4N3CA

Crystal structure of human o-glcnac transferase bound to a peptide from hcf-1 pro-repeat2(1-26) and udp-glcnac
Total Genus 279
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
279
sequence length
716
structure length
697
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HCF-1 is cleaved in the active site of O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/substrate
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 279
structure length 697
sequence length 716
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3cA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3cA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4n3cA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4n3cA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n3cA03
4AY5A 2GPBA 4AMGA 5D0QD 4U0SA 1NOJA 4I9CA 2C4MA 5G04C 2GJ4A 7GPBA 4WNDA 1NZFA 2IW1A 5G04J 1JG7A 3SYMA 1IHGA 3Q49B 4UI9K 5BNWA 4BTBA 3MT9A 3ZCTA 2BGUA 2QFCA 2F3SA 4ME2A 2X6QA 2XCBA 5A6CA 3PDNA 2BGTA 2Q6VA 4X6LA 1C8KA 2JLBA 5DU2A 3RT1A 2IEGA 4KXKB 5IKPA 3RU0A 3MT8A 3RJVA 5JJ6A 5M72A 1C8LA 1NOKA 1YA6A 3T3DA 4A1SA 4GZ5A 2Y4TA 3KS2A 4BFCA 2FO7A 4RELA 2PRJA 3S0JA 1RRVA 3ASGA 3H4IA 3CX4A 1GPBA 3S7DA 3TG4A 2LSUA 2PYDA 1ZBPA 3CKCA 2UY1B 3AS4A 3MV3B 2F9FA 3OKAA 1HH8A 2G9VA 3DZCA 1WV1A 3T3EA 5JJ7A 2BISA 8GPBA 3BEEA 3BDAA 2Q7FA 2R68A 1JG6A 4FZRA 4GPBA 4AM9A 4KQ2A 4F97A 3MS7A 1O6CA 2QRHA 3OTHA 2PYIA 3CVQA 1YA0A 3ZCPA 2BFWA 1NVKA 3ZFWA 4N3AA 5TVGA 1NZDA 4G24A 5DIZA 4LEIA 3WXXA 3URZA 1JEJA 4KQMA 6GPBA 3KD7A 4RIIA 3GYZA 2G9RA 4GCOA 3C4QA 4UQZA 5FT9A 1LWOA 3CEHA 1HXIA 3MTDA 4U0ZA 2XCCA 3LY9A 2IEIA 1YGPA 4WNFA 4X7RA 1GPYA 3BCSA 1ZU2A 2PRIA 2H1HA 1GGNA 3BD6A 4RBNA 3GZ1A 2NC9A 1XL0A 1Z6QA 4B94A 3DD1A 5D0OD 5A7DB 1P4GA 3ZCSA 2FF4A 3TG5A 2QN9A 3ZCRA 1NA3A 3MRXA 4GA1A 2GPAA 1RZVA 3ZPJA 4I17A 2X0EA 3TAXA 5KJMA 4EQFA 3FWVA 3L01A 2QN2A 5C1DA 3ZHEB 4Z5XA 4J8EA 4G25A 1WW2A 3ASHA 4NESA 3MS4A 2GEKA 3RKVA 3E3LA 1IXYA 4BTAA 2XGOA 3ASFA 2R60A 3HYMB 3QOUA 4HWGA 2C1ZA 5FZQA 3E3NA 3MEKA 3VDMA 1KTIA 3FFLA 3EBPA 5JTTA 2XPIA 4U07A 3OTGA 3OT5A 3Q4AB 2BUGA 3N71A 2FBNA 4F9FA 3CK9A 3SZ7A 4AMBA 4EL5A 5CHEE 2GM9A 1AXRA 2F3QA 4N39A 3CEQA 2XCIA 5CCLA 4CGWA 5D00A 4GA2A 2QLNA 5LCWJ 3NCHA 1ELRA 4YUAA 3CUTA 4NRHB 2F3PA 4WHMA 2JJMA 3NP9A 1XL1A 3CEJA 1KT1A 4I1AA 3RHZA 2VSYA 4J8FA 3MA5A 1JIXA 4AY6A 4N2SA 1XKXA 3AS5A 3G2JA 4GZ3A 3QHPA 2Y4UA 3DDSA 2GT1A 1P29A 2PQRA 2LNIA 4UI9C 2AW3A 2VGXB 4RIEA 3D0RA 4BQFA 5BW8C 2O6LA 3TSAA 4RG6A 4UQYA 3BCUA 2L6JA 3RSCA 2QZSA 2QLLA 2KATA 2VGYA 1NA0A 3DDWA 2XGMA 2C0LA 5TMBA 4WNEA 3NAZA 3S7BA 3BD7A 3OTIA 2IUYA 3CKBA 4XIFA 3MT7A 2G9QA 2KS6A 4HOTA 2ECPA 3L7DA 1HZ4A 3FROA 3E4BA 3S27A 2PL2A 1PC2A 2FETA 1NOIA 4M60A 3CUVA 3TGOA 3NP7A 3G2IA 2VCEA 1L5VA 1WUYA 1UQTA 5D01A 3T7DA 2E2EA 3O48A 4BQEA 2YHCA 1WV0A 3R9AB 4YNDA 3COPA 1C3JA 4MICA 3LY8A 2ATIA 3VUEA 3CUUA 2IV7A 1EXVA 1NZNA 5KJLA 4U0UA 2DBAA 4REMA 2XA2A 1SXQA 3CV3A 5HXAA 2VSNA 4GYOA 4BWRA 4ABNA 4J8DA 3CEMA 4M83A 3S2UA 2C2LA 4YVOA 3C48A 4YVQC 4XI0A 3S28A 1M5RA 2PQ6A 1Z62A 4N9WA 5ARFA 2VQ2A 3Q3EA 1Y6FA 4JA9A 2QRPA 3CUWA 4O6FA 1Y8ZA 4MI6A 2I6HA 3CV0A 4GCNA 2FEZA 1JIVA 1Z6PA 5G05J 1EM6A 3QWPA 1L7XA 5G05C 4MI9A 4MHOA 5BT1A 5ENZA 4EKYA 3UPVA 3E3OA 2XA9A 3GUHA 4LDPA 4NEQA 1V4VA 4JL0A 3MBOA 3OXGA 3ZCQA 3OY7A 2GW1A 3HBJA 2ASVA 2R66A 2QRQA 2GEJA 1UQUA 2X0DA 1W3BA 4NQ0A 1TJCA 2P6PA 2XGSA 3MSCA 3MTBA 3QWVA 4X7PA 4RIFA 4APOA 3K9IA 5GPBA 3JYSA 2R4UA 5AYWD 2XEVA 1P5QA 4X7MA 4I2WA 2LSVA 1P2DA 4BT9A 4I9EA 1WM5A 1HLFA 2C1XA 3BEOA 3CVPA 2PQNA 4Y6CA 1B4DA 5EX0A 1IIRA 3HBMA 2FFRA 3L7BA 3WC4A 3GZ2A 3O3CA 4U04A 1P4JA 2V5FA 2AZDA 2H1FA 4WADA 3ZCUA 1E4OA 4N3CA 3WADA 3C4VA 3LCAA 1A8IA 2IF4A 3BCRA 3H4TA 4N2QA 1Z8DA 4N5CA 2YQ8A 5JTUA 1Y8MA 3LPZA 4RG9A 1A17A 4F96A 3VUFA 1QZ2A 1Y6GA 3D1JA 4HOSA 3IA7A 3UUXA 4W9RA 2HYZA 3S7JA 3Q3IA 4GYYA 1K08A 1ELWA 2R4TA 1NLMA 4H7XA 1AHPA 5FZSA 1XV5A 4QLBA 3OKPA 2HR2A 1XC7A 1FTYA 2C9ZA 5FTPA 2AVPA 3CVNA 2QNBA 1KLXA 3Q3HA 3ZN3A 3NB0A 3UYKA 3CK8A 3SYRA 3T5TA 5ARGA 3G2LA 4HORA 3T3IA 3VDNB 5LCWC 3S29A 4WUYA 5TMDA 2PZIA 4G23A 2XA1A 4XI9A 3PE4A 2QN3A 2VGXA 3LY7A 2VYIA 2MHKA 4WACA 2XMPA 3WAGA 4HOQA 4YI3A 4JA7A 5DBKA 2YJNA 3QDNA 1BX3A 2FF5A 4GZ6A 4PQGA 5HQ8A 1PN3A 1FS4A 1GG8A 4G1TA 1UZUA 2WPVA 2KCKA 3U4TA 3QWWA 3RO2A 1E1YA 4IN3B 4HLNA 1OUVA 3VTXA 2AMVA 3Q47B 4G26A 4UQXA 3IEGA 5EX3A 3NC4A 4F3VA 1QKJA 3RIBA 2JZCA 4G2VA 4Y6WA 1P4HA 4M7PA 4CTOA 4EKEA 4FKZA 1XOIA 2G9UA 2HO1A 3IAAA 3QKYA 4J0UA 3MQFA 2QLMA 2IFUA 1GFZA 3OXFA 5IKOA 1FTQA 1L5RA 1VGVA 3L7CA 2IYFA 1J39A 3S7FA 1K06A 3ZHEA 1GZ5A 4N3BA 1IYGA 4HOUA 3ZGQA 1FU4A 1QQEA 2WQHA 3T3HA 5HI7A 4YI5A 4CGVA 3UYLA 2KCLA 1XNFA 4EL0A 4JHRA 2OOEA 3UQ3A 1FU7A 3L7AA 3LYAA 3MRVA 2QRMA 2GPNA 3LKUA 3L79A 4RENA 4W6QA 2X0FA 2KCVA 1ABBA 1KT0A 5FJYA 3QKWA 3RSZA 3OKCA 2ZB2A 2WTXA 3CVLA 4G2TA 1GPAA 3MS2A 2OFFA 2FI7A 2VCHA 1FC0A 3OXLA 4KBQA 4CTMA 5LQDA 4GYWA 1WAO1 3ULQA 2UWJG 1FU8A 2VG8A 4NC9A 4MRAA 2P58C 9GPBA 4H7YA 1F0KA 1C50A 1WW3A 2HY7A 2SKCA 2R5SA 4I2ZA 1L6IA 1PNVA 3ASDA 3PE3A 1P2BA 5I45A 4KQ1A 3FP3A 1L5SA 2IYAA 3NPAA 3MTAA 3G2HA 1PSWA 1F6DA 3EBOA 4LEUA 3U3WA 3SF4A 5EKQD 2QN7A 4RIHA 3TOVA 2AV6A 3D0QA 5FZRA 1JIUA 4CDRA 2XCUA 5CCMA 4KYOB 3BD8A 3G2KA 3Q15A 3MRTA 2J9QA 2F3UA 2IV3A 4RIGA 4AIFA 5DXFA 1E96B 5KJKA 3ESKA 3ZCVA 3CUYA 2ACWA 3GW4A 3EDTB 1LWNA 3MV2B 2KC7A 1H5UA 1WUTA 3MKRA 3RO3A 3T3GA 4EJ2A 4UI9J 4GPKA 4MI3A 3NF1A 2QRGA 3OY2A 1SXPA 2SKEA 4BQIA 4BT8A 3AS8A 4L22A 2X6RA 2ACVA 5JJTA 1L5QA 2C0MA 1FCHA 1FTWA 3G2NA 5TMEA 3VTYA 1QM5A 3GPBA 1B89A 3HBFA 3KAEA 1RZUA 2QN1A 2QN8A 4MHSA 3CK7A 1P2GA 5KJNA 2ONDA 3Q5MA 4GA0A 2SKDA 3AMVA 3HBNA 4CTNA 1FA9A 1PYGA 4WNGA 4AN4A 1L5WA 5DLDA 2UY1A
