4N3CA

Crystal structure of human o-glcnac transferase bound to a peptide from hcf-1 pro-repeat2(1-26) and udp-glcnac
Total Genus 279
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
279
sequence length
716
structure length
697
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/substrate
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title HCF-1 is cleaved in the active site of O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 279
structure length 697
sequence length 716
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3cA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3cA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4n3cA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4n3cA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n3cA03
2PZIA 1PC2A 1C8KA 5LCWC 4BQIA 2AV6A 5G04J 2SKEA 3IAAA 1FU7A 1XC7A 4WACA 1ZU2A 4N2QA 2GT1A 4Z5XA 1TJCA 1XL0A 3S7DA 4RG6A 3TSAA 1FU4A 3MRVA 5ARFA 2VGYA 4IN3B 4RG9A 4U07A 3GZ2A 4YVOA 3G2JA 4X7PA 5GPBA 3ASGA 4BWRA 1Y6FA 5G05J 3T7DA 3NAZA 1ABBA 5JJ7A 4EJ2A 1VGVA 3PE4A 2IYAA 1JIVA 1GZ5A 3G2KA 3VUEA 2VSYA 3CKCA 4XI0A 1L5RA 5TMBA 4UQYA 3D0QA 4G24A 3NC4A 1K08A 3DZCA 4JA9A 3CUTA 2IV3A 3CVPA 2FFRA 4EKEA 1NA3A 1IXYA 2KS6A 4LDPA 4XI9A 3G2NA 5HI7A 3CEQA 3Q47B 3NP9A 1HH8A 3S28A 3WAGA 4N39A 4YI3A 1AHPA 4RBNA 5BW8C 1NLMA 2QLLA 4F3VA 5LCWJ 2QN9A 3S2UA 4HOQA 2XGSA 3L7AA 4EQFA 3CK7A 2KATA 1LWNA 3QKWA 3ZCRA 2WPVA 5EKQD 4HOTA 1KT1A 2UY1B 4WUYA 9GPBA 1Y8ZA 3CUWA 2R4UA 3PE3A 1F0KA 4WADA 5KJNA 5D0OD 4BQEA 4J8FA 3Q3IA 4Y6CA 4WHMA 2XGOA 3LY8A 2VQ2A 2VGXA 4GCOA 2XGMA 2Q7FA 2IYFA 1P4GA 4MI3A 3URZA 2GPAA 3Q4AB 3ASHA 1OUVA 1PNVA 3T3HA 3RO3A 3Q3HA 3T3IA 4YUAA 4H7XA 3CK8A 5LQDA 4HOUA 1L5SA 3CVQA 2GM9A 1SXPA 2WQHA 4AN4A 4RIIA 4CDRA 5JJTA 3D0RA 5FZQA 1C8LA 2Y4UA 2QRGA 4GZ5A 4KBQA 2C0MA 3UQ3A 3ZPJA 1HLFA 1NA0A 2F9FA 3UYLA 2YHCA 1WUTA 4EL0A 3CK9A 1NVKA 5CHEE 1A8IA 4GCNA 4N5CA 2QN3A 3MEKA 1XNFA 4I9EA 2ACWA 4ME2A 3IA7A 3MSCA 5AYWD 5D01A 3O48A 3LKUA 2VGXB 2AZDA 4W6QA 4BT8A 3OXGA 2ONDA 4BQFA 1WAO1 2XA2A 3BCSA 2E2EA 4YVQC 3EBOA 2C0LA 2ACVA 1H5UA 3H4TA 3FROA 3FP3A 1EXVA 3OY2A 3CEMA 3AS5A 4CTNA 3LYAA 1F6DA 3SYMA 5KJKA 1NZFA 1ELWA 5I45A 2C4MA 2X6QA 5TVGA 3L79A 1Z8DA 4QLBA 5ARGA 3MKRA 3DD1A 1B4DA 3RU0A 1GFZA 3SF4A 2ZB2A 3WADA 3OKPA 4X7MA 1FTQA 2QN7A 3RT1A 1IHGA 4GZ6A 2R4TA 4A1SA 2VCEA 3QWVA 3MTAA 3O3CA 1GPAA 3S7JA 1E1YA 2R66A 4Y6WA 2VCHA 1FTYA 1P2BA 3FWVA 3TGOA 3QKYA 4GA1A 2IW1A 2ATIA 2J9QA 3VDMA 4GZ3A 3NCHA 4CTMA 3S0JA 2PRIA 3VUFA 4AY5A 2F3PA 4GYWA 2BFWA 1L5WA 1WM5A 3MQFA 3E3OA 1WV0A 3OTGA 5FJYA 5A7DB 3KD7A 5A6CA 4UI9K 2GJ4A 1NOKA 2P6PA 1KLXA 2XA1A 4GPBA 4KXKB 1WUYA 3BCUA 3MTBA 3MTDA 3ZCPA 5IKPA 3KAEA 4HOSA 4N3CA 1PSWA 3MV2B 3QHPA 2QRMA 2XCUA 1RZVA 4CTOA 3OKCA 2FEZA 1FU8A 2QN8A 2VYIA 5FTPA 5DIZA 4CGVA 3EBPA 5JTTA 1JG7A 4U0ZA 3C48A 4I2WA 2YJNA 3TG5A 4REMA 2JZCA 3BCRA 2O6LA 2R68A 2L6JA 3RO2A 3VTXA 1K06A 3MBOA 2QN2A 3GPBA 3E3LA 2G9QA 1WV1A 6GPBA 3ZHEA 1NOJA 3ASFA 5DXFA 3BD8A 5IKOA 3MRXA 4F9FA 1B89A 3MA5A 3OT5A 4F97A 3R9AB 2FF4A 3ZN3A 4AY6A 4GA2A 4GYOA 4I9CA 1LWOA 4N2SA 1UQUA 1HZ4A 2FBNA 3LY7A 4NRHB 1QKJA 1WW2A 4HLNA 3PDNA 5BNWA 2GEJA 1XL1A 2YQ8A 3GYZA 3G2LA 3VDNB 4U0SA 7GPBA 2BGTA 1JIUA 2DBAA 2KCVA 5HXAA 4H7YA 3SZ7A 3CUVA 2QFCA 5KJLA 4UQXA 3HBFA 4I1AA 2IFUA 4BT9A 4G23A 3RSCA 3S29A 1C3JA 3CX4A 5M72A 1XOIA 3MT8A 1XV5A 4J8DA 1RRVA 2NC9A 5CCLA 4LEUA 2X0DA 2QRHA 2PYIA 3GUHA 3T5TA 1L6IA 2I6HA 3GZ1A 3H4IA 3AMVA 3MT9A 2PRJA 5CCMA 4YNDA 4RENA 5DBKA 2HYZA 3T3EA 2H1HA 2XMPA 4UI9C 3CVLA 1NOIA 4O6FA 3UPVA 2IF4A 4GPKA 3BDAA 3OTHA 1RZUA 2SKDA 4N3BA 3BEOA 5D00A 2VSNA 4G26A 1P4HA 1PN3A 2BUGA 3S7FA 4CGWA 1IYGA 1WW3A 4AMGA 3L7CA 1PYGA 1XKXA 5DLDA 1NZNA 2XA9A 2AVPA 4BTAA 4AM9A 4M7PA 4NC9A 3RHZA 3CUYA 3ZCVA 1FA9A 4ABNA 2QZSA 2PQRA 1P2DA 3Q5MA 1FTWA 4WNFA 4MRAA 3MRTA 4FZRA 1Y8MA 2XCCA 1ZBPA 1Z6QA 2C9ZA 3C4QA 4B94A 2JJMA 4MICA 4X7RA 2Y4TA 3RJVA 4KQ1A 5FT9A 3OY7A 2PQNA 4G2VA 4WNGA 3IEGA 5D0QD 2F3QA 4N9WA 3L7BA 4XIFA 2FO7A 4KQ2A 3OKAA 2WTXA 5JTUA 4PQGA 5FZRA 4UI9J 2GEKA 1L5QA 4F96A 1YA6A 3FFLA 2G9RA 1IIRA 2G9UA 5EX0A 2QLNA 4AIFA 1Z62A 2KCKA 2BISA 3ZGQA 3S7BA 3CUUA 4I2ZA 2OFFA 1L5VA 4HWGA 4MHSA 2LNIA 3JYSA 1BX3A 4EL5A 3HYMB 3MS4A 4GYYA 3NB0A 1E4OA 2C1XA 3QWWA 3VTYA 1UQTA 3OTIA 4EKYA 1QM5A 3AS4A 1GGNA 3G2IA 3ZFWA 3CEJA 5KJMA 3RSZA 1NZDA 3T3DA 3U4TA 2UWJG 3L01A 1JG6A 2H1FA 4BFCA 3D1JA 1O6CA 3DDSA 3BD6A 4X6LA 1C50A 1P4JA 1EM6A 2ECPA 3CKBA 1ELRA 2PQ6A 3WC4A 4JHRA 2UY1A 1P2GA 1W3BA 4LEIA 3BEEA 3HBMA 3HBNA 1QZ2A 4M60A 2X6RA 4RIHA 3NPAA 3UUXA 4N3AA 2FI7A 3N71A 1KT0A 3LCAA 2GPNA 4L22A 2LSUA 2XEVA 3L7DA 4MI6A 4KQMA 2XPIA 2KC7A 2QRPA 2F3SA 3AS8A 3COPA 1Z6PA 2HR2A 3UYKA 4G1TA 4U0UA 1GPBA 2JLBA 3OXFA 3MS2A 3C4VA 4U04A 4JA7A 3ESKA 3CV3A 5DU2A 3CVNA 3U3WA 4I17A 3MV3B 1UZUA 2XCIA 3MS7A 3Q15A 3T3GA 5ENZA 2AW3A 5EX3A 4RIFA 2FETA 2P58C 3S27A 8GPBA 3CEHA 1P5QA 2R5SA 3Q49B 3QWPA 3ZHEB 5TMDA 1E96B 3WXXA 2IV7A 3QOUA 2X0FA 3ZCQA 5TMEA 3ULQA 2LSVA 4G2TA 3GW4A 2R60A 2ASVA 4KYOB 5HQ8A 4BTBA 3TAXA 1AXRA 3ZCSA 3NP7A 3RIBA 1JEJA 4GA0A 2QNBA 4MHOA 4RIGA 2IEGA 2AMVA 1GPYA 2F3UA 2MHKA 1YGPA 2C1ZA 4J0UA 2VG8A 1FS4A 1V4VA 4JL0A 2GPBA 4WNEA 3KS2A 3ZCUA 1FCHA 2C2LA 2HO1A 4J8EA 3TOVA 2X0EA 2OOEA 4RELA 2QLMA 1A17A 3SYRA 2PL2A 1GG8A 1JIXA 4FKZA 3CV0A 2QRQA 2GW1A 1SXQA 2KCLA 5G04C 2PYDA 1Y6GA 4NQ0A 4G25A 3RKVA 2G9VA 3EDTB 4UQZA 5JJ6A 1HXIA 1J39A 1L7XA 3NF1A 3BD7A 3G2HA 2V5FA 1P29A 4NESA 3ASDA 3ZCTA 5C1DA 2SKCA 1FC0A 5G05C 2Q6VA 1QQEA 1YA0A 2HY7A 4RIEA 3TG4A 4AMBA 4HORA 3DDWA 2QN1A 1M5RA 2IUYA 4NEQA 2FF5A 3E4BA 3MT7A 4M83A 4MI9A 2XCBA 3OXLA 3LPZA 4WNDA 2IEIA 1KTIA 2BGUA 3LY9A 4APOA 3HBJA 3Q3EA 5BT1A 4W9RA 3E3NA 4YI5A 3QDNA 5FZSA 3K9IA
