1KLXA 3S27A 3OXLA 3CKBA 5HXAA 3CVLA 1GZ5A 5A6CA 3ZHEB 3WAGA 2BISA 1KT1A 2QRGA 3MS4A 2PQNA 2GPAA 2PYIA 4UQZA 1XL1A 3CX4A 3OTIA 3URZA 4U07A 1KTIA 3SYRA 4WNDA 3L7CA 1P29A 1WV1A 2F3QA 1L5WA 2AMVA 4BQEA 2X0EA 4NEQA 3RT1A 4GYWA 3TAXA 1NVKA 3QWWA 3JYSA 4WNGA 3CV3A 4HLNA 3NP9A 3MTBA 3LYAA 3UYLA 4BWRA 1PSWA 2XMPA 3BCRA 4M83A 4M7PA 1P4HA 5FJYA 3HBMA 4EKYA 2BGTA 1HZ4A 5IKOA 3ULQA 4NESA 3SF4A 3S28A 1PYGA 2BUGA 2UWJG 3CUTA 4JA7A 3BCUA 3G2IA 2YJNA 1UQUA 4HWGA 5BW8C 3MKRA 2GJ4A 2VQ2A 3DD1A 3H4IA 5HI7A 2XEVA 3ASGA 4GZ6A 4BQFA 2IYFA 4N2QA 2I6HA 1EM6A 2XGSA 4U0ZA 2QRQA 1L7XA 3O3CA 2LNIA 5TMEA 1P2GA 1GFZA 1ELWA 3TGOA 3EBPA 1L5SA 4NRHB 2IF4A 4RIHA 2WPVA 5C1DA 4MI6A 3LY8A 1FTWA 2GEKA 4N9WA 3NF1A 2QN1A 2C9ZA 4CTMA 1F0KA 1FU8A 1P2DA 3HBFA 5I45A 3OKCA 4N2SA 4HOSA 3MT9A 2PRJA 8GPBA 3D0RA 2J9QA 1IYGA 3G2JA 3NAZA 4W6QA 5DLDA 3T5TA 4CGVA 3BEOA 3UYKA 1V4VA 1JIXA 3EBOA 2HYZA 5EX3A 2QN9A 2LSUA 3T3IA 3S7JA 5TMDA 1RZVA 4GA1A 2R60A 2PYDA 2HO1A 3S29A 2VG8A 3MEKA 3E3NA 3QKYA 2IW1A 4LDPA 1P5QA 2X6QA 2F3SA 6GPBA 1FU4A 3FROA 3C4VA 5G05J 2XPIA 4YVQC 4GPKA 2ONDA 3GPBA 4Y6CA 1PNVA 2QLLA 4JL0A 1K08A 3ASHA 2KC7A 3L01A 4LEIA 3CK8A 2KCLA 4MI3A 4F9FA 4GCOA 2FI7A 1ZU2A 5EKQD 3TSAA 5KJKA 3ASFA 3C48A 5IKPA 7GPBA 1W3BA 1O6CA 2UY1B 2AW3A 4HOTA 1Z62A 3UQ3A 2KATA 4G23A 3H4TA 3DDWA 3ZFWA 3E3OA 4F3VA 2V5FA 1E1YA 3T3GA 3RU0A 3CVNA 3ASDA 3CUVA 4RIFA 4EL0A 3VTXA 2Q7FA 3IEGA 4RELA 4RIEA 1XNFA 3DZCA 4KQ2A 3Q4AB 2KS6A 4W9RA 1XOIA 4AN4A 2IYAA 4WHMA 4KXKB 3WXXA 3IA7A 4JA9A 3GW4A 2GM9A 4QLBA 4N39A 4EL5A 1NA3A 3KS2A 3MQFA 3VDNB 2C0MA 4J0UA 1NZNA 3CUWA 4AMGA 3BDAA 3RIBA 2VSNA 2GW1A 3VUEA 3PDNA 3WC4A 3GZ1A 2QN8A 3OT5A 2BFWA 2ACWA 1WAO1 2FO7A 4CTNA 3UUXA 4NC9A 1JEJA 3S2UA 2UY1A 2QLNA 3FWVA 3LY9A 1WW3A 1P4GA 2XA1A 4Y6WA 2ASVA 4FZRA 3RO2A 4HOUA 3T3EA 4A1SA 5FT9A 1NLMA 3MT7A 1Y8MA 4UQXA 3G2NA 4AY6A
chains in the Genus database with same CATH superfamily
3WBKA 5JHBA 4FE3A 3ZPJA 4BTBA 2W6IA 4Z4CA 2OHJA 2PWZA 3NUQA 5ETJA 2RGAA 3REOA 2C7RA 2Y1OA 1UK8A 3DBHB 3UI2A 4AMZA 5A5VA 2OBMA 3PRZA 2HGSA 2X0IA 3D81A 4I9CA 1DRWA 3E3LA 3OZBA 1X3SA 4WK6A 3VNRA 4JI7B 1ZRNA 1Y8QA 1SC3A 1QCYA 3OZIA 3PNLB 1SH7A 5CT5A 1CR1A 3KC2A 1Y5NA 3WBBA 1R10A 2WM8A 3SBTB 1TKBA 1GXSA 3D3WB 4DADA 2AW5A 3I9MA 1TM2A 2X1VA 1MEOA 1W4AA 4DSTA 2WMYA 4U8VD 1HZZC 5H7PA 5I7SA 4GZLA 1Q7GA 2W6QA 4TSKA 1P6QA 4FU0A 3VPGA 3B7BA 3RU2A 4OQNA 5DX0A 2QRVA 3T5MA 3PDUA 3GMDA 1J42A 4CT4A 3OJEA 4P4SB 4ZHQA 4DOMA 2IYZA 3AW8A 4X6YA 4UAJA 3WGYA 4DA9A 2AF3C 4DY4A 2CHZA 3MBOA 2GN6A 4DLNA 3U64A 2Y76A 2Q5FA 4LA4A 1O9HA 4IHJF 3MIIA 5JXIA 4LXXA 2X0FA 4QXAA 4HB2A 1NBAA 4TMVA 3LHKA 1QYCA 1JTVA 4FS8A 4OMUA 1NXTA 1QE0A 2ZYTX 5TY0A 2BJVA 4R2MA 2VDLB 4U7WA 5JCJD 4ZVSA 4KAJA 1P9NA 3RK0A 2XMCA 5CHYA 3T1QA 1FYVA 5FPQA 1ETHA 1P2BA 3UAOA 4CCWA 1E32A 3DBRA 5FBRB 2Y1KA 2QQ5A 1K4KA 3A36A 1SXGA 1T0UA 2ISCA 1UJNA 2ZR9A 4H7JA 4W5RA 2J7PA 4CQMB 2RSFA 2GEDA 4IXNA 3L7IA 1Z75A 3W7BA 3QEBZ 3K5IA 2YWCA 2V96A 5ARCA 5BWNA 3QU4A 2A84A 3KAEA 4GQAA 5LA6F 1HFEL 2PV0A 1GGFA 3FGOA 1I0LA 1ZG3A 5H02A 1J8MF 2Y9PB 2CFZA 3OM9A 4CPDA 4QASA 1O94D 1FPQA 1NQ5A 1U0OC 3RCBA 1E2MA 1ZIOA 2C4HA 4DLTA 1MX1A 2QNBA 2N47A 2O8FB 1QHYA 1SCJA 3ED1A 3R7WB 1OLXB 3P9QA 4CIVA 2GRQB 1UP6A 1GAQA 1O96A 2XCIA 3HUTA 4H7KA 1DTEA 4YI3A 1BDBA 3VR1A 5LJIA 2LE0A 3D8UA 2WXMA 5HGJA 4TYNA 5HJ2A 1T26A 1OYOA 4AO8A 3C3PA 3ABOB 1XZMA 4L50A 4WESB 3DOHA 3GVPA 5KKCA 3BZBA 1TNDA 2GTIA 1EWVA 3RTBA 2ECKA 2QJOA 1PFYA 4YROA 1A8QA 1E8MA 2Q9CA 4CV0A 4EABA 4EHHA 4IXTA 2H3EA 2X5KO 1EB9A 3TKLA 3HM9A 2QTVB 1LB1B 3LD9A 2Q4TA 4QYTA 3KYCB 5AHXA 4G24A 4HGNA 2ILRA 1LVHA 1KDRA 1TAQA 2K4MA 4GOLD 1VGVA 1TIKA 4KE6A 2J3KA 4Q4AA 4A2QA 3P2EA 4O2BA 4ZYVA 3C3EA 1FNDA 1YA0A 2JASA 4FULA 2RFLA 2VGXA 3AF2A 2P4SA 4HRAA 2WLTA 5E6SA 5KTKA 5CBOA 5LLSA 5KAMA 3ZWBA 2W9JA 4ZHSA 1ZICA 4YTEA 3FHTA 5E3JA 1L5YA 3RV4A 1YRBA 5AKKA 3Q7IA 2HFJA 3NM4A 3RRJA 2ZM5A 2Z95A 4P4UA 3VR4A 1E7UA 4GRAA 5EERA 1SXJE 4I81A 4TT3D 3RWBA 5KI6A 3MKQA 4RKFA 3RAUA 2B3DA 2QEQA 1DC8A 1GTJ1 3ASYA 2RDMA 3DW3X 3UAGA 3GBPA 1O2DA 3P94A 3ZDXB 3ONNA 1Z2EA 4LC1A 1PZNA 5FWDA 4CL8A 4D3FA 4DX5D 3ESDA 2QZAA 3VISA 2YCLA 4X92A 1UAAA 1TJ4A 3B3GA 4U02A 3IT3A 2Z3ZA 1C80A 3PPVA 4GW3A 1IG3A 1YHYA 1QANA 4V0OA 4ND7A 1WF3A 4U0KA 1VPLA 4RWEA 4UC0A 4D4LA 1I9CA 1KEEB 1TT5A 2I2AA 2WVGA 1LLUA 1TJ3A 4RSMA 4AQDA 3T95A 1Y1KE 4IGKA 2R6ZA 5BW8A 4L0MA 4OYSA 1D1PA 4BWFB 4NARA 3A9TA 4MQMA 4BPBA 1HDEA 1S64A 3KE8A 4QLOA 4EBBA 4HLLA 1T2UA 1Y98A 1NJFA 1J1UA 1YCSB 3BSWA 4X1KA 3LUAA 2WV9A 3WLRA 3NVKI 1G41A 3CRQA 4Y0AA 3UT4A 1RNLA 4TVOA 1TYAE 3MCVA 4GGOA 5CU7A 3IOCA 5G0SA 4CDRA 2PX5A 5JWRA 3OXFA 2UVQA 4LZZA 4G0PA 4XH9B 