chains in the Genus database with same CATH superfamily
1VTKA 3Q3VA 2R44A 5BQOA 2GXQA 3VH2A 1ZLYA 2VRCA 4Q66C 4CF4A 1YIAA 2CW5A 4KIGA 4DJJA 3JAWA 1NRJB 2D3TA 1NV8A 1U2GC 4CV3A 1QYVA 1RP1A 4K7JA 1TM3E 2XSZA 4PLCA 5DULA 4DSNA 5EP1A 2XLBA 5I48A 5C37A 2BKXA 5A7GA 1ZKMA 1X1EA 4YJGB 4CRWB 1LBHA 2RG8A 4X6LA 5KKCA 2BGLA 1BI7B 2GVNA 2QD1A 3AG3E 3EMVA 1QV7A 4PHTA 3N8KA 5E95A 4X92A 3NKFA 1JWLA 2VQEB 3R6LA 4BO4A 1ILEA 5KU7A 4DCTA 3U5ZB 1SCIA 1SY7A 4RK0A 4BX9A 3E2IA 1WXQA 1SR8A 1BDBA 1HYQA 4CKWB 5D66A 5ESXA 5KBAA 1XQ9A 3T3DA 3KOOA 3WGOA 1BE1A 1NMSA 4IJUA 1ZVMA 1VMEA 2Q9AA 4C3VA 4B8WA 3CLHA 1IHYA 2XYQA 4AP2A 4TN5A 3CX4A 2C78A 4EJSA 2J5XA 3RFXA 3UK2A 2EKPA 7MHTA 1ONPA 3TG4A 1D2HA 1V35A 3ZRHA 3GT4A 3ZOKA 4QATA 5AW7A 4DVJA 3QI2A 3BK7A 3E18A 1JNZB 4CG3A 2IOFA 3C41J 3CKCA 4XWOA 2XUPA 1C9NA 2Y6UA 2WV7A 2Z9DA 2HRQA 2A1UA 3OZXA 5BNZA 1YMQA 4PTYA 3RAGA 3W9GA 4QOGA 5LBUA 5KPDA 4LNAA 4DY4A 4ZMSA 1E9DA 1N0VC 4IIHA 5AHKA 3T9EA 3RRMA 3VRHA 4TXJA 5A3RA 4BO1A 1STOA 3CVQA 3ESAA 3RWMB 4BKUA 3QEBZ 1V45E 1W1WA 4JBGA 4MDHA 1Q1ZA 5KYNA 1VA5A 3AEZA 2YKGA 1DV2A 3REFA 1AU9A 4S0ZA 1SVIA 5LP1A 1IYZA 3W6ZA 5HIKA 2R9VA 4KQXA 3QJZA 1G291 1E79D 3GJ8A 5AVJA 3WBKA 3CINA 4JL8A 1C3OB 2DSNA 4MMYB 4C0JA 1LRLA 3AERB 2AZMA 2C5EA 4FI3C 3OFSA 2WMNA 2PMWB 2BMWA 3OBBA 4PSAA 5E7JA 2XCCA 4PS0A 2CFIA 4E5UA 4YR7A 3JR7A 3GJ5A 1NHWA 3KR0A 3LKDA 4I50A 3E8SA 4ER6A 5GINE 2XZPA 5MGNA 2VTBB 1KVSA 3N0WA 4RHYA 3H4MA 4JVSB 1RZ3A 1EP9A 1FFCA 2V8OA 4HQFA 4RBNA 3R0JA 4ESHA 3AK4A 4IOLA 3URKA 4LDAA 3MILA 1HSOA 5KSWB 3HFRA 2CXNA 4PPYA 4DUYB 2RSFA 3DC7A 3ZXYA 4OYLA 3HXOA 2QRLA 2IXDA 3CLRC 4LHZA 4FMDB 3U80A 3S8EA 2B7BA 5KJMA 4JUDX 2NO5A 4MW6A 4WEOA 4ZHQF 3MAJA 4WXYB 3QJ5A 5CCEA 1XRQA 2PZAA 2VXBA 3QLEA 3P9RA 2JL1A 4FYJA 2VJCA 2R6HA 4YQEA 1NF2A 3TKLA 2P3LA 2QIPA 4MZXA 5B55A 5M29A 4F56A 5KYYA 1W2WB 3IQFA 3NHBA 2HHHB 1INZA 2IX3A 1IBCA 1ZIXA 1W36D 3QOUA 1BDJA 2DPYA 3MIIA 1D4FA 5AVOA 1R7RA 1T8TA 4BBPA 3SVLA 2ICAA 1R16A 1NR1A 3E7DA 2OCGA 5G3YA 3T7EA 2ZVQX 1P62B 1FNMA 2AFVA 2AOTA 2GR9A 1PYDA 3Q4AB 2XRZA 1O97D 3EXFA 3NEPX 4XH9B 1IBKB 1O87A 4W8OA 1BE8A 5HQ3A 1HI9A 3HL0A 4FP9A 3T5XA 2HU2A 2B78A 4BASA 4YJ3A 2FH5B 3TTVA 4ER0A 5DBHX 2ZI9A 2AXPA 4P93A 4BTLA 2N46A 1XMQB 1T8PA 4PZPA 5EP2A 1ND5A 1JKJB 1T5TA 5DCWA 4B5KA 3PRHA 4UD6A 1S6YA 3DJYA 4W1RA 1QRTA 1GHTA 3A4TA 2AX4A 3WJ7A 2B4TO 4UBJA 5EY5B 1AGXA 4JMPA 1S01A 1GNRA 1O5IA 1AS3A 3DDHA 3FUTA 2JGRA 1DPGA 4FC6A 4O2BA 3UMSA 4ARVA 3DL2A 2C88A 3ZHOA 2O1EA 2ZRFA 1PFVA 1QIDA 1RQ7A 1X1RA 2YXNA 1M7BA 1QIJA 2X8JB 3EJ6A 3FNRA 4HXYA 5TQVA 4DGSA 1P4RA 3R1IA 2CL5A 3VR5A 4Q4JB 5IN4A 4L0MA 1RWPA 1OLSA 2GCOA 2KWIA 2RSLA 3K7EA 3NVMB 3PFFA 4QDJA 1A1SA 4U9HS 3UGKA 4AMZA 1SOWA 2WYVA 4BQRA 1SBTA 4HGQA 2MHCA 4M8IA 2OD9A 1XELA 1L7AA 1NXQA 1GFIA 4AKTA 4B32A 2H63A 2JW5A 2OZVA 2PJDA 1CT9A 1IOWA 1OFUX 3F3MA 3NLLA 3X43A 2CMGA 2IKSA 3AV0B 3E8XA 5ENDA 1CJTC 3LC1O 5TPZA 1KI8A 2ZRIA 3EYWA 1JEYB 1T1EA 1U3TA 5TQ2B 2KZTA 2QD5A 1PWXA 2NUTB 3FCYA 4DREA 4DRXB 4E5NA 3NZSA 5JC1A 2XHZA 4I3FA 3P0JA 4KN6A 3ZHZA 4F7DA 1BWQA 4OXQA 3AVTA 1X94A 2O3RA 1SXJA 2XMSA 1L5ZA 3EN0A 2FX5A 3EUAA 4YV1A 4CEHB 2FETA 1ELKA 2X42A 1XNJA 3F3SA 3W04A 3GCZA 4PXAA 2XRFA 3O75A 1T9ZA 1IM5A 1GPLA 1GARA 3NIWA 1XHFA 5DBIA 4EY3A 2I2XB 3VR2D 2O0LA 2ZIXA 3FCCA 4FYHA 1KEZA 1O54A 1XD2A 4H7DA 7ABPA 1RP7A 3K6SA 1PJTA 4UCQA 1JUQA 1X13A 1Z4QA 2PIDA 1EF1C 4IUDS 4BVFA 1WV0A 2IZ7A 1VJCA 4XB1A 2CXTA 1QGOA 1C3JA 3A1CA 3IB6A 3L7YA 1DDGA 4FLFA 1SM4A 2HH9A 3B5JA 4H6XA 1OCRE 3ILXA 4UHHA 1QQAA 2FQWA 1NZNA 1PJSA 4NAHA 5EUQB 1SKMA 4A3TA 4RPCA 1ZIDA 1ZVJA 3GG9A 1R10A 3H2GA 4G5FA 1A7UA 5KQMA 1A5ZA 2BEUB 2JHCA 3CV3A 3DLBA 5LL6P 1HV8A 3KPYA 1A4UA 2ZRKA 4UHCA 3GVIA 5GM1A 5BNFA 3IKJA 1NAHA 2AW6A 3D2AA 1X77A 3H5RA 1NMYA 2PMFA 1BHSA 4ZO8A 3I8XA 3PFCA 3ACDA 3LRTA 4HUQA 3DXXA 3EIQA 2RI0A 4TKLA 5D7BA 4JR1A 4UYKA 1P1FA 1SCQA 3DLAA 3QPDA 3TSZA 1TJNA 4MI6A 4CKBA 3RYIA 1Z74A 1SOUA 4TMYA 5C2JB 4EARA 4EUSA 1EGMB 3QWPA 4OK5A 2NU8A 3INGA 4IIJA 4TVOA 4N7RA 2G76A 2OM6A 2J31A 4FE4A 4UXJA 4A0QA 1GKIA 2OD2A 4RLSA 2GCGA 3WAJA 2CZCA 1A2QA 1DS6A 2BV3A 1XHLA 3SFYA 4GC5A 1ZP6A 3FPHA 4XVQA 5E38A 3WRXC 4DLZA 5K0EA 5LQAA 1K97A 1ZEJA 2N75A 2BT4A 2YWRA 1W5BA 5D3MA 5FA6A 5BSFA 3T3OA 4XOUA 4HC4A 3CZ5A 2IH4A 2XRYA 4J6FA 2HR1A 3BHIA 3JSXA 2XGSA 4Y6GB 5T4YA 4HFNA 5AWFC 3VU1A 2ZBVA 1LJ8A 2Q8QA 3U16A 1VMIA 1Q11A 4TTIA 5AW2A 1V7QA 2ENWA 5T6MA 4EP1A 3D3WB 4ZGWA 4UTOA 4N48A 4E14A 2BGKA 3HCOA 3NHRA 4HLCA 3OO0A 5FEUA 5KOHA 5KNCD 6ADHA 4RLFA 1XZQA 4FN5A 4BE7B 3SHOA 1F1BA 1ZICA 2EEPA 