chains in the Genus database with same CATH superfamily
4B85A 2EIME 2SKEA 1SULA 3UAVA 3AHDA 1MDBA 5BO5A 5LUBA 1AH2A 4UWFA 3IBCA 4E6HA 4AD8A 5FQOA 3DD5A 5AKLA 4IXNA 3HA3A 3MMXA 4GL4A 4KGZA 3KTAA 4FNOA 4R51A 2GK6A 3CCFA 3UK1A 4JI0B 4MO9A 5AOXA 3TFQA 4P22A 3W79A 2FFBA 4UBIA 1XNHA 3K9NA 3Q79A 4LI0A 2ILRA 4N6OA 1W2HA 3DNPA 1IBCA 4M0UA 4J9UE 3IDZA 4O4HB 4EJSA 3BZWA 3GD7A 1I32A 1N0HA 4G9EA 4JDPA 2IU3A 3PVSA 4AJLA 1NI4B 2Z1DA 5KI6A 3L1UA 3FFWA 2O4CA 1C3XA 1RYBA 2AFVA 3WGVA 1VLZA 4IHJB 3MAAC 3GAFA 3MEKA 3ZK9A 1DKRA 4XIIA 1QYWA 4NATA 3EGWA 4C14A 3OMSA 4C7JA 2JC3A 4YBZA 4AN0A 4AN1A 1DOHA 3OY2A 2A57A 3TJZA 4FMCF 1SG6A 3WNQA 2HLNA 3IB3A 2W48A 5BYJA 4QLBA 4PIMA 2G04A 3SF4A 1JQAA 1A97A 3TL6A 4Z4HA 4PR0A 1LTQA 5CH3A 4FZ3A 4X63A 4Z3KA 3U7FB 5C8YF 3FDHA 2IW1A 3PNLA 3OFSA 2CJYA 4J90A 1ND5A 3C8HA 3N86A 2GYWA 4IWYA 2IE0A 1WPXA 3SQXA 4H18A 3I61A 2K5UA 1IVYA 2ZYSA 4L07A 2WD9A 2H2HA 4JROA 4IXTA 3TPFA 2FWAA 4A10A 4DMMA 3ASFA 4PXYA 2J4BA 3F9CA 1BVHA 5H70A 4D9KA 1UC9A 3SNHA 4XFDA 4J0HA 4DLPA 4YMLA 4MW5A 2KCVA 4QDJA 5CVVA 4RPGA 3OZXA 1NNEA 2XF2A 1YACA 4ENVA 1RP1A 1G8KA 5L53A 4MWOA 3JPYA 4UHJA 5FQNA 4P4GA 4MV0A 2NVOA 4E5DA 3PRJA 3EAGA 4GPKA 3VKHA 2PRKA 3UUEA 1QHYA 4L2YA 3W4IA 4EB8A 3F6RA 3FUUA 2J8ZA 3FUIA 3U0VA 3S2GA 3E5RA 1HZZA 1ZH8A 3E1SA 4FQ5A 2BAGA 1WMBA 1PKEA 1HG0A 1N2BA 3PQ6A 3TQRA 1SCKA 1C14A 2ROQA 1E69A 1N52A 2BFFA 2EWMA 2R8YA 5DDIP 1T3GA 5EZSA 3AUFA 3THXA 4D26A 1NULA 1QANA 3IHTA 2OFXA 3H8VA 5ALZA 3K0FB 3ITNA 3ZFWA 2QYOA 3U4TA 2HIGA 4HTFA 1FF9A 1UM8A 3LQYA 4BFYA 2FN4A 3RH0A 1B3RA 2GCOB 4MZXA 4M9XA 4XFKA 4YUXA 1BVUA 1PUJA 2HNAA 3U9TA 1LW6E 3D4LA 2DC1A 3BT3A 2EXXA 4AZ3B 5BUCA 1G8MA 3RT7A 4EI7A 1SVIA 4WUTA 4JNKA 1CUAA 4QLAA 4C29A 1YZ3A 2VP5A 4ZXPA 1VZ2A 2ATCA 4HLCA 3WIBA 4WESA 4ED9A 1ZB1A 3TXAA 3FMPB 1TUBB 1P1JA 4DLRA 3BE4A 3A9UA 4C4PA 2C2LA 2KZTB 3GFOA 1Q1BA 3CCBA 4NFLA 3L18A 1ZL0A 2JARA 3BD7A 2CC2A 2YXBA 2NMVA 4RIEA 1ANKA 4ZEVA 1HX8A 2HDHA 4MI9A 3JRNA 5JSFA 1YE5A 3TDNA 1R6BX 1EFVA 1KR2A 1UC4B 4LTMA 5JZVA 3SC6A 4BLSA 4EYGA 1G7CA 1A7AA 3CIOA 1PZEA 1J97A 4HBGA 3OH8A 5FO0A 2XBUA 1ZW6A 1WDLA 4MPJA 2ZSEA 1Y6FA 3OVMA 1T8PA 4BEWA 1OCCE 3QMMA 3TGLA 2B4YA 4II2A 4QFDA 1LQUA 4F5DA 2YIDA 4RLQA 3RC2A 3JVIA 5FUMA 2C7GA 2HF8A 4FCVA 2VF5X 3TWXA 3DVAA 3FUWA 1X8JA 4E13A 1QHHA 2VS1A 1Y8ZA 3N8NA 1O08A 3LTNC 4OHYA 2R8XA 9MHTA 2YZKA 3OCYA 2I4IA 3IQWA 1ILWA 3B7PA 4NCNA 3HO1A 2M9MA 4KO3S 4YUAA 3N6RA 1OF1A 1QORA 2Q4OA 4MLPA 4QQNA 5AXDA 2ECOA 4W99A 5IBPA 2WK1A 3K9BA 3QE9Y 2PUAA 4B0PA 1YFZA 3Q9LA 4LY9A 2H16A 3E7FA 3GFPA 3GVIA 1B23P 4GBJA 1IDOA 1KQFA 5LMNB 1LX7A 3LI2A 1XZKA 1ZS9A 4P38A 5DN9A 2QN7A 3DCYA 4PANA 2XQ0A 1V7PC 1CNMA 2DYSE 4AK9A 4AYWA 3O2JA 1K92A 3EXFB 3F0TA 3JQ8A 4ZTZB 4P5PA 4BO1A 4F92B 2C3YA 3DL0A 4K6MA 2XQVA 2VKQA 4R7ZA 4OQXA 3SLRA 3WZLA 4BRZA 2EFDB 2HB6A 1CYEA 2FDRA 4ANFA 1R6UA 4UU7A 2WJ4A 4HS2A 1RHKA 3KS9A 4JLOA 4N1AA 1MB4A 1RHRA 3ED1A 3X2FA 3T1QA 4UPEA 1T1RA 2AK3A 2JFGA 2ZI6A 2HSZA 1Y9AA 5TT1A 2IOQA 3I37X 5MFPA 1KMIY 1JSRA 3GJTA 4WWNA 3IQZA 4HLNA 1JU3A 2GRUA 3X1MA 2H85A 4HTAA 1ZCAA 1IHXA 3M4JA 2I80A 2BKVA 4YRMA 3WRXA 3CGHA 5I3CA 5KMGA 3B7SA 4NJEA 1J0AA 5CCLA 1HE4A 2HWWA 1EGVB 3NPMA 2ODQA 5G0TA 4ZO4A 4D9MA 1GR0A 3DMYA 5B6PA 4GMRA 5FTWA 3VKUA 2CYCA 3SHQA 1RQ2A 1U2ZA 2B2NA 2B5VA 3KM0A 3E9NA 2HJSA 2JGKA 3B6ZA 5IANA 3HC7A 1KJ8A 3WG9A 5B1BE 2X42A 1KH2A 4YLGA 4TWRA 1FLAA 4N40A 1ZVKA 4QQ8A 2NSDA 4G97A 5HIKA 3ZDFA 4N41A 1QX4A 3ESYA 3LO8A 3OO1A 4OBXA 2AL7A 2GEUA 3EEYA 3TEMA 2ZUCA 4CT0A 3R9XB 1SEPA 4DCMA 3KD3A 3JZFA 1X1QA 1ID8A 3HFGA 1TA4A 2YY7A 2WPDA 1E7QA 2MSLA 4O2LA 4Q7QA 2RFLA 1EWTA 2FN9A 2HR2A 1AV7A 3G0HA 4KODA 3DCJA 4LE0A 4XARA 1DRUA 3OQNA 4I19A 1TIBA 1W48A 5ALYA 1P3DA 2ZI4A 3P8ZA 1YDMA 3HA5A 4WD3A 1EXMA 4F46A 4ZU6X 3SAJA 3RC9A 2MSDB 4M1SA 4ILIA 3ZYQA 2NUTB 2XMRA 1DZ3A 4JB8A 4TYYA 3HCWA 3KSQA 2A6PA 4MGHA 4JYAB 2QRQA 4YONB 4X1IA 3TAUA 3I30X 3IXEA 4B4OA 1RT9A 2B1RA 1Q6YA 3EIOA 3ABZA 2NUPA 4WNDA 3GOQA 2NVBA 4BC0A 2Z5GA 4MZDA 3PHJA 1RBMA 3TK1A 3FH7A 2O20A 5D6OA 3FA2A 4TUYB 1VL0A 5I51A 2YWJA 2MU1A 2ZGGA 2J0VA 2ZRQA 3OJXA 2BHRA 3GJ4A 3FOWA 1W5AA 3QU4A 1GN8A 2YV4A 3L84A 1YE3A 3G7UA 2APJA 1FSFA 1SUFA 4CF4A 4M36A 3WGLA 5G1NA 1AQUA 3RROA 5HI7A 2HO4A 4QQIA 2IHYA 2XGSA 1LWNA 1HL7A 2GFIA 2PMFA 4REOA 5CM2Z 3CS3A 4MUYA 5B3SE 4EO4A 1U0JA 5F52A 1SQ5A 1O9BA 4LOAA 1U9IC 2PTGA 3PR3A 5CVUA 2B8TA 3RFXA 2GPAA 2PKXA 1TYBE 3V8BA 5LQDA 4HX9A 1FQJA 5LBIA 2Z98A 4GVPA 3VR2D 1HDIA 2QTTA 4NF2A 3SU8A 3FDZA 3ZI0A 2QGZA 4EEXA 4BNUA 5FADA 3ZHSA 4PAQA 4KQFA 3SSNA 3DBRA 3PZ2A 