5CITA 4J8YA 1GL6A 4FOTA 5HZHA 3H2YA 2X13A 3PQ6A 5HIMA 2GRPB 1IXRC 2Q8QA 4ARZA 3ELBA 4DW8A 1RC8A 5CFOA 2FF7A 4RF5A 1J8YF 3KD7A 1PJLA 3P1UA 2NUTB 3IKMB 2F9FA 3OSZA 2OV6A 2X4LA 1UP7A 3MSCA 5JG7A 4CQLA 1NMEA 4C4TA 3KSBC 2IS1A 1FFGA 1ID1A 1ZKDA 2QMEA 2WZQA 3LQYA 4L27A 1K9SA 4EUKA 1Z12A 1EUCA 3RF6A 5JHHB 1NAHA 1FDVA 4FCWA 3QLVA 1ANKA 1V2GA 2FSVC 2QNIA 2WXOA 2V58A 4K3VA 3VPBA 4OCZA 5DMXA 4GP6A 3N0RA 5LP6C 2GNOA 3PDWA 1OR8A 4OFBA 3D9MA 1Z6XA 3OOHA 2OAP1 4I2VA 4URVR 3HIZA 4FNGA 5EWMA 4O8ZA 4EVSA 2PJRA 2P41A 4JJ4A 4AJEA 1UPTA 3A58B 3H87A 2WTAA 3A32A 1P18A 2GLTA 2R1ZA 3AR5A 3EW9A 1ZD3A 1PZHA 2ZIGA 3HWX1 1TAGA 1Y9AA 5EE5B 3ZV4A 2V8BA 2DQZA 4Y1FA 2V1UA 3K8QA 1CK4A 1A7KA 3FLEA 3WGLA 1SOAA 2Z5FA 3UOWA 3ZKWA 3ZH9B 5JAQA 4GGPA 1GKKA 2VP5A 2EKBA 4MTLA 5PNTA 5FOQA 2YJ5A 1OY3D 4ZYXA 4R9UC 4OBEA 5IYZF 1KGDA 4KTTE 4GMXA 2YOFA 1ZX1A 2O6LA 2Q5LA 2Z9CA 2OR3A 1PD0A 4U0SA 2PX4A 3CFYA 1O1SA 4FX5A 2QUJA 4EUEA 3ROTA 2WT4A 3KJXA 2YHCA 4LGMA 1AQ6A 3JWEA 1A9PA 4TS1A 3WNVA 5FEMA 3E8MA 3AEYA 2AHOA 1P91A 1MEJA 1PGPA 3IHTA 5DNDA 3AI7A 3B7WA 1EGAA 1HEYA 4ARUA 2NU8B 1R3UA 5G3ZA 1X42A 4HTAA 1JG4A 4EZKA 3AKDA 5C8ZA 1XB2A 3BDVA 4GC9A 3WYNA 1EUCB 1FE8A 1BS2A 1VIAA 3EW7A 3QW2A 5JI3E 2PZJA 3KSQA 4GX0A 4RMJA 1G9XA 4G0VA 4AX8A 1DGQA 2FRDC 3RC2A 2B6CA 2PYZA 3Q12A 1CQWA 1GPJA 2F6RA 2P7HA 5F64A 1F48A 2Q3CA 3UB2A 1OIWA 1PJBA 2G08A 2G4VA 3DA8A 3LKDA 3R0IA 4HJRA 3PIRA 4MWBA 3SCZA 1I1NA 3A4MA 5ITVA 1HTTA 3T99A 5C8YB 5I7RA 2R87A 2CHXA 2ZZMA 4A2WA 3JPWA 4UZSA 3RUPA 1PR3A 5EIBD 1KMHA 2ZE5A 3CCCA 1CG6A 3PFBA 2EIKE 1HT3A 4ZQCB 4Q3LA 5CPBA 4E3ZA 2X7XA 1CUZA 4DGQA 1SIOA 1DVRA 4ZJPA 3QF7A 5EIDA 4UOEA 4UI9J 4TKVB 1MQSA 1T1IA 5HUHA 3KUCA 3BJRA 5JEEA 5JLJA 5I9MA 1Q14A 1TYZA 2V6JA 5I9IA 3GNSA 1A82A 5CXXA 2AQKA 5CH3A 3UC9A 1G16A 5IJ0B 3CLSD 3EN0A 1JKMA 3O2QB 4BFCA 4RG9A 1OH7A 4AC9A 2YXNA 2DX7A 3V4ZA 4DB2A 2OFXA 2QTHA 4BLTA 2IDJA 2VAVA 1WNTA 4ZQFA 5KPDA 2H5IA 4H27A 3BGSA 3BX1A 1RFLA 4DYVA 4F3NA 3GP8A 3DTNA 5DGCA 1PDVA 2ZK7A 2JABA 4BU1A 2LXLA 3WWCA 1OLSA 4C21A 2CFCA 3EZ9A 1E8NA 1QR6A 4KH0A 4B89A 2C58A 4KXYA 1R0YA 3RYCA 1M9NA 4IWYA 4MMXB 3MKQB 3AB7A 4A73A 4GMLA 1ZLYA 3M2PA 1A4RA 1DAOA 2A57A 3UNXA 6AT1A 1PNOA 1YR2A 4EJFA 3EXIA 5HDQA 1X1AA 4NBRA 2IUEA 3E05A 1E1QD 1C3JA 1RQ2A 1PY1A 2IEBA 2K2WA 2R00C 3GGOA 4JB3A 3SYKA 4BZXA 4IKEA 1MB4A 1KR5A 4MVJM 4O2BB 2HHCA 4FFLA 4IO1A 2NU8A 4I14A 3R7NA 1GILA 1JGTA 2PZBA 4GR5A 4KAXA 4HXFB 3LZDA 4OY3A 3SDSA 4O1OA 3H9CA 1S2MA 5HXAA 2X3MA 3TFOA 2XTAA 2AEFA 1MMFB 1FFXA 1VM6A 5A6CA 1Y1SA 4RK1A 3W1WA 4EVRA 4EUSA 1NLYA 4ZZ2A 2NSZA 4LHYA 1TCVA 2PYIA 3RU3A 1ENZA 1G8FA 1OXBB 3C24A 4U07A 1BFDA 2LZ0A 4HS4A 4CKWB 3SVZA 1SKUA 2B0CA 2XS1A 4UOQA 1NJ2A 1SUEA 2ZITA 3IAHA 3SNKA 1O77A 2L19A 2PL3A 3R7DA 3Q41A 4ZTZB 3V1TC 4URZR 4I9NA 2F67A 4HR7A 3OCCA 3IESA 3OZEA 2MT9A 3PI7A 3IHWA 4M99A 2JJQA 4RJLA 4TTJA 4A1OA 4BMZA 4YUWA 3O4IA 3UJNA 3LYAA 3GLHE 4OJYA 4G97A 1UG3A 1XVIA 1P4HA 3PDCA 5CTJA 2Q62A 1DMRA 4E0BA 5BRJA 4DA6A 1HSOA 5ENNA 1E6CA 2VO1A 2VLIA 3EVAA 3NBQA 2IS4A 3U7QB 4OHXA 5DHAA 1U63A 4JA7A 2W90A 2WJVA 1OKKA 4NYJR 4R0VA 2CV0A 2P1RA 2VQ2A 2L0IA 4CQMA 4PGGA 3HR4A 3HV0A 4OQEA 4Z86A 4EKIA 5KVSA 1VC2A 4BP8A 1EXNA 1E8ZA 2ZQZA 4E22A 4NXNB 3PH0C 1TQ8A 3DXZA 4Q15A 4BY9E 4U0ZA 3R77A 2AXPA 3DHVA 2LNIA 1JNZB 1ESNA 1KZ9A 1SO8A 2DPLA 2I67A 4H6XA 2GPSA 1G8PA 4K9LA 3BE8A 4KDFA 4QQ8A 5BXQC 4H4DA 2IF4A 4NRHB 2OG2A 3DBLB 4GMHA 5BVHB 3FNRA 2P69A 4RTKA 2XWQA 4LJLA 3MHTA 1SVSA 5FWYA 3PXUA 4D2IA 3HABA 4G5GA 1FS6A 5JWHA 5HTOA 3WLLA 4DLWA 1ESMA 2GEKA 4FS3A 3OEEA 4UUCA 4NQRA 5AKXA 5KYWA 1LQUA 2EIJE 2X4IA 3D7NA 5JCXA 4MKIA 4P4SA 2ACEA 3CZCA 4BNWA 3NIBA 3G0HA 4LWQA 2OAGA 4YRFA 1H23A 2FFGA 1NM5C 1RQLA 2KBEA 1RQ7A 2V03A 1ISSA 2X8JA 4L0CA 4QQFA 1P80A 4O33A 4BVEA 1N77A 5BWLA 5JJCA 1XRQA 1NW7A 2NT4A 1Z6ZA 4IIXA 3PD1A 1O95D 3BEOA 1TA0A 1GFWA 3R8FA 3BTSA 2Q2NA 1VL0A 2WDZA 5EXTA 4J0KA 4GFDA 1DT3A 1O95A 4KXUA 1KP2A 3IUJA 1TF7A 4YJHA 4DI3A 3FNEA 1DV2A 4HD8A 1Z3XA 5JSYA 4F4HA 4JH0A 3FUHA 1QS0A 1DBSA 5TT0A 4C4XA 3K0FB 3FROA 3LBYA 3RUCA 3T6KA 1NVTA 2J4DA 1LC3A 3L13A 1HYHA 5B1SA 4F7WA 2RKOA 4M36A 1QRUA 3KVNA 1M1ZA 5DVZA 1C0LA 1G4HA 1M6HA 1UK9A 1W9HA 1DQPA 2F8LA 3H5OA 1Z5OA 1NI5A 2DPHA 4O2LA 3L01A 4WOCA 5AIAA 5C5CA 2CK3A 2XNSA 4RD6A 1MQAA 5JDIC 2HR1A 3KKLA 1NBME 1AZSC 3K0CA 1EMDA 5IY5E 2IUSA 1V7ZA 2YH2A 1QGYA 2F43B 2IVZA 3EUAA 3GLKA 3IKVA 1FXWA 1KYXA 1P1IA 2O20A 3E2MA 4FJ0A 3SJAA 3U4QA 2BKLA 4NP6A 1WCV1 1WHSB 1OTHA 4J16C 4NYMQ 4QHTA 4TQGA 1L4BA 5EKUA 4CIXA 1VKNA 4LECA 2O19A 1ZVQA 3FWPA 1DJNA 1KVTA 2R5WA 4GVPA 1VGQA 1ZH8A 1G6Q1 1Z7GA 1A5AB 1E3WA 5LQUA 3E3OA 3IR6A 3QX3A 2HH9A 3ESZA 4N5HX 4DILA 4MS3B 