4XIFA

Human ogt in complex with udp-5s-glcnac and substrate peptide (keratin-7)
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
717
structure length
702
Chain Sequence
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The active site of O-GlcNAc transferase imposes constraints on substrate sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 268
structure length 702
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xifA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xifA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4xifA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4xifA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xifA03
1NLMA 5G05C 2BGTA 3CEMA 4GA2A 3MT8A 2F3PA 2QRPA 2XPIA 4QLBA 3T7DA 3L7AA 2YQ8A 3MQFA 1BX3A 3Q47B 4BQEA 5D01A 2V5FA 2ATIA 3S7BA 2AZDA 1HZ4A 1JIVA 4RELA 3UPVA 1K08A 1QQEA 2R66A 4BQFA 2ONDA 2KCLA 2VGXA 3OTHA 1EXVA 4N2QA 3NP7A 3L01A 3D0RA 4WNEA 3QWWA 4JL0A 4AM9A 3G2KA 3MBOA 3L79A 2JJMA 1L5VA 3Q4AB 1KT1A 4U07A 5IKOA 2F3UA 2R4UA 1FU8A 1XOIA 2X6RA 2IYAA 3OXGA 4CGWA 4Y6CA 2Y4TA 3NF1A 2PQNA 5FTPA 2QN9A 3FP3A 5BT1A 3OT5A 3NPAA 1HXIA 4WNDA 5EX0A 1GPYA 4RIGA 4FKZA 2JLBA 3MS7A 1W3BA 1E96B 3S28A 1NVKA 5JTUA 1C3JA 5DIZA 5CHEE 3C48A 1A17A 3URZA 2QN3A 3MRXA 5IKPA 3S27A 3CVQA 1JG6A 2AMVA 2ZB2A 3RKVA 3ASDA 6GPBA 4BTAA 3H4IA 3ZCVA 2PQRA 3FROA 2XMPA 2FFRA 2AW3A 5EKQD 4F9FA 1FTYA 3VUEA 2AV6A 5TMEA 4A1SA 4BQIA 2QN7A 1GPAA 2C1ZA 4GA0A 3QHPA 4YI3A 1OUVA 1P5QA 4YVQC 2QRQA 1M5RA 2FI7A 4EQFA 3G2LA 2KCKA 3Q15A 1XV5A 4WACA 3O3CA 2QN8A 4I2WA 4KYOB 1O6CA 1RZVA 3S29A 3MTAA 3NC4A 3GPBA 4NEQA 2IFUA 1FS4A 4UI9C 4BT8A 5KJKA 1PN3A 2HY7A 1FTWA 4N39A 1C8KA 3LY7A 4Z5XA 2P6PA 1ABBA 1SXPA 4J8EA 4B94A 5FZSA 3S7FA 3MS4A 4CTOA 5HI7A 3MTDA 3T3IA 2FF5A 3GYZA 4G25A 2XA9A 2XCBA 2H1FA 1WV1A 1VGVA 3Q3EA 4HOSA 5LCWJ 5DXFA 2XCCA 1C8LA 3T3EA 3BDAA 2UWJG 3CV0A 4WADA 3RSCA 3T3HA 1QKJA 2FBNA 1XKXA 1NOJA 3ASGA 8GPBA 5EX3A 2BGUA 3KS2A 4GZ6A 4Y6WA 2QN1A 3MEKA 3Q5MA 1IIRA 5DLDA 3ULQA 3MRVA 1IYGA 1L5QA 1F0KA 1NOKA 3ZCQA 4YI5A 2FF4A 1EM6A 5ARGA 4HOTA 4HOQA 1JEJA 4G2VA 4KQ1A 1AHPA 5AYWD 2OOEA 5C1DA 2ECPA 4M7PA 3DDSA 3RIBA 2I6HA 5FZQA 3ZHEB 3Q49B 3LY8A 5G04J 3S0JA 2GPAA 4G26A 2VQ2A 1GGNA 2QRMA 2C0MA 3MT7A 3L7BA 2HR2A 1NA0A 2FEZA 2C2LA 5KJNA 2QRGA 4MHOA 4YVOA 2R60A 2E2EA 2QLLA 3L7DA 3VTYA 2GEJA 3CKCA 5D0OD 1J39A 3L7CA 1PC2A 3EDTB 3CEQA 4APOA 5KJMA 3ZN3A 4LDPA 3EBOA 4LEUA 1YA0A 1F6DA 4MHSA 2DBAA 1NOIA 4GPBA 1QZ2A 2GPNA 3G2NA 3BCUA 3T3GA 4N3BA 3NB0A 4F97A 5JJTA 3K9IA 5LCWC 1NZFA 2XCIA 3PE4A 3LCAA 5A6CA 3COPA 4RIIA 2PYIA 3OXFA 5TMDA 3WADA 5G04C 4GYWA 4EJ2A 3QKYA 4XI9A 4CDRA 3NCHA 3IAAA 2ACVA 4WNGA 2UY1A 4M83A 3VTXA 3U4TA 4RBNA 1KTIA 1ZBPA 2FO7A 4XI0A 1PSWA 4L22A 3N71A 3ESKA 3HBMA 