4MCIA 4I8XA 4UARA 3ITDA 4U7JA 1EXVA 2AFHA 1VKOA 4H7DA 4JC5A 4OM7A 4ZQCB 4P3NA 3AI2A 1WHTB 3PHIA 3R3SA 4L4RA 5IZCA 3NORA 4RLSA 1OXJA 2XYRA 3K09A 1JQDA 1VQ1A 3DS8A 3QBVA 2D2IA 3PKIA 3QVSA 4CI9A 3OTGA 5B3AA 4N5DA 2HCTA 2VYIA 2HDOA 2HA3A 1TQ2A 1XN1A 3HYSA 1UZAA 3TG5A 2VUUA 3VYRB 5DX1A 3SX2A 1XAGA 1AF7A 2DZDA 3IE1A 3AUTA 2PGIA 4XQGA 5BV0A 5AI5A 3LOUA 3Q2KA 1HZ4A 3IHKA 5A9SB 4BCCA 1DEHA 3AVOA 5E4TA 1G7TA 1OQAA 5C37A 5I7HA 3QX8A 3ABIA 3AM5A 4ZKEA 2W2XA 1OYWA 2YCLA 3G1TA 4M21A 1SUEA 3PDWA 3R3WA 4Z4CA 1B8OA 3KZ1E 1JHRA 2QD2A 4E5UA 2Q50A 4RTLA 2N46A 2XMPA 1Y6QA 421PA 1UAAA 4JLVA 4AT1A 3RG8A 1P5FA 5THXA 4JSTA 3RHZA 2GF2A 1EUCB 1UMDB 5K3OA 4OMUA 2FE1A 2CLLB 2G17A 1Z74A 1BW9B 3K1JA 1RRPA 3N5KA 2BP7B 4QUIA 4P4TA 4DDTA 2AIRA 1V55E 2R6JA 1CUWA 2RIRA 4OHCA 4KQ2A 4PC3A 1EPUA 4K5BA 1DJLA 2QI9F 3B5JA 1BS2A 3MMSA 1S4MA 1HTTA 2ZSAA 4BS9A 4EAQA 4ESOA 1VLQA 1LSOA 1CRPA 4DPRA 2EKLA 1AURA 3T9FA 4LYFA 1A9SA 3DGFC 3DDSA 1QRRA 5CEFA 4GXQA 2GK3A 3E58A 3P71T 1KT0A 2NUAB 3L4SO 1Z6PA 2JLBA 5EIOA 4DB4A 4BO5A 1HK7A 1KXZA 4C6RA 3LWNA 1OHHA 3MERA 1G4UR 4CTKA 3D3WB 4L4SA 5EZYF 2R62A 3G2SA 3K70C 2FWPA 1BKDR 5JBQA 3L8MA 4C6TA 4XQCA 1L7OA 3QFFA 2FFJA 4YR9A 4JL5A 4EH1A 4WNEA 2YY6A 4YQYA 1QRSA 1PJRA 1I36A 3AVWA 1N95A 4EKIA 4DR2B 5I7EA 1DBQA 1G21B 3EIQA 1JFLA 3UMYA 2R79A 2DH5A 2FW8A 1SBYA 2F3RA 4HORA 1Y63A 4MDYA 4JD5A 4F86A 2OM6A 5FAXA 2VNHA 3UNXA 3I73A 3A1UA 1E2IA 5IDYA 2P8JA 5ECWA 3FPAA 5HGJA 4H3VA 2P2DA 2HK6A 1TMGE 3L1VA 3TR5A 4X66B 3BMOB 4KDFA 3G0OA 2GN0A 1C7QA 3NAZA 2ZRAA 2DFDA 2Q7XA 1R0SA 3PNPA 2CHFA 4S0XA 4IOMA 3L6OO 4ZZ0A 4UEQA 1QJ4A 2TYSB 4B84A 2OCAA 1EE9A 2AA3A 4E4TA 1ZJ4A 4OQYA 1UUFA 3KQOA 1N5OX 5CFQA 1M1YA 3W5AA 3E37A 3DF9A 4Q37A 2AEFA 1VSBA 3KQTA 5BPPA 2BR3A 4HWRA 3UXEA 1Z3XA 4CDRA 1TM4E 1L7PA 3BREA 1NA0A 3CMCO 1U1GA 2QMYA 1DT3A 4GDMA 1F20A 5B7NA 1T9HA 3CUSA 1O94C 1N9GA 4CQLA 1U1IA 3IPCA 4N03A 3MWJA 1UBJS 2XQIA 3CM0A 5EIFA 4EGFA 4LDNA 5AKYA 1A96A 1V3TA 1U0RA 2BEWA 3KSDO 3ESAA 4BGVA 4Q93A 3O2SB 3VR1A 1O97D 5D8DA 4WH0A 5A23A 2GBLC 1R1DA 1S2MA 13PKA 3EISA 3QF7A 1E1YA 3KKLA 1Q6ZA 2B7CA 2GRJA 1EWRA 1MCZA 4HQOA 5EYPB 3CVVA 3LT2A 1CUDA 3O21A 1CR1A 3ZWQA 3WGJA 4HN9A 3IL2A 2VAMA 1M8PA 3ZXXA 1VL8A 1ZHHA 2H7XA 2E9SA 2M6KA 5FNZA 3SZLA 3U49A 3SQNA 4O2AB 2EF1A 1Q50A 4F97A 2I8CA 2KLHA 3BRWA 5AVOA 4TYPA 1K7YA 1ZCBA 5FINA 1JLHA 3RF7A 2BFAA 4LJ5A 2WJGA 2XUFA 2JAUA 1OIXA 4UTXA 5GOTA 2IYVA 3QEAZ 2PKEA 5J47A 1NWCA 1ORTA 6NULA 2PPVA 3HCFA 4ZJYA 5SZIA 2NO0A 4ZJUA 4TMKA 4AIRA 5DHSA 1I0LA 3GLTA 3H19A 1PZMA 4DTIA 4Q18A 2F00A 4HDOB 1SC4A 3RREA 1SUAA 3OUZA 1IFXA 1VDYA 1VOTA 4X7RA 1CC1S 4G2VA 3QFRA 4CF6A 1KMHB 4FCCA 2GLXA 4EBFA 2K7FA 2CV0A 1JT9A 1V16A 4NTZA 1O95D 2CBXA 1WSDA 1BSVA 2QA5A 2OCCE 3NHUA 2G1PA 2YIVX 3GYXB 1S0UA 2VDNB 2OFFA 3OMXA 5IN4A 3DXKG 1NYRA 2QN6A 3M2TA 3HYNA 3LPNA 2PGLA 1PV1A 1GP2A 3SDSA 3TIFA 4CLOA 3EPPA 4EZLA 4PRKA 4I5DA 2D74A 4B32A 1L3CA 4TPKA 4PNZA 1D2EA 3PC4A 4XW2A 5KOIA 5FBHA 2EDCA 4TSFA 5A4JA 3GEPA 3PQ7A 4ZQHA 5LQUA 4C08A 3KCQA 1QNLA 2I3BA 1NTOA 2H4XA 1P5QA 1O89A 3EEFA 1FJXA 2JATA 4FT4A 3E15A 1H2TC 1OI4A 2Y0BA 3WP0A 3FPHA 3G2TA 3G8CA 3DFUA 3HM9A 1F7VA 2NT4A 1C5KA 4BECA 4FXOA 3CH5A 1MJGM 1F0NA 4J3JA 1IYZA 5I7FA 3IBGA 1N8KA 2P1DA 1IHYA 2NO9A 1YCSB 4G4IA 3IP5A 1J24A 3OFJA 1RVDA 1D04A 3NH6A 4EO7A 1SWVA 1ESEA 3T7IA 3QEOA 4FULA 3MJHA 3U4MA 2XCBA 1JRLA 1JKJA 1EU1A 2XB8A 4ZCLA 2XKJE 4H3KB 3T5DA 2I2CA 1UIMA 3AGPA 4HZUA 4HNTA 1QC5B 4X24A 3ZK8A 4PYQA 2HQSA 4N6NA 3H1BA 5EMKA 2BHSA 1DT5A 3PHHA 1PQYA 4OB6A 4GI1A 3FWPA 1JWLA 5I9TA 3ZUGA 2TMYA 2C7BA 4N7BA 1IEQA 2JDIA 1CE8B 5FWQA 5T8IA 2FSVA 1K08A 3JQFA 2NV0A 3AG4E 1QH8A 3ZGYA 1GKLA 4WKOA 3GZNB 4CMAA 4R5MA 2JANA 3TUJC 5LLSA 1O5IA 3TW0A 4L27A 2UY1B 4Y0AA 3B9QA 2VDPB 2DR2A 2ODTX 1SCAA 5I5GA 3B7RL 4QATA 4L1BA 3WSWA 5A3QA 4DE5A 3ZQJA 4NK4A 3QEJA 3BJZA 3UAYA 2ANCA 2IY9A 1U6IA 5ENPD 2ZT6A 5U9CA 5ALVA 1ZNQO 1SAYA 1AQ6A 1XZIA 5AJWA 3M9XA 4IQFA 1GYRA 2YHCA 2I3DA 2AYXA 2HIAA 4FZ5A 4AKEA 3LQFA 2GBGA 3Q5EA 5ERYA 4ME2A 4YNBA 1MKYA 3GJZA 4AS2A 4BQFA 5FUQA 2IGBA 3PQCA 3V2HA 5LQMA 1PD0A 2G80A 1PR2A 3A2KA 9LDTA 5CVEA 3VPCA 2PKQP 4JHLA 3H4MA 2AXVA 5YASA 3EFEA 1NSYA 4ZQEA 2HZ7A 2C7OA 4IJWA 1CR4A 5G4LA 4OOEA 3A9VA 2HTFA 3BXEA 3RVNA 4C3ZA 1NVVR 1VJRA 4HAOA 4D98A 4HH4A 2WDZA 4KXKB 1WUYA 1DHTA 4IICA 4GIBA 3UXYA 4IDDA 4OI0A 1WCXA 3VYSB 3DP9A 1P9WA 1B6RA 1KO4A 2ZISA 2XXAA 4MRMA 4NMMA 4YDHB 3QVLA 3O74A 2C5BA 4DWWA 1AD2A 1YWGO 2YNMD 2ZTHA 3GMSA 4G56A 3LGAA 4GOKA 3W9UA 1BD8A 1Q7GA 2AC4A 3S1AA 3N8KA 1MC1A 5KWIA 2QMHA 3IHWA 4WZBB 5M72A 2AOWA 1RRVA 2POCA 4COOA 1DTWB 3EUEA 3FH8A 3KVVA 4IHAA 4PRLA 5BN3A 3OEHA 3CVLA 3AEUA 3IKOB 1XP8A 1UXGA 3S1SA 3GNLA 3JWIA 2G5TA 3CX8A 1TEXA 4NMWA 2PM8A 1L4EA 4FW8A 4Z7NB 1Z4QA 4AJKA 4NOKA 5CUQA 3E32A 4J8SA 5K3FB 1AX9A 2GBCA 2Y4TA 1GTSA 4XYGA 4BPBA 1Z07A 1UWVA 3BXOA 3NV9A 1X7WB 5FEUA 4CETA 2PX4A 4I2VA 1IUNA 2H6HA 4WBNA 4WPGA 1YBAA 1KARA 2HM7A 3NWEA 2R00A 4KK3A 4I5EA 2CD7A 1YZYA 2EZTA 1SB9A 2H7VA 1P4JA 4GX2A 4K1XA 1N4SA 4MYSA 1TTHA 4EY8A 4N5QA 3JATB 2A9RA 2ORYA 2FCAA 4YR7A 3DF7A 5AKXA 1MAUA 3VSEA 3DEHA 4JX8A 3PUJA 3PGLA 5A1TA 5BMOA 3CE9A 2FETA 