3NIWA 4HSGA 3PNMA 2W22A 5D86A 1WKCA 3ZU2A 1GQYA 4BKOA 4NOJA 2XEEA 4FFPA 3EUEA 2HU8A 2O52A 2LAHA 3PQFA 3P0FA 3V2HA 4IFTA 1CLEA 2GO1A 2YZKA 1Z2NX 3CUKA 1TMOA 2VSOA 3RSEG 3K1JA 3MCAA 1J99A 5DHTA 4E7PA 5CYOA 5KOHA 2GESA 1QV7A 1UXKA 2ZDQA 2VJBA 1AGPA 1LK0A 3VDNB 4E4YA 3LO5A 4DX1A 2C0MA 3UGKA 1YCDA 3RFUA 3RUIA 4KIJA 4ID3A 1D2CA 2QXUA 4MP8A 1RAEA 3FNQA 2A92A 4RW0A 5FIOA 1DOAA 5ADHA 2HDWA 1RZRA 4XD2A 3EEOA 1FNNA 1ONOA 2JFVA 2NG1A 1RZRD 2R11A 5C4MA 4HQDA 3ZPXA 2DKNA 2RGBA 2YMLA 3JAWA 5H59A 3JQBA 1ONNA 1YZUA 3VYTB 3R6TA 1JQLB 1KO4A 4I4IA 4XWOA 5H81A 1R6TA 3T0FA 3ZV7A 3UKRG 2LDXA 4UXIA 2OESA 4BEVA 4C07A 3HC7A 5MGNA 4FZRA 1Y5LA 3JQ6A 1LJ8A 1NDQA 3A4NA 3AG5A 1QJ4A 4ZFHA 3OM8A 4KBYA 1SQ5A 2FX3A 5FT9A 1N6KA 2EP7A 2NZUG 3JD3A 3MT7A 4DV0B 2O2DA 4ZVTA 5CRUA 1IPEA 1B76A 1SCQA 1NVVQ 2BHSA 3DL2A 3NTLA 4IXDA 1WD5A 2ZRJA 5EUCA 1QIMA 4HHEA 1D7AA 2VPQA 4R81A 1EGMB 4DQKA 2QW8A 3EODA 4FR0A 1N78A 2HRZA 1XZBA 5CDTA 1MXFA 4O0LA 2I3GA 4DA4A 2O8EA 4R41A 3KQMA 3K2QA 2FMHA 4NEHB 4ND8A 3WWDA 5JA4D 2WJJA 5HRCA 3W77A 1HX7A 3ULYA 3MUOA 4BESA 4TXQA 1R4MA 5CGQB 2AMFA 1QLJA 4C4OA 2ON6A 3LUDA 4H17A 1V7QA 1DINA 2FSFA 3A9CA 1UQRA 3MLEA 5K05A 4Z8XA 1NFFA 4IDHA 3IURA 4HOQA 3TWVA 1ICEA 1ZC4A 2AOVA 2X19A 3D3WA 3GT0A 1U02A 2KJQA 4RM2A 2QXYA 1V39A 1YJBA 1Z4NA 1KU0A 3TM4A 5K0NA 4Q7QA 3N0VA 3OKPA 3EIQC 4HRNA 5TEVA 3RG2A 1OCZE 4DLYA 3N3AC 4B34A 3FDJA 2G5TA 4XIYA 4QBTA 3H4MA 4ZZIA 3NBMA 4A03A 1GVNB 2P27A 4JQOA 3QJGA 1DTWA 2AXZA 3UHAA 1TW3A 3GRRA 5DCLA 1RLTA 1NPTO 3QYFA 6Q21A 3THXB 2IONA 1GGHA 4GR4A 3U4TA 2HQRA 3KHTA 3IR5A 3O82A 3GLFB 2WWVD 5TQ2A 1VFNA 3JWJA 4FJ2A 2WTBA 1QONA 1M5RA 4RMGA 3ZIMA 4NULA 4JROA 1U1GA 2J0UB 2HU2A 1TB4A 1WEKA 3X44A 3AM1A 2NXWA 4Q39A 2GXAA 4LAFA 1MH1A 1DAIA 1H5QA 1VL2A 2C2HA 3IO5A 3IULA 4HN2A 3O3NB 4PS1A 2AG0A 1M2OA 2ZTVA 3K7EA 3CF4A 4WD3A 1OV6A 1KQNA 2C1ZA 1XXHE 4FEAA 4G86A 1RM5A 2GF0A 2P5TB 2I0FA 4JUDX 4P8RA 3ZHEA 4UFOA 4V0MA 5EZYB 3RUDA 3D8RA 1T24A 3EGOA 4IO0A 4UBOA 3S7ZA 2NIPA 3ZXXA 5EPOA 4TL9A 3HB1A 5TDHA 1NL4A 3QKSA 4NFSA 2D1TA 2JBWA 3GN1A 2E7ZA 3OBBA 5E76A 3ELYA 4HNGA 4NL4H 1VE9A 4MAAA 1F14A 4DUZB 3AC0A 5KYYA 1BVRA 3AHGA 2KBXA 4F2PA 4YT4A 4Q9AA 3LBAA 1L7NA 2BHTA 1U4SA 5JD3A 2KCKA 4J0IA 3LL4A 2EHDA 4J0JA 4DMHA 3WL6A 4B5KA 2X77A 4NZZA 4XIGS 3WVNA 3NEAA 4QARA 2XZOA 5EVJA 3GQBB 4Z3KA 2P2NA 4JJ7A 3WLFA 3KETA 2PT5A 4HDSA 4NHEA 4E03A 3GRVA 3EYWA 4FHDA 2E82A 4ZVMA 3F98A 3E9QA 4HDSB 2ZSKA 4QJIA 2R48A 2YN0A 4DWWA 1UBKS 1NBWB 2IW3A 3HKCA 5I4BA 4RTRA 2JHCA 2BGRA 4LWPA 1UBFA 2EX4A 3WMRA 3CSFA 3T8MA 1KQOA 3NTVA 5JJTA 1F5SA 3U7IA 3PZ3A 4G9BA 2GETA 1P0QA 1X80B 1L3CA 2HMSA 4MPRA 2AD5A 1TJFA 1N6OA 1NQUA 5K4AA 5FFFA 3IA2A 2OEVA 2DQKA 3GZSA 3QKSB 4HV4A 2G82A 2VDRB 5JJ6A 2ZIXB 1FFYA 3JVEA 1UMCA 1I4TD 3FMGA 4EHIA 1ZK4A 1DKRA 4M87A 4YP5A 3Q10A 2ZLBA 1VG8A 5EJEA 3NPAA 2IXBA 2IOYA 5DCUA 1A72A 1R8SA 1SHJA 4G4SO 3L82A 4LZPA 2L6JA 4PFQA 3VYSB 2EIHA 3ZHOA 1ZPDA 4LV8B 1VJTA 3SM9A 4PNHA 1IY1A 3ZDYB 1E7SA 1U1IA 2C5GA 4IZIA 4MGEA 4XSGA 4Y9TA 1C0IA 2JAPA 2GPYA 3TLCA 3ZNPA 3U7FB 1NW5A 3FPBA 1DIOB 3UKJA 3L6AA 1G55A 2EFJA 4RHCA 3AHFA 1LPPA 2FOXA 2FW9A 2V6GA 4UUBA 2XOKD 1P3JA 4FFBB 1FUYB 1GUZA 1W30A 3E9CA 2IYQA 4U0JA 3TLKA 4LXQA 4NG5A 2JCSA 1BEEA 4Q9IA 4GKJB 3GLFA 1ND5A 1YD7A 2QTGA 4KBQA 1QO0A 1PZXA 3M81A 4A4DA 4DJDC 3CK7A 4YAUA 4UBIA 2PD6A 3LCAA 1E3LA 4Q1EA 2HL6A 5EILA 2CXPA 2W2KB 2XDWA 5CH8A 3M1LA 1BMDA 4KP7A 4YI5A 5ITZA 3UPTA 1JEYB 3Q47B 1QPGA 1RPNA 1Q74A 4MP3A 2UU9B 1QF7A 2QUBA 1X19A 4B2IA 1Y3FE 3E33A 3AZQA 3C6YA 5FAXA 1G66A 1XDUA 5LZ9A 2OPBA 5F51A 2WT9A 1NWCA 2Y4UA 1IBSA 1LFDB 3MERA 1B89A 3AG3E 4I4LA 4WFIA 5TQ0A 4N6OA 1E2KA 4BSXA 1MNQA 5TVGA 4ZIRA 4RJKA 2YOHA 2C2LA 5IPFA 1T25A 1E79A 3FGPA 4XX0B 3RV3A 4BLWA 4O4JB 4JU8A 5LZ4A 4XB1A 2NWQA 1CQXA 3EG9B 3SEQA 5AHKA 1W4CA 1I6MA 5AK5A 4HUQB 1PQ4A 2VT2A 1NC1A 4BMYA 3CR7A 4TV9B 4GWLA 1AXRA 1JIJA 2EC5A 1R74A 4DEYA 1IOLA 3OX2A 1PSZA 3T5CA 1A8PA 2VBCA 3AG6A 1IY8A 1C2YA 4JZKA 2V1XA 4Q21A 5A04A 2BFDA 2YMMA 4RIGA 1R6DA 4C6TB 4KE7A 5CCLA 3ZXSA 3PLRA 4Q47A 5CFRA 2JFQA 1RT9A 1J2UA 2BH9A 3QXGA 4QOGA 4B8ZA 5TE9A 3O4GA 3TUJC 3ZE2B 4OQ4A 5L3SB 2EFHB 3AY3A 1Q7BA 4MVWA 4LDAA 4UM9B 2GD0A 4PX5A 1E96B 1XYGA 2BDTA 3FPHA 3L4SO 2GEJA 1N4AA 1AQJA 1JA1A 1Z3IX 4CUZA 4EA8A 2QG4A 5U1PA 2WTXA 3UBTA 2QS9A 1D2HA 2PGOA 5DTMA 3TRKA 3QOXA 2QD5A 3EMDA 1RI2A 1T0BA 5L51A 2G1PA 1V7PC 4KWEA 4HNQA 2IV2X 1NVXQ 2H0AA 4IOLA 4G67A 3FBGA 2G1UA 2BEVB 2Y6VA 3PUVA 5G2OA 2O2ZA 2AEMA 1R9JA 2NAFA 2P91A 4LDRA 4JC8A 1J06A 2BEUB 1BDMA 3GO4A 1HL7A 4FE4A 3KWJA 3SF8B 1A97A 1OLUA 3NWBA 1N9KA 2AYYA 1HEIA 1FVOA 4R1SA 2XTNA 3K1YA 1B1CA 1LS6A 3GLRA 5G4KB 1NBHA 5L6MB 3ZHYA 