1WV0A 2IF4A 3LY9A 4I1AA 1WAO1 2HYZA 2XA2A 2X6QA 4H7YA 2F3SA 4W6QA 4I9CA 1K06A 5JJ6A 2VG8A 2GJ4A 3RO3A 1A8IA 3LYAA 3Q3IA 1P2BA 1TJCA 3UYLA 2PL2A 2C1XA 4JHRA 5TVGA 2GEKA 3UUXA 2AVPA 3NAZA 3S2UA 3WAGA 4BTBA 1JIUA 1P4GA 2KATA 1ZU2A 3CUVA 4AIFA 2PYDA 3DZCA 2H1HA 2QNBA 5M72A 1FA9A 3G2IA 2GW1A 4N3AA 3CVLA 3CK9A 3MV3B 4AMGA 3LKUA 2J9QA 4HLNA 5ARFA 2XEVA 1B4DA 4RIFA 2C0LA 3CK8A 3TOVA 4AN4A 3EBPA 2LNIA 2VSYA 4GZ3A 4N5CA 4G2TA 1LWOA 3RSZA 1B89A 3OKAA 4WHMA 1WUTA 3JYSA 3BEOA 4MICA 4REMA 3IEGA 4J8DA 2F3QA 3CUYA 4X7MA 3VDMA 3CV3A 1GG8A 4XIFA 3QWVA 4BFCA 3GUHA 1FU7A 1L5WA 2QRHA 1PYGA 2QLMA 3SF4A 4N9WA 3CUWA 3MSCA 2PRJA 1RRVA 2VGYA 4F96A 3MTBA 1NZDA 5JTTA 1RZUA 2BUGA 2IV3A 3PDNA 3ASFA 3CUTA 1ELWA 2IYFA 4RIEA 4GCNA 2IEIA 4LEIA 4GPKA 4AMBA 2IEGA 1IXYA 4JA7A 4JA9A 1KLXA 2YJNA 3KAEA 3UQ3A 2Y4UA 2PQ6A 3BD7A 3ZCTA 4UQZA 2OFFA 4RIHA 4GZ5A 4I9EA 2SKEA 3HBFA 3RU0A 4AY6A 3OXLA 2SKDA 3TSAA 4EL0A 4X7PA 5A7DB 2L6JA 3VUFA 1Y6GA 5BW8C 3LPZA 2SKCA 3C4VA 4RENA 2O6LA 3OTGA 5D0QD 1GFZA 5FT9A 4ABNA 3MS2A 3BCSA 5ENZA 5HXAA 3ZPJA 2KC7A 2WQHA 3CK7A 1WW3A 3TGOA 4UQXA 4J8FA 1V4VA 3E3LA 2X0DA 3AS4A 2XGMA 1HLFA 3E3NA 5GPBA 2WPVA 3OY7A 2G9UA 1JIXA 1LWNA 1QM5A 4UQYA 3PE3A 4F3VA 5I45A 2XGOA 2QLNA 1P2GA 5BNWA 2VYIA 4AY5A 4BWRA 1PNVA 2ACWA 4HWGA 3CEJA 3ZCSA 4NQ0A 3QWPA 3MA5A 2VSNA 2LSUA 4NRHB 5CCMA 3CX4A 4PQGA 5G05J 2WTXA 3ZCRA 5FZRA 3S7DA 2HO1A 4G24A 2G9RA 3Q3HA 3KD7A 4I17A 1L5RA 5HQ8A 4ME2A 5FJYA 4MRAA 3AS8A 3HBJA 3MRTA 4CTNA 3CVNA 4U04A 3QKWA 5LQDA 3S7JA 2LSVA 1UQTA 3OTIA 2F9FA 4N3CA 1E4OA 4EKEA 3C4QA 1FC0A 3BD8A 4EKYA 3E4BA 3WC4A 2R4TA 2XA1A 4J0UA 3BEEA 1WM5A 4WUYA 2P58C 1IHGA 3ASHA 2JZCA 5TMBA 1GPBA 3ZCUA 3R9AB 1XC7A 2KCVA 1XL0A 4RG6A 3CVPA 1WUYA 1Z6PA 2VCHA 2FETA 1Z6QA 2QFCA 3T3DA 4KQMA 1Y8ZA 1YA6A 3MT9A 1WW2A 3H4TA 3GZ1A 2YHCA 3O48A 4GYOA 1C50A 4FZRA 2IV7A 4N2SA 4CGVA 1XL1A 1NA3A 2MHKA 3VDNB 4I2ZA 1P4JA 2UY1B 4G23A 4HOUA 4RG9A 2XGSA 3OY2A 1Y6FA 3UYKA 3CEHA 4CTMA 2X0FA 4NESA 4GYYA 4UI9J 1SXQA 1FU4A 2PRIA 4YUAA 1H5UA 1HH8A 3MV2B 3NP9A 4W9RA 3DDWA 3FWVA 3G2HA 4KBQA 1KT0A 2NC9A 4KQ2A 3QDNA 5DBKA 5CCLA 2C9ZA 4U0UA 2VCEA 4G1TA 2KS6A 1L5SA 4GA1A 3SYRA 1JG7A 2QN2A 2GPBA 2IUYA 2R68A 3OKPA 1Z62A 4BT9A 4IN3B 3CUUA 4NC9A 1FTQA 4MI3A 1P4HA 4MI6A 7GPBA 2GM9A 2BFWA 3TG5A 3RT1A 4X6LA 1XNFA 4KXKB 4H7XA 5JJ7A 2GT1A 2C4MA 4UI9K 2QZSA 5DU2A 1P2DA 4U0ZA 3ZHEA 4O6FA 3E3OA 3OKCA 4EL5A 2Q7FA 2G9QA 3ZCPA 3QOUA 3FFLA 1P29A 1UQUA 3RHZA 3ZFWA 1E1YA 3CKBA 3BD6A 2X0EA 2VGXB 3DD1A 1YGPA 9GPBA 2IW1A 3G2JA 4GCOA 3T5TA 3IA7A 2XCUA 1UZUA 3SYMA 1NZNA 2PZIA 4M60A 2BISA 1Y8MA 4MI9A 3RO2A 2G9VA 3HBNA 1FCHA 3D0QA 3AMVA 4X7RA 5D00A 3HYMB 3ZGQA 3WXXA 1ELRA 3BCRA 3SZ7A 4HORA 4U0SA 1GZ5A 3MKRA 3GW4A 2Q6VA 3TG4A 3RJVA 1L7XA 3AS5A 4WNFA 1AXRA 3TAXA 3U3WA 5KJLA 2ASVA 4YNDA 1Z8DA 2R5SA 1L6IA 3GZ2A 3D1JA