3MJTA 3ZXIA 3EH1A 2BTQA 2W9JA 4AMZA 1VJCA 1E0JA 3H2JA 1E94E 2WXFA 3OC6A 1Z0DA 2XCSB 2WJAA 1UWLA 2N0SA 3WGNA 4TMFA 3UTMA 1JSLA 2HRZA 4A92A 1UBHS 1HEIA 3QENA 1ICIA 1JLSA 5J4KA 4XD2A 4Y1RA 3S70A 2X0EA 3QEKA 4YMGA 1YRWA 3SF8B 3M2PA 5JHHB 2NXWA 5HDQA 4D9BA 1OXBB 3DOJA 4AVXA 4GM4A 4D8XA 5MFZA 2C2ZA 1D4AA 1BE8A 2WTNA 3HNOA 3MIIA 4GC5A 3NF1A 1CJVC 1G98A 4MR7A 4PNPA 2BDUA 2WNHA 1C0EA 5JE8A 1RI2A 4DCPA 3RE1A 1JIQA 4V0ME 2D5LA 4Q1FA 4UHHA 4XKBA 1D8TA 3L7YA 2Q5FA 4DSTA 3TWRA 1IWOA 1E3EA 5C2YA 3L7JA 4APOA 5LA6F 2X0JA 4IIJA 1T4GA 4ZAVA 8MHTA 2NZ8A 2YASA 1K75A 1IOWA 1FU7A 2RJNA 1CFZA 1EJ0A 3QVVA 5EMHA 3UB2A 3SBDA 1IBMB 3MGKA 5EQTA 1LBEA 5I8WA 1SVSA 3G1UA 3I2HA 1CR0A 2JLRA 1VGVA 3FTCA 2WT4A 1TYCA 3ZNGA 2C2OA 3PGVA 2XYHA 1NURA 3LDGA 2O7SA 1GSHA 3B5EA 3OHSX 4URKA 3AP1A 3P0EA 2QN9A 1D9SA 2CL0X 1GQSA 4TLDA 1P5RA 3HVHA 2BEUB 3GMDA 2L9BA 2O2YA 4K8OA 2ZBDA 2YX1A 3OZBA 5C51B 4ARCA 3ZJUA 1FRZA 3H2HA 1KGSA 3RO3A 2PCLA 621PA 3WWYA 4RMGA 3TZHA 3QELB 2CL6X 1MR3F 2VUHB 1SPBS 1QQ7A 3BXHA 1HRDA 3ZHRA 4UBNA 4MUFA 2ZIXA 4U63A 1I3KA 4D4LA 3DLHA 5T64A 4YWHA 2NYVA 5D5QA 1ONPA 4D4GA 2XMQA 5BQ5A 3TBFA 5KJKA 1NZFA 4WKBA 3CPHA 5TVGA 1V3UA 4ABTA 3FETA 1L5HA 4JPSA 4X1KB 5LWQA 1ST2A 3KSRA 4H7PA 1JG3A 1V1MA 6ABPA 1OFIA 4MKRA 3NDJA 5I4CA 4JLJA 3OJLA 1RLJA 2OILA 1AOXA 1R0YA 4JXXA 2BYTA 3FZYA 1L5WA 1Z63A 4BMOB 3GUYA 4TV9A 2ESRA 1G9XA 2BE7A 4M46A 2O07A 3ADKA 2Y1GA 4M0FA 5IBRA 1MZVA 1S2NA 2AG6A 1OOEA 3HWRA 1P2SA 2P9YA 2OXCA 4R7GA 4NBSA 2H7CA 3TD9A 3KDPA 3LC2O 4QU5A 5ALXA 1UXKA 4QAJA 1E7VA 2C77A 2QTMA 5HIMA 4GM1A 4F4IA 5TVKA 3JALB 4PAMA 3E84A 1NJ1A 5A0TA 1R18A 4LKRA 2WNSA 4Q34A 3MT8A 5AWFC 3EN0A 3WLPA 4E07A 3WNCA 3RS2A 3CNBA 4TKZA 1M6EX 1RU3A 1ZK1A 3HY6A 4U8YD 3PHCA 2H1OA 3GVCA 5GADl 1D0VA 4IV0A 1S6YA 4OAUC 2MT9A 1NA5A 4MV8A 3LKZA 1XDUA 5AYVA 4XDHA 1PT6A 4QECA 2Q2WA 2JFUA 3EBLA 1XMIA 1Z75A 3GAMA 1K63A 3MG9A 1HX7A 4IG9A 3I83A 1MH9A 1REQA 4GVXA 4AJNA 4AP2A 2WSSA 3QE3A 5LIRA 2PGAA 4DUYB 4LK2A 3HJCA 3DV2A 2FMHA 5F1PA 1DWQA 4G3XA 1PFGA 3CUUA 3RYTC 3IIJA 3I04A 1VJTA 2P3SA 4NHOA 4RKRA 2PUJA 2DCMA 1Z7GA 2PMDA 4ZC8A 3PFIA 1MRNA 3BL5A 4A4DA 3G82C 3FF4A 4N0EA 2X8JA 2H0QA 3IBYA 4HG2A 1T4CA 5HUJA 3ROQA 4RCZA 2FJDB 2W2OA 3KQUA 3SEQA 4MR8A 3CONA 2IH4A 3AF0A 1JLRA 5DGIA 4JEIA 1LPSA 3PDCA 4UM9D 1JF8A 5IM4F 3QXCA 1J23A 3BYZA 3ZKWB 3KJFA 1WBDA 1HU3A 1PG5A 1RCFA 1PWHA 2IPLA 1GPJA 1L7QA 1P45A 1ZQ9A 4YJ2B 5TEWA 5KNGA 2HMTA 4YJKA 2DLNA 5JOQA 3ZQ6A 4GR4A 1RLTA 2EG5A 2ZVDA 5DK4A 4GPZA 2RARA 4WCFA 2OV6A 2HA7A 1TT5A 3ZQUA 4IPTA 4UNNA 1EDUA 4I5IA 1YK1A 1NHWA 3FM9A 4DZTA 1SUCA 5E7JA 1R0RE 3UMRA 1BOOA 1RJEA 5K8IA 3I8SA 2D7JA 4UTNA 3HO8A 3PF8A 3DE4X 3V4PB 4CM4A 4ZTBA 3DDOA 3KEMA 3O8NA 3BTSA 2CXSA 1SR8A 2OPBA 3EW9A 3EPJA 4IDFA 4MWBA 4RG6A 3DB2A 4JI4B 1F1JA 5JVDB 2XE7A 3HY3A 4MW9A 1S8FA 2NO7A 4DA7A 2VJNA 3DZCA 4JA9A 5FXMA 2OYSA 4WA7A 3RAJA 3SVTA 2IBMA 1AJEA 1YVUA 2AN5A 4KQGA 3CK7A 2GZRA 3KEQA 3HP1A 1QBQA 1YMQA 1R6TA 3D8UA 1G4AE 3QUTA 4WOCA 1QGUB 4DC0A 1LBSA 4GG1A 3A26A 5LWHA 3P2MA 3ZC3A 1R0LA 2CHEA 4Y2UA 3PPIA 1K8ZB 2AR7A 2X0IA 3PZ1A 3EA0A 2GJAA 3AB7A 2GKSA 4CL2A 3C3JA 3A1NA 3CZ4A 5AJUA 3IBTA 1HOTA 2QJTA 4GPIB 4MVJE 3BCSA 2PJZA 1W1IA 4WFIA 5DM0A 3I04M 1V5WA 1EGMB 4K6CA 2A4ZA 2YTZA 5JXJA 3UUWA 2WJYA 4RXMA 4O4LF 3ONDA 1OX4B 4HVTA 4B3TB 1ZD1A 4QBHA 2O1XA 1PVOA 4V0RA 1ZUIA 2FZCA 3KDSE 3JZAA 3OM0A 3R0VA 1QPZA 2J8SD 3AETB 1ZWLA 5KOJB 2QNRA 1R4ZA 2PQ2A 4P4SA 4UCXA 3F78A 4P29A 3OPYA 2C97A 4RQTA 3KEGA 1A04A 5FP0A 2DPMA 1E3WB 2FWBA 4FDUA 3MXOA 4HGZA 2NTVA 1GV0A 4H0CA 4POAA 3KWLA 3VTKA 1WCIB 3NTUA 3CJQA 1BX1A 4X20A 2I8AA 5EIBD 4WK6A 3N53A 1LBHA 2VJOA 1TMYA 4CM9A 1EG7A 5K05A 1ZRSA 3NFRA 1O03A 1R0XA 5JI2E 3SZ7A 1IN7A 4U02A 2W0SA 1P6QA 1A7JA 1Y7TA 2VRCA 1L5MA 3MMNA 1KF0A 4C2UA 2QBYB 2XB4A 3CSUA 3DHWC 3VPAA 1JCQA 1L6IA 4TT8A 4BFVA 1G20B 1RXUA 1UKZA 2XE6A 1CJKC 3KJGA 4UI9C 4RY9A 1P4SA 3W1VA 3R5SA 4H9GA 2F1IA 1PZXA 4GVLA 2R6ZA 1N5JA 3CQCB 3ZWKA 5IJWA 5T4EA 1RKBA 4ITRC 4QYIB 3IB6A 2ZLBA 4FZJA 3LS2A 2FO7A 1E2PA 2EP8A 1U9CA 2PSSA 3S7ZA 1G5QA 4FKMA 4BB6A 4DDWA 3AZOA 5IC5A 2KCKA 3DEAA 3V34A 1BX3A 2PY6A 2X5NA 3DR5A 3EPHA 3TNFA 3OTIA 1PD1A 2QK4A 3SY8A 1P0CA 3T9CA 3ICWA 4CTJA 1P3Y1 3E9ZA 1P2GA 1W3BA 3A1DA 4Q9DA 4EZEA 5C7YA 3ZWBA 1IWPB 2ZIRA 2UUPA 2Q5JA 5ALPA 4UXJA 1U5BA 3ISJA 1T8UA 4HNAA 1JLLB 4EFDA 4K9NA 2CUTA 4HH1A 3ONFA 3ZJYA 1IZYA 2IV7A 1TJNA 1AKEA 4LYEA 4DA8A 4QBKA 3ROKA 1N2JA 3OOEA 1DE0A 3RS7A 5I6DA 1Q0HA 5B1DA 5EPOA 1SHTX 4MTCA 2EYQA 1B0PA 3D4OA 3GFVA 1G2PA 3D81A 1A17A 5A6VA 4R8RA 4KQEA 2POQX 2F90A 3WHPA 1CY2A 3BFVA 3RVLA 4LRWA 2O5CA 2CKMA 2E6UX 5AK3A 1A95A 1C1DA 2BGMA 4KRXA 4MMYB 1TAGA 1XXLA 1ENZA 3FPSA 4QUHA 2VC2B 2JA2A 1NDQA 4DUIA 5H81A 1QFYA 2XOKA 3QFHA 2OKGA 1IPHA 2FEKA 4O4JA 4HB4A 3PJGA 1G21E 3PVLA 3C24A 4JJEA 1UBMS 4GX5A 2FOXA 2H6IA 1KIAA 2Z58A 1FQKA 3Q11A 1NI3A 5KOHB 2FZKA 2HJVA 5K99A 2F4VB 4DYVA 4CE6A 4QRIA 2JHGA 3DFZA 2WIKA 3MJFA 3SC3A 3LK6A 3W6UA 4EY3A 1E6LA 5KSZA 5KNBA 1OZ0A 1P0QA 1GT6A 1WP9A 5CPFA 3I9LA 1QG4A 4A26A 3R3XA 3T5PA 3IX7A 5AM2A 2WBLC 3P2EA 2J7PD 4B17A 1TMKA 4Z8XA 4O2BF 1JPNA 4WHMA 4BY9E 1GRRA 1QX3A 5K6AA 4HDNA 1A5EA 3KKOA 