4M37A 1EBFA 4LQ4A 4Q6WA 5IJ0A 1XTRA 2FFGA 4KNVA 1AGYA 1QJCA 2I2FA 2XX3A 3ZU6A 2E0IA 4BCBA 3LO8A 1TM1E 1GLGA 3ZCUA 1RWKA 2R48A 3N3AC 1WD7A 1T35A 1A72A 2YWCA 1E4OA 5IJZA 1O7JA 4UPVA 2ZBUA 3V6LA 3IBFA 1DIGA 2Y05A 4MV6A 3CF0A 1FFBA 4NONA 5LZ7A 1M1UA 1XVUA 1G9TA 4M1TA 2R2AA 1P45A 3KQQA 4KYVA 3ZHVA 4WCFC 3B7GA 1NQAO 3ZU7B 1MOZA 2R1VA 1KVRA 2HO5A 2I7XA 4QGGA 3SHQA 4C78A 4UWHA 3RJ9A 2OP1A 2YV4A 4XA8A 4YV0A 1TMOA 4TLDA 2ZITA 2VAVA 3ZV4A 1K08A 4YIKA 2CKMA 1KH2A 5DH9A 3KTFA 4OAQA 2C20A 5IBQA 2D3WA 1FFHA 1QYIA 2QUKA 2GK3A 5EL0A 1U2DC 2OCAA 1BROA 5SZKB 1LPAB 4C0LA 1SVNA 4AROA 2Z5VA 1UXGA 1LFAA 4RZQA 8LDHA 2HR2A 5HTOA 1CUCA 1V8PA 3DFZA 4L07A 4PQRA 4TLAA 3KPJA 3L8MA 4LDZA 4P32A 3EZXA 4WXEA 5E3IA 3FTFA 2OP0A 4FUQA 3GAAA 4J4TA 3MWJA 4LOKA 1M2WA 5KWJA 3LBAA 4G67A 3I6IA 3UWMA 5LVAA 1KBQA 2A33A 5F52A 4Z0NA 2E85A 4AJEA 2IYSA 5M5BA 4OX9B 4LCBA 5LDHA 3TJPA 5TPWB 3DYVA 5B30A 2BN4A 3HJBA 2DOKA 3P9CA 4D6YA 2OXIA 4E07A 1A9SA 1CZLA 1O8BA 2GYVA 2RC6A 3L7LA 4PR0A 4RFLA 5C5CA 1W47A 2IHZA 3LY7A 3I4LA 4LERA 4K03A 1TB4A 4U2DA 1P80A 2P9FA 1PAQA 3MXOA 1LD3A 4MKGA 4XIGS 2LKDA 1Q0RA 1SXJB 3F5FA 5F76A 2PUEA 2X86A 1YR3A 1D2RA 2G04A 3ZN2A 5EIBD 1A9TA 3O26A 4NG5A 3QX8A 5EQFA 4DFDA 4CIYA 5DM0A 4HRXA 5JDCA 1ISJA 2NUAB 2W70A 3NGLA 3I76A 1GPDG 3U7GA 1CY1A 3CQGB 1FS4A 4KNWA 5DTQA 2Q5LA 1H5QA 4OKSA 4UPDA 4ONEA 5KKNB 1RYMA 1QFJA 2FPOA 2GFQA 5F77A 4CL8A 2X7XA 2IIVA 2H4FA 4AG6A 4L8WB 4TMTA 2OSVA 3T9BA 4C7OA 5ITVA 1MABA 1PWZA 4JASB 4ME6A 1NJGA 2V9PA 3O8OB 3O9MA 3FOCA 1FUEA 4PTLA 1N9KA 5EX3A 3UUEA 3B1WA 3FMIA 3MAGA 4F3VA 4OLAA 2XOKA 5EE5B 1XTVA 2DUJA 4LYEA 3ZHYA 3D7KA 4MPRA 1EJBA 4HYQA 4R2XA 4ZRDA 2HQBA 4NE9A 3HXLA 5A1TA 3H86A 3GEDA 4Z9XA 5FWDA 5AR1A 1G5TA 1YQTA 1C14A 5BOSA 2B0CA 2Q1TA 3LECA 1BS2A 4J6EA 4Q37A 4FHFA 5C7YA 3TXNA 1OFIA 4V0SA 4GZCA 2NU6B 1FTQA 1O9BA 3QSGA 3VNAA 3ZU2A 3NDRA 2NU7A 2R8YA 3L7CA 2GTIA 3KJZA 3M6UA 3MPOA 2X8JA 4A2CA 4QGFA 4E4TA 3UGJA 3RAFC 2WJ4A 1J56A 4NU0A 1BW9B 1NJSA 2CF5A 1XD9A 2OLKA 3L8GA 1PZMA 4WA7A 5G3ZA 4N3GA 3SF8B 3UM1A 4UPEA 1QQEA 2D0PB 4IDBA 3TUJC 3X1ZA 2VF4X 1NG1A 4CGVA 1N2HA 4K3UA 2F0YA 3AFIA 3IAM6 3A05A 4NK5A 4FTWA 2G83A 4GZLA 1MB9A 4LOJA 4S1VA 2XJ4A 4MKHA 4X1IA 5HCNA 1MENA 2FFHA 3BULA 4BX2A 4AV7A 1MEEA 1IATA 2JKYA 1Y6QA 2GYWA 3EIFA 4XUDA 3M3HA 3R4VA 3NEYA 4N7BA 3ZHCA 2MRIA 2YV3A 1GPAA 3SD5A 5E6SB 3EWIA 3KLBA 1FC0A 3OXLA 4PG5A 1O77A 4WGGA 3FTWA 3V8QA 1AF4A 1L8OA 2XKKA 1H0KA 2AMFA 5DYIA 2XVZA 2JVKA 1FU8A 4DMFA 1YJQA 2ZJAA 4IWXA 5DCUA 5DTIA 4CNQA 4DV3B 2Q0QA 3NJ8A 4L6AA 4HV4A 5K05A 1SPXA 1ZK2A 3IP3A 3C7DB 3OCWA 4JDPA 4LV8B 2KMLA 1N2BA 1Y4UA 2RGNC 1UJ6A 3HY3A 3R3ZA 4IHJF 1NRWA 3BMXA 2HHLA 4YQFA 1M8FA 2H1VA 3OAAD 1YZYA 3GG2A 3AIIA 4PN7A 1SXJD 5U9CA 2WF9A 3F6RA 1W88A 3NKVA 1XQYA 4JY7A 2CYBA 3B6KA 2ERCA 3EBOA 4CTJA 3JALB 1VCHA 4O4JF 1JAXA 1MQSA 2CHUA 3AHGA 3OUZA 5EMMA 3SJZA 5JHBA 1M8PA 3GIWA 5GGYA 1E3WB 2A9PA 2W2KA 3VR2A 1EUQA 4ZVNA 1KJIA 4S1WA 1W88B 2HO4A 1UDBA 1J2RA 3NIFB 3NTLA 4YCNA 3D7NA 3EWNA 3C6ZA 5AOVA 3QMWA 4ZCLA 1E0DA 3VR1A 4IVRA 1QHXA 3CM0A 3EDTB 4BP9A 2QE7D 5CBNA 2RD2A 5AKHA 4EJ2A 1TAUA 3AOEC 3VNRA 1E4VA 3EBLA 1MVLA 4HN2A 3NF1A 2NZXA 3B1KA 2QMHA 2D1SA 2GD0A 1M34A 1W48A 4M1SA 4C9BB 4PICA 2NYJA 3QELB 2N47A 4QOFA 1SGWA 5ICCA 3N6VA 4ZQIA 1B6GA 3UT5B 2ZOSA 5IWCA 1K8YB 4R8SA 3TJZA 2II6A 2HIGA 4QTZA 2IPMA 4RK6A 4PM4A 4BO5A 1KJ9A 2QN8A 4GPAA 1SZ9A 1KY3A 2SCUA 2SKDA 3L6RA 3SOPA 3ZE2B 1P5RA 1QF9A 2YYZA 2ZROA 4C3UA 1EGQA 3RC8A 1TNYA 1OV6A 3BJRA 3K35A 4MDYA 2LXNA 1TFUA 2R1TB 2ZIUB 4HXEB 4M9CA 1I1NA 4I1OA 4EFNA 1NFFA 3LTNC 4AMGA 3C3BA 1JFRA 3UFBA 3WB9A 1W36C 3R5SA 2YUTA 1N6IA 3D5EA 5EUCA 2WWHA 1H2TC 1ADGA 1YMVA 2QYTA 4Y3UA 4ZANA 3W9BA 2CVFA 1WMAA 1NI4B 1Y3BE 2IOYA 1DB3A 1QR6A 3NHSA 3MD9A 1IHGA 5C8XA 5L51A 2CLSA 1UFVA 1UK7A 1Z3CA 4JLDA 2CLOB 5J2TF 5FWNA 3CHMA 1KAHA 1O5TA 3D8HA 5LMCA 3C70A 1UDWA 3AHCA 4UW9A 1BPOA 4U7DA 1EXDA 5F1PA 3ZXXA 3VKVA 3ETCA 1OY1A 4RE6A 2K4NA 3H9BA 2Y4NA 2DYKA 3QENA 3ZHUA 4PSCA 3MT8A 1NQUA 3K53A 4LYHA 3UQZA 4UMEA 1IVNA 4ZCIA 3BQMB 1DAHA 2HMVA 3ELDA 1G5IA 5FBRB 2OBXA 2XUIA 1P4SA 3EY9A 4NJOA 4A1SA 1J9ZA 4S2EA 2X1HA 5EMLA 3DZDA 2GK4A 3RRMB 2ZR9A 3EQ8A 3S0JA 3FTDA 3A2NA 3L4BA 3QPWA 3LLCA 4B43A 1T36B 3ONLA 1CR6A 1XKTA 5C4IA 4JB0A 5TRTA 3LPAA 1SBYA 2AN3A 4I4TF 2LSUA 1TZKA 2D74A 3GRVA 3LV8A 1GUAA 1JR3E 2EIKE 4GMLA 3FYUB 3PA6A 1PP4A 3GOQA 2VPXA 2WLTA 1QP8A 4WI1A 4CL0A 4TYYA 1XN4A 2JCVA 3PNLB 1TL7C 1N8SA 1N2GA 4Q3KA 4L8YA 1Z8NA 3TL3A 3KVNA 3TJMA 2C84A 4BFXA 3FAZA 3BEEA 2ZE7A 3UB2A 2OESA 2XITA 3DQZA 4DI4A 1SXIA 2ZSAA 5LC1A 3WL7A 3AV3A 4C7KA 1QK3A 2QSJA 4OFZA 5IBCA 1GADO 3O0DA 1C30A 2C2OA 3BCHA 4Z3OA 4CPDA 2PS3A 2QL6A 3HBAA 4OSOA 3SJAA 3K09A 1TEHA 3ZD8A 1RTTA 2WJHA 2WTUA 3EF0A 3TLJA 3KD7A 2BR4A 3A4VA 1YUMA 2DBZA 1Z0FA 4JBXA 3HHPA 1O95A 4NMLA 4DADA 3NHFA 4EATA 1UC5B 1QRDA 4GR9A 3CEHA 5C1BA 4HADA 1XCPA 6CHYA 2QRNA 5EIBE 1Z7WA 3AUJB 3D6VA 3VA7A 1FDRA 2XMZA 2W71A 1GAJA 2FN9A 4IM7A 2HPZA 4B1FA 1Y6RA 2B1QA 1YZUA 2C98A 5ALRA 3QMVA 5LUBA 4FM9A 3GJTA 4DLXA 5CA0B 4H9GA 1CX9B 4L0DA 1YB4A 3MC1A 3GX1A 4U0JA 1ADFA 5G4LA 5KWIA 1F2DA 2NSDA 4J0HA 3PGKA 4Q3BA 2A9VA 3TWOA 2ZR0A 