1JVBA 4EY3A 1PG5A 3GFBA 1F2UA 2ZB4A 4QVIA 3JQ7B 1G59A 1YRQA 2Y2VA 1QQEA 2Y1DA 2HXGA 4DX7D 3IVCA 4ILHB 1Q6ZA 2C0QA 3DEAA 5CG2A 4IS3A 2AVPA 4H3SA 3AJDA 3ROZA 1XHLA 2H1FA 4AJ4A 1YCHA 3FVWA 4IMPA 1RBQA 4QOJA 1CZLA 3FTXA 2QK4A 2Q7DA 3REGA 3I1IA 1MX4A 3LA6A 3EVEA 4QOFA 1ZH0A 2V3VA 4FC7A 1FFBA 3PNVA 5FPHA 2OHHA 3BEEA 2D2EA 1Q7EA 3ONKA 2VJAA 3M89A 4Q6WA 3MGAA 3T15A 1JX6A 3VR0A 3A70A 3ZHSA 4B6GA 4BJ3A 2O8VA 4M88A 4URYR 2R4QA 3QOFA 4RIIA 2QRJA 3SNXA 3COZA 3J5PA 4GZ3A 1B8NA 1C9JA 2I80A 4B74A 2ZJ3A 1YB2A 3FPFA 2VHVA 2YDYA 4ZI2A 3KLPX 1JJ7A 4UASA 2I2OA 4JA0A 3KEFA 1FX1A 3NNDA 5FADA 4JBNA 1AKNA 4A26A 4B33A 4QM6A 4V0SA 4E09A 5H3HA 1OZGA 1SC1A 4N65A 3RVDA 2GEUA 2VDUE 4HWOA 5KINB 3T4PA 2R8PA 1HY3A 4NQ0A 3OZFA 5SZJA 1C30B 1AVTA 4J1SA 1A27A 1NA0A 5ILGA 3R20A 5EG5A 2Q8NA 5CB6A 4BKMA 2O8DB 4Z4GA 5LP1A 4GYJA 1CFZA 4A0HA 1QZ3A 2XCTB 4WXHA 1H6OA 5AIJA 3PJGA 3PXAA 1BFUA 4Q3KA 5C37A 1EFCA 2J0SA 2IDZA 2WD8A 4HEA1 1MORA 4Q48A 1OY1A 1PJ4A 4RF3A 4Y8VA 4AB1A 3DPDA 4E1BA 5LLTA 3O38A 5JDCA 3GJ0A 3I1JA 1FCHA 1EQUA 4JVMA 2I91A 2VTDA 3TW4A 1RQXA 2W2LD 2Q1SA 3AL3A 1XTIA 3PF8A 1II8B 4EZJA 1W94A 3KE9A 2GS9A 4DQXA 4Z49A 2VAPA 3H86A 3KP1A 1PNRA 2YHSA 4C0EA 5FPTA 3P7MA 4QBFA 4IDEA 1N4QA 1NBOA 2FMUA 4NDZA 4Z9AA 2GUWA 5ERGB 1QC5A 2RKWA 5AM1A 4BP1A 2Q6LA 3W5IA 4ZVLA 4HH1A 3M1IA 1ACMA 4ATGA 4P1ZA 4ZC8A 4P54A 4YV2A 4UUMA 4JUAA 3KJIA 4MEBA 5FWYB 3U0BA 4U7FA 1Y37A 1JHRA 1SHLA 2Q7XA 2EF1A 1P7VA 3FG9A 3FN4A 3D4PA 3UJPA 4RETA 4G8JA 1XQVA 1KI7A 4BQEA 2Y8EA 4I1VA 2XMZA 2V0NA 3IQZA 5ESXA 3T3OA 2Y71A 1I30A 3W9BA 2BP7A 3RS3A 3D9QX 2ZUEA 2GVNA 1RP7A 2Q21A 3KOWA 3Q8WA 4TMTA 1PSWA 3HG0D 4PVDA 3BRSA 5TGZA 2DWCA 1Z25A 3UJ6A 2DPMA 3QY9A 2NUPB 1NVVR 5AICA 5B4UA 2VYQA 3EEQA 5AHOA 2I34A 3G9ZA 4PR3A 5ALMA 3QXSA 1HEUA 1Q20A 1SXJC 1GUDA 4Q3DA 4ETNA 1NBMA 1Z7WA 2XENA 1MGOA 1NVGA 2H57A 3CO0S 2GJ4A 4LI0A 3ZWQA 5JS1A 4L5CA 2A88A 3PTZA 2BMVA 4X62B 2BP7B 3R7BA 1KMNA 3ZYCA 5F12A 1K8ZB 3HJCA 3IDAA 4FTWA 3LXXA 3T1OA 8MHTA 3OQ1A 2QL7A 2Y05A 4F46A 2MSWA 4KTVE 4FNMA 1PQYA 5CFQA 2FMTA 4MVCA 1XIVA 2BM8A 3E7DA 2I2DA 1K0FA 1LDGA 3PQ7A 3P0JA 2GILA 4DLSA 4S12A 4DR7B 1GV0A 3UFXA 1P7PA 1AZTA 4DT1B 3U7GA 3LY8A 1FBNA 1E1LA 2XW6A 4PNZA 5D84A 4XDYA 2NVBA 1KC1A 4URFA 2CWWA 4FHFA 4PC6A 4LZWA 3EFOA 5AK4A 4FM9A 5AARA 2XKKA 3W9YA 1DBIA 3FTDA 3K30A 4PAOA 5E1MA 4YLYA 1AB6A 5EIWA 1I10A 2FPKA 3C6KA 4J3JA 2P9PG 1RLUA 1VL8A 1ZK1A 2GBGA 2MDTA 2GZRA 2QPTA 5IH3A 3JQAA 3AKZA 4W1RA 3T9BA 1EUDA 3EIWA 2E4AA 4HQKA 2ROQA 3I34X 1GQRA 3C85A 2GD1O 3JVVA 4PC3A 1LJUA 3RJ9A 5HP4A 3EBOA 1VCHA 2VTEA 5ULLA 1QG6A 3T3IA 1POXA 1VRCA 2I1JA 4KACA 3NZUA 2B98A 4RFLA 3ABKE 3STWA 2B37A 4GMRA 4LY3A 2VG8A 4CTKA 5EL0A 5CIWA 3H3JA 4TXHA 1N75A 2XUKA 1C0KA 2GKOA 3T0IA 3PRJA 5A6SA 4MRPA 4WZAE 3W2EA 2HW8A 3IKTA 3K70C 3RYCB 1U3WA 1YYHA 3RBZA 1VECA 1YV9A 4MUGA 4ZOQI 2JFZA 4CKCB 2AFIA 1L4MA 1ZEMA 2FPSA 4JT2A 2XX3A 5KPJA 2XE7A 2NU9B 3AF5A 3BF7A 2J5KA 1A2KC 2CL0X 3K92A 3QNKA 5KWEA 1DDGA 4PSKA 3UB3A 3KG2A 2KCLA 3WDKA 3GGGA 1W1WA 4ND5A 3D9OA 2Y92A 3DR5A 4C22A 1OD6A 5GQSA 4NJMA 1SUWA 1WETA 4M6WA 4BVBA 1OB2A 2IXTA 4WBXC 5JXWA 4LXHA 1EFVB 4P5EA 1UR5A 2AW3A 2V7BA 1NW3A 1UP4A 1Z62A 4EG0A 4C7OB 2WG0A 2E5WA 1QTRA 3X1XA 3VO2A 4FYJA 3HLYA 1JYEA 1P4SA 5EHQA 5KOYA 1V55E 4A0RA 3IEGA 4HQ6A 5HK9A 4LVUA 1VIVA 4Q9LA 2OCAA 3PZ2A 1DL5A 1ZQ9A 3I3SR 4LK2A 3Q4AB 1SVUA 1GWNA 4B31A 2ZRPA 4DNOA 3OE7D 4B2PA 2PAAA 4DNQA 1M7HA 1WQ4A 5K0BA 4DMMA 3EJNA 4M89A 2FY8A 2FTKE 3IA7A 3QMMA 5SYMA 1NMXA 2Z8XA 4MRUA 3PFGA 1F9AA 4PONA 1JZSA 1THZA 4QYWA 4QX6A 4RV4A 3W5JA 3KS2A 2BEUA 4EYOA 3QHQA 1NUHA 4BP3A 1N57A 4J0UA 3CUWA 4OSEA 2J0EA 5DHPA 3RIBA 2KB0A 1Q2UA 3G0BA 4L4RA 3LBNA 2O4UX 4TMZA 4H0NA 1YR1A 2C99A 3GRZA 1E2GA 2ANCA 3WK9A 5BN1A 1GPLA 2FPIB 5AP9A 2DMRA 2RI0A 4NC9A 4WN9A 1MIOA 3UW1A 2QPAA 1MIHA 2H07A 3CBGA 4RHYA 5G40A 1A8SA 1P4GA 1KWGA 1Z0SA 3KYIB 2A0KA 4FFDA 1SY7A 3ZJ4A 3T3EA 3UUEA 4DSAA 3HU1A 2O8CB 3BH0A 3P52A 2E2WA 2OYSA 1D7OA 2H1CA 4EZIA 3WHPA 3MPUA 4AY6A 3LLCA 4C6TA 1XGWA 3HM2A 3VH3A 2NUAB 3M6MD 5AKYA 1Q17A 1C7FA 4I8XA 3EG5A 5IBQA 3MUEA 4IVNA 3PHLA 4FYWA 3TTUA 1HE2A 2VF5X 3Q75A 1IEWA 4P7BA 4KK3A 2REOA 2O2CA 4LY0A 1N4PA 5KMGB 2CV2A 4XKJA 1T3SA 2JVIA 1ZGBA 5DBOA 1HDXA 1Z2DA 3FH5A 4YIHA 2Q4EA 4NCHA 1T13A 8ATCA 4O4JA 4MUKA 3BWEA 3OZ7A 2QT9A 4W6ZA 1OPXA 1O9GA 1SG6A 3HYCA 3VNBA 1KEZA 3CIAA 1HL3A 2W00A 3BB1A 3VR6D 3KQNA 1BDHA 4BQIA 2DHRA 1IUNA 4BECA 4NZ9A 2CVZA 3RH0A 3COSA 4JOBA 4KQMA 1EF1C 1Y82A 4RMHA 2ASEA 4EY4A 2XNDA 3HCCA 1WIWA 4B8AA 3K0AA 2O2GA 3U60B 2XHZA 1D4OA 1H4VB 2FH5B 4OLHA 5ITZB 2PU7A 4GO1A 2JIOA 4ZWNA 4I3HA 3GI1A 3CVWA 3ND8A 1U0NA 2G70A 2ZSDA 4YJKA 2PKYX 1BG6A 1PN3A 