3EQ7A 1QR2A 4FW9A 2V5VA 3E27A 2Y4UA 1SU7A 3KAJA 3NHYA 5TX7A 2AG5A 5B64A 3RSGA 7MHTA 3VSAA 4ARIA 3O38A 1F6WA 1L4LA 4G8LA 2J6BA 5CBOA 1O6ZA 2XA2A 4L76A 1YB7A 1RHQA 5FWXB 5CMYA 3N2IA 4OLJA 3QVOA 3T7KA 1E58A 4B3CA 1E3SA 3HN6A 1EUDB 2GAIA 3LSTA 5ARGA 2Y0CA 3ML8A 5LPNA 4FGUA 4ZDIA 2H08A 2VCEA 3TJMA 2GQ0A 3V4RA 3OQMA 2IELA 2AFIA 2VVTA 4KYVA 1WM5A 2WB4A 5IJXA 3I9MA 1QG0A 2C8KA 3SCZA 5HS6A 4CIDA 4PLZA 4ZAWA 3Q7SA 3BB1A 3NUZA 1ZOLA 2W11A 2DFVA 1X15A 2ABWA 4RA6A 1QHSA 1N4AA 3DBHA 1YVPA 1ZD3A 4CL3A 4LMBA 3S2ZA 4YASA 1XTJA 4DUZB 4U0SA 2DMRA 4F3KA 4MGKR 2C7QA 1EX7A 2CJXA 3CF6R 2QB5A 1P31A 4KN8A 3VVLA 3LXXA 3U7HB 2PBFA 4EI2A 2F43B 1J99A 2ZJ2A 4TL9A 4B7XA 4H1TA 2Q5OA 2B82A 1XB2A 3VGPA 4WFJA 3IT3A 3O7WA 2PM6A 5DBIA 4IQGA 2CNNA 4KKXB 4PY2A 1IKND 3L4BC 4GKVA 5BWBA 1PT7A 4O25A 2VH2A 2B98A 1B6SA 2TSYB 2WSMA 2A0KA 2BMAA 4QQKA 4ZHQA 2GD2A 1TU3A 2QE6A 5DOVA 4XSGA 4DJTA 5DSXA 4IEIA 1V71A 4R05A 4TXJA 2H1WA 5LP6A 4LNUB 5HTKA 5JTUA 5B5SA 4FLHA 4AS1A 1Z47A 4MKFA 3FSGA 4EZKA 3OT4A 4NMLA 3EWNA 2CCJA 3HDGA 4FBGA 4JOQA 4HI9A 3JSXA 2JI4A 2WSIA 4MS1A 4PLFA 3VTYA 3AXSA 4RNDB 4TN1A 3PP8A 4YCMA 2WUVA 1G6OA 2BGKA 3EY4A 1Q0RA 1Y80A 1GPUA 1AMNA 4DOMA 3I5AA 4N3AA 2X38A 2ONZA 3L05A 3AF5A 1QHFA 1RMTA 3TZEA 5K2MA 5A05A 1OTYA 1JHUA 4GI3A 1R64A 3FJ1A 2PKCA 1J8FA 1Z38A 4C7OB 4OATA 3IOCA 2R25B 3PC7A 4Y2YA 4DLAA 3LCCA 1I5EA 2IF2A 3CLTC 3AERB 2OD2A 3QVMA 3R76A 2SECE 2FW9A 5JJBA 2RMKA 3TI9A 4P1ZA 5AW2A 3W1WA 4KI7A 3WL4A 4L5JA 2M98A 4JBLA 3AVQA 3O8DA 3M6XA 3L77A 4HDMB 4LDJA 1FFEA 3RSQA 5JSUA 1SXQA 1Y6GA 2PNJA 1GUBA 2G1AA 1TQDA 2HPZA 3T15A 1L7XA 4QNMA 2OEVA 1DC6A 1M5TA 5C7LO 2R85A 2WXGA 4WBSA 1TA0A 2DETA 4EWLA 3NEJA 3IEMA 4ATGA 4LERA 1M1UA 2FR1A 2BT4A 3D7MA 5L7TA 1YHYA 3NT5A 3N7AA 3GFSA 2WHXA 3WJAA 3O4JA 2Q8QA 2D0PB 1B14A 4J0FA 3CMMA 5ALUA 1VIVA 1XROA 1NMYA 2ZQZA 4Y2GA 1BCSA 1FTNA 5IAKA 4TQUS 3ZKAA 3MTIA 1RWOA 2RK6A 4PYNA 3WAGA 4FLFA 3JQAA 1ULSA 1P4RA 2R1UA 1RZRA 1SO8A 5EWJB 3I4CA 4BQEA 4WWOA 1O87A 2OHGA 4UBKA 2VFAA 1Z7YA 2N1BA 4L23A 3C41J 3URZA 4QOFA 2P9PG 1H8HD 3GBVA 4OHZA 4BNJA 1MFPA 1XNJA 2FQ1A 1S7GA 3KUUA 4V1CA 1MT3A 3QOYA 2ZJBA 1XAJA 3CBGA 3ND9A 4ZCTA 3MKQB 3FH5A 4TKUA 2WABA 1ESNA 2XNDD 2PUGA 3LT5A 2HBQA 3E4CA 3LUBA 4HNSA 4BSZB 4Z0TA 1KJIA 3ENKA 5BXUA 4R83A 5HBRA 3SYMA 1L7VC 3P9ZA 3TJRA 2DWPA 2PRYA 4ZCRA 3U9SA 1HDOA 4IGFA 2AQHA 2BM8A 1N0IA 2FMKA 2C3MA 1HNWB 1EFHA 3GZSA 1VKJA 5ALRA 1N54A 4GKBA 3WNBA 1P1FA 2H06A 1TFRA 4P35A 3LH5A 4RPIA 2BFWA 2P69A 2XNHA 4ZCMA 4N47A 1YL6A 4QGAA 2DUNA 5CCBA 4U2KA 1PGQA 1JKXA 2H6FA 4HOSA 4J7WA 3KL2A 1XZPA 2C99A 1FU8A 2LTAA 2NACA 4AUNA 1NVXQ 1R9NA 5F21A 2HMYB 4BMDA 2QTLA 1JDBB 4PGFA 2J48A 2Z2YA 3ND8A 4BLOA 2CSXA 4R68A 1ZMOA 2BE9A 5EXDA 3IYLW 2PXAA 2XXJA 1Q20A 3V8RA 4LKOA 2ZP1A 4RMNA 1JAHA 1LBQA 3AEXA 4UUMA 1CERA 4LF8B 4KFTA 3TRKA 5B58C 4TWBA 1E64A 3NIGB 3BK7A 3H4IA 4G0YA 1U8UA 5KYUA 4PZLA 1M34B 4HDSB 1W6UA 1WHSB 2VDLB 3LTEA 4TYWA 3OSUA 3KBBA 2MYNA 4Z2AA 3ABOB 5E38A 5LNK1 1A9ZA 4V2IA 1CRLA 1EESA 3IESA 1DADA 4WZBE 3KR0A 3EFOA 2JJ1A 1FMCA 1SPXA 4IP0A 3VMFA 5AKEA 2PQMA 3NHBA 2VN8A 4JASB 2D59A 3I58A 5AENA 2RK3A 2C9BA 5L6MB 2WE8A 3JX9A 3TBHA 3IUSA 2UXCB 1ZCZA 3B2NA 4KSBA 1M6VA 1SKAA 2GDZA 5M34A 5KQSA 3TXNA 5JW6A 4JZKA 3F7TA 1N6LA 4A1GA 1ISSA 3CJTA 4MPDA 4P82A 2JJQA 1SUPA 4NOMA 5KWJA 1GG5A 4Q9JA 2FFQA 4QFCA 4E08A 2WG2A 4HS9A 4LOIA 3QLUC 2F3SA 2VHJA 3ROFA 4LY3A 4ZQIA 2O8EA 1EHYA 2RH5A 2O8DA 4TZ6A 3EQ2A 1RI1A 3OKFA 4G2TA 3ILYA 1P73A 1NMZA 2ASVA 4ZGBA 1FUYB 1UKVY 5H83A 1JR2A 5C8ZA 1AB6A 1KY2A 2CLIB 1JDZA 3OQIA 1C7JA 1UN8A 4JBYA 4YAWA 5A6SB 1TQ8A 1I1OA 3L06A 3H8WA 3I12A 2PH3A 3RS5A 1T3LA 3ZDXB 1SU8A 4G8BA 4RW0A 1Y3DE 1TOAA 2A59A 4PINA 4LN1A 1O77A 1US8B 5EVJA 3O8CA 1W5EA 4NIKA 1BWPA 5TMPA 2FFHA 2FGKA 3IV0A 1R16A 5C8YA 1W4ZA 4OEHA 1GN9A 4URXR 4BE9A 2C9DA 4W9RA 3E3NA 4MQ4A 4CGZA 4XDYA 4KWHA 3CUKA 4P54A 4OJQA 4R8LA 4C7BA 1XTBA 5AH0A 4F9EA 5B3KA 2YRXA 5HJEA 1S1MA 1DRWA 2SCUA 3O1IC 3DZDA 1P7CA 5AM4A 2O2EA 2YQ5A 2IX3A 1MPTA 1R3DA 4ALJA 5BUZA 2P2CA 3W9GA 3JRXA 3HJHA 4EG6A 3L0ZA 1B26A 4JQSA 1FRNA 2XT9A 1N2IA 4DMGA 3PNBA 2D2EA 1RC1A 5EWMB 3A9TA 4M1KA 4UAJA 1XCBA 2IA5A 3TNDA 4CM5A 4DM4A 4EHDA 3Q7PA 2W2QA 1B6GA 3OQJA 4QHYA 3U7QB 1CCWA 3NHPA 4A6EA 3RJZA 3AVYA 4ALIA 1ML3A 4W6QA 5FFNA 3OXGA 2W6JD 4EYOA 1ZUNB 4B5KA 3WKDA 2X1VA 4ZI7F 3LYAA 4GPTA 1CTQA 4JMPA 2D2VA 1KYQA 3EIEA 4C06A 1KE1A 3G0DA 4NSNA 4B6GA 1GZHB 3ANLA 2WXNA 1IHGA 2BEVB 5AKHA 2VHWA 1V6AA 2AEEA 3AZQA 5JARA 3KOYA 1W0KA 3EGIA 4R1MA 4G5SA 4M0LA 2WM9A 3ISVA 2IKSA 4ON9A 3UAXA 1YB1A 2JEYA 4BVEA 4C30A 3FYDA 1NBMD 5K0LA 5E1MA 1DUIA 2YHSA 1XHEA 2O0KA 5FD8A 3OE7D 3D9OA 4B3XA 4YAEA 1CETA 1SUDA 5DHQA 5JAQA 4OXXA 1I6KA 2PTHA 2WKQA 2OOSA 5EJFA 4KBGA 4RD1A 3ZWOA 3RBXA 1E4EA 1AS3A 4DM7A 3D6NB 2NQ8A 3TLGA 5AW1A 3K8QA 3IMEA 5CYPA 4K87A 5BSGA 3GCXA 3UJDA 3KXLA 2FJAB 3BZUA 1Q1NA 1RHUA 2I7VA 2IX9A 1Z29A 3IILA 1OAOA 4X62B 1GTRA 3AJRA 5TRTA 3OQPA 2IFTA 3FNRA 3FTXA 1GQRA 2VZ9A 1QP8A 2XZTA 4P84A 3GNTA 1N3IA 4L15A 1WKBA 3KR9A 3PFNA 2GAJA 2OCBA 2PBZA 3C6BA 1RTTA 1IJFA 2W6IA 1G2IA 5EWLA 2ID8A 3G59A 1P1CA 4FFDA 1DOZA 4P80A 2AG1A 2IIQA 1TIKA 5EX0A 4V38A 5TQ2B 