chains in the Genus database with same CATH superfamily
3S70A 4R83A 5JNRA 1L5JA 5G05C 1OU4A 3QC1A 2SICE 5E3HA 1PL7A 5ENQD 1YR8A 5IEBA 3T1YB 4XSVA 3VVMA 1XCBA 3PPVA 5HQ3A 3DKIA 3HJRA 2WUVA 3DD5A 2Y1DA 3Q41A 2IHKA 3R6LA 3Q47B 4C21A 5C53B 1YDGA 1UWVA 2HD4A 3Q7TA 2HRZA 1GNTA 1UZLA 4JKOA 1QO7A 5JVDA 2OOKA 2Z95A 2OXEA 4V1CB 1K08A 4MQ4A 4YHHB 1Z5VA 2SNIE 1W0JA 2NVUA 3AFGA 1RXIA 3DOEA 3DXXA 4LCBA 1EVKA 5EJ5A 5JH7B 3N7AA 2WVJA 3D0RA 4WNEA 5DPMA 4IULA 5BN4A 5KNCD 1LD3A 1VSBA 5GV8A 3E7FA 2YYSA 2QVGA 3R0IA 2EZUA 1V8BA 4TV8F 3RFVA 3U1BA 1PVDA 4K6GA 3QLEA 1NYLA 4GMLA 1KT1A 3H7IA 1OCEA 2YJ4A 4IEEA 4JJEA 4Q1EA 1U8XX 3IERA 4DK5A 1XZPA 2IYAA 1FJHA 3I6MA 2EHDA 4XQEA 1FNDA 1TZBA 1KFEB 5EG5A 3K4QA 5HDBB 2WXKA 4ZQCB 4E2FA 3NPAA 1GPYA 4L07A 2BKVA 2PN1A 2FJEB 3W5BA 1DUIA 1DTWB 1OXSC 3LC1O 4MYSA 5AVZA 2F8YA 4JXTA 1NVKA 2F8SA 2QZJA 1DKOA 4O4IA 5G0TA 1OIWA 1QYDA 1KBQA 1YZHA 2GHIA 3C41J 6CHYA 4IKEA 4RPJA 3RQSA 3ZR4B 3OCZA 3SZOA 3B7TA 5ALQA 2QN3A 4QYIB 4DLAA 4Z2AA 4QQ8A 1E1RA 1VL2A 2GO1A 4Y2JA 1IQUA 3NTOA 4PLZA 1Y9DA 3QUCA 4MUXA 4FJ0A 3H1BA 4OXRA 3STTA 1ZJJA 3UCFA 3KSZO 4HQDA 1TM5E 4KWCA 3ZCVA 1Y9ZA 4LRQA 4YJFB 5ERXA 5EKQD 3EYWA 4DV7B 2OESA 2G8LA 3GQVA 4LSWA 4NBVA 5HX7A 3KQHA 1A9SA 4W5HA 3IKVA 1JHPA 2ZSBA 4CM6A 4P7JA 4DLYA 1FEZA 1T8TA 3DONA 2OCYC 3DSRA 5AVJA 2ESRA 4DIUA 5DRTA 4FGWA 2QMQA 4JOQA 3QENA 1L3IA 2BEWA 2W2NA 1C8BA 4POAA 4QE3A 4WACA 4B0OA 4N5IX 1NN1A 2DQYA 1E6UA 1QGDA 4UBLA 5LYJA 4CLOB 1SBCA 3DZHA 2RI6A 2WYIA 5FF9A 3VYRB 2PLWA 3UJ8A 2FHSA 2UYQA 2HU5A 4XM1A 2X86A 3QY0A 4KQIA 4A55A 1FTWA 2QI9F 4X45A 4YAFA 2DZDA 1XZGA 2HXYA 1XZEA 3MGKA 1SC1A 5TNXA 4CRWA 2ZAYA 2E4UA 4FLFA 4DSZA 3S7FA 9LDTA 1VCIA 5ILOA 2AC4A 4PYJA 2PUAA 2JPDA 1KS9A 4FFOA 3D8NA 3UG6A 3DVRX 1XLWA 2RIPA 4KIGA 1L7OA 2HE0A 3NQ41 3WJ7A 4DLKA 4UU0A 2ZEJA 4Z51A 3JSAA 2VR1A 3RYFB 1I1QB 1J42A 1MORA 2J6IA 1L7EA 1LLDA 2VTVA 3G0IA 3OQPA 4C7MA 1J9EA 6YASA 2J6BA 3QLVA 3Q9LA 2VK4A 3V9AA 4Q1AA 1XRSB 3BDAA 4X92A 2UWJG 1YZQA 2YFHA 3CRNA 4XX5A 3FTPA 1XJWA 4X91A 2HBQA 4QSHA 1UJNA 3FMGA 5EXSA 2J7PD 1QE0A 1QKJA 4M9QA 4U2CA 4B35A 4L0MA 1NOJA 5T4FA 4HX5A 2J4DA 3SYKA 1WVIA 1U7DA 1V5WA 2HEIA 2RGGA 2VHEA 2W6NA 2VS1A 2YCLA 3GROA 3H4VA 1QGAA 3K9BA 1J97A 5KNBH 5DLDA 3TLCA 3WJAA 4ZICA 5D6NA 4QLOA 4YFVA 4K81B 1KJJA 1C4WA 1D3AA 5E38A 4TYNA 1F0KA 4TS9A 3QPWA 1E92A 1KSHA 2CVQA 2NXJA 1I5EA 3DVSX 3OA2A 3PQFA 3OJCA 3WGZA 3FHEA 1NDQA 4MS1B 3F4BA 5CK4A 3UXEA 621PA 4ZDJA 1Z7YA 3F98A 5ARGA 3SZ3A 3TRHA 4MGZR 4OF4A 1MO6A 1YBVA 3ZXXA 3B78A 4D6XA 3RIBA 1WM1A 1RRMA 2EV9A 4NFHA 1XTPA 3V8EA 1SELA 2AOXA 3AHHA 1LFAA 1THZA 4BB6A 1P72A 3V1UA 1NFRA 2AGVA 4Y1EA 2CYCA 1HXHA 2ZB7A 2GBLC 5B1AE 1SNYA 1JSCA 5DGXA 1CIJA 3QKRA 4ZOEA 1M2NA 