1FMJA 4PM4A 4E6HA 4OGGA 5AFSA 3PA8A 3GLGB 4MQBA 4PXYA 3GFGA 2QMYA 3R8XA 3SKVA 3RAGA 3V8MA 4LRWA 3SC2A 1WB5A 5BVGB 2XZTA 3TDMA 4R3UC 4EYKA 1DC4A 5JMND 4L0QA 4LJ8A 1EGQA 3WL3A 4EQ6B 2E89A 1BX3A 2C00A 5ENOD 1E5TA 4TTAA 4CU5A 2R7MA 3AM3A 3CKLA 3HFGA 2ES4A 1ZB1A 3F97A 1J0AA 1SZPA 1Z0IA 4YJFB 1NXPA 3UA4A 4ARVA 4EMTA 4MYDA 2CHFA 2FOIA 4JDUA 3V7WA 2V55B 2HCTA 1HFAA 1XMVA 1QH9A 4G8LA 1KMCA 1AKQA 3NRBA 3RUAA 4L9AA 3ZH2A 1XRMA 3LJ3A 4R84A 2ZXWE 1UMCB 4GPAA 3AF1A 1WWKA 3CKMA 4ZOLB 3ZWYA 3ZEFA 3AF3A 3C5HA 1K8XB 3LV8A 4KITB 5I9LA 1G2OA 2C2OA 4IWNA 4X54A 1BJTA 3QTBA 5E2IA 3T5PA 2JLCA 2ZJ5A 3CPSA 1TNZA 4EIWA 1ZK2A 1K6JA 3P2JA 3N75A 4BMSA 4L6AA 5H4GA 3NYRA 1HF8A 3HCWA 5HQ8A 4JFAA 5KCMA 1JQKA 3E23A 2AX4A 2YRWA 4ACAA 4LVOA 4IQ0A 2Q3MA 4DHEA 1B73A 1E9AA 4MTCA 3S1SA 1KAQA 4C1BA 2ZJ8A 2J3MA 2GF9A 2WKPA 3A4LA 4J1NA 4P84A 4XE5A 1D1QA 4YYEA 5K0SA 1C9EA 6PFKA 3PE4A 4KYIB 3ZJVA 1U5BB 3SBEA 3MXTA 3CH6A 3M7IA 4Q3OA 4XXHA 3WX0A 5E95A 4MUJA 3LK7A 1LY1A 4YO8A 4C29A 3GEGA 5JS6A 4D9NA 3MWGA 1P0PA 4EA7A 4JI3B 1E8DA 2ZJZA 5JAOA 1UZNA 4XFDA 2B83A 3R3YA 1U3GA 3O1IC 4RV9A 2CMHA 4MMZB 2JBAA 5IT0A 3H2GA 3FHOA 3WNBA 1YRHA 1VE7A 1ZFNA 2I1QA 1JNXX 1ADJA 2ZBGA 1N0VC 2SNIE 4K9PA 5JBQA 2DR0A 3ER8A 2FZVA 3G82C 4WIAA 4X95A 5ALOA 2IHBA 4XE0A 3FOZA 4J2OA 1ZHFA 4MW2A 3MTQA 5AI9A 4M0KA 3LTEA 5B37A 5FX2A 4DSOA 3L1KA 1WO8A 1J8QA 1TT7A 2NGRA 3ROKA 4GICA 4E15A 4DDVA 2W37A 4BKPA 5LDDC 3DTTA 2D1YA 3D8TA 2YX1A 3OIUA 4CF5A 3VHRA 4BNNA 3ESAA 3D8BA 3H9UA 2QZ4A 4LJKA 4ZV9A 1RYMA 3OTHA 4YJ2B 4OOEA 1SULA 3W06A 3W2TA 1EK1A 4JGBA 3WADA 4S1TA 4RXUA 4AZ0A 4YAEA 4L22A 3V2IA 3K6SB 2FUNB 2L0TB 1DVPA 2DHCA 3KHSA 2BCEA 3EUFA 4RL6A 5JXGA 3GJQA 4BNIA 3ESKA 4QDXA 2XUJA 3NJ8A 1SC4A 1M2KA 3OAAA 1VMKA 1V1MB 3PHGA 3UJAA 4CG0A 3ZCUA 1FZTA 1YT5A 2JFGA 4Z53A 3WLOA 1PR1A 2B61A 1VHLA 1KC3A 1RXIA 1XA4A 3BBPA 3R24A 2GEVA 2LR0A 3O48A 5EIBE 2VHJA 1Z6TA 1HH8A 1II0A 4REMA 3QNMA 3PGLA 4KCGA 1GUYA 1XDDA 1X39A 5CHEA 4ILKA 2V54A 1JAZA 4YUAA 4AKTA 4W9NA 3SN6A 2PRIA 4ASUD 3SQMA 4ESHA 2ALJA 3ASVA 3MJFA 1I7LA 4B7AA 3I62A 2BTDA 4XEIG 2B78A 3E58A 2MIIA 5DLYA 4DL9A 1VJ1A 3HKBA 3FP3A 1QMOE 1G8AA 3CLSC 3EEBA 3TSOA 4LF4B 1AQLA 1NVEA 1R5JA 1TEVA 2PLAA 2VT3A 4Q34A 3SJUA 1GL3A 1SZCA 2W6JA 2CN1A 4E30A 1SQMA 1FSFA 1S01A 3O9VA 4HAWA 3H5LA 1RIFA 1MVNA 1UADA 1QX3A 2DHEA 2W6JD 3HEBA 1P9OA 5HQTA 4L7QA 3TG8A 3QFHA 3QFRA 3PNLA 1KI6A 1XO1A 2NP7A 5GGYA 3BG5A 4JBHA 2HSGA 1F38A 3E6AA 4M7OA 1T34A 3V34A 5F98A 4TYWA 2IYRA 4ETIA 3PUWA 1JG6A 5TT1A 2Z30A 4JQCA 4ER3A 1I2AA 1E89A 1X70A 3B95A 4HORA 1BWSA 4JKIA 4M46A 1NU8A 3Q87B 5JVDF 2FSIA 3DFZA 3SYMA 1QBGA 3O4VA 3UJDA 1U7DA 1FXSA 3R9KA 4UBNA 4YNDA 1N54A 1KYTA 1CZUA 2PLNA 5EESA 2WIKA 1URPA 2I65A 2IXGA 3O4HA 4HAXA 1AU9A 3CUEF 2EG5A 3O8LA 4QNMA 5D3ZA 4DNFA 4JIGA 2WJGA 5BOSA 3BH6A 3Q8KA 1ZIDA 2XGOA 4WUYA 2R6HA 3PENA 3QI2A 4DDWA 1YE3A 4X84A 3CUYA 1Y9JA 3KTAA 5IC6A 5BN5B 1Z08A 1BKSB 1PLJA 1XEFA 2PL9A 5ALNA 1ECLA 3BWYA 2I3BA 3WYEA 2HK8A 4KZ0A 1MAWA 5ALFA 1Y6JA 5J4YA 1KH2A 1L1EA 5KHAA 3T52A 4C43A 1G38A 1YRAA 4ILGA 3AETA 4OLBA 4IIYA 1DC2A 3ZX4A 3JQ1A 1H94A 2Z1NA 4KT6B 2IOLA 1M6YA 4HGZA 1MH9A 2WWXA 3EOAI 2D3WA 4PZAA 2XRMA 4UWLA 3RGGA 3RNLA 4LRSB 3KPJA 1GZ4A 1RW4A 2V8OA 3BORA 4LBYA 1A95A 3ZW8A 4LVCA 2P0AA 1T2FA 4CM5A 4LJRA 3D8SA 3FZYA 3LS2A 1GCOA 4JHJA 1TXGA 4BIIA 1GARA 1MDFA 3AERB 4PYRA 3RYFB 3EGEA 3LKVA 4XKCA 2NC9A 2QVLA 2VNKA 2I7TA 3NOVA 3PC3A 5EPUA 3TTVA 5F3WB 2GERA 1I3KA 4DQLA 1P4AA 2A9VA 3R8CA 4DRZA 4ALNA 5A5DA 2O3SA 5G0VA 2ZSFA 1GP2A 5DRYA 1ND6A 2VEOA 2UZ4A 3R5FA 1VKJA 5HZGA 1VDYA 1C7EA 4BFYA 1Z0DA 1NOKA 2XKAA 3WRXC 2IOFA 3FUDA 1FC0A 5IWCA 2G8NA 1Z7EA 4DX6D 3FSRA 1RI3A 1QGZA 2HNKA 1NFRA 3Q7RA 4EECA 5TEWA 3R76A 2P9BA 3SG0A 2C96A 4OYYA 4Z9BA 5AWFC 5C81A 2IS6A 2X4DA 5ARFA 2IX3A 3H42B 1PR0A 1EK2A 2AVDA 4RCVA 3PFNA 3NC0C 4MR9B 1IJEA 2V7XA 5GVRA 4D8WA 3UKOA 3AKYA 4L78A 3I05A 4I3FA 4Y30A 2CDBA 2O8BB 2FFHA 4RZ2A 1TUEA 1UPCA 2I5PO 3RE1A 3AR8A 4EKGA 4QBHA 1X7DA 2NADA 3BB4A 2HIHA 2RK3A 2NN3C 4WV3A 4BB9A 4UOZA 3IPRA 1NE2A 4ZD6A 3RO7A 4LCBA 1OI4A 2BN4A 2IDMA 3PL5A 1Z0ZA 1JXAA 1JDNA 3DEKA 1N3YA 5ENRD 3HJNA 1K6XA 2ZATA 4B4DA 3WDMA 2DXIA 4HNRA 4DDKA 3AFHA 4CFZA 1LRJA 3W5VA 4B2YA 2Y9MB 1XMPA 3Q3VA 1F3OA 1TQ6A 4PYIA 3VJMA 4IIJF 1F8XA 2GGSA 1Q44A 3LUHA 2WF7A 3DDNA 4GHWA 4QGBA 4EYEA 1L5OA 1RWOA 2CUZA 2PGJA 2Z3WA 2ZUSA 1YZ3A 2H2HA 4RGYA 4HY3A 4E12A 1GNVA 1KJQA 1LRLA 1TDJA 3F96A 1T9KA 5D87A 5HILA 2IZ5A 5IJXA 5AVZA 2Z58A 5LXTB 2ONZA 4US1R 3KSLA 3GVHA 1MX2A 5M29A 3TPFA 5H16A 3MJWA 4DCGA 2AXUA 1ZMTA 2C5BA 3WLQA 4LRUA 3WK7A 3TTSA 2TMYA 3NNNA 4NS1A 4P4NA 5CK5A 3AUSA 1C3OB 1QHXA 4GMGA 2IZ7A 1PHRA 1VMIA 2EJTA 