3W7VA 1E60A 3DSWA 1PLJA 3GDFA 3CLUC 5EEGA 3SXPA 2PXXA 5FWDA 4XKJA 1EI9A 1HDZA 2FPOA 1NZDA 3JAKB 1IPFA 3P1JA 1VRCA 1I51A 3WNVA 1TA9A 3DE3X 4XWGA 1TT7A 2JGAA 4QJ5A 1MAWA 3Q73A 1R9JA 1U0HC 5DXAA 1CP3A 3ZXYA 2V6BA 1SOVA 3DMRA 3ULKA 3K5PA 3UKRG 1H4SA 3HDJA 3D3NA 1WCYA 3RVMA 1UJNA 3D8RA 2PSJA 3ULQA 1CZKA 3AHFA 2FMFA 4TV3A 1FJGB 3TPZA 3LL7A 1FDVA 3HRIA 4IJMA 3HCAA 3TE7A 3BMCA 4TVSA 4JOBA 2XKKA 1NVVQ 1WS6A 1ODCA 3HXQA 2XADA 2FQWA 3SZMA 2XYPA 4HWOA 4JJZA 2Z95A 2RHLA 2QT0A 2NLOA 4YT2A 2QT9A 2ZDQA 4CM1A 4CRWB 4HVBA 1NRIA 4K46A 1RM4A 2IEIA 5AJVB 2QVYX 1NNLA 2Q62A 4L51A 4U2FA 3OM1A 4E1VA 5EJAA 1G0OA 2QLBA 4QOJA 5JAOA 4URUR 1W73A 2D6FA 5FORA 3P9XA 1DJMA 2ZS8A 3GGGA 5KKNB 5G2OA 3TLCA 2BLLA 1RAAA 3X1DA 3TNYA 5E95A 4HH0A 4JQOA 2OZPA 4WY8A 1DEKA 3Q5DA 1I7LA 3H75A 3RU3A 4G4GA 2VYCA 4EBBA 1Q11A 1C81A 2E82A 4N5HX 3K15A 3TB4A 4PSAA 5DWQA 4C04A 2VAWA 3ENEA 1F0KA 4MCHA 4UVEA 2BSXA 3EIUA 3ZH9B 3KDAA 3GOHA 1XVTA 4RJJA 5CHEE 4E4YA 3VOSA 4US1R 4HXGA 4MQMA 2LDXA 3AR5A 1FVHA 3IQGX 3QF4B 3H83A 2GERA 2JCSA 4KIWA 3FPEA 2ZDHA 3Q8MA 4TVBA 3WK9A 1FMFA 3I5UA 1MB0A 1AKQA 1VGRA 4KAAA 4R9VA 1E2JA 4DQUA 1RXIA 5FJYA 4CKBA 1KLXA 3OZRA 3OZAA 4MDEA 4YVFA 4WAFA 1NFRA 1SZDA 5M5BA 3U80A 4TOIA 4ZT6A 1XWFA 4CMKA 3BWEA 1UEJA 2AWNA 1EDDA 2YWBA 3KKPA 3VDXA 1H0KA 5HVNA 2OHJA 1GPMA 3ELYA 3BKXA 2QYJA 4O1HA 4G0VA 3UJBA 2WE7A 4E1BA 2YQ8A 4FT2A 1M1NA 1B73A 5CM9C 4F1JA 3CVUA 2O8BB 1BDJA 1OBFO 1RFLA 3KUXA 3GZ4A 4BVJA 3OF2A 2G07A 3V2IA 3CHSA 2V7WA 2Q46A 3B6MA 3RSFA 2QSJA 4MQBA 4MARA 5HZKA 2WWVD 4X61A 1PN3A 4ER5A 2XD4A 1KAEA 3NBNB 1IHOA 5E6SA 3VX3A 5KJEA 4D44A 1U0EA 2A5LA 3DWIA 5PGMA 3LFTA 1N2OA 4E33A 2B9EA 3BE8A 1G20E 1KIFA 3O94A 4PYLA 1T2DA 3A1VA 2PIAA 4J16C 4J7CA 1ZONA 2C0CA 4L16A 3X0DA 4ETNA 2OLJA 3GIDA 4LJSA 3O26A 5WRFA 3FOBA 1DG1G 3QWWA 4DR1B 2ZRDA 2OB2A 4JITA 1LVGA 2BUBA 3DL7A 1CRZA 1BAPA 4F2HA 3CKBA 2LO6A 4UDXX 3PQ3A 1YQQA 4LMPA 4J3FA 3I62A 4JBHA 5IM5A 3H2KA 3K70D 2BMVA 1SVXA 1W35A 3HU1A 3R5JA 2XWJI 5EN4A 2ZBEA 3X2QE 1RS0A 2AOXA 1H2ZA 1GUAA 4E12A 1HDRA 4HT3B 1Y5LA 3LP6A 1MO4A 5LYJF 1F12A 3ZD8A 2QENA 3STXA 1ZRMA 3CF4A 3BQ9A 1LBTA 2WVGA 2P9CA 4GAAA 3B85A 1M67A 5B6IA 4GOLD 2B4AA 3V1NA 3WGOA 4AUEA 2V1UA 4J0UA 3JR7A 3FTFA 4YDSA 3D59A 4AKXB 3SXUA 2VZEA 3VAAA 5JHBA 2QTWB 2VBIA 2FFGA 3L7OA 1E2DA 4EI8A 1X0XA 2ORIA 4R0MA 1WG8A 2WZCA 4AF7A 1JPLA 4ILKA 2ARKA 1E2NA 1EDEA 4QU8A 4CQMA 4C21A 2OK7A 5DFAA 4CMCA 5JFOA 3AVUA 3EVNA 5CA0F 2NNLD 4PCAA 1JWGA 4QHSA 3PT9A 3ILVA 3QU5A 4AIIA 5DN6D 4EQ6B 1TGVA 1MHPA 5FZSA 4XD7A 4WJZA 4YMWA 1ULHA 3E2PA 2JRLA 3W8EA 4GPD1 2YC2C 1V5EA 3MRVA 4GOJA 1W34A 3PEUA 3UTDA 3BM5A 3EG5A 3EDOA 2RC5A 1VM6A 5FOVA 2C2WA 3HJGA 3CKCA 5TMBA 3NC4A 2IYXA 2L69A 4AWXA 4OB7A 5BW8C 3N8HA 5ES3A 2R8EA 2ZSHA 1XVUA 2IEZA 2YRFA 4Q7JB 5F7JA 3INNA 1RYEA 3S68A 1O94D 3PFGA 3PE3A 3ZJ5A 1INZA 4YP6A 1J6UA 1M74A 2OB1A 1PNRA 1JQJC 3OCUA 2GA9A 5EUMA 4TLEA 5BN4A 1DWUA 1IQ0A 4AQDA 1NJ5A 2QKYA 2UYHA 3QKIA 2RHRA 1YDGA 4GLBA 1NXSA 4HV4A 4LV8B 5FO1A 1L4GA 3TKAA 4AB1A 5A9RA 4JL6A 2QTHA 3IA7A 1KAHA 1IOVA 3KOOA 1GWNA 4KXXA 2AZDA 1N6OA 5ECYA 1KTVA 4EG1A 1IQPA 3N0TA 5K09A 3FROA 4YJ3F 5DISB 4IDEA 4DBLC 3S81A 1DFHA 2CWDA 3RU0A 2KPOA 4FGJA 3ZDCA 1MFZA 1ML4A 1GL6A 1ZIYA 2IDMA 3JS5A 3HU3A 1XZLA 1HT2E 2ZUWA 4OBEA 1U8CB 5JNSA 3JTMA 4FM9A 1OH8A 1YBMA 2AJCA 4K6FA 4MR9A 1Z4LA 2RI1A 1NY5A 2CXQA 3RRFA 1RLUA 3REOA 3HS3A 2CYAA 4I1OB 2E7ZA 5HIJA 4PE5B 1OBCA 3DXYA 4YRSA 3FTPA 3OLVA 3R8CA 3JRWA 4MMXB 2MR6A 4H0FA 3TTSA 5K0NA 4WOKA 3W34A 1UBFA 1C80A 5GV8A 2V74B 5EZYA 5DM1A 4GE0A 3FVWA 2C2KA 1SXGA 2CJFA 3C8ZA 4XVUA 3OBBA 1XF9A 3C15C 2XMZA 1QYDA 4DB2A 2EGHA 2DQSA 4O63O 3D54D 5J5AA 1KI6B 5BXQC 4UYKA 1E2EA 4HNRA 4PHTA 4A82A 5HKPA 4J0QA 1NAHA 4BU0A 3E8XA 3UPDA 3ZYZA 3QFSA 1N8TA 3UJ8A 3RYFB 2OCDA 4RD2A 3H5VA 2WD7A 1S2DA 3R0XA 2ZJZA 3A4LA 1SXJA 4DPKA 1H8ED 3N7UA 4RLHA 2ERYA 5JCPA 3IAXA 1PUIA 3ZLTA 4AQYB 4AIFA 5ED4A 4YAUA 3RIMA 4DY6A 1UDBA 2ID9A 1SN7A 4KXLA 3AF4A 4I81A 3SHOA 2ZYUX 3KYIB 1RCTE 3OFVA 3EHRA 2WKRA 2B1IA 3AHCA 1W88A 3A1WA 3F67A 4UCFA 1HA3A 1SVWA 4ZT7A 2I67A 3DNMA 5EN5D 5CNJA 1ISMA 3COPA 4GOXA 4K9LA 1GA4A 4RD6A 5JAPA 3RVKA 2IEYA 5TNXA 2AMFA 1M2NA 2P2GA 2HE0A 4RPLA 2CYBA 3UT5B 4Q4JA 5ITZF 3Q3JB 3TQIA 2VSQA 1EVZA 3OPMA 4Q4DA 2AMJA 3A10A 4EMTA 3RIEA 2BOVA 3HKEA 1DAFA 5CEEA 1OZGA 3H11A 2D06A 2Q5EA 1JLMA 4JVOA 1VJGA 3L07A 2WXQA 1V43A 3QXGA 4UHBA 4IHKA 3DOUA 4UXIA 2NSHA 3DZKA 3EIHA 1SA0B 4F6CA 4BASA 5BOVA 3HYTA 2AZXA 4OYSA 2SKCA 3Q1KA 3ICQB 5JSQA 1H4QA 1UMCB 5MN6A 1CZNA 2HCRA 3DMFA 2VPZA 3U26A 3LY9A 1LTHR 1FNSA 1PJCA 1Z4MA 5GZ1A 5DNYB 2GTHA 2FK8A 2QAGA 4DT1B 3B7BA 4GWLA 2WAYA 5F3DA 3TSAA 4MRNA 2FTKE 3O75A 4KW7A 4QJ3A 1LXCA 3U3MA 2FXIA 2PL1A 5BSMA 1ZNWA 2ZR9A 4D80A 1SC9A 4E94A 2ILVA 1N7IA 3ML9A 2YXPX 1L5YA 3CLHA 4N0MA 3VA7A 2PAAA 3AW8A 1QO7A 4O4HF 1WZIA 1MX2A 2YYZA 3R5FA 3DYIA 3ROMA 4ZYWA 2VT7A 1HTWA 2TMKA 4MJ7A 3ZW3A 3H5WA 3RYCB 4I2NA 4O3FA 2XIJA 4IHJF 3O4HA 5AW0A 2RBEA 1C8LA 3L8FA 3W2FA 1UH5A 1HZZC 1VLVA 3O8OB 4A8JA 4E5KA 3BTOA 3UV6A 5SV2A 2VP4A 4PTLA 2XBLA 3ASZA 5K3AA 2Q2OA 3FJYA 4HYQA 4LQLA 2I0FA 3UXHA 1ST3A 3D7NA 4UD6A 2O52A 1RAEA 1F1BA 3VNUA 