4A0FA 2WIAA 2W42A 2E5LB 3TMAA 5K0ZA 4HWPA 3DFIA 4OUKX 3VZBA 2R8ZA 2VRNA 1GCIA 1OWOA 3FU0A 4QYWA 2XWQA 3EISA 4L7VA 1HX7A 2WJPA 1QIMA 4AJWA 1HDCA 2W2MA 3K94A 1P77A 4CU5A 3QLVA 5B1SA 1TLFA 4CM8A 5JNVA 1NVVR 4DPKA 3BSFA 1CQIA 1IU9A 4MUAA 1XKLA 5EI5A 5MN4A 2DWCA 1DNPA 4EW2A 1E1KA 4TZ0A 3JQFC 3E15A 4K6OA 1RHUA 3MK31 4GKJB 4IGAA 4HRMB 4LRQA 5HJ7A 2HEGA 3AKDA 5JTTA 2GZSA 1GNSA 2JFWA 5FOQA 4E4RA 1AHIA 4G89A 4N5DA 4DLQA 3DZIA 3GFFA 3DV0B 1W85A 4RABA 4K8OA 3PUJA 4TVBA 1R5NA 1C7FA 4Q16A 3CEQA 3KEQA 5CCLA 4RSYA 1THGA 2FV8A 2WUGA 4CGWA 5D00A 4WTOA 5AJXA 5LQKA 5LCWJ 5JFOA 2WF6A 1FYVA 1YR2A 2EBHX 2XNDA 4XSHA 4LEIA 1UZLA 2P7IA 3FSGA 3M4YA 4HN9A 1HX8A 4BWGA 4G07A 2PWAA 1C80A 3K4QA 4OP1A 1BS1A 1K7FB 3A2LA 5AO9A 3VVMA 3E1SA 4HDRB 5CR9A 5IASA 3EVAA 4C0QC 2XB4A 1QAQA 5EXTA 3I1JA 3D2CA 2DLNA 4MKZA 3ZY5A 4KACA 4C01A 5BMVB 5KWVA 1NIPA 4UYJA 4UFNA 3N0XA 3DTTA 5BW5A 5EKTA 4M86A 1ZVVA 2VGXB 5ALTA 1IN8A 4MV1A 4URYR 1M9NA 4K1LA 4KUHA 3ONVA 2DMRA 4B5LA 1A5SB 1AA9A 2PJZA 3N75A 4L08A 4IV5A 4FGLA 4FT2A 1ESMA 1G21B 1H0RA 1VLHA 2GOYA 1NDHA 1RBQA 2XUQA 3FOWA 2BD0A 4TKMA 4MWBA 1XTSA 4X20A 1D2CA 1XZIA 4DUPA 4TSRA 2C0LA 5C5DA 1XTBA 4GL2A 2IC5A 4WNEA 3F74A 1E3TA 2ID7A 3KYCB 5SZHB 2JAQA 3RS3A 3VC1A 4RSRA 3OX1A 3I3NA 3VZPA 4XIFA 4MDEA 3B20A 2GAOA 8ATCA 2FQXA 4ITVA 1U28C 3VI3B 1U11A 2L9BA 3X1KA 2DFKB 2IIPA 2Y3IA 2XMGA 3GGDA 3SVTA 2H4WA 1WHTA 3QVGB 5HTKA 1KYVA 1TK2A 4EY5A 4FZ3A 1SUDA 5DMHA 2C07A 3D6FA 3K6JA 1IMJA 1EFCA 3BT7A 3IAS1 4DM4A 1ZESA 2GO1A 2BFPA 1YR1A 3DE0X 5JJLA 1PFGA 4HUJA 1UKAA 2YYAA 3V2HA 1N33B 2FUKA 3IS3A 3QEMB 4OVVA 2OPHA 3H5TA 1Q0PA 2EX0A 4Y2UA 1HTBA 1LLQA 5CM2Z 5ALKA 1I7QB 1AT1A 2V7WA 3JWPA 3ZDQA 2CL7X 4IIJF 3B8EA 4JJZA 2VTKA 1N4RA 4I1VA 4UC0A 2JGNA 4B87A 1UJMA 1B8PA 3TWTA 2ZW9A 2WG1A 2RHOA 3U17A 4D3DA 2DQ4A 1PGOA 2WUFA 3Q7IA 4Q00A 1Q7BA 1E5TA 1EP1B 2G5GX 2ZSIA 2GBLC 3G8AA 3O92A 1XLVA 5AVTA 2CL6X 5COQA 4ABNA 4R81A 3CEMA 1E0SA 3U44B 1H2WA 4I14A 4DQKA 1YCGA 3WLNA 5AKYA 5BQPA 3DWGA 2P3OA 1FDVA 1Y82A 2B25A 4BTVA 1EM8B 3CUWA 3FUHA 4O6FA 2NVUA 5AVXA 5T4BA 1QRRA 3F7NA 2Q9CA 4I55F 4BNDA 3OE4A 4TZKA 2EARA 1M1ZA 4HQNA 1CY4A 5A71A 1KDYA 2HWUA 1KK2A 4WKCA 1EFLA 2I6GA 2TMDA 2YZ2A 3AHFA 5K20A 1S3GA 2VK4A 5DHRA 4JL0A 3GLFA 5DSTA 3ADOA 3COYA 1T8RA 1CEEA 1YHNA 5C1PA 3IMGA 1Z4IA 4PLTA 2R66A 4U7PB 4YMWA 1FS5A 3I30X 1YRWA 1J70A 2CVOA 1TCBA 5M7EA 5EN5D 4DQLA 3LLVA 3SYNA 3Q88A 4X7PA 4HQKA 3JYSA 1G6KA 1JT9A 3GUCA 3H1GA 2GVZC 3O9ZA 1US8A 4U2KA 2DWPA 4PC3A 5D3QA 3H5IA 5EHIA 1USGA 4DSTA 4EX7A 2BGMA 4MW0A 2C1XA 4HQLA 3LYUA 5LYYA 1C3XA 2RBGA 2FX3A 4HWSA 5JAUA 3I2GA 4LMBA 1J0BA 1KZGB 1OTHA 1RJGA 1RYDA 3G9XA 4DN6A 2C7QA 1QU2A 1O2DA 2XOKD 3QXJA 3MGCA 1KK3A 4L4ZA 5ALYA 2JBHA 4ALMA 4X95A 1GO2A 5JQWA 3PPVA 1FFAA 1G5RA 5BSUA 4TXQA 2WM9A 1PR0A 1U3GA 9MHTA 1QK4A 3ND9A 4PF1A 4ZI2A 2O8EB 4M1QA 5LA6A 1II8B 1BXRA 1YVRA 2XQVA 3H1TA 2H3EA 1I3MA 2NTNA 3P5BA 4LXTA 4D82A 3VDRA 4RQTA 5ABPA 2P65A 1A3CA 2ZIXB 4MV3A 2HBYA 3PLRA 4BNKA 4DDTA 1WMDA 3G2OA 3FFWA 1R4MA 1SU8A 4KXMA 4CMCA 4PIPA 4GM0A 4CDMA 4N0QA 3IOYA 4NZPA 4E08A 1M6VA 1UK9A 1U3CA 1NLMA 4MAFA 3BIJA 2BHRA 4CIVA 5CHYA 3HY4A 4TV8F 4EI7A 3D0OA 3JQ9C 2GZ3A 2ZISA 3NDJA 3T7IA 4Z3DA 1MCZA 3SJBA 3RTDA 5F7ZA 4RTNA 3JVVA 1TKRA 2PZEA 4K9NA 2NO6A 4G8DA 4HWTA 2PNNA 3P0EA 3IBEA 1HLPA 1OXTA 3TBKA 2AFIA 2CYAA 2I4IA 2VWQA 2QB5A 1WQ1R 4ND2A 3UM0A 5ARGA 4RVGA 1WB5A 3EF3A 4IMJB 1QB8A 2C4NA 3H1BA 4UZFA 2NT3A 2GLUA 3BGOS 3K8ZA 4FADA 4UNSA 2AOUB 3AJ8A 3QKUA 2KX7A 2BEVB 4ZQCB 1JDVA 3NV9A 4CGZA 4X00A 2P2ZA 5H3CA 2VYIA 1ORTA 5G0WA 5KYWB 2BCJQ 1BFUA 4WT7A 2KLBA 1HEUA 5DYTA 2OYSA 1GN8A 4TL7A 3G8DA 5U1PA 2BH9A 2H7XA 3GPCA 4UCWA 2ZT8A 1EWKA 3DNFA 3ZNOA 4OD0A 2CD9A 2WWIA 4JGIA 2A1TR 4ZVPA 2IWHA 1NKSA 3NT2A 1WOYA 1QAMA 2QXYA 3L2OB 4NR0A 4AF8A 1Q2XA 5BQXA 1GG8A 1M1YE 1OCCE 1BS9A 1POXA 2XPYA 5ENPD 2QTLA 3LQ1A 1K89A 3ER6A 4BX0A 2J0UB 5F7XA 1AKTA 3PUHA 4KQEA 2O8FA 3HM9A 1PEAA 2WXGA 2H9YA 3T5BA 2JD0A 4GDFA 2VP2A 2PZJA 1ZS9A 4F46A 1W5FA 3NC4A 4DB4A 3GRFA 4CEJB 1UAGA 3H6GA 5H70A 5JDCC 1ULZA 3DMYA 2JHAA 3QRWA 3M6LA 4XQ9A 1QFMA 1W46A 1U4NA 3T95A 1DQYA 4H17A 3U9WA 3DPSA 2GAAA 1F8GA 2WFLA 4E7PA 1HBJA 4X93A 2WK1A 3SR3A 1O0CA 5LR6A 1BN7A 1C8BA 1F5SA 2FPIB 5EZ5A 4X1YB 4XGNA 5F3DA 3BFXA 4XGKA 4KL8S 4AP5A 3L6UA 3U4CA 1VGVA 4PTZA 3NTXA 3EK2A 3L04A 1J39A 2RG7A 4BNIA 1KYTA 5E9QA 1ORVA 3CRW1 2XNDD 1RJ9B 3FRHA 3NTUA 4ENTA 1GPWB 3H1EA 3WDMA 2V7QA 1WSBA 3GVPA 4ND4A 4B46A 1OXXK 3QYAA 4IFEA 1SOVA 4ZV9A 1Q0ZA 4JN6B 5IT9A 5KBYA 4G1CA 4XZ4A 3PCXA 3DMPA 1QDLB 3KEFA 2IH2A 2X9LA 1KI9A 3DZGA 1A77A 4WDQA 3FU5A 4FSDA 3K0KA 4BU1A 5J1SB 3ZPXA 2XDQA 4ZXPA 4YRAA 4OOEA 2C7GA 4J0GA 2GLXA 3MJTA 3PIRA 3O03A 4K2HA 4KXYA 4P7GA 3QKWA 3OA0A 4DV0B 1Z6GA 1XVLA 2VL7A 2BMFA 5AK5A 4A03A 4D4LA 2OG2A 4CTMA 3AT1A 3GVHA 5BSVA 3RU9A 5AW4A 1UKVY 3GT7A 1I3OA 2AR7A 3AVPA 3UK0A 3E34A 1UKYA 2H1WA 4A1GA 1JZSA 3O2NA 3SNHA 3O4FA 4TYNA 4KXQA 1WB9A 3KPUA 1ZUWA 4Z7NB 1V8OA 1KEUA 1Z2OX 1FF9A 4F4CA 9GPBA 3H7AA 2J6BA 1JEAA 3THRA 5CBOA 1LX6A 1T1SA 3IMEA 1PDOA 3PQCA 2ADOA 4JI1B 1Z6TA 1DAEA 1A9RA 3GP3A 2IEAA 3ZKAA 4EBBA 5JAZA 1XGKA 1Z5UA 2HSJA 1P2BA 4WGFA 1FQKA 