3A04A 3IMKA 3PSAA 3M3DA 1P29A 1I6KA 1KARA 2H4ZA 4NJOA 2NSLA 1SURA 3EIJA 4GYWA 2WMOA 1KHHA 4QJ3A 3PK0A 2BKGA 1J8FA 1Q83A 3EUWA 3MINB 3ED5A 3RF7A 1SD1A 4CBVA 4CT5A 3ZW7A 1XXHA 1R66A 2JHAA 5DM0A 1E7WA 4AI6A 2AZXA 1R6UA 2VK4A 4JDPA 5KYXB 5EYLA 3AOEC 3JWIA 4KSBA 4CKEA 5HUJA 5KEIA 1KXJA 3I2FA 7YASA 1XAIA 2G09A 3M5WA 3OFVA 5BUQA 1Z7YA 1SCKA 2LDBA 4MV1A 1C4XA 4MKZA 3RT9A 3VR2D 2EBHX 2ZS9A 3DD1A 4B6EA 5ITZF 3R5XA 3CHRA 2NV6A 1R0LA 3CC8A 1WSWA 3PNQA 1I7DA 3LUGA 3TWRA 1J07A 2H7XA 1CUGA 2YWJA 1SQ0A 4G5RA 4INOA 5E4TA 4LFCB 1SC6A 4NDNE 2IP4A 2WSIA 4C2TA 4TTQA 1XXLA 3Q7AA 2OSVA 2KHZA 4KJXA 3ZWDA 2A9RA 4U00A 1EJ0A 4QHYA 2J0VA 2M6SA 4NBKA 1TN6A 3NIFB 2C7BA 4G1FA 4OAPA 3ZWMA 1JNYA 4DLPA 2AG5A 2MSCB 5BP7A 4P2BA 3E70C 5C2YA 4FFSA 2J08A 3TJPA 1P7CA 4IXWA 4CTMA 1F0KA 5KNDD 3HN6A 3T9KA 1RIIA 4CN8A 4BETA 3F8WA 2AIRA 2IOQA 4NACA 4MIYA 2PSJA 4D6XA 1Y0BA 2HA5A 1U28C 2ZIZA 3BAZA 1IY2A 2OILA 4JJEA 3G2PA 2AMJA 5GM1A 2Q6TA 4WKPA 3ERCA 8GPBA 1KO5A 1WQ1R 3NDPA 1TCCA 4TZTA 3OFND 4I4TB 4X64B 2KYRA 4EITA 2BFCB 5ICCA 1PFKA 1XYVA 1Z29A 4CGVA 1T8RA 1C4WA 1JEOA 4Y2RA 2WYIA 1M1YA 3SWWA 1NJ5A 5AJHA 2IZOA 2PUGA 3KSMA 5HFAA 2AC7A 4GMKA 1BAPA 1PGOA 4QFCA 1OIXA 3F7NA 4U7PB 4V0QA 5JSZB 1WPRA 5C34B 2HXYA 4GGMX 3L22A 4I0WB 4XJVA 3MEKA 3NG1A 2C4WA 3G89A 1EE2A 3SX4A 1EG2A 3DF9A 3HQ4O 3ICPA 1M34B 3HFJA 2JFHA 2RE8A 1WXIA 5G05J 2PNNA 4PAQA 1A2OA 1E62A 1X8LA 1TTHA 4PPNA 3KYBA 1NQAO 3LP6A 1MO4A 4QHSA 5LQRA 4A3SA 1QLWA 3ILXA 1CQJB 3NYIA 4YCBA 3V80A 1PVOA 3GOHA 2KC7A 1JAXA 1M2WA 1AMNA 4CZ2D 3DO8A 2WUWE 4UBLA 5THQA 3THRA 4EB6A 1K6EA 4D57A 1GT91 4JXTA 4OP2A 4IYPA 4TUUA 1ZU2A 5EKQD 5AQ7A 1P75A 1QB8A 3ASFA 4QDOA 2C4KA 5IKPA 2ZW9A 3LYUA 3PQDA 3TOSA 5CFMA 2QMQA 1FP6A 2ZSEA 3NXKA 4CI9A 5JANA 1NI4B 3AUYA 3QB2A 2CCKA 1XZGA 3G6WA 5EMMA 3WKAA 1SAYA 1UKAA 1X92A 3LECA 3UJ9A 2EFCB 5F4ZA 2LTAA 4QTXA 2FPMA 3BG1B 1ZUHA 5FLYA 1JT2A 1Y4ZA 3ITWA 2V5UA 3ESYA 1TJ5A 5LXTF 4R6WA 5C8YA 3UWSA 4DANA 1XNFA 5JT1A 1NE7A 4G0OA 3M9LA 3VYVA 1K3ZD 2YN4A 2WXJA 1MO6A 1EVIA 4KFSA 3EZFA 1ATZA 1C1XB 1CP2A 4BKRA 1GR0A 3M5DA 3U9TA 2CFRA 3ZYQA 1KQ3A 1D3AA 1YC2A 1ZJ6A 2ZR8A 1CUBA 3ITKA 1NI3A 5AI4A 1OYYA 4N39A 1KNQA 3DEFA 3DV2A 3JQAB 3A1CA 1EDZA 3T9FA 3MQFA 2CXUA 2PO5A 1VYVA 2PM8A 5J9FA 1ISFA 4HDNA 4HRLA 4LGYA 2HWWA 5A9TA 1T36A 3UZUA 2LGJA 3TFWA 3BDAA 3NTUA 2B2NA 4JVSA 2A30A 2BFWA 1BU9A 2I55A 5G41A 2ZPTX 5MDHA 1N1GA 1F4PA 4CTNA 3C15C 5DTEA 4KFRA 1XZHA 4XCVA 4LXTA 2ZJ2A 1H93A 3Q85A 4IEIA 2Q46A 4HNAD 3EIFA 4X93A 1X8XA 5IBRA 3DLPX 4ATNA 4BB0A 3FKQA 1NSTA 4YR9A 3O2NA 3I9FA 3TB6A 5LOVB 3TQQA 5JEDA 3OFKA 2FJ0A 4MVJH 4P3OA 2X2PA 5D1HA 5EWJB 1XD2A 2IUYA 4J9VA 3N5KA 3MTJA 1XWWA 4YNBA 2IFUA 1ZDMA 2R68A 5TJHA 1A9ZA 1TM1E 1IVNA 2ZKLA 2VP0A 4X5OA 3EISA 5D0QD 5CGZA 4MDFA 3W8RA 3T35A 1NR7A 2RFAA 4FDMA 3LCUA 3D3MA 3P27A 1OX6A 4D3SA 1QQTA 3A6PC 5JQGF 2GXQA 4YP6A 4ZI5A 1NN1A 1RWBA 3OJCA 4GBGA 1QPZA 2AWNA 1MFPA 2JZNA 3B7UX 1UDAA 4NWIA 1MC5A 2UYQA 4A16A 2E9SA 3QDNA 2DPGA 2OUKA 3HDVA 3HJGA 4KVAA 3WHKA 5BQFA 5HG0A 2OZVA 2OB2A 4IL5A 2VPPA 3IELA 1Z4OA 4ZXFA 4A3TA 4KGZA 3G2QA 1JR2A 3EA0A 4TV8B 5JZVA 3N2KB 3ZV3A 1L4UA 1WM1A 4GZDA 2ZYSA 2GXSA 4OQZA 4BT8A 3MMZA 3JYQA 1ZUIA 4L0DA 2Q3DA 3L49A 4OLAA 2QLMA 4JL5A 2VKTA 3AOGA 1UK6A 4IUDS 3DSUA 3DE1X 3NS7A 4U39A 3KQUA 1HURA 5REQA 1RWVA 4BE4A 3W5AA 2BM0A 4P58A 4Q16A 5EEGA 5KVQA 5CCDA 2M6KA 1NF3A 1QFXA 3OH8A 4LXGA 2QLJA 3V2UA 3BMNB 4BVJA 4F86A 3U49A 1MXHA 1LTQA 3AS5A 2NTNA 3FX2A 4EHJA 4C5CA 4C2AA 3OLWA 2VJQA 1T3LA 4G1UC 5IANA 4BSZB 3I6IA 4O4JF 4BNTA 4K7JA 2P9JA 2CCJA 2WFLB 4RM3A 3GA0A 1BOFA 2P2SA 3QKUA 2QZSA 3L4BC 1C30A 2BI8A 3CRVA 3FYDA 3OE5A 3ORRA 1IHOA 1W4BA 1EBFA 2BMWA 4XEUA 4E88A 1U4OA 4CFYA 4EKEA 1F7UA 2XQFA 5FXMA 1OZFA 2ATCA 2HLDA 1VPDA 4UBJA 4Y7DA 4CFSA 2NXEA 2CHEA 2VR1A 4M1EA 2B9EA 1DJMA 3AG4E 2D3TA 5JYBA 4RTMA 3K3PA 4ZRNA 4ZO4A 2EILE 4S35A 4EZLA 1ZC3A 4RH3A 3OIFA 2DY0A 2ZI6A 3GNQA 1EWYA 3QTTA 3ZQJA 5C5IA 3G7SA 2GZHA 1ZN8A 1M73E 3BJIC 4UUNA 4ZAXA 5HFNA 2P4QA 3T94A 1XZCA 1XJ0A 2OXIA 5AK3A 4EO9A 2VGXB 3CA8A 4DM7A 1AHHA 3AVUA 1U3DA 2ZAMA 4RKYA 2ETCA 2QQFA 4DF3A 2JHGA 1O8CA 3TSCA 3M49A 1NVUQ 1RKXA 3WG7E 1QHIA 3K4HA 2JLWA 3KYCA 2Z6AA 2G9RA 3UXEA 1ZD4A 5JDIA 1BU5A 1VJCA 4H16A 2HK9A 5JCPA 1ZOPA 2OLKA 1FTYA 1NWHA 5EJ4A 3AY6A 2QN7A 4NCIA 1P9RA 3SEAA 3F7MA 3UMJA 2XUAA 3F5QA 5A05A 3OEHD 4P3PA 2BZ0A 2AN9A 3IQDB 2GN0A 2L17A 4EGSA 4ESOA 1OH5A 1CCWA 1NQOA 4YDHB 3GB9A 3VU1A 1Z37A 4FKZA 1RABA 3JQBC 5ED0A 4BP9A 3FLMA 2V7UA 3DMPA 3NO4A 1GR1A 2HBYA 2GCGA 3FCCA 1G63A 2QJFA 4LTNA 2AS0A 4M60A 4Q7EA 4DGSA 3WKBA 3NX4A 1V8PA 4MS4B 4IPTA 3RODA 3HA2A 1N2OA 3B1FA 2RI6A 3R3XA 4MV7A 2HMVA 3SHVA 3WAJA 4CXMA 