1F60A 4FINA 3K1ZA 3GA7A 3SZOA 5CLLA 3QARA 2QTNA 3U4DA 3PVCA 2YRWA 3L6RA 3TQSA 2F1KA 4H60A 1BQEA 3GNSA 4EKGA 1FYWA 1CY8A 1GGFA 3I39X 1IG0A 4S1VA 3NCHA 4ENSA 3ZD9A 4D9NA 2EQAA 4GRAA 1TEHA 3CIFA 4YRKA 1AHNA 1PL0A 3THSA 2EFCB 4P92A 5L3SA 1BXGA 5HILA 5GVSA 1GZVA 3V1TC 5K8TA 5EA2A 4RZUA 2J4FA 2Q5QA 2WZBA 2E4YA 1G5HA 1J5EB 2Q9AA 5B7PA 3CT6A 4XX0B 3MD0A 3DXZA 4JBIA 3IODA 1FSGA 1TN6A 1LWOA 3DDNA 5AQBA 2ZRPA 4KXQA 1XL1A 1ZN8A 2YV1A 3WNZA 3VZSA 4AF6A 2R6FA 1D0SA 2E5WA 1UMKA 2NADA 3E18A 4IH9A 4CIYA 3D6TB 1Y8QA 5J4HA 2EHJA 3PA8A 2PMWB 2I6HA 4XWKA 4UUOA 1AK9A 2HYZA 1O0SA 4Z3OA 3Q9UC 5FOWA 5IDXA 3HTXA 3PPXA 1WW3A 2GRNB 2D0DA 4MEJA 3L22A 1YHNA 3HHMA 1E5QA 2ZI7A 4Q1VA 5F9MA 2V7QD 1DAMA 1PGPA 3SBOA 1HQYE 3VAYA 1UAYA 5TQ0A 2W00A 1RAHA 2XVMA 3GEDA 4U7TB 4UMVA 2ZR0A 1EFPA 4X8HA 4P7FA 3HKBB 3L6CA 3ROTA 3LOPA 3LZ6A 4HFJA 1M34E 3NWBA 4HJXA 1HO3A 5LD2B 2FW7A 5EQDA 2MR5A 5KPJA 3JAMA 2PT9A 2J0UA 4EGJA 3MF4A 2BISA 2HFKA 3FYUA 1VE1A 2FRDA 4OJMX 3PXCX 1N5KA 3Q9NA 4GTQA 1M8JA 2JK1A 2OR3A 3WL5A 1NW7A 1VFNA 3AY7A 4R2IA 3BGVA 2UUAB 4RV5A 3GRKA 2DQKA 1K6MA 1N1GA 1A9PA 2W2PA 2WJ6A 1UOPA 5I48A 3W05A 1E98A 4JBNA 3RFTA 5LU9A 2H9AA 4UNRA 3E9EA 3VPGA 3D7LA 3WDLA 8GPBA 5LLTA 2BFOA 3PRKE 2EEZA 3LP5A 3DEPA 3D7RA 2IYEA 2W6PA 3IDQA 4FIZA 3EXG2 2F3UA 1IRXA 4FGLA 4HNQA 2YVLA 4Z0HO 3BMNB 1T13A 1N0VC 4IINA 4J8EA 4FHGA 4CCAA 4CMIB 3GRUA 3RKVA 4CLRB 3BN3A 4RF5A 2WFZA 4LX0A 1KDVA 1G6HA 1GKUB 4HUTA 3TIGA 1YUMA 4IVNA 5JD5A 4LQCA 2Q6VA 1FFXB 4YCJA 3LQ4A 4CLXA 3E2IA 3AKEA 2F1JA 2FZLA 1TDJA 3A36A 3KU4A 2ZG6A 3IV9A 3IGFA 4E88A 1OAAA 4JLNA 5HRYA 3CTPA 1C30B 4QXPA 4IDAA 1K8YB 4Z0PA 4TLCA 1FDWA 4CT4B 3DC7A 2EAUA 4DANA 4I0WB 2PMEA 2LCFA 1MOQA 2JLZA 2E0IA 3V2OA 5ALKA 2UYCA 4DG8A 2V9CA 3OZGA 3UUFA 2IOHA 3H42B 5CLFA 2XPYA 3AJ8A 1ODIA 7ABPA 4GFDA 4Q1EA 4WFQA 4V0LA 3G68A 2NPFA 4MQ5A 3HI6A 1VBMA 4TMTA 2IZ0A 4G1CA 5G1PA 2R8ZA 3CB4A 3QMWA 2X14A 2XI4A 1E2MA 5CIQA 3G1WA 2J9FB 2VQ2A 4Q16A 5ALWA 2UKDA 3B1YA 5B1EA 1YQ9A 2RKKA 1Y1SA 4JI2B 2VRWA 5L3QB 4P9NA 1PL6A 5AW3A 1QH9A 4NARA 3MLAA 5IRCD 3HJFA 1Q1GA 1A98A 2V0PA 5FQ7A 4REQB 1ZCFA 2YNQA 2A4MA 3HPQA 3FHLA 4ACAA 4YX9A 2P1ZA 1FUEA 3MINB 1KS2A 4P08A 2I1JA 2LCIA 1XPOA 1PJ2A 2BN4A 1M6YA 3IUEA 3IJ5A 4WJKB 4KXUA 1ZMRA 3LOQA 3SE0A 4G1VA 4D3FA 5KWDA 1RWBA 3O73A 3MV2B 1P6UA 1VHTA 1QRTA 2DBQA 5FTPA 3W78A 4B35A 4X94A 5IDQA 2PRSA 4FNAA 2E85A 2ZIZA 2WXOA 3VTXA 2FN3A 2Z56A 1FBTA 4FIDA 4YIHA 1FFDA 3R40A 2JJYA 5J5VA 1P7VA 3UAGA 2HTEA 3R9AB 1SEVA 1FYVA 4AMUA 3AM3A 3LCUA 1Y4AE 3ESCA 4ES6A 2DUWA 1GEGA 4LVUA 3I28A 1GRCA 5HQ3B 4XM2A 3ENNA 2I8LA 3VH2A 4TXPA 1E66A 3GLSA 5I5EA 4NOJA 4M0MA 4HD8A 2GJKA 2RFMA 2F55A 1NG1A 1VIAA 4D9JA 1NBEA 1RHMA 1OLXA 1LZKA 4YCCA 3LXMA 2XA9A 3ZLBA 1HT1E 3PEVA 4L95C 3VR3D 3HDYA 4L50A 5KNCD 3ZHXA 1CQZA 1QR6A 1VCMA 3BXFA 1KP9A 4DLOA 2XSZD 1KYWA 1OLUB 2VIIA 5FJIA 2FLWA 3GUCA 4Z51A 2C2XA 3LT1A 5K0FA 1XDWA 5LA6A 3RRJA 4I1UA 5CBNA 2GETA 5BUSA 1A71A 1N6HA 2ZZNA 2J6IA 3D3KA 2GCGA 1QK4A 1W87A 3RC7A 3ZDBA 2ZGDA 3VBEA 3CXUA 2YMLA 1OR8A 2OGSA 3DSVA 1LPAB 2C1XA 3LPDA 4RFLA 2YJ6A 2UWJG 4LJ6A 5EJ9A 3DH0A 3EVFA 5F77A 1DC7A 3QI2A 3OEWA 2ONJA 5DBGA 2A3NA 1JXOA 1R9MA 2HUNA 1EFKA 4DZRA 3HFRA 1NZJA 4H77A 1U2QA 1OXUA 5AOCA 3M6UA 5GQSA 4MP3A 3ZHZA 3VPXA 1DKOA 4XPIB 4F12A 5CECB 5HQ8A 1X7HA 3NP7A 4PHCA 1GJRA 5GZ6A 5AJHA 1UOQA 4F3TA 4K2AA 4YHHB 4BC1A 2VDMB 2L19A 4X8OA 4H1UA 3NYWA 4N6GA 4NK5A 4F11A 3EDTB 2ORED 4DUPA 2CL5A 2FR8C 4PG5A 2QP4A 3ITWA 3EPKA 2LGJA 5CRUA 4A6DA 5IZCC 3IMKA 3BWDD 2A1TR 3K09C 5TT0A 4MQLA 4ALNA 1SZPA 1JDVA 1M2FA 3T9BA 2H07A 2EJTA 4EW2A 1O1TA 2B0CA 5MGBA 2HJGA 3H17A 1Q1QA 1CB0A 5H68A 3KT3A 1HRKA 2IP4A 4TUYF 1FW6A 2ZBPA 4YP1A 1F3LA 1U0BB 4L7TA 1JHZA 1GYPA 3A8TA 3HL4A 4AXHA 3H1GA 3DFMA 3EXAA 1N6KA 4D3ZA 1D6JA 1KJWA 2GO7A 2PZLA 4XQ0A 5ITWA 2I54A 1G6Q1 4UQYA 4K81B 3R2JA 3FU0A 5ENVA 4MIOA 4FFBB 2DLDA 1HUQA 3GUUA 4MVJF 3IFSA 4QUGA 2EW8A 4JXZA 1YQUA 3IA2A 2J1LA 4QGBA 3USES 2QZ9A 1BE6A 1T91A 1MHTA 2JGDB 1FX0B 4BVGA 4PCVA 3RSLA 4AG6A 5CAEB 3O4ZA 4IFIA 3AEQA 1XCPA 2DX7A 1Z4IA 2NXJA 3A9CA 4OHFA 4BYGA 4FXPA 1KOLA 4DYDA 1PR5A 1WMEA 2C0LA 1EZZA 2EARA 3ASUA 2ACKA 3FP3A 2G5GX 5EIXA 3HGQA 1FL9A 1I01A 4RSGA 3EDQA 2YHIA 1XZAA 1RMQA 1C0LA 4D5GA 2EIJE 1LNZA 2D0OB 3AINA 3DAYA 2Z3VA 7AT1A 1P1HA 1PY1A 1ZJ6A 2Q6LA 2VCHA 1DIGA 2X8WA 2D5AA 4WERA 4GZ3A 1WO8A 3WV5A 1YB6A 3NDIA 1YS4A 1WXDA 3T8YA 2W37A 3QWFA 4B3BA 1UL1X 4LZLA 2BSQA 1I4TD 4CLHA 1WV1A 2A0YA 5IM4A 3EZGA 1GL3A 4KIJA 4V0OA 3H87A 3EJNA 3H97A 3OP1A 3QKRA 2V4MA 4GUAA 4Q7MB 5F2KA 3RR2A 4DEYA 4TLBA 3KNZA 4RVCA 1I94B 1ISPA 1QMGA 1UANA 3IXMA 3M6FA 4H7EA 2L0IA 4BO6A 3EIQC 2WILA 3AMVA 4TXQA 2PRJA 4YNDA 1Q74A 3T7AA 4R2HA 4O5OA 1CR6A 5T6BA 2OFPA 4GKJB 3PV0A 2CE2X 4RKFA 3Q5MA 5EE1A 4INPA 2YZ2A 5JEDA 4FI3F 3FMIA 1ODTC 1U0LA 3OY7A 4XIYA 2PQNA 3K0FA 4HC4A 3OPYI 4IYJA 2K2QB 5K8CA 2PL9A 5I4BA 3O4RA 3H3FA 1XPUA 2GEKA 1CEQA 2GCOA 4AJ4A 4P34A 2G9UA 4CM3A 4X95A 2OQRA 4TQAA 2GVNA 2B1JA 3P9CA 2F3TA 3ZW7A 5H7PA 1HG1A 2Z57A 1ZC3A 4B44A 2G76A 4YAOA 5JZMA 4AZ3A 1LA2A 2AF3C 3CO5A 1IY1A 1ATZA 2XPCA 1H1TA 1UZNA 4M60A 2Q5CA 3FHOA 1LW7A 5DYWA 5JNTA 4HPXB 3FPGA 1PE0A 3RAGA 