2RGCA 2XH8A 2Z4RA 2G1PA 2IDMA 2IE0A 1XDWA 4R01A 3A1UA 1H2WA 4AYWA 4X00A 4HT3B 3C70A 5DBEX 5IKXA 3BRWD 3TOZA 4YPOA 3J80A 3Q9NA 4YJKA 1V3UA 1OKKD 1YT5A 3QBDA 3ZNNA 5CCEA 3VR3D 3DNFA 3PQ7A 5J47A 2P77A 3MLAA 1XDUA 4QQFA 4KLZA 3TW4A 1IXRC 3EDRA 2B3DA 4N8DA 1T2EA 4KH1A 9LDBA 1YA0A 1U3WA 3AILA 3U4CA 4PN7A 3M3PA 1A5ZA 3Q79A 1F6DA 4JBYA 1KZ9A 4L7TA 3O03A 5LVAA 1YL5A 1FDIA 1W35A 1VRWA 4WXRA 3T7TA 1UAAA 1T5LA 4F3RA 2ZP1A 1ONNA 2GZSA 4NYIQ 3WYGA 3PZ1A 4GF5A 1JU9A 1NF9A 2C3YA 3ZXUB 1JJBA 3OX4A 5K20A 2W6IA 4DM4A 1UFOA 4FZVA 4M0FA 4UVEA 5TMDA 5G04C 3W5HA 1GDDA 2AOVA 4KXLA 4AZ3A 4GYWA 4UM5A 2O8EB 1N2GA 2ZRIA 3NCHA 1XLTA 2X5TA 3EPHA 3KJNA 3WAJA 3HA5A 2OUKA 3FTEA 3SDZA 3QVSA 4ZO9A 4D97A 4A3TA 1BEZA 2F7SA 1MT0A 3AEUB 3EZYA 1PSWA 1KAMA 4HS4A 4Q9KA 2GKGA 3LIIA 1TZCA 1WQ1R 1XPJA 4LYJA 5B7NA 5EGSA 1SVMA 1CD5A 2WZQA 1H42A 2DC1A 3N07A 2BFBB 5EKTA 4D8YA 2Y76A 2XUHA 4BU0A 4DZZA 2ZCJA 4Q7QA 4U6NA 1LQTA 4XX0A 4HN4B 4NK5A 3SZMA 5IDVA 3QV2A 2Y6UA 5KVCA 1WETA 3O8LA 2F8LA 2J8SD 5IAGA 1OXVA 1NUTA 5EZYA 4TKVB 3SHTA 3D7NA 4M0EA 5E7MA 4OKIA 4OVUA 5LQJA 2GAOA 2VDOB 2YASA 4BNHA 3DSXA 1G7TA 4KIWA 4N18A 1BX0A 1T36B 2CJYA 2IZ7A 3OHSX 4RVFA 3RJZA 1UT5A 5TXGA 4J3NA 4C7OB 4N3AA 1NXXA 4BNKA 1XZJA 3LKUA 3KVVA 4PBTA 3IQZA 3FUKA 3CK8A 4MV6A 1J9ZA 4MUBA 2C54A 2ON6A 3FN4A 1HWYA 3D3MA 3EBPA 4XPIA 3HU3A 5I4BA 4B3RB 2NXPA 1X8XA 1OWPA 4JJ4A 2IDZA 3B7UX 2OL4A 2OEVA 1CZHA 4MKFA 1QXSA 5I4KA 3EOZA 4R1TA 3BIFA 2C7BA 3GPIA 3LW7A 3SPXA 4B4WA 2YY5A 1H65A 2O2YA 3BF7A 3C3PA 4IMJB 4MW7A 2E6KA 3EXG2 5EPOA 5ESXA 5FOTA 5SY6A 4CQMD 4CU5A 1K89A 1HDEA 2BGGA 1GG8A 5IBPA 4CVNA 1G5FA 2F67A 3V4ZA 3VBEA 4B3SB 2CXOA 4NCJA 4YDHB 5D1NA 3ZJTA 1L9KA 3RVBA 4RACA 4ETWA 3A6DA 4NBWA 5K45A 2WLTA 1IUKA 5AVWA 2HWKA 3AEQA 4F5DA 2QR2A 2CHQA 2EFGA 2F4NA 4NZ9A 5FA8A 5BQFA 2RFAA 2JVKA 3OBBA 5FTMA 5B3AA 2DT8A 1XZHA 5FFNA 3KU1A 4J43A 1DHRA 5K09A 2C2XA 5IDWA 3LT1A 2IEGA 2Q3BA 4M89A 4QDJA 4D1YA 3EVNA 4Y9UA 1KLXA 1PNQA 1TCBA 2ZWAA 2DR0A 3EXEA 3WYEA 3LEWA 4I50A 1ZXBA 1VPDA 3FU3A 1X1BA 3A37A 5LYYA 3CVWA 1S3SA 2OQ2A 2OORC 3QLJA 4JZKA 1Z4KA 3F6EX 3ESBA 2I22A 2QT9A 1YS7A 2BR3A 2Y8EA 3M6AA 421PA 3MUNA 4G5QA 5JYDA 1EGAA 4B93B 3V80A 2HW8A 4GX2A 1ZCBA 3TEFA 4MVJA 2CV2A 2VAPA 3GEMA 4HZUB 3C4VA 5EHXA 3GLRA 3ISJA 3CW9A 2P67A 2ZJ2A 3D2LA 1NASA 3KHTA 2E21A 1SFRA 4IDPA 4DIOA 1E2DA 1RZ4A 5C2YA 5BRJA 4HQRA 3C8ZA 5BYAA 3ABRB 4OP3A 5HXAA 3D02A 3KEQA 3EZLA 3APFA 1N9AA 4JXJA 4LK2A 2AC2A 3AW8A 4KQWA 5ES4B 4PIPA 5JPCA 5I5GA 3WR5A 1BHJA 1I4EB 1VLVA 4O4LA 2NUPA 1O54A 1W5EA 3CRMA 1FMTA 5A3RA 2QEQA 3DT6A 2JARA 3WWZA 3CHSA 3C15C 3OJFA 2GXSA 1CNEA 4JBHA 2ISSD 2PUWA 2UVPB 4R1UA 2R00A 3OQ6A 4XCXA 4OAVB 4E15A 4ZT6A 2W70A 4JB8A 4ZCSA 4MV1A 3DEZA 3ZN2A 4ADSG 2EWMA 4TV8A 1U3UA 3R3VA 2HDWA 2QC9A 1GUBA 