4BGUA 2A7QA 1WZUA 1Y6GA 3HLTA 1NOIA 3DKRA 1FXUA 1AKYA 3JWGA 4J3NA 1OOEA 2WT8A 1BMFD 4XDHA 3A2KA 2QU7A 4L08A 4YACA 5I6DA 5TPZA 2A58A 3CUSA 4PICA 3I04A 3RUEA 4M0MA 3UV7A 4B3JA 3CEQA 2E37A 4BJHB 3CWZA 3CX7A 1FVFA 3AB3A 4OF4A 3UM0A 2FPOA 3FRJA 1LF8A 3ADOA 4G0WA 3MX3A 1E96A 4NBSA 5CK4A 3PXBA 4IIHA 1BVHA 1TMKA 4UD2A 3LQFA 4WFQA 1EVLA 4Y98A 5ICEA 2AC4A 4GWKA 2HJRA 4KXFB 4AJJA 1M6EX 2X0JA 2N3ZA 1UF9A 1P7WA 4FCVA 5E9AA 1E0DA 1WHTB 3OFJA 2WVHA 1P4JA 3E9MA 4TM7A 3AESB 4Q3NA 4WLVA 1N8SA 3D6HA 3UAYA 3CCFA 2AOXA 2RFMA 1A9YA 2IY9A 4J7XA 4IJUA 4Z5XA 5JPCA 1YS6A 2NUBA 2YN2A 4BGDA 4I1RA 4DCMA 2ZTHA 3ZGNA 2XOEA 3DONA 4PFJA 3WTCA 5FUBA 4CT4B 3MLBA 4EZBA 1KYVA 1FF9A 1D09A 2X1MA 4A8TA 5CW2A 3IMCA 4JT4A 1J20A 1KR2A 4X3PA 4YPFA 3D54D 2H8KA 5C46F 1RWWA 4H9GA 2JLZA 4YC7A 1Y3IA 3DWEX 3WGZA 1DZ3A 3C0KA 1US8B 5CUQA 1ELRA 2WJIA 2K2QB 1T3GA 2MYTA 4HOYA 2NSHA 2IPNA 4XA8A 3S7BA 4IJQA 4L8WB 4PBSA 5AUQA 5C5EA 1A5BB 1VRWA 4FYMA 3EA5A 4QU0A 2JGLA 3A6LA 2XVZA 3WQHA 2PE5A 1H69A 1AMOA 3ZDDA 5COBA 1Q5PA 3H5IA 5CYPA 4NMLA 5JRJA 5KC9A 2WJPA 5LCXA 1CR2A 4LMRA 3D4NA 3W6UA 2HWUA 4JLPA 5JE8A 2QOEA 3Q7FA 3PYMA 1H2UA 1XMJA 2A5YB 5FZRA 3EMBA 2C0CA 1L5GB 4CE6A 5JFOA 1N2XA 2YYZA 4RXMA 4OJKA 1JB1A 2ZROA 3FTYA 4DLUA 2BEJA 2XQGA 3ENVA 4R9RA 3RJMA 3ET5A 3E22A 4BO4A 5COAA 1NVAA 4Q4JB 1I33A 5CCMA 3SVTA 2Y0BA 4TMYA 3AFIA 4CM8A 3L16A 2E5LB 1L7VC 4C2BA 2YC2C 4G5YA 1ZKMA 2PD4A 3GG2A 2QVYX 4X6XA 1UJ2A 4QUJA 3HU2A 2C5HA 1SXJA 1QPBA 2NQ8A 3IIJA 2GCNA 3ANNA 3OCYA 2R03A 1G7CA 1LS1A 1U7PA 2PBRA 3TL5A 2YNMD 2Z09A 4FD2A 4MB6A 2GHTA 4F3TA 1WXDA 4IR7A 3Q11A 3UWDA 2QP3A 1BWPA 3CTPA 3CEJA 1W44A 1XVUA 2Y3IA 3WOVA 1Q0TA 4TLAA 5FTJA 3M4YA 1W88A 1Z0FA 1NZJA 3PG5A 2VBFA 2W2MA 1NF2A 3QIAA 5AK6A 5EY5B 4HZUB 5EN5D 1ESZA 4B4WA 2R6DA 3GL9A 4A6PA 2HU7A 1E60A 2ZRLA 1EJ6A 1F51E 2JGJA 3EXFA 2N75A 4L02A 3DKIA 3RVPA 1H8HD 2P9HA 2ST1A 1PK9A 4CLXA 1IKND 2VOJA 5IBPA 4AOFA 3KYDA 2H6GA 1XCJA 3NUZA 4KGXA 4LNUA 1RSZA 4M22A 5EZ6B 4ZOLF 1NRIA 5GGXA 3UK0A 1LX6A 1TCBA 3T8KA 1LC0A 3N8HA 4WKOA 5MN6A 1NV9A 2GK6A 1GGKA 4MI9A 2GZ2A 4TKLA 1RLOA 2WYWA 4DM3A 4ZQIA 1E5QA 1DELA 2YASA 3N2ZB 2CVHA 2MYPA 2Y1FA 3BIWA 3DZGA 2NZ2A 3FCYA 2WQZA 3ZD7A 3EDTB 2B92A 3HUFA 2PS0A 2J7PD 3LDFA 3QVXA 4GAEA 4D4HA 3KAJA 1JR3A 4FE7A 2AEEA 4OQQA 1LD3A 1CVRA 3UMMA 5A3JA 5IHPA 2YY6A 1DLIA 3AS4A 4C89A 2PXAA 2QGFA 1RZ4A 5KYGA 5IFLA 1VLJA 1RYYA 1JLKA 1Z33A 1YR7A 3GROA 3IP3A 3PNYA 4C20A 3FBWA 5BV7A 3IP8A 2Z08A 3BH7A 3B12A 5EIFA 1ZITA 3OQMA 2C2ZA 3TBHA 5I9SA 1XZIA 1D9SA 4HZUA 4LRTB 2FW0A 1QOZA 3FSEA 3U1TA 3U9LA 5FDFA 2P3LA 4II7A 4EJSB 4FFRA 1ZSVA 1X9HA 4IDOA 5TF0A 1WAMA 2I9PA 1RQPA 2WI8A 4FFOA 3U3RA 2P8JA 3ZDEA 2GDJA 4UM7A 1N4SA 2JFOA 1Y6QA 1R15A 3D64A 2BE9A 2ZRHA 4HDCA 5F21A 3COWA 2DYSE 4OLFA 4F1JA 2C7QA 1ZI9A 4DKJA 2GRAA 2IUUA 2GM3A 1QHFA 2HYIC 4IHJA 3ZGQA 5HTKA 4YCMA 4Y0NA 3K9BA 2BM9A 1Q12A 1XXHB 2WK1A 1L7QA 3IHVA 1W25A 2J0UA 2WD9A 3HR8A 4M7WA 4YRLA 5DXAA 5FBWB 4IDNA 2EBFX 1YUBA 5B7QA 2NO5A 3MWDA 2QPOA 1F06A 2QG9A 4G01B 4G4SP 3LY7A 4BTLA 1Y6IA 1QR2A 1W35A 4QKQA 4U7GA 5GJVC 3UXMA 1SUSA 4HWTA 4MA0A 5J59A 1A98A 4P4LA 4EFMA 3PEUA 1GKYA 5T8KC 5HQJA 3ZCRA 2CVQA 3P97A 1KLXA 4B6FA 2X38A 2D4HA 2ZBVA 3N2GB 2VRCA 1T1JA 4UUOA 4TV3A 4V0LA 4BWVA 3IT2A 3RK1A 5CH5A 2HDOA 2IXAA 3WAGA 4XDGA 1KT1A 1ZM9A 1XG5A 2PXHA 1EINA 1HKHA 2PQNA 2GPAA 3PC8C 4OFXA 4X1IA 2WY2D 2NZ8A 3B82A 3OTIA 3AQ4A 2E4WA 1W59A 3AR6A 1V5WA 2CLLB 4P33A 2INGX 1O97C 3TXMA 5LBIA 4Y18A 1JHYA 3FUNA 2NU7B 4JASB 3DBVO 1SMKA 2BCJQ 2GYWA 1G5RA 1BXZA 2RGXA 3KXKA 4I9GA 3I8SA 4M86A 4DXHA 3CX3A 1YR6A 3AEQB 3L1JA 1ODJA 5ALIA 1GG2A 4KHZA 5FPPA 5TSDA 2I78A 2WM3A 2YR0A 3OIDA 5AESA 3SQVA 4F4CA 3NP9A 3MTBA 5FHRA 4IQ4A 3UYLA 4LF7B 2F17A 4P6VF 1J33A 5IVDA 1RTTA 1L7PA 3JASA 2PSSA 2YWBA 1AXGA 1HZ4A 2BGTA 3ILHA 5LC1A 3N0XA 4PGHA 2O9JA 3W0LB 5J1TB 4FCCA 2GTPA 1UJCA 1ZK3A 4G5QA 1D8DA 5J2UF 3HWSA 4F92B 3PNPA 5A7GA 2C83A 3DT6A 3LPLA 3EXG1 4Q1BA 4F38A 4QPPA 1ZVJA 2QTWB 2NOAA 2B4KA 5IK2A 4HNVA 1TN7A 1F12A 1J5XA 4CMGA 4UJ5A 3HY3A 1I7SB 1XKTA 3CNEA 3VKFA 3VPSA 2FWNA 4BV9A 1X1CA 3JVUA 4KREA 4HLEA 3DDHA 4XR9A 4BRUA 1W4ZA 4YDYA 1GZ6A 1RCFA 5AR1A 1O0BA 3PEVB 4F4DA 1XLWA 4HPJB 1NTRA 4G5SA 3UJHA 4X1YA 4DA0A 4S04A 2KM1A 2DWQA 1FQWA 4C0BA 4N4AA 4MI6A 4A8JC 3WMGA 3L6OO 1DC7A 4PZPA 3B6MA 1JQDA 2QRZA 1NVDA 3CVOA 3SY2A 3NF1A 4AO6A 3VGPA 2Z98A 5EGNA 4QXPA 1E3IA 4IQFA 4WECA 3AHJA 5DE3A 4Q7LA 4PIVA 3RS9A 5KHLB 5TLSA 2WICA 3SDZA 5CAEA 2FK7A 3IAM6 1OYVA 3K31A 2GARA 1TI7A 4X3OA 1T8YA 3AHHA 5MN4A 4DIDA 2IC5A 2ZAIA 1HK7A 1ZGCA 5DBFA 1NBIA 3OOJA 5FO0A 1GPH1 4HQRA 5JAZA 4EEXA 3T5TA 2FHPA 2HA3A 2CJWA 1KS2A 4C7BA 4B2LA 1NT2A 3LCJA 2LSUA 