3G9UA 4HGPA 4QDUA 3FP3A 1W52X 1JL3A 2BF0X 4EJ6A 2IUUA 3DL7A 1YZNA 3E0XA 4PFQA 3RF7A 1HG1A 4ARBA 3ZVLA 5BYAA 4QFVA 4TXRA 4QNMA 4YRLA 1KPSB 3H4VA 1L4MA 3WVNA 4DA6A 1RCFA 2XODA 4CFZA 3G02A 1SOAA 4F86A 1V71A 2WV9A 4YR9A 1E8NA 5CCMA 2BUBA 3DCYA 2DAPA 4E2YA 2MSEB 2IHYA 4H4DA 2EWWA 5IU6A 3MYYA 2PQMA 4ZI3A 5DGHA 5DP1A 3SP1A 4C7OB 4J29A 4AY4A 5JARA 2ACEA 1GTSA 4U7FA 5IH3A 4HEHA 2OQRA 3F2IA 2ECOA 2VDUE 1WDWB 4ESVA 3MV2B 5M34A 1H5UA 4IHKA 3QBJA 3FUNA 1QANA 2WJVA 5KJ6A 5EGSA 2P0EA 1YRQA 3EEOA 3H2BA 1MAHA 3AI1A 2GA8A 3PPIA 4DBVO 1EHCA 1L7BA 2UAGA 1ECPA 3P94A 1UAAA 3HN2A 3MTGA 4GT1A 1ZLXA 3WMWA 1XCBA 2GM3A 2PHZA 2D0DA 3JRWA 3OY2A 1CUWA 4HWOA 1A9PA 2WWVD 4C5BA 4LOLA 2W6MA 4PHFA 5CFOA 4WLVA 1ZD1A 4BQIA 1ZHOA 4B84A 3H0KA 3A06A 3TFQA 3TZLA 3ITEA 2EHJA 5FR1A 5BQ5A 1QVZA 3G2NA 4IDHA 3KQKA 3ASYA 4OJQA 1E9BA 2CE7A 1N25A 2QN1A 4ATNA 4TYPA 5L7TA 3OZGA 3V2IA 4DR3B 1MZPA 2HLDA 1Q17A 1U8FO 4H7FA 3UJ6A 1P1IA 4TRNA 4OI4A 1LH0A 3H5AA 4UEQA 3F98A 1L5WA 4F1JA 2W6JD 3HL4A 3P20A 3A4IA 2ZU0C 2WSSA 5A9TA 1NIJA 3JW8A 3M3DA 2XBMA 1M0TA 4FDUA 4RGBA 5ALEA 1PV1A 3ABQB 3UZUA 3W5UA 3DA8A 1HK7A 1MX9A 1QVAA 2QAGB 2DPHA 4LTMA 3U40A 3J81A 2P2DA 1NAIA 3EGEA 4Z9YA 3E0QA 4ZOBA 1ISGA 4CKXA 1IHUA 1U3WA 3F6EX 3Q49B 4AS3A 1CJSA 3WLPA 5JFGA 4OXKA 4Q9NA 2GK7A 4TS4A 1QF7A 2AQKA 4O0LA 5GPBA 4AYWA 4KE8A 2C7RA 3ICEA 4YPFA 2YRFA 3SXUA 3O2QB 2H0QA 5CUQA 3SI7A 1ZUD1 3K73O 3C5EA 4PWYA 5F78A 3L02A 3HEAA 3RU0A 1JBQA 1JSRA 2IZ6A 3PITA 3RJVA 4G0MA 4JLUA 5EZYB 3W2GA 4NE2A 3M70A 2GAJA 1JHXA 2YV1A 1K7EB 3OTWA 2YCBA 1HDOA 1GDHA 3HWRA 3PL5A 2P0YA 4OH7A 1TF5A 1BZYA 3BM5A 1UG3A 4L3VA 5CA1B 1OC2A 4B4OA 1T8WA 1NT2A 3RFFA 3D3KA 1EUYA 1Q2ZA 3T0FA 1TF7A 1YZFA 3OIDA 4I19A 4F1KA 5D85A 3EGCA 4Y0NA 1GPBA 3O2SB 4YBZA 2SICE 3BJMA 3BA6A 4J0QA 3BGSA 2PRSA 3ONWA 4X91A 2DZDA 3C98A 2XQGA 4CFYA 4UREA 2ESRA 2IPLA 1NYQA 2GPYA 4M53A 4EB3A 2XV1A 3RIYA 4K9LA 2HK7A 1J8DA 1QIFA 2C31A 3KZNA 5DLQC 5F5LA 5EZQA 1U0EA 1R0RE 1BJRE 4R7GA 3K70C 4Y9DA 2HF7A 2P1RA 5B4UA 3K31A 2PZBA 3ZDYB 4MKTA 5JJ7A 1JR4A 3ASOE 3R9MA 3ZH9B 3CGHA 2Q5JA 3V4ZA 4XGRA 3CO0S 3W9UA 4Y1RB 2J3JA 3GZ4A 3I09A 4RF5A 4KH0A 4TMWA 4CG2A 1NWHA 3W9SA 3TTYA 1ULHA 1E1QA 1XJQA 4V1CI 5HKPA 2GMWA 1NDQA 1NZDA 2VHEA 2WP0A 3B3AA 4NIKA 3L8EA 2XRMA 3V3KA 4CF3A 3CHQA 3ANMA 2WSBA 5C34B 4OXRA 4NAUA 1R1DA 2QHXA 3GLIA 2G9NA 2JIZD 6GPBA 3CZMA 3W5BA 4AUKA 2JG3A 1DDOA 3LX6A 1Q14A 1KEWA 2HU7A 4PBTA 4ACKA 1HXIA 3CRVA 2OAGA 2P9JA 4UUPA 4AKXB 4XB2A 4RQBA 4M22A 1S4QA 1JLRA 2PL9A 2PUGA 5GMOA 3RIEA 1SVWA 1V8ZA 4E7OA 1JU3A 3C1AA 1UXKA 4YCDA 3M5PA 5DI9A 3W5AA 1UPUA 3D6AA 4QTTB 3PFIA 2D1TA 2Z4SA 2W0MA 4BFLA 3WLOA 4TV8A 1ODKA 1SB8A 4DQUA 1K6EA 1SC6A 3IJPA 5KYUA 4ZOEA 3JQ8B 3I6YA 4DXAA 3ZDRA 1Z36A 2D6FA 3ZEAA 1O95C 2AOWA 1ECJA 3NS7A 5E4FA 5PNTA 3ZV6A 4EG0A 2D7CA 1A7JA 4ZZ3A 1RZVA 4JT2A 1CLEA 4I17A 2ZUVA 4DBLC 2PPVA 2Y0PA 3KQWA 4WOBA 1HNXB 5HRAA 1V2HE 3QARA 1LDEA 4LK2A 4ZVVA 2R00C 4CN8A 2JLAA 2Y9MB 3KXIA 4QECA 1WW2A 3ASHA 3GUZA 5DHQA 3AILA 1W75A 3TQFA 5L9AA 3UG7A 1AB5A 1YAHA 3E48A 4XX5A 5JD4A 4Q1DA 3T7RA 3SXJA 4JB2A 3EGWA 3PEWA 4PWZA 2KBEA 4AJIA 4EEZA 1G9SA 1ZD2P 2VHVA 2Q5QA 3C24A 4IG4A 5CW2A 1K4YA 1S9DA 3JQ6A 4BKOA 3AKCA 4U07A 4YT4A 4DCPA 4RF3A 1WBBA 2R62A 3IVRA 1NRXA 3A9WA 2O2XA 3IOBA 3MUFA 3SBEA 3WK9A 3IV9A 3VC3A 1XZKA 2I1KA 2V7GA 3RIXA 1C41A 1BTOA 4XVHA 3UHOA 2JFHA 2V6FA 1VYUA 3DHWC 1YB1A 5EHQA 2ZREA 3ZW3A 4JLWA 4X54A 5FL3A 1VJDA 3DKRA 3SE7A 3Q9UC 3E2PA 3FNEA 4KLZA 4YAOA 3FPFA 3UA4A 2GPWA 2WZCA 5L8VA 2DFTA 2PAAA 1KI6A 2C9YA 1VRVA 2F3PA 3C87A 2X1LA 4FVTA 3SZ3A 2O8DA 3VTKA 3EFEA 3HXPA 3STTA 1KT1A 2B2NA 4I1AA 1I0LA 1YRYE 4OBEA 1QMOE 1WXEA 2ECFA 4GOKA 4A92A 3MA5A 4A55A 3KJHA 4INZA 4BLRA 3ZVMA 3BFKA 3R75A 4NDAA 4XM0A 1XE3A 4BSXA 1H2BA 3S8MA 8OHMA 3UIPC 2VLBA 1P33A 2V0PA 3C5HA 3U13A 2OGZA 2JI9A 4JYMA 4HZUB 3I58A 3C3KA 4D1YA 6AT1A 2CXSA 3ZW7A 2QM8A 3TSAA 1TMKA 4ZCMA 1GGHA 1QGYA 1U1DA 4UEWA 1ISFA 4EKDA 4YRNA 1SKYE 3BCUA 3K9CA 2XSZD 4IDAA 4HDKB 1NP6A 1IMOA 4O2AB 2QZSA 1E8DA 3ZNGA 4WESA 3KQLA 5CM8B 2O23A 2FF7A 3LBNA 1MX4A 2E4YA 3C85A 3TEMA 3PJDA 5THXA 5L4NA 5I5EA 3QE2A 3BFPA 5JAHA 4RSHA 4QXOA 3OTIA 3HYRA 4LNBA 3ZY3A 2PQ0A 2V54A 3IPCA 5HS4A 2QLFA 3R6WA 3HJNA 2NUTA 3NQPA 2PS0A 3A1EA 3DOJA 4EAQA 1FE8A 1YA8A 2O2HA 3E4CA 1N0RA 1QYCA 4GMXA 3VPDA 5IULC 2YHBA 1RS0A 1UJ2A 3MD0A 1XALA 1MOPA 3REQB 2WMYA 2VBIA 2EZ9A 2GZHA 4R51A 4MUFA 4UHBA 3EVDA 1R5JA 1YS7A 3N59A 5IAEA 3UWDA 4EHFA 3I8SA 5KHOC 3TGOA 4B4DA 2R2LA 3QEJA 4DGQA 4Z4GA 3QI7A 1A27A 3L1IA 3NP7A 3H65A 2WNIA 3DVLA 1L7MA 3KS9A 4R6WA 5HYVA 4JYZA 3WO1A 4XAQA 4MMXB 2ZRPA 1YYHA 3NBFA 2QZAA 3HS3A 4AXHA 2QR2A 3HUTA 3M89A 3PXDA 3SLGA 4D9JA 2DH5A 4IUCS 5GZ3A 3R9AB 1CQIB 3ADDA 4FD3A 1N2CE 1PWHA 2ZZKA 1C1HA 3L07A 5I9IA 3B6JA 4WWPA 1OPXA 2O7QA 3HXEA 3CZ4A 5KAPA 4F0JA 4PS3A 1F8FA 4R2KA 4B3IA 1EYHA 1L9XA 4GP7A 2EC5A 1MX6A 4GMDA 2Q29A 4NRDA 2J3IA 2AJDA 3SZGA 1OHHD 4QG3A 5K3OA 1H4TA 2XD4A 2WDZA 1HL3A 2VJDA 1XEWX 1VIMA 4XI0A 4KR9A 1FP6A 2E82A 2QLBA 1LI4A 3R7SA 3JD0A 1DJQA 4RTLA 2EW2A 1XMPA 3KAPA 2I7CA 1O9HA 2BFDA 2VT2A 4JA9A 4GBGA 4JGBA 5HR5A 5FFFA 5KSYA 1DQPA 3EHRA 4OHMA 4MVJH 4PC6A 4HBDA 1F9AA 