1SG9A 3A6FA 3EZXA 2C20A 3H1TA 4FP9A 4OUDA 5AKLA 4BX8A 3CX3A 4FQ8A 3QOXA 3V4FA 1DGQA 3MBIA 4C6HA 1MJFA 2C07A 3EHNA 2WYHA 5KNDD 1O03A 4U3JB 1RWXA 2YWCA 1AGYA 1DDIA 1E1LA 3M89A 3PNOA 3AF5A 1KDTA 5LPNA 4HHEA 3PC4A 4R69A 2QU8A 1Y8QB 4KSYA 1Y4SA 5FBKA 3KBOA 3CPSA 1LS1A 2W93A 2XDQB 3O3MB 4YS6A 3NKVA 4HNUA 2YV1A 3UM0A 3NJ8A 5FP0A 1OROA 2XDYA 4CLDA 1KYZA 2OM2A 3GT3A 3MGBA 2C58A 4J0UA 4XWKA 1A9TA 4QGGA 4C0KA 4I1IA 2C7GA 3CXUA 1GKYA 4RLFA 4ZZ2A 3T7RA 4EG8A 2I2OA 3K6RA 5ED4A 2B5VA 1N1DA 5CPBA 1OWNA 5K1ZA 3AF3A 3NEPX 3SZLA 1LC3A 4QFCA 1OH6A 2PPLA 1CFZA 2NG1A 3VYVA 3AXTA 3MAJA 1LC0A 4OLAA 5C80A 3ITKA 1WUYA 2AHRA 1MGOA 2B8NA 2WKQA 2YYAA 3OOSA 4NMLA 5D85A 3Q9NC 1ZVJA 2XCSB 4EUNA 1LNSA 3ZVNA 3WLPA 1BRTA 2Q6KA 2PGNA 4K1XA 4IVPA 4RESA 4UHHA 1C81A 2VJKA 4FZRA 3HUTA 4YAJA 3HDXA 2XAAA 3MUEA 4LWPA 1VP9A 5DM0A 1E9AA 3ZE7A 4HPWA 4C4YA 3FWHA 4YT8A 1S4MA 1XALA 4OHWA 4G23A 9MHTA 1JNXX 1SZJG 4Y2XA 1NHWA 1AWCB 1YVRA 3JSXA 5B1BE 2CB0A 4CTMA 1DWPA 1IK6A 1M1YB 4LTMA 3T3NA 4UI9J 2QJFA 1RAGA 2WJ3A 4N5MA 2J4FA 3SJ7A 3PGMA 5IK2D 1E9CA 1I7DA 3K0CA 1AQ6A 4B2IA 2GAFA 5LOVB 3GQBB 3EBLA 1N1GA 2HJWA 1VKHA 4AO8A 2VDLB 3OZRA 4NCAA 4K0RA 1Z5PA 4R0NA 1P5ZB 5FWXA 1FXSA 3UMGA 4KQ2A 4DLTA 5C7OO 2B4TO 3DTVB 1CR4A 1CQJA 4WLUA 1V5FA 1LV7A 3HKDB 3MWDA 2LKCA 1F20A 1IYZA 2REBA 4PX2A 5F1OA 1XZMA 4YRIA 5J2TA 3EMVA 1RI2A 1QH8A 4IN3B 5CT4A 2X3YA 4MARA 3H9BA 3WIBA 3KTOA 5FLEX 2HQOA 5KBAA 4L6IA 5C1PA 3N1UA 2C3MA 1FVFA 1OAOA 3R4CA 1T5TA 3TG5A 1RKVA 1TNDA 3CLKA 1DO0A 4KXKB 1KYVA 1Y37A 3OT4A 3DHNA 2RB5A 1SHJA 3JQ1A 4ICIA 2VN8A 4BE9A 4C03A 5KWSA 1NLZA 1QK4A 4QDUA 4JLVA 3N05A 3W05A 3BUSA 2W4IA 2ZBDA 3EAFA 3F6YA 4ARIA 2FFBA 3KQWA 4L0DA 3DMTA 1GPLA 2NTNA 1N8NA 2WWIA 2J3DA 1NBAA 3ZYZA 5CA1F 1DCFA 2WMNA 4NBLA 4WA7A 4UAUA 3WFZA 5KJFA 3IAHA 1Y4DE 3PR2B 1RZ3A 4V02A 5BPHA 5KIAA 3OT1A 4F8EA 2VGXB 4TXRA 2PAAA 1QG6A 1ULUA 3FRHA 3OIFA 3GI1A 5CVVA 2H1RA 2GFQA 4QDOA 3DLBA 1HNWB 1VBKA 1ZESA 2UZIR 3TTTA 1UZUA 3UTDA 5L6MB 2PZIA 4L4YA 1J33A 2Y9PB 3MWYW 4QGHA 3M4YA 5CAEB 1CVLA 3CCFA 4GI1A 1DV2A 2PYZA 1HQKA 1YZGA 1U2ZA 2O06A 2YWXA 3G13A 2V9CA 1CZUA 3GDHA 4P54A 1HG0A 5ARDA 3ZZ0A 2OD7A 1E1KA 5CBNA 4KXWA 4OD0A 4HLEA 3W7VA 3CURA 3OIVA 3AUUA 1QORA 4Z4EA 3WLJA 3QHAA 2I9CA 5DWDA 4UHJA 3ADDA 4DIEA 1SQSA 3GGOA 5ER9A 4UHEA 4QWMA 3WRWA 4NMXB 4JW1A 1YO6A 2VJAA 4IO1A 4LNUD 1MABB 3TG4A 5LDDC 3RJVA 3OX3A 3ZWOA 2VNKA 3EVDA 4M7OA 5FPYA 3PNPA 3MTQA 1DI0A 3HYTA 4FJYA 1T5OA 4QEDA 1KYIA 4QO7A 3UW3A 5KVSA 5CIWA 1U2TA 1Q1EA 2E49A 4X84A 1I3OA 2AR7A 3JWHA 1KAOA 3PSHA 1OX5A 3RADC 1HX7A 3H75A 4NBNA 4J1NA 4U8VD 3CEMA 3MT8A 4HFNA 3WKBA 3GRZA 1L9XA 5ENPD 2DYKA 3FAZA 2Y67A 3IT2A 3NT2A 4D6PA 5CB0A 3ZG6A 4B2LA 4U7HA 5AFSA 4HXYA 2YQ8A 2ZYVX 3DNPA 1XEAA 1DBQA 1XN4A 5D01A 5IAEA 4JI3B 