1HDYA 4TVOA 1TUBA 3OU2A 3UT8A 2UV8A 1KZ1A 4RIFA 2FCRA 2H2DA 3CQGB 2RE8A 4OTZA 4ANWA 3D9MA 3W04A 3ORYA 1Q3KA 1Q95A 1YJQA 2XKBA 3MWDA 3P0JA 4NE7A 1KP2A 4K9KA 2WWTA 4JWKA 4OK6A 2EYUA 2PMKA 5H16A 3PUYA 1ZXXA 1TCAA 1PKXA 1WZCA 3P0IA 1FB5A 3ZWAA 5K20A 4PPNA 1W6RA 4Q94A 1NDUA 1U99A 3H5NA 4CT5A 3TS1A 2ECQA 1L8AA 3QPUA 1QTIA 2G9VA 4O4LA 3DT9A 2QX4A 4FOSA 2V5FA 4G5YA 4L2LA 2GH1A 3WZMA 2GLUA 4ZD6A 3DXFA 4OH1A 4L4ZA 1DQSA 4DNQA 4N7MA 4XR4A 3GUVA 1SCBA 1EYHA 4Q82A 2VYNA 3VZQA 2B4RO 2GUGA 4YN3A 4YI5A 1E6MA 1LS1A 2V9PA 1NHGA 2CNBA 2H59A 1UOOA 3PGA1 3MYVA 4P58A 1XZJA 3UFBA 1WPQA 4GP6A 3A6FA 2EJBA 3D0QA 1O57A 4Q3DA 2H1CA 1R5OA 5CX1A 1XEWY 3CEQA 3A14A 2RHTA 1B16A 3LK7A 2M1ZA 3RRNA 1RRCA 2KATA 4JEMA 3ZCRA 4C05A 5EKQD 5AO9A 1WY5A 3V7UA 2IUFA 3TE6A 1ZSVA 4S3MA 1NKTA 4G8JA 4B47A 1CJSA 4GWGA 2GRLA 4BLUA 2OZLB 4HOUA 3AR6A 3UIEA 3HB7A 4KBQA 5K3DA 3T35A 2XRFA 3GP5A 3V9AA 1OFUA 1YL5A 3UC9A 4LYYA 4PGAA 3EXFA 3I23A 1C8VB 3LUAA 4BQNA 4K3UA 1L8QA 1FJ2A 3GVHA 2V6MA 3D6MA 5EYPF 4XYBA 1ZLYA 5F7OA 2FUEA 1JX6A 6ADHA 2FDXA 4GL2A 4LXQA 4TTPA 4DR5B 5BNTA 4EOGA 1WLYA 3RIXA 5DHAA 2XA1A 3SC2A 1NT4A 4QUKA 3K1AB 1LF8A 2EW2A 1U7PA 4O2AF 2ZRGA 5E1OA 1NJ2A 2EFEB 2RJ3A 1K0UA 1RABA 3TEFA 3KQQA 1DRVA 4W5HA 2ZJ1A 1SBHA 2WC1A 1CY0A 3DDCA 3OZDA 1WSWA 4N5MA 4YRQA 4D6YA 5CR9A 1JIUA 3UCEA 1DAKA 3GRYA 2NW6A 4FYHA 4DIUA 4UBJA 3A27A 2C9OA 4C4RA 4MSUA 2WUFA 1FLVA 1I8TA 2QMOA 4GAEA 3MSXA 1NVBA 2H1HA 5KC9A 3A4MA 2ZRLA 2P9BA 1AZSC 5LBUA 1QMPA 3T5BA 5BW6B 4ZYLA 2C61A 5AXCA 5C18A 2Q8PA 5E2AA 1KGDA 4F1SA 4WOBA 3DLAA 4KN5A 2CG3A 2JASA 3R7FA 4MYCA 4DRZA 3STWA 1T35A 3DP7A 1WEKA 1YAHA 5E6UA 3JPWA 1Z82A 4E3WA 1DAOA 1RAGA 1OI7A 1CW2B 1HFJA 1EVKA 3R9XA 2X7XA 1T5OA 3NATA 2WXKA 3I4GA 2ZJ7A 2WSBA 4PX3A 3JYSA 2LW7A 3HYMB 2VYQA 1V47A 3TUIC 2FSVC 1G6KA 2FPGB 3LQQA 3RSZA 3TL5A 1SKUA 4L7VA 2C00A 1HNNA 3FLAA 1UPTA 3UCFA 4ACBA 3O0TA 4JI3B 4UE3S 4L22A 3BAFA 1LPOA 4R40A 3PNKA 3E3MA 4NAHA 2MYPA 2PZFA 1ZGBA 4O2BA 2XTJA 1QBKC 3LUHA 4BX0A 5EE0A 3X1YA 3SWWA 1K89A 4JAVC 1P9RA 1FP1D 1RC0A 1DUSA 5EG5A 3WRYA 4ND5A 5KYVA 1KZPA 3UAZA 5JAIA 3FCUB 3F74A 4F7DA 4ZHBA 3MOIA 1ENOA 1CVLA 1TO1E 3L8DA 2WIAA 4Y30A 1DNPA 1KE2A 4ZJZA 4NIMA 1G0NA 3ASDA 4X0EA 3AG6A 4IUBS 4GLLA 3GCDA 4LNAA 2WEKA 4CEMA 2PJUA 5D1HA 3AKDA 2OUKA 3LPZA 1LD8A 3P19A 2XTAA 4KAJA 3D5TA 5BT1A 2PX5A 1I5RA 1U7ZA 3W5DA 2I76A 2P6MA 4BXOB 3NYRA 5K0GA 4HHEA 1D7OA 4D10C 5JMTA 3NKLA 1FXUA 4RLYA 1SOMA 4ZVKA 5AK0A 2PKQO 1CSEE 4G1FA 3V4OA 3L92A 1VBKA 1CUBA 1E9CA 1D2RA 4RV9A 1JE0A 2Y66A 1CRQA 4AZSA 3M5PA 3AJIA 1QV7A 4IJQA 2IODA 2ZUBA 4F3VA 4LV5B 2X76A 5BT9A 4C4AA 2NU7A 3A04A 3DBVO 5TF4A 3PGMA 5K8LA 3TTTA 2CMGA 3QK0A 4H31A 2EJUA 3N76A 4L8FA 3I72A 4BQQA 1A4IA 1KZ9A 1DAPA 4TYQA 2GM9A 1J8MF 3U7IA 3MX3A 2JAOA 3ANYB 1LPBB 4JSYA 1W36B 2AGVA 2RHGB 5HMMA 4EFLA 3W4JA 4UHEA 1ZW1A 5C5EA 3KTOA 4FHJA 1FSSA 1IZ7A 3QX9A 2BKXA 2O3QA 3A6KA 1WU7A 1XUOA 4OO3A 1S64A 5ADWA 2X6IA 2AD5A 4J7XA 2UUOA 4E5PA 3UMMA 3DJFA 4DV4B 2Y1XA 3IAUA 4UFNA 1A2OA 2R00C 1B8UA 2VNIA 1EWYA 3R9IA 3DPYA 3FUMA 4CTMA 1OD6A 5A5GA 3Q88A 4HAWA 1CZRA 3CLSC 1CK4A 1T8TA 4YGYA 4LY0A 5A9SA 2Q2VA 2IXFA 4GICA 2PX0A 5ALOA 4CGVA 3AZPA 3U6BA 5LP1A 4FNMA 1YJ8A 3ZU7B 1W4AA 1K97A 4KJXA 4BBPA 3V7NA 2O5RA 2RD0A 1AHHA 1DZIA 1G16A 3GX1A 5CDTA 2OV2A 3R4VA 3BRSA 4V1CI 3LPAA 3FMFA 1QJCA 1EUCA 4LY6A 4UQOA 3VFDA 2WUEA 1X7XB 1BW9A 2LZ0A 3HYLA 1JVSA 2BRUA 3GDWA 3I5MA 5KYTA 1HOXA 2ZULA 3SIWA 2RSFA 4CGWA 4MKGA 4IUCS 2A9FA 2CMFA 7YASA 4EG7A 4YMSA 1Z4PX 3MYYA 1ZLXA 1VBNA 3IURA 2NZXA 4WKGA 1LLDA 3HB9A 3V2UA 4F72A 2JJ8A 1D2MA 3ND5A 1DDIA 3WR5A 3HXLA 3IXLA 3MWGA 2NYJA 5HE8A 3FPBA 4CU2A 1QO0D 2NO1A 5KWSA 4IVRA 4IV5A 1W0JA 1WXHA 4JI8B 4NFYA 3RHTA 1QIKA 3TTYA 1YR3A 1WDYA 1MVNA 1HFAA 2JAPA 3FKSD 3M33A 4YRZA 3EYAA 4FFWA 3GFBA 1HSOA 1Z6ZA 4BHTA 4PFJA 4AJ9A 1F0PA 5TDHA 1PI3A 1A2QA 4CU5A 1NLYA 4R2KA 1P60A 2DQZA 2OKCA 5BSRA 3HUDA 3D3WA 4BJ3A 1N3BA 1TW3A 3TI7A 5H3CA 3TMKA 2PWYA 2R6R1 4RVGA 1YR6A 1JECA 3FBGA 2J31A 2GN8A 2OAP1 4BNLA 3RJ9A 4WOJA 3BJRA 3KXKA 3SPXA 1HR0B 1NUPA 2VUTA 1CF9A 4JB3A 2FH5B 1F38A 5DTMA 4X85A 3NRBA 2JA1A 2H17A 1G1AA 1OI2A 4OA8A 2AMVA 5F5XA 1OWPA 1JVNA 2IV2X 2C3UA 4C07A 4H6VA 3OJ0A 4S0ZA 4L4UA 4S2EA 2QZZA 4ZDJA 4QOIA 3LCRA 4PRZA 3NRJA 3A6HA 4MUNA 3OPQA 1DBVO 4YEDA 2QLTA 1E8WA 4PPGA 3WLEA 3QNKA 4PZEA 1OMOA 4UM7A 1N6RA 4OLAA 4JEUA 3HN7A 1N0WA 4KG7A 1IEVA 2RG7A 4XVHA 4E11A 4DCTA 2CN1A 2A5DA 4HXIA 3DTVB 2GN1A 2HC9A 4ALKA 4A2QA 3ZD7A 3C6YA 4G0OA 1SVUA 2I6SA 1MV8A 4Z49A 2Y3AA 1HY3A 1F0YA 1QYCA 2RDMA 4F9TA 4C9BA 1J2TA 4F5EA 3PPVA 3KQLA 4B45A 3AL3A 1IVSA 1KC3A 1TU0A 1SIBE 1MO2A 1UDRA 5EP3A 3RAPR 2FJBB 3HCEA 4EQFA 2AKEA 4MV9A 1CHNA 5KAPA 4TKLA 1P80A 5CLHA 1L9KA 2BVNA 4RZHA 1XTKA 3VLDA 2C2MA 2ZJ6A 1UJJA 5CGQB 3W5VA 4LF5B 1KI7A 1LC0A 3OU7A 4GCOA 4BZXA 2OV4A 4HH3C 3PCXA 5E9QA 1BCRB 1EGQA 1W7AA 3VJMA 4KYTA 1VYVA 1CDOA 3AJEA 3BS4A 5FWYA 3PA6A 4B6FA 2ZM5A 5GP1A 121PA 3EF1A 1KEPA 4HXEB 1UPUA 5K8JB 3HVEB 2DJIA 4XWTA 1Z35A 5KNLA 1NTRA 1SCDA 1HEUA 4G5FA 3CRMA 2XDQB 3MKRA 3KX2A 1PSZA 4YDWA 4HVAA 3SVLA 2I7DA 3AESA 4H4EA 3O8BA 2J9QA 1CUUA 2ZAGA 4RYLA 5AARA 4UQLA 5BXOA 1VIDA 3D9QX 5EJ6