2GCPA 5EE0A 5LQRA 1U8EA 4K5AB 5G05C 2ZTHA 4WJLA 3QFRA 4QYMA 5ED0A 3IT0A 1SQSA 1G20E 3DXFA 3GFBA 3OUTA 1MB2A 5FPHA 1Z9BA 4B33A 4Q3LA 1BEEA 4J76A 3X1XA 4ZYVA 3BL6A 3FKQA 3LU1A 2RFAA 1T5DX 3MBOA 1Z18A 2XB8A 3EGDA 4HNRA 5KYYB 1HYEA 4JJIA 4LZLA 3FCAA 1R0LA 1FQJA 1K68A 3D8TA 1Q1GA 1YZQA 4Q3AA 3ULKA 4YCCA 4JI8B 1ZQ9A 3PZDA 1HG0A 3JYHA 4OB7A 2GETA 3DOHA 3Q40A 5HDQA 4BV3A 2GQ0A 4FT4A 3RC3A 5LBIA 1PJ8A 1T9DA 4PEVA 5EKSA 2WINI 5J2TB 2VDQB 1QYDA 1VI2A 4B3MB 2AN9A 2HBRA 2ZI5A 4EFDA 3BEOA 1J8MF 3F7OA 4KR6A 1OB2A 2OCYC 1MB4A 3CVPA 1T2AA 3DXYA 2ZWOA 3PF9A 4LNUB 4HVCA 4HNQA 1MP0A 3B5IA 5A03A 1G3QA 1BOFA 1NW6A 5LN1A 3C72A 5C3UA 1T2VA 4CZ2D 3CNOA 4I5DA 4U04A 2BFFA 1PTKA 3F3KA 4L85A 1R88A 5E9JA 3ZDEA 4EZEA 1EJ0A 2NXJA 4QYSA 1YI0A 2LTAA 3MF4A 3HVIA 4J7AA 3WADA 5A4JA 5BPPA 4BVEA 1N0WA 1M1NB 3ZE7A 2CXRA 1KU6A 1E61A 1T5LA 2Y6VA 4J2TA 3TSCA 3UCFA 1NXXA 3QV1A 5LWQA 3T1HB 2B6HA 4Q9HA 1UBUS 3LPZA 3Q73A 3X2SA 4NCNA 1A17A 2AXUA 2BUCA 2H85A 3RUAA 1L7OA 3TRJA 3EU9A 3UJHA 1A7KA 1Y6GA 3BF7A 3ED1A 3QUSA 3VTAA 3FZEA 1RQPA 2A35A 2FPKA 4QD3A 4ZOLF 2PEYA 2IO3C 3WQRA 2XB9A 5DX1A 4CQJA 3ZH2A 3KSRA 3KL2A 4H2DA 3WLIA 1ELWA 2I22A 1TQHA 3JAKA 2QMUA 4XR9A 2D62A 4NPHA 1Q74A 4K40A 4MLZA 3F1LA 2V5UA 1H6BA 3UBTA 1ZC4A 4EECA 4WNYA 3I61A 5IVHA 3GLHB 4IH9A 3E7FA 3H2SA 3KO8A 3HA7A 1I1HA 3KJEA 5IBRA 4F60A 3RVPA 2VHUA 1YC2A 4L15A 5ALIA 3UKUG 1K7XB 2IJGX 1KVUA 2TMYA 4QFCA 4BVBA 5IUNC 1EFRA 1ENYA 2O2IA 1NI1A 1WPXA 4JJ7A 3CH6A 1FQWA 3QOXA 1N6OA 1Y1SA 1EB9A 3G0DA 3OJOA 3B7BA 2DH6A 4DZZA 2X6IA 3DC2A 2XYGA 1M66A 5LOZA 1ZUHA 4YDWA 4XZ3A 4XI9A 3ESDA 1KSFX 1P5FA 1GEEA 3PE4A 2VAWA 1IEQA 2GCOB 1T2CA 3PICA 5AJUA 2MHKA 3I52A 2EFGA 4DLOA 1E2MA 2IHKA 4U6SA 4OVKA 5GJWC 1WF3A 1AQIA 1MFPA 5LQMA 3DDOA 4E2ZA 4HOQA 5C51B 1DKOA 5GIOE 4RGYA 3WY9A 4H3KB 5AQBA 1TQDA 5KWEA 3ZYKA 3VNVA 4E51A 3ACBA 3UC5A 3KUDA 4IILA 3K0HA 4R9NA 2HQRA 2EILE 4GS5A 1N5JA 4N8DA 4F06A 2IELA 3SJ7A 5BN4A 3SQNA 1PJAA 5H9WA 4DWWA 2ZZMA 1EFPB 3HN7A 4LMRA 1GCOA 3D9KA 4JLBA 4WESB 4XUEA 5DYWA 1IDN1 2ETBA 3FIUA 3VKWA 1FK8A 1B0UA 1DUIA 2AMVA 2EG5A 2JD1A 2YBDA 2KW5A 3SGHA 1SA0A 4GGOA 4ZRMA 3RC9A 3W0LB 4CIAA 5ARCA 3OZFA 4BUCA 1FDTA 4QTXA 5K7SA 5FINA 2G6TA 3GLKA 4DHWA 4COOA 4M7PA 1CRLA 1EPUA 1RXSA 3G8CA 1S3FA 3M1AA 4IFTA 3U3XA 5IK2D 3AF6A 3OJCA 3QEMA 3UIOC 4Q9KA 3K30A 2RHTA 3TD6A 1OA0A 4HH3C 4LX0A 2MCFA 3WK4A 4FMCF 4LXGA 4R3NA 2AA3A 3A9SA 1JHOA 4DRYA 3GAZA 3EZNA 4NZZA 1TQ4A 4NOMA 3TK1A 1NBME 2BJHA 2J9FB 2NYUA 1SVSA 1LRKA 3ICCA 3SICE 4GP6A 3WMGA 1VJGA 3EW9A 1IYGA 1J2JA 4U7JA 4V0OA 3HCCA 4RJKA 3G7NA 2ZR7A 3GQBA 4ZO4A 5TS2A 4KR2A 1UMDB 4RNDB 1SQ6A 3AEKA 3IEIA 5HI7A 1ZM9A 1XSEA 3W9YA 2NADA 2QSYA 5AJVB 2GJAA 3UQ3A 2QIOA 2F6RA 3K1JA 1UBKS 4P82A 2C4WA 1W9HA 2PX0A 4RMGA 2QRMA 5ELLA 5FYDA 4C6TB 3CNEA 2HJVA 1Q12A 2YY6A 2X0FA 4Y6SA 4BN0A 3W4JA 5JVDF 1BVHA 2CNKA 3IT3A 3W2HA 2UUCB 5B2ZA 1YH3A 2H17A 3PC3A 2P27A 3NZUA 1E5QA 5G41A 5IBPA 1C1XA 3KJXA 3JQAA 1H1TA 1NM5C 3B53X 2HJRA 5FR2A 4LRWA 5DYYA 3UA3A 2GGFA 1UBHS 2Z2XA 4WFQA 1R6XA 4E6HA 1G5PA 1F8UA 2E1RA 2QUJA 3QWBA 4BKRA 3U7HB 4H7YA 1F0KA 4OHUA 2OVBA 2AGVA 3WWCA 3I0MA 1N8KA 4I2ZA 1YNSA 3G0IA 4V3BA 5KWSA 1SOMA 2L6BA 2G1KA 2YIDA 3HCDA 4HAIA 2PZLA 3BB3A 1MV8A 1R6UA 1SK8A 3OZWA 1FL9A 4WW0A 4CQLA 4F3CA 3GLVA 3N2YA 4UAGA 3KQSA 1H8EA 4YBRA 4ZCSA 3ZZ1A 2IYUA 3PNMA 4C0KA 4F53A 1KDRA 2OG1A 3TYXA 1KO5A 1SBQA 1TAGA 4C7VA 3KR9A 4XGQA 4XR4A 4XWAA 4CYMA 1U2EA 1Y3IA 3PNBA 1T8YA 1CDEA 3FUMA 4CDRA 5IP5A 1IZ9A 1CE8A 5LZ8A 1P0IA 3E84A 5KTSA 3NIDB 4X94A 1R0ZA 2H6IA 1UF9A 3BG0B 2XAUA 4MUMA 1U0SY 4OYRA 1JPNA 1Z25A 4HQDA 3ZXPA 5K5EA 3M9LA 5EWMB 3LRXA 3SBDA 4BJHB 5BT8A 1ODSA 1G3RA 1PUJA 1LCIA 2D7JA 2FHSA 3T3GA 2V5AA 1ZITA 1MAVA 1R9NA 4ZJPA 3QB2A 1JH9A 4WAUA 3QUAA 4KVGA 3UXMA 3EDOA 2QRGA 4RH1A 1N1MA 2J08A 1Q83A 3FCOA 5EE1A 3ISTA 2EDCA 3PLNA 1UMKA 3HG7A 5EMKA 1VHLA 3T5CA 4YDOA 3WLJA 5TGZA 5J3JA 4R3UC 1QRUA 2F8LA 4LQCA 4HUTA 1H5NA 2WTMA 3EPKA 1RHJA 3CF4G 3JQ8A 3IMFA 3QMPA 1F17A 1QBQA 1CIJA 2XVXA 5AJYA 5JMOA 5CVJA 4AP6A 1BCRA 4MVJE 3I45A 3U1BA 2LAHA 4DTIA 4B31A 3AEXA 2E6KA 4BIMA 1ZISA 5IT4A 5B6IA 4UWFA 4UOEA 5BW8A 3VNBA 4Y0AA 2C2YA 3L6AA 1F3OA 4NFSA 5GGXA 4C22A 4R05A 4CUZA 5EIAA 5BXUA 5K0CA 1KY2A 2WHQA 3W8DA 5HMMA 3BORA 5L3SB 4WNAA 2HTFA 3KELA 2MYOA 2ODNA 2DGDA 1NOJA 2O14A 3T06B 5FA8A 4CQMD 3NC1C 4LRZA 3GL9A 1JX6A 1X1TA 4EYKA 2IYEA 1EFPA 1PK8A 2E4ZA 3SYMA 4X3OA 4AU1A 4UI9K 1QDEA 2BGUA 3X3HA 2ZYTX 4ME2A 1WPRA 2DC1A 2ZUUA 2EFDB 2IYTA 2HGSA 2AB0A 4W9MC 1RI1A 5T3YA 1RT9A 4B81A 1MB3A 1DP4A 1GJRA 1UDXA 1BHJA 1TK3A 1XVAA 2GERA 2ZS9A 3LGAA 3QVTA 3WK7A 1B23P 3VX3A 5GJBA 5KYXA 1NOKA 1NXVA 3QC1A 3HVRA 3AP3A 3AY6A 1EJ2A 3BB1A 2Z04A 4Q1BA 5FOUA 2JFGA 1T9HA 1JSCA 3PXCX 4Y1RA 2WHXA 4DCJA 4ETMA 5JISA 1UBJS 3MGKA 4Z7OB 2J5KA 1SMKA 2QUIA 2UKDA 3QLJA 4R1MA 2OV3A 1EX6A 3RSHA 1IHOA 4NZNA 3EZYA 1CS4C 2OBMA 4Q4LA 1T5IA 4JVNA 3IODA 2OLJA 3M5DA 2OWDA 4LHXA 5E4JA 5IC5A 3L40A 1O1TA 4PPNA 3BRSA 5DZSA 4KI7A 2UVPA 1U1EA 4R2MA 4AB1A 1A5EA 2OR3A 4FJ1A 1Y1TA 2POCA 1ORRA 1Y8AA 1GGKA 3DBHA 4G09A 3MWGA 3SKXA 4EG4A 4L9PA 3G82C 3BDAA 4R9UC 1NGSA 3U7RA 4Q1FA 4MB6A 2R68A 1Y9DA 1JSZA 5C4GB 1COWD 