3MAJA 2BZSA 5ENTD 1ENPA 2D0IA 4ZJUA 2FW8A 2BGIA 3MXOA 2HO1A 1NJ6A 3B1WA 4CV1A 4PLWA 3WWEA 2X5GA 2HPHA 4F84A 2NQ2C 5CFZA 1MUUA 2PFKA 4AMVA 3NB2A 5HIKA 4LNGA 2Q1XA 1F8UA 1VYUA 3AVPA 2IYLD 2QTLA 4PZYA 3I58A 1BN6A 4GPKA 2XUOA 4LOHA 4I6EA 2C20A 5J2TF 1GN8A 4DQUA 1HQYE 2I66A 1UJ4A 2FX5A 3CQ9A 3PNSA 4UBMA 4Y6RA 3HZZA 5EQJB 1W0KD 1W36C 4HTFB 4E5NA 5A7FA 3GEIA 2YHAA 1XF1A 2E21A 2WE8A 1LZKA 4ZHBA 3ISVA 3QPCA 1T2CA 4NZOA 2HGZA 3VKUA 4C4YA 1UDXA 1JHVA 2CFSA 1RRGA 3TLZA 1CYDA 4CRWA 3WGOA 1HDCA 2RAUA 1RYBA 3DWFA 4BDSA 4JEUA 3OEWA 2KZTA 1EX1A 2CSUA 4LRXA 3VHXA 4MUBA 1G5HA 2HRDA 5F3DA 5F2OA 1KI3A 1WY7A 3LT5A 2RHJA 3DVAA 1IUKA 4LCEA 4M0UA 1H0AA 1BXRB 4QPDA 5AAOA 3NRCA 1WX1A 2XD9A 5FHQA 1Z5SC 4HDQB 3P96A 1KI6B 2KS6A 1T5IA 1W9MA 1R0ZA 4KUEA 2C5SA 4FKMA 3UWMA 1JUQA 1OW3B 3O74A 4X90A 2AEJA 2RHHA 3QMPA 2A3NA 5JMPA 3UGTA 2HSEA 1QP8A 2NO1A 2I3AA 2Q0HA 3N2YA 1KOJA 2H5EA 1QDLB 3KBOA 5AI5A 4TRQA 2C9BA 5JV5A 3JQ8B 1XZDA 4ZV7A 4DQVA 2V6BA 4Q96A 1Q6YA 4FJZA 1NKSA 1KPHA 3IUPA 4LZLA 4LYFA 5A3VA 2PPVA 5I4KA 4FLBA 4ILIA 4Q82A 3WSVA 2AZ4A 2E1RA 4GSLA 2O2HA 4DRYA 3C7AA 2XE6A 4R40A 4GNRA 2YCBA 5FTNA 3WRYA 1ST3A 3DE6X 4G0XA 3NT2A 4UU7A 3S2UA 3T3MB 1CJCA 5FRDA 1JXQA 3GJZA 3H04A 3K1ZA 4QUAA 1C5KA 1DIAA 4EY6A 2DY1A 4AP5A 1K1EA 1R8QA 1ZONA 3DBLA 4DLRA 4KYUA 1B6GA 3L9XA 3CZPA 1CVLA 2WYUA 4RYDA 3B8EA 3JWHA 1VHJA 3BJZA 2O0HA 4IZOA 4PV7A 2UYCA 2VDMB 1PFVA 3B6IA 3R5TA 1R8XA 1X14A 3H6KA 4LWOA 4P36A 3RRMA 3ZIAA 1PVVA 4ZO8A 3QJYA 3PXGA 2JJMA 2EKLA 3WYAA 4Z2YA 4EO4A 2OBNA 1GZHB 1T5LA 3I23A 3IQHX 2QTFA 3X1DA 1D6MA 3S8MA 1QZUA 1XKXA 3LUPA 1DOHA 3TL3A 1UPAA 4ZI7F 3Q40A 5FV4A 2BGGA 1PZGA 4J29A 2CXHA 2XJ9A 5L3QA 4GX1A 4KR0A 4L6IA 1H2VC 3Q6MA 2UUBB 2AWIA 1G42A 2G6TA 3R40A 2G06A 4M8KA 1RQGA 2P7IA 2JGFA 2PKRA 2IV7A 1XD2B 1J25A 1A96A 4D79A 1Z6YA 4O8CA 4D9KA 1U6KA 1Z0AA 1FNBA 2J49A 1ULTA 2H4XA 2XDQA 2JC3A 2YXEA 3LQRA 5ESRA 3LBIA 4YX9A 1SBZA 3AF6A 2BMJA 1J0EA 3MGBA 1RLIA 2CF6A 4YCDA 4ZQEA 3IBTA 3TGPA 3RJVA 1G3RA 5G0WA 3VO1A 2F64A 3IQGX 1NMYA 5DNUA 1ISIA 3TLMA 2F37A 2OXEA 1U2RA 4NPCA 1UWVA 3OQOA 4QJ4A 1NVBA 1XDSA 2W43A 1GCIA 3NHFA 4D0SA 4QGFA 3W9GA 4DG9A 3W9FA 3PREA 2PZLA 1ZL2A 2Y27A 2B8WA 3DVRX 4AXBA 3ZIUA 2O2JA 2Z4RA 1KBOA 3P2YA 1VDMA 3W7VA 1T3ZA 5AO9A 4UM9D 1GRQA 1V11B 3O8NA 4ZDKA 1JZTA 1W73A 2EL7A 4P34A 4YEDA 4KKXB 2ZIRA 2VPWA 4WDQA 2FG6C 5DV9A 2Z8ZA 2K6GA 3DXYA 5AQEA 3U5TA 1SU8A 3CV0A 3HCFA 3Q72A 4IGAA 2OHOA 4UHKA 4PNEA 7MHTA 4GPBA 1B2LA 1IHGA 2J4CA 2QL6A 2NVUB 1I1QB 4HRMB 3M6LA 5A0FA 4HLUC 4QT4A 5AK0A 3LNCA 3QSYA 1AS2A 1ZXLA 3U3ZA 4MZDA 4D25A 2IZZA 3HY4A 1A2QA 3CSUA 3U9SA 1UBNA 3PITA 4BMDA 4PO8A 1ZVVA 1Z07A 3AQIA 4RQTA 4W1PA 4B9AA 4WWOA 1BH6A 1YA6A 2D00A 1FLDA 3B3FA 5DGTA 4NAVA 4XIJA 5EMLA 3IJ5A 2FJAB 4Q1DA 3H1FA 5AJWA 4DJTA 1DX4A 2AFIE 2WA2A 2FCAA 3DFUA 1L5NA 1JQ3A 1OFIA 2FZ4A 2Q3LA 3EJ6A 4JR0A 1AF7A 4OM7A 2C3UA 5E3HA 3RJ5A 1IN1A 2I7VA 2V4ZA 4UZFA 1NT4A 1K9VF 1YZKA 3CSSA 4N5IX 2UVPB 4PXAA 1QQBA 2O23A 5ECDA 5LIRA 1EFPA 3H0KA 1E4OA 4B3SB 5TJ9A 3KDPA 1R37A 3EGXA 1SB9A 4MUFA 4P7FA 4WAUA 2UXCB 2MJLA 3MSXA 4QXRA 3SS9X 1TCUA 4JWKA 4DLXA 2TYSB 2BFFB 5LU9A 4ZAYA 3X1JA 1PK7A 4KVMA 2AE1A 3GJ7A 1WVIA 3SF0A 2QZZA 2IYTA 3GLGA 1GPBA 2DM6A 1SM4A 3B89A 1MRNA 3FHJA 1EVYA 2LSVA 4L9SA 3M82A 3NGMA 4PZ9A 5A3SA 3PA6A 5F33A 3WK6A 4CL3A 1M66A 4YP9A 5JSZA 4B6SA 1U0RA 1M0EA 1QX4A 3LHFA 1HLPA 4UMFA 3RQSA 4BBPA 3AJIA 3T1VA 1SUIA 2ZI9A 2WWWA 4GH5A 5K3BA 3VYWA 2HCBA 1H3NA 4GPZA 1ZP6A 1P2VA 1SCAA 3CZ5A 2IGTA 4P92A 2R84A 2PN1A 2IO3C 2CNBA 1UT5A 2CKMA 1WPGA 2Q2OA 1KOGA 4O4IB 1I6LA 3LOPA 2V45A 1STOA 3PD7A 2ZBDA 5EX0A 1YJAA 5DTIA 4LCJA 2KBFA 5A23A 1HE5A 2CCGA 1DI0A 3FDZB 3ZC3A 3W5CA 3EYAA 3WNDA 1X74A 2IYVA 4ZYUA 1GSAA 3IE0A 3WRXA 2C7PA 2A1IA 3ADKA 3LKBA 4J1QA 4HMQA 4U7JA 4F3YA 3V46A 3CGGA 5KMGA 4OHWA 1P3DA 3RBXA 4G1TA 4ZMSA 2PLWA 3AU9A 5B7NA 1SCIA 1H1LA 4QYMA 5I5GA 2IH2A 1K92A 3Q0IA 5C52B 2QMUA 5TVKA 1P1JA 1CBUA 5AXDA 1S70B 5JJIA 3MGCA 1Z26A 3IOYA 4MVJG 2B35A 1NUSA 1RC0A 4I1UA 3TL2A 1KZ4A 3FZEA 2HV9A 3SE0A 3UXHA 5JFGA 2RGNA 1L6IA 3F5MA 4XLLA 3GQVA 4DMUB 1S4QA 3GJYA 5ALXA 1KHTA 3V4RA 3HKDA 2VYNA 2FR1A 2IU4A 2VSQA 2JG3A 3FSGA 1ML4A 2FEXA 3DW1X 3GP3A 3PV0A 4ZQHA 5DYYA 3SIXA 3OMXA 3FDZA 3OZUA 2XNCA 2AOTB 4Z2AA 4I17A 3C3AA 1DNPA 3FDXA 3H5WA 3I2KA 2DJ5A 1HG2A 1K3FA 4HBGA 4RVDA 3WGIA 4LWZA 3DCNA 2G9UA 3F7OA 5BY2A 2F8TA 2PFGA 3F6QA 2J3QA 4JVLA 3ZJYA 4ER7A 1PFWA 4FPXA 5CEEA 3CEHA 4TV9F 5DNCA 3HPRA 3X1MA 1OMOA 4MCHA 2OEWA 4AJ1A 4KG7A 1PT5A 2PA0A 3AMVA 2BAGA 3OZDA 4FD3A 3RANA 2Q99A 3H6GA 1O1RA 5IM5A 3VV3A 2YYAA 4YJDA 2UYHA 3RKUA 3WRVA 5GTDA 2Z2IA 4X44A 3NB0A 4S1OA 2AB0A 2JAXA 1K8QA 4P5PA 5EXXA 4LRYA