4AZ0A 5LQMA 1NW6A 3W5DA 2QUHA 1B43A 3MZ0A 4M0KA 3F7NA 2XOEA 1X1RA 4RSHA 3ZVMA 1AA9A 4J49A 4LGMA 4PO9A 1UMDB 3FPJA 4Q4JB 5GQSA 4ZEWA 4AF6A 1JTVA 4HH4A 1ATZA 2OOSA 5HS0A 1T2UA 1AKNA 1Y82A 4NY1A 3T5XA 1H69A 3K1JA 4K26A 3G2KA 4BNVA 3HB5X 2PMBA 4LY3A 3C3XA 3FMPB 4YJ2F 1V9LA 3AU4A 1IY9A 1CS0A 3KJIA 1N75A 1A9QA 1TAHA 2Q1UA 3L0BA 1G8GA 3ONDA 3S2IA 2XUQA 1J5PA 2BGMA 2VHXA 2B82A 1ESCA 3AU9A 3HBAA 4GMFA 2V7UA 3DR5A 3SJAA 3RWBA 4MINA 1PG0A 1AUXA 4EYSA 3O8RA 1VLQA 2BOVA 3CW2A 5KYTA 3CZPA 1COWD 3FTDA 3DHYA 4TV3A 2ZUSA 4FZ5A 4HQNA 3NV7A 3E27A 4RGVA 3V34A 1W3BA 3E23A 4R9UC 1SH7A 3QBTA 3WS7A 4HEHA 5EXXA 5C4MA 5FPHA 4S04A 5JAQA 4FM9A 3OHMA 4IIHA 2W6PA 4TYQA 4F04A 1AQUA 4MZDA 4L4RA 1KF0A 3DEHA 1T26A 2I3ZA 2VEOA 2R8ZA 4MZXA 4UREA 1U0FA 2QKYA 5KTSA 3IPLA 3EA5A 3MWKA 4OA5A 1GPH1 3G49A 1UBNA 3WMRA 2ZE7A 4O1PA 1DC4A 1TJ4A 1TW2A 2WU1A 2ZJYA 3A11A 3A3YA 4G56A 4ACBA 1J06A 2PS0A 1ZW6A 2EW8A 2GD1O 2HGZA 1GKKA 2P27A 4GMDA 5CA0F 2G4LA 1C0IA 3SS9X 4BO7A 4EEKA 4JELA 1SQ5A 4G1EB 3MJ4A 3RU9A 3V42A 4DNOA 1JAHA 1F60A 3WLLA 4AJOA 4EAAA 3G6KA 1JHXA 1Z38A 2AMJA 2X5XA 1M34E 1DJQA 2WXIA 3ZYLA 2GYUA 3JVUA 3QSGA 4RTLA 3OE1A 5F5NA 4CUKA 1S01A 1N6NA 1RM5A 3KT0A 4W6ZA 4P4SA 1P5QA 3U3RA 2V6FA 4RO0A 3NWEA 3FPEA 3T61A 1QFMA 4CFYA 3AX6A 4G5OA 4P3OA 1N5OX 3MN1A 4PAWA 1MT3A 4X1KB 4Q47A 1UOHA 2OPHA 1W76A 2P8JA 1EUZA 2Z8ZA 3M34A 2Z0MA 1VDYA 2PZJA 2DR2A 5EWJB 4EY8A 1E3JA 3VTFA 2R11A 1BW9B 4JSYA 4K2AA 1DAOA 4OMDA 4QPCA 5J5VA 4FR0A 2IWHA 4WKCA 4GMGA 1XK6A 5L3QA 5D1HA 5HTKA 3T4UA 1BYIA 1GLVA 3Q7FA 1JJIA 3GOQA 3HHPA 2I99A 1VBMA 3HR8A 3PFGA 4TUYA 1N2CE 4XX1A 5B1YA 4CKCB 1YAJA 3IAFA 2YRXA 1N34B 4YCNA 1CQJB 1GZSA 1R6BX 3AGQA 3IVGA 3KCQA 3MTDA 3T3IA 4M9CA 1H2RS 4D96A 4P5DA 2H8KA 4JOBA 3ABLE 3JZDA 1OY3D 4BYMA 3F9CA 4YN3A 2PFSA 3C5RA 1A1SA 1ESMA 1KFJB 1J25A 1JEDA 1LLFA 1SXJD 1EDOA 2O23A 2O2DA 2WWTA 1N5KA 2C3PA 3ECAA 4JODA 3C1AA 4FSDA 3JQBC 4V38A 1R64A 1ZD3A 2Z8YM 1SU7A 1AKQA 3A6LA 3F9RA 3N0XA 1GG9A 3BIXA 1HFAA 1L5GB 3CG0A 3DV9A 5CLHA 1Q11A 3ONKA 1JRLA 1I2MA 1N2HA 2IYNA 3WKCA 5C37A 5D3ZA 1D8EA 4L2LA 1JSLA 1G59A 2QAGA 2B30A 4WQMA 4B7ZA 1Z0AA 1FSFA 1OAOC 4M99A 3TX6A 4A8TA 3KQPA 5AUNB 1COZA 1T3LA 3IP9A 4MKZA 4E33A 1CETA 3UMYA 3C8UA 1YVPA 3A3NA 1RRGA 2XD4A 1MRZA 1YWGO 2ZKIA 1GV1A 1SIUA 1KEVA 2J48A 3DWFA 5TQ2A 3E1SA 5DYGA 3UY4A 4HOTA 5ELLA 4HOQA 5G2NA 2WHPA 1Z2CA 1U4NA 4V0OA 2I4OA 3QK0A 4LY0A 4MUIA 4PYMA 1TL7C 2ZJAA 4PNHA 5DHUA 4NVRA 5JV5A 1QQAA 5AR1A 1WHSB 3V8QA 2XUPA 1ORVA 1YI1A 2YR0A 3WQHA 1XZ8A 1T2VA 1EUDA 2FXIA 5KQSA 1G21E 4YYZA 2HSEA 2QAJA 2OAEA 1LX6A 2OQVA 3WNBA 1H2BA 1YD7A 2E4VA 4RF4A 3ZJUA 3ASOE 3N2KB 5LKRA 2HSZA 2JEZA 4DMKA 4EPTA 4HBDA 1ZFNA 2AXUA 4BO6A 3P9NA 2F59A 1KRHA 4ZTBA 4YAGA 4Q66C 1WPQA 3KB2A 3DXFA 5FOXA 1XRLA 2YH2A 3NYWA 