3B9BA 4U2GA 4BNHA 3VGJA 2ZIAA 3OTHA 4F5ZA 2GF2A 3TLZA 4KV7A 3ZFWA 4DUGD 2H1CA 4OMCA 1IN5A 3O38A 3INRA 2PH3A 3L8YA 4D5EA 2JI4A 2VSOA 4JP5A 2X9VA 4IMPA 1Z34A 2DT8A 2PD4A 2ISCA 3CUKA 4LJ4A 3I73A 1ZD4A 4LCEA 4MJ3A 5E2BA 4BFUA 3WLMA 4BP8A 3N8HA 4ENQA 4NFHA 2PUDA 2P77A 1MJFA 3HIZA 1XVVA 1WXFA 1OI4A 2H4YA 2P79A 1A2OA 3CSDA 3FETA 3MFYA 1NMEA 4B45A 2GRUA 2OB2A 2ZRHA 4LJSA 4EKNB 1YGPA 2YNQA 1A8QA 1E99A 1PFUA 4P1ZA 3NT4A 3G1TA 4PIMA 5ECGC 1E8ZA 4L4YA 2W6NA 4NENA 2H0AA 1XCGB 3PZRA 3CF2A 1QG6A 1Y9AA 1NUSA 2X4DA 2G1JA 4M0LA 3SXPA 4P2GA 3K2BA 2XMBA 2BYTA 1YDGA 4KJZA 5D86A 4RD0A 2PM6A 2VLIA 3ILSA 4R1SA 1NA3A 5IXJA 3D4LA 5I47A 1I51A 1Z6ZA 2W58A 3LL7A 3MRXA 2EWVA 1BRMA 4YREA 2YHIA 1ITZA 3ZPJA 3DO8A 4WY5A 1JB1A 4H1VA 4KEAA 1OFGA 3C3CA 4ZOCA 4EQ6A 3LUJA 3ZWDA 3HV0A 2VH1A 2EZTA 1I94B 1XZLA 2P9UG 2J5RA 2YZGA 4PG4A 2G77B 2QYHA 5FWAA 1IJBA 1N2ZA 3CLKA 4WOCA 2BBSA 4BTAA 4MI1A 4PO9A 1L3BA 1W96A 4NCBA 1ENPA 4URFA 5CNJA 4OATA 1MXHA 4GHWA 2FOLA 3MWYW 3C6MA 4G4SP 1B6RA 1FLVA 3B13A 1Y1PA 2D1YA 3GA5A 3R7WA 4AZ0A 4U7EB 4MYDA 2BUGA 3M34A 3GEEA 5BYJA 1XNHA 3O8RA 4K86A 1KPGA 3KUXA 3FUVA 3B2EA 2CXPA 2IU3A 2VI5A 3S44A 1CQJA 3O83A 1VSVA 4WMLA 1HDZA 1B1CA 2Y1LE 3CZQA 3AG4E 2WD7A 3HJUA 3KWFA 3PTZA 1N4QA 3Q2KA 2MU1A 4XRGA 1NSYA 2IYOA 3NCHA 1OU4A 3BMNB 4K9SA 1KOLA 2IK8A 2HDOA 2YHAA 3A6KA 4YUAA 3JV7A 4WL0A 5IKMA 3DPYA 3EJWA 2QW0X 1X74A 2JC3A 1O4VA 2H1IA 2KBFA 4D9GA 4HSGA 4I9HA 4FD2A 1Q7CA 3NFYA 1M74A 3VZCA 2X1VA 2C58A 4E6PA 4G1FA 1CUDA 4XLZA 3THYB 1RIIA 4WJKB 4F6LA 4BEPA 5EILA 1YMUA 1P81A 3DZFA 3NBAA 1M2FA 1ZNZA 2D0IA 2CFSA 5HKOA 2ZJ3A 3ZZTA 1J25A 3DW1X 1GKLA 3HKBB 3NRBA 4PRLA 3RYTC 2P0AA 1H3EA 2ZJFA 1PGNA 1P7WA 1W0KD 1M75A 2B9VA 2Q6KA 2AFRA 2ZFUA 4MUBA 4YYEA 4ALJA 3W9FA 2GRJA 1ZX1A 4AMYA 5KDOA 2A0YA 4WZZA 2P9IG 5F9HA 4HRLA 3DDWA 2DHQA 3B5EA 4R1UA 4JEIA 2C5LA 4UFOA 1QO0D 4ZV4A 3EHNA 5EINA 2WZQA 3S7BA 2FRDA 4AK9A 4EA6A 2PXCA 3JWGA 5T64A 4U7WA 4IZ6A 3UATA 1U65A 1FTSA 2V0NA 4KAXA 3IL2A 4PO3X 4HOTA 1JQLB 4WZAE 5J4KA 1ZB1A 2W22A 3GELA 4K9KA 1BX1A 4J49A 5D1HA 4Y6PA 5BURA 4BNFA 1NBWB 2HN9A 4YJ3B 1W5SA 2PL2A 2EP5A 4ZARA 3L54A 1LRJA 4AIIA 4OK3A 3FGPA 4Z4HA 2FPWA 3L4KA 4J2OA 3OOSA 5EXEA 1QC5B 2Z2ZA 4EY4A 1BLXB 3PPWA 3DCNA 2JGAA 2XUOA 2K2WA 4O6VA 1GNVA 5J5AA 3B85A 4HJRA 3WO0A 1ZUIA 4G1VA 3AR7A 5D01A 3MJSA 2WOOA 4TL8A 1UKEA 4BNMA 5TJHA 1RBYA 4LRSB 1EHIA 4LHSA 4KWHA 3RVMA 4YNDA 2EJWA 3IR7A 4MICA 3U26A 1N94A 2FQ1A 5B53A 1YA4A 2E4XA 1G8KA 1MO5A 2Z1MA 2ZUBA 4MH0R 3UCXA 3QM1A 3BTVA 4Y2TA 3PTAA 2LXMA 5B4TA 2XUFA 4ABTA 3E9DA 1M2HA 2F9LA 4OQZA 4XDYA 4ANXA 1VMAA 1BNCA 1AGRA 1LXCA 2IIBA 2WU8A 3UV6A 5TQJA 3CLTC 3IAM1 3WL8A 2DWQA 3OZIA 1MN6A 2H2FA 1DMRA 1PR1A 3FDZA 4ICIA 3ACCA 2NO4A 2C2LA 4LQDA 4QVIA 1JWGA 1KOJA 5EZYF 5FHRA 2M6RA 3E30A 3ICOA 3NOOA 3KJGA 3LWZA 1M2KA 4PYRA 1Y6FA 2H6HA 1JR3D 1Y8ZA 3OX2A 4FKMA 4ZI7F 1B1AA 2BP7A 5J4LA 4CW7A 3UMJA 2DYRE 1TR4A 1O08A 2QI9C 3SZOA 7YASA 4GTMA 1C7QA 2B35A 3NDPA 4RVCA 4NYJQ 1MB0A 1MGOA 2ORED 3EULA 1VPEA 2HBZA 2PSJA 1IXVA 3E6AA 3ROXA 4EKYA 5CEDB 4BYMA 3E22B 2J3KA 1D04A 4M98A 4OHFA 3F73A 1LF8A 2Z6AA 3W8RA 2YHIB 3OY7A 2GW1A 5FTWA 3CH4B 5T41A 1BYIA 1H0AA 2L17A 3O3OB 4WN9A 2ZU6B 3HSKA 2ATEA 2Q3LA 4Y98A 3AESA 4WVLA 5E7QA 5FH9A 1YJAA 3FH0A 3DLIA 2H1SA 3VFDA 2ETVA 1H2FA 1M2VA 1TE2A 2PKYX 4Q19A 2MDTA 3HN6A 2IP2A 3KUUA 1NJFA 3MVEA 5HZKA 1N75A 1YS4A 4KR3A 3RHTA 4RKQA 1DHRA 2XBUA 3BZWA 5CB8A 1LFDB 2C77A 3QITA 4IJ6A 3DWFA 5JFTA 2WB4A 3OT1A 1MW8X 4BMZA 2HRBA 5AUOB 2IXGA 4C76A 3EHDA 4P0QB 3ADPA 1GPMA 3JD1A 1Z0SA 4KGDA 3RUHA 3HJGA 3V1UA 1ONOA 4DWOA 4FNGA 3HXKA 2FR0A 3GRRA 5EP4A 3UKOA 1W87A 4CEIA 1UBNA 1W59A 2AZDA 2H1FA 2H31A 1BU5A 2HHAA 1HFKA 4IQ8A 4KTVE 2O8BA 5EMHA 3TW8B 1HU3A 3BQOA 1A8IA 3ZGLA 4B3SB 5CRIA 4AEZC 1EGHA 4F8JA 4ZVOA 5FUVA 3I4GA 2JIMA 3WRVA 1JEDA 4K9PA 4BZPA 5LNK6 4MWZA 2YQ8A 2IDKA 4Z7JA 1RABA 4L75A 4D4JA 2KBXA 5HVNA 1OKKD 2G9ZA 2F17A 1MZCA 5FADA 1JWBB 2YXDA 3QNKA 5ENSD 4JNCA 3M5CA 4OU4A 2BGNA 4KV9A 3V1MA 3HSSA 2WMOA 2HPAA 2PVSA 3EEFA 3NU1A 3W06A 1JLSA 2OEPA 3CVVA 2DWOA 4J16A 3A14A 3A37A 3K2QA 3PXGA 1E2FA 4HZIA 3TQOA 3L13A 2CK3A 2VDNB 3D6TB 5CFZA 1COZA 1ZWKA 2CNOA 3H9QA 4KQFA 3VR5H 1QHFA 1WCXA 4LZWA 5CA0A 4DRZA 4EYQA 4D74A 1LZKA 5B1HA 5JR3A 1NV9A 4ZOAA 2NIPA 3GLUA 4BECA 3OLYA 1X6VA 4X9XA 4WIAA 3WYFA 2H2AA 2VP0A 3P7MA 1HS6A 4JLVA 1XXHB 5P8WA 3J5PA 4DLVA 2GK6A 1MQAA 3TTSA 1O1RA 1UPTA 3KZKA 1QYRA 4RY8A 4YWJA 4DDHA 1G59A 4WH0A 2H2HA 4FA6A 4M2LA 2HWKA 1TM5E 3H19A 1B41A 3QSYA 3I01M 4PGHA 5B1DA 3C8DA 2Z4RA 3G23A 5LCWC 1EK1A 5B7GA 2PSDA 4BNJA 3CVUA 2JKVA 2PZIA 3LGSA 1N92A 3WHLA 2A9JA 2YZNA 4M0FA 4UBKA 1EI9A 2ZGVA 4AJKA 5HSGA 5K8JB 3R76A 2CVPA 1E4EA 3SIWA 4DAEA 1FFXB 2CNWD 1TCVA 4IIEA 2IS6A 2X14A 5AJTA 2CNDA 3CR7A 2X2FA 1E79A 2F1IA 2OBBA 2Z3WA 1KZHA 4DM7A 1XP5A 3RBZA 5F9FA 2YFKA 1Z28A 2Y1DA 3BG1B 3QDNA 2XZTG 4YLGA 4US2R 2FF5A 1KY4A 1TO2E 4GZ6A 4J8YA 1J24A 1EEHA 1FYFA 2B8NA 2R6DA 2JAHA 3BXPA 3OPYB 4ZVTA 5GJCA 1QFXA 5AUPB 5BR1A 5E2AA 4L8LA 1NDUA 1GT6A 5K0BA 5THKA 5GIPE 3JVEA 4KRFA 4AZTA 4GUAA 2AF3C 2X9GA 3QX9A 4DRXE 1LQUA 5JSUA 4LSZE 1D4ZA 1ONBA 2HXSA 2VHZA 3SIXA 1CZKA 5HKKD 1UPXA 