4I1YA 3QBVA 2UYCA 1GA4A 3ZWBA 4ZPXA 2H2FA 5TS2A 8ABPA 4GOMD 1O58A 4WVLA 3TLXA 4UASA 2WUEA 2R5WA 4ZT4A 1C7ZA 2BE7A 4URYR 3RPEA 3ZHZA 5C5CA 2RJOA 4OB8A 4OLBA 2LAIA 1ODFA 1FX0A 2XRFA 2YW9A 2YZ7A 3EIUA 3A1DA 3NWJA 4WZBB 3B2NA 4Q16A 3P94A 3FTQA 1VLLA 4ZVQA 2VQEB 1RE0A 1J9GA 3D6AA 3MB5A 4LYFA 4ZYYA 3BD9A 3PDCA 4B32A 1TVEA 1L7MA 4HAWA 1SHUX 1KI4A 1UPXA 1Z6ZA 3HN6A 1BU5A 1IWPB 1O5IA 2F8MA 2YJ5A 5FOQA 3ZWAA 3DM5A 4LE0A 1DO2A 1X1SA 2FN9A 2OBYA 3G17A 4IJKA 5GJCA 5KSPA 2JAWA 3CF0A 1YK0A 2B8WA 4KZ0A 3THWA 1UP7A 5K05A 3VTXA 1EFVB 3TLGB 4DM7A 3VI4B 5JI3E 1L7AA 1KTIA 3DHWC 2VTBA 5F1PA 4EABA 3D9MA 2AJLI 4KKVA 4G84A 2A67A 5I9NA 3WB9A 4H15A 2UYGA 3LRTA 1DC7A 2JCSA 4G1UC 4J1QA 4I1AA 3PENA 1WSAA 3N8HA 2C1EA 4I6EA 3QNWA 3GFTA 5KSOA 5LU8A 3OURA 1NM5C 1NV8A 5IJXA 5AH0A 1WEHA 5JC1A 3EDYA 3PC3A 4QOHA 4RTSA 1E59A 4FLEA 3S5JA 2W42A 5BSRA 3U4GA 2VSFA 2PQ0A 3S68A 2PSSA 2IV2X 2PL2A 1FFGA 3UO8B 3V7YA 4C0LA 4MUHA 4RY2A 3R76A 4OUDB 2DJ5A 1IBLB 4IJ5A 3L04A 3S2UA 3SJBA 1UBKS 3UUFA 3DMDA 4QUAA 5BW5A 5IG2A 1M3SA 4XSHA 1IJKA 3PT5A 4AIFA 4L6AA 1BH2A 3OPMA 2AKEA 4LQLA 2E3JA 3DAFA 4NATA 4ALLA 3L6BA 1UXJA 3H2YA 5HS6A 1ECPA 4Q3LA 5HZKA 1MC5A 4H7PA 3R9XB 2PJZA 3HVIA 4HLNA 5ARFA 3THXB 2QMEA 4A10A 2C0LA 1OE0A 2ZJZA 3QU9A 4IJMA 5KWJA 1NBEA 4HNQA 4X1OA 3MT0A 4XASA 1VIYA 5IUNC 1K3UB 3JUIA 2I2CA 3D3NA 3TLEA 1TUBB 3FBGA 3HKBB 5AP9A 2I6UA 2HOQA 4EB8A 1BCRB 4V0SA 4D9FA 4D42A 3NZUA 1JWFA 4KLCA 4MICA 4IV0A 4J8DA 2F17A 2VT6A 3OI7A 1RHJA 3BBLA 1M2JA 2FJ0A 5FO0A 4DUGA 3DTNA 2J9FB 4WSOA 3U7QB 4JUBA 4TT8A 3WWCA 1FU7A 3V1KA 3LUDA 4BUCA 3SVLA 3E9QA 5JCOA 4UM9D 5B7GA 3E5NA 2NXWA 3TNLA 2HKIA 3ISVA 3DM9B 2AX3A 2O05A 4TZKA 1ZD5A 2B7CA 4N5NA 4F4IA 1ZUNB 2Z1NA 4IAOA 4XDHA 3DV2A 3MTBA 4D4KA 1P1HA 3QJYA 4Z4FA 3AOEA 3TD2A 4DT1A 2H31A 1QYVA 1U0SY 3CUTA 4KGDA 4UTVA 1XAJA 4MKHA 3S2SA 3SR3A 1H2FA 2IP4A 4MR7A 4B9EA 3C1OA 2AYZA 3DFUA 1YFKA 2A94A 2O57A 3HCDA 1UPBA 2HRDA 3JQDA 4JMLA 3BT7A 4NS1A 4P38A 1WDMA 2XF8A 2GD6A 1EAMA 4JJFA 4MK4A 4ZK2A 4IFBA 5JAUA 3NMUF 3NRCA 2AOWA 3KJXA 4CMEA 1QMPA 3FGPA 1RYHA 4R84A 2AW5A 2SKEA 4DPMA 5CDYA 3KTFA 4ZAZA 4XIJA 5ERYA 2VXOA 5AM2A 3U31A 1EWQA 1FTGA 1TC2A 1WSDA 2I2FA 2PBFA 4FVTA 2V7BA 4HLUC 4KWHA 3ETLA 1UBCA 4B40A 3C1UA 4OI2A 1AK9A 2O6LA 3HVEA 4LJLA 5TR9A 3KE9A 2JCXA 4KR3A 2ZYSA 4ZAGA 4WK2B 2DUNA 4LV5B 1N0UA 4HAZA 4JCCA 1R5NA 2J59A 4X93A 4FFSA 1XTQA 5D86A 5B1IA 3ZDQA 1D1PA 4E5KA 1JNYA 2BP7A 1YA8A 1S64A 4O0LA 3N0VA 5I8WA 4PVDA 4LPSA 3WYCA 4ACKA 1EK0A 1S2GA 2DCUA 3QFSA 4IQFA 1FDTA 2VJBA 1JDUA 1V41E 2IYLD 3BOSA 3F5SA 3QFHA 4JOSA 3F46A 4ALIA 3PIDA 2XQJA 3SQWA 3UAOA 3HABA 2LVBA 4K5CA 3R9MA 3AKYA 4H1TA 3UQYS 3F5MA 4Q94A 1HNNA 4MJXA 2DCMA 3WGKA 4BY6A 4DAOA 3GLIB 1G291 4FS8A 2Z2JA 1MZPA 4V2IA 4AEZC 2WYWA 2XKJE 1U8CB 5EDSA 