4IULA 2CJXA 4LE0A 1CQJB 1QOQB 3LHFA 4G5YA 3CLUC 3ESZA 5B1BE 1AO0A 1M6WA 5AVKA 1UBGA 4XD2A 2HIMA 4FOLA 5G40A 4H1TA 3LT5A 4KAJA 2YZMA 3A28A 2IONA 2HSGA 4IXNA 2FJAB 1E7WA 2IODA 4OQMA 2IBSA 2EZUA 2PVCA 2Q46A 4JIMA 3PQ5A 4OYYA 1QYMA 1EVYA 2A5YB 3NKLA 4BCDA 4E3ZA 1MBZA 4N0EA 3GGPA 2ZAMA 3QFFA 5KJ1A 2FAXA 4TMZA 2HA5A 4QT4A 1UFKA 4K5CA 3TNYA 3GFQA 3QLUC 4G86A 2Q6IA 4IIXA 5D2CA 3RYFA 2I5PO 2A5UA 4MAAA 1AKUA 4WPGA 5HUHA 3MA0A 1QZUA 3N53A 1YE3A 3IO3A 4CQMB 3PQEA 1CDZA 3W77A 3MCUA 2GZAA 4XQ0A 2B20A 1W2HA 2JGKA 2AS0A 3DEPA 4JQZA 4GVPA 3M6VA 4GRDA 4KQHA 4UTPA 4S05A 2WIDA 1WG0A 3D64A 4CT4A 3ZGNA 1ZHHA 1V0JA 2C2BA 4HAVA 5CX4A 1S2LA 1TZJA 3GFGA 1SUBA 3LWNA 3M4JA 5KYUB 5KO2A 1HEYA 2GPNA 4HNSA 1QE3A 4KGZA 4F4IA 1R0KA 3BBPA 4ZGGA 2PMDA 3C45A 1B26A 4BATA 4CQLB 2X19A 1MDFA 5AIAA 4C7XA 5LQDA 1YFZA 4TV9A 2VFAA 1Z17A 3TRHA 2GDZA 2VHYA 4BZQA 4GYWA 3RAPR 1XQ1A 1N5LA 4LNGA 5DP2A 3K1AB 2O19A 2DFVA 1QTNA 3CU5A 5AW9A 3F8SA 4DV4B 1NATA 2YWGA 2GAIA 1JYSA 4JU9A 4BFWA 1E1QD 4NV3A 3DLHA 4C03A 4YV7A 3WJ1A 2P9SG 1WXDA 2QMOA 4K8RB 3BC1A 1JA0A 1BXRB 1FLAA 4IJVA 5ERXA 4DA8A 2J8ZA 1JQEA 4NH0A 1T4GA 2Q2OA 2HRZA 4H27A 3HMQA 3GHYA 4MR9B 1L5GB 3A9CA 3H13A 3O90A 1DEXA 3JZFA 4MPPA 4DM3A 5BN3A 4YMHA 3U56A 3VPBA 2HDWA 2R1UA 3V2GA 1OCZE 5EKQD 2PSEA 2Z1DA 3NUGA 3QQ5A 3PNVA 4IV8A 3RS8A 3V97A 2AV6A 1XMOB 5FZRA 4KRXA 4CM7A 4EUKA 4C2AA 1P1BA 3WKDA 2I99A 4YUZA 1G66A 2XCUA 4KYOB 2ES4A 2G71A 2CL0X 2YVLA 3FUCA 3IAEA 3R24A 1BMFA 3JD3A 1RLTA 3IDOA 3WV5A 4QBGB 3HHMA 2IYZA 2XDQB 3F90A 1HLGA 1E96B 4WUVA 3AC0A 2BM1A 3FHLA 3DH0A 4OPMA 2DM6A 3VYTB 4HLLA 5DMXA 4B2YA 2LAIA 4JR2A 4U95D 3ME5A 5EYPB 4RCVA 3MNFA 3ZJVA 2FN7A 1PO7A 4IIDA 3KV1A 3ZC3A 1NJ8A 1IEXA 1NVGA 2EBWA 2I2DA 3P71T 1S2DA 3RO3A 3PWTA 3B78A 1PWEA 4R7TA 3AGQA 4UI9J 3OA2A 4RD6A 1DOHA 1ZGAA 3KSLA 4GPKA 3JRNA 3J7AC 3E5RA 3K0CA 1OYVA 4UQLA 5A5GA 4OMFG 2O8BB 1N52A 3AJAA 4L9SA 4M0CA 4YWHA 3AL0C 3DBIA 1E7YA 2EJCA 3MWDA 2I6FA 2F8MA 2GHIA 3P5SA 4DNFA 2X6RA 2ZKIA 3AHEA 3KQVA 3RASA 1S89A 1RQNA 1C30B 4HOYA 3L1HA 1XGWA 4YMIA 2IXTA 2W2XA 2XF8A 3C2QA 4IGIA 4W5TA 5TMEA 1E2JA 1Q1BA 2E2WA 3RYIB 4YAIA 4KUGA 3KC2A 4CG1A 2QD3A 3IVAA 4X1OA 5FHQA 3X2FA 3TB4A 3PUVA 2W2QA 3MM4A 2WXHA 3WRYA 4MV9A 4KMMA 4P3NA 2XECA 5AM3A 5ISMA 3U3KA 2V1XA 1Z26A 3BBLA 2JLCA 4Y2YA 4P92A 3D9OA 2A92A 4YXWD 1FPQA 1AS0A 4HKTA 2KQUA 4ZEXA 2XIJA 3Q3JB 4UNPA 1ENZA 3LVQE 2V6BA 3PIIA 1KWKA 3BWDD 1LJUA 3IQEA 1W6UA 4JV5B 1M67A 2W90A 1QVRA 5FJJA 2PXHA 2WVIA 4FMDF 1KI2A 1Z0IA 4QBTA 3MT9A 5KPJA 3CPHA 5AMXA 3UT7A 1FRVA 3DTYA 3EQ2A 4JUCA 4LY0A 1Y9JA 3ML9A 2Q6VA 5A6CA 2JAOA 2VHWA 3YASA 4DIBA 1VBMA 2VPZA 5JAMA 4N9QA 5EKXA 3TCKA 3FPEA 2J9ZB 1Q21A 3DFMA 4WCVA 3ZWAA 4C6HA 3GO4A 3MCTA 3UN1A 5IKPA 2ZWPA 2AE2A 5KX5B 4GL4A 1QCDA 1YA6A 2PTHA 2B1RA 2OCCE 3H75A 1JALA 2MYTA 3GFOA 2WD8A 4X60A 2FZCA 2ODPA 1OXMA 4OL0A 2FZLA 3LUFA 4IJKA 2Z6QA 2V6IA 1XJCA 1BHO1 2PTGA 5CPFA 1CNMA 4BXOB 3D02A 2GTPA 2OT3B 1U99A 3L6OO 2XT9A 2LDXA 1LV7A 4O59O 1EDBA 2QTZA 4B4WA 5BN4B 1JFFA 3RS0A 2L19A 2ZGGA 1DXOA 1IG3A 4H6VA 1VZ3A 5HFNA 2UY1B 4MV4A 2E49A 2HIAA 1OWNA 5EE9A 1TYEB 3NBXX 1J06A 1PL7A 3B70A 4AWXA 5JAIA 1G19A 4UNQA 4KGXA 4UTNA 4W5OA 2P90A 1Y98A 1YAJA 2C82A 2Q7FA 1FP1D 3A9VA 1OLXA 1HKUA 2R25B 5H83A 3S70A 1YD7A 1Q57A 3G59A 4F97A 2Q7XA 3ONFA 2ERXA 1JQJC 4K9DA 3U7IA 1NVKA 1EXNA 4ZT7A 1GUYA 1NVWQ 1CRQA 3KEZA 2ZB3A 3PKJA 3KDSE 1UK6A 2CMKA 2FSPA 4ILKA 2AG5A 5DXAA 1V43A 3HB9A 4PANA 1X14A 3FNBA 3PD0A 1VIAA 4QWWA 1NUUA 3IP1A 3CSTA 4HDRA 4PY2A 2QVXX 3DZHA 2DRIA 1WB4A 4N7MA 3PC6A 4I1OB 1QB7A 1RWQA 5CDUA 3L82A 1N2CA 1YZTA 2SBTA 3TQQA 3O8QA 3HYLA 1FZQA 2R7NA 1L1EA 5EQTA 4EZLA 3BCSA 4PZ0A 1KDZA 3S2YA 2QTHA 3K3PA 2O2EA 1ATZA 1EE2A 3AIKA 4WX2B 2C4VA 3RF6A 1J0AA 2QP3A 2WVHA 1GGNA 4WZBA 5CNKA 2X2OA 5JE8A 2R5FA 4FONA 3ZOZA 3Q8MA 2I6UA 2NC9A 1CUBA 3AUKA 1OIXA 3GK3A 4FCVA 4EHMA 3D7RA 3GPIA 3SHWA 5ED4A 2HWWA 1V4BA 1I2DA 1X7XA 2ZPAA 4IOJA 5CURA 2XWPA 3TAXA 3QELA 4J7CA 4OXYA 2HJHA 1DTWA 4JK3A 4ID3A 4DNXA 3TLBA 2JIDA 5M04A 4MQFB 3NOQA 2AFHB 2EFCB 4UCXA 5HKLA 4MB2A 4LFAB 2G06A 3GU3A 2AVDA 5FNZA 3KEMA 3VZDA 1KHTA 4YAGA 1CS0A 2PK3A 1Y42X 2MINB 4L4UA 2R60A 2B5OA 3ASFA 4N5MA 5JOQA 3DAHA 3WGYA 4BNWA 1TECE 4W9NA 5SYNA 2ZXUA 4DIEA 1P1CA 3RS7A 5A5EA 3L0CA 1L5YA 1QQ5A 2XPIA 5T8KC 4I1YA 1GYRA 2ZUEA 4JKOA 4K6CA 3IRVA 3VR4H 2AG8A 5HJ5A 3UPTA 3LHIA 1AE1A 1Y7HA 3BWEA 3F46A 3G68A 4INJA 3SYLA 1D0VA 2AW5A 4D25A 4G0UA 3BGDA 2X5KO 3SR4A 2XGJA 4BGVA 1NNUA 2XCIA 4PAWA 4BO0A 1RFLA 1TVEA 4DMRA 4JKIA 1J21A 3AR2A 4PBSA 4D6PA 1ST3A 5IDQA 4F5YA 5JCPA 4WHMA 3KU4A 3OOYA 2X5OA 3NZEA 3WV4A 1VP3A 2YOHA 1G6Q1 2FB9A 3RHZA 3TXYA 4BAZA 3KQNA 1UT6A 1EZZA 4P36A 4LY6A 4CHTA 4J8FA 3BT3A 1KFKB 4AY6A 2B98A 2R8PA 1JRLA 4KIWA 3WP1B 3UINC 3ZWXA 3C3QA 1ZL0A 3AS5A 5FUBA 3BJIC 2P91A 3SXUB 1DJOA 3K1AA 4G9GA 4H1HA 3WQBA 5DN6A 1CDOA 3DDSA 1RJWA 2X5HA 2YMPA 1JHRA 1D1SA 4PIVA 2VZ0A 3E35A 4NPAA 3FPBA 1UXHA 4EQ6B 1YT5A 3VZRA 3F1KA 2L6JA 1JAZA 3EIUA 5JH7A 4N41A 4JBHA 3TXAA 1YDFA 1UBRS 1PD1A 1YRBA 3K9WA 3UQYS 2KATA 5A1JA 2BELA 2VXCA 1IPEA 3I0NA 4NYMQ 3VOBA 5B3JC 3TWVA 4BAGA 4GSKA 3T5AA 4Q6BA 5G0SA 3U4QB 1UR5A 4OAPA 1W7AA 3CKBA