4NQ0A 1W9MA 5BMVA 1PR3A 1OT3A 5E8RA 3WL8A 4DW8A 4TRNA 3A4LA 3EQZA 4FHKA 1IKND 2CV1A 4MMZB 4NRHB 5CCMA 2Z4TA 3IHLA 4PBRA 4QAQA 2P9UG 3JQ8A 4IEFB 4QBFA 2Q8QA 3UQZA 4ALJA 1U0BB 5TEWA 2EIXA 4KN8A 2RC5A 1SEVA 2FY8A 1TT7A 1K0UA 2X5NA 2EF1A 5ADHA 1LW6E 4AFNA 1J0XO 1U6IA 3OWXA 1QX3A 1ZI9A 2PZFA 1ZKDA 4CLEA 4KRFA 4TYYA 2XZLA 5ALLA 3OQIA 2HPZA 3UPDA 1WBBA 2C59A 1Y6IA 1K6EA 4FFWA 2J3EA 5BXOA 1KY4A 5G0WA 1E66A 4OCZA 3LF1A 3L1KA 3EAQA 2NQ8A 4R1MA 4YRDA 4CRWB 3Q9UA 3EB9A 2XA1A 4YONB 4IR7A 1Q7CA 5K8VA 4WUYA 1E99A 3ASYA 4OXXA 1QOQB 3TO5A 4AP9A 5FTWA 5JI2E 2WXJA 3I8OA 2H3EA 1BVRA 3QXJA 3HO8A 3AO0B 4WK6A 1ELKA 3WL4A 4H7IA 3D8HA 3ZCUA 2A4ZA 2PEZA 2O0LA 2XX3A 3NDJA 4PLVA 2HA4A 2WKPA 1ZLYA 2VH2A 3DPYA 1SXIA 2EYQA 3ER6A 5B1SA 2YDXA 5CFZA 4KQMA 4N49A 3BK2A 5FUWA 2J0QA 4ZYXA 4C0HA 4RMJA 3GT7A 2IV7A 4DA4A 3QVVA 4DMUB 1Z13A 1ISRA 4RE6A 4C4RA 5EQFA 2VDQB 4ITVA 1E2UA 3E2PA 3AFOA 1G9XA 3PRYA 4EHHA 5A71A 5HUJA 2XGSA 2AOTB 3L7IA 2JAOA 4CL8A 4BO5A 2LDBA 1PTKA 1Y7HA 3DEFA 3UAWA 2ZISA 4I8XA 1K63A 2IONA 1GPDG 2OP0A 4XDGA 1MIOA 3DMRA 1CX9B 1CR1A 1JMYA 3I9FA 3OOHA 4BEVA 1ZC4A 3A2LA 5CEDB 2P4HX 3CWZA 1LD7A 1HE8A 3MV2B 1X7GA 3DEOA 4KQHA 2BM0A 4L8LA 3TPCA 1L7NA 3FWVA 1PGOA 4D81A 3DBRB 4BP3A 1H2ZA 4IDCA 5TPWB 5ITZB 4LZOA 3A2NA 1PEDA 1SK8A 1U28A 1TJFA 4EFLA 2DSTA 1C41A 3KR2A 1PR9A 3NIBA 5BVHA 1TNUA 2QN2A 3CKLA 3GWZA 3DAHA 1G8PA 3N75A 4ZARA 1IK4A 1MPXA 3S2ZA 4R9VA 1P4HA 1O1RA 4LJSA 1W96A 3ONFA 1Y5MA 3FMIA 3WL6A 2GD0A 4AP2A 4RX1A 2ACEA 2V98A 3QKRB 5JRZA 3U7HB 4AJHA 5JDCC 4FYIA 2NV2B 4GO1A 4ZFHA 3KKZA 1YJBA 3IT3A 4A6PA 3ZJ5A 3E58A 3L17A 4BWFB 4EHAA 3UMVA 3QVUA 4PZDA 3TZLA 3AEKB 1ZIYA 4Y6RA 1ZSYA 2EILE 1TUBA 3GNQA 3HKBA 3LUKA 1RP7A 4KODA 4NH4A 1OA1A 3FPHA 4FCVA 3HZOA 2B21A 2G9QA 4IQ8A 4UEJA 4DXAA 1F8UA 1LRKA 1P29A 4QG3A 4QC2A 3AIOA 1MQAA 2GOYA 1OCOE 2X7XA 5I5EA 4O2BF 1QZTA 4FQ7A 3UHAA 4BO3A 2C5EA 3BSFA 3N3BC 3NVMB 4TGLA 3LUAA 3Q8LA 5HP4A 4GCOA 1WPGA 1M34B 1A4XA 3RS0A 2IRWA 2NXNA 3FFTA 4MIYA 1Y6JA 4Q9AA 4CKWA 3PEEA 2REQA 2C00A 2XTJA 1RRPA 3D1VA 3K92A 1T8UA 4CLXA 3FTUA 1SD5A 4RA6A 1IEQA 1W581 3DBLB 4KBFA 4I2VA 1EE2A 1FCHA 3OPYA 4V0RA 1YR2A 3BFVA 3QLUA 3FVTA 4O8ZA 1N5RA 4BUJA 4L7QA 5JXIA 2NYUA 4FGKA 2GZRA 3BGIA 4MRRA 5A7GA 3DZDA 3T8YA 1QHSA 2RCNA 2YMLA 2FW0A 1B3BA 2JGIA 3R6DA 4M86A 3KKEA 2C95A 3DF9A 3GFVA 3MILA 1C30A 3EDMA 5E3IA 5FOWA 4JVSB 2HYIC 2QQ0A 4LF6B 3G0DA 1AUVA 4XYEA 4Y9TA 2F8TA 2QROA 2WFLB 4C05A 2HMAA 3SQOA 2IYSA 4AUEA 3OC6A 1QHNA 2AOUA 4RM2A 5E0KB 3W8RA 5DBOA 4BB0A 4HNHA 2ID4A 4OAOA 4MVXA 4FU0A 3U3WA 1DX4A 5DTJA 1A7KA 3B53X 1D9SA 1E3DA 3STWA 3WL7A 3I1JA 4MIEA 4UBJA 1TYEB 3SHQA 1AMUA 3U3OA 3OQBA 3PVZA 2VH5R 2YVAA 1DPFA 2DP4E 2QRPA 2YWRA 1LLQA 2PL1A 3PXUA 1CFJA 2J1LA 2X4IA 3GGJA 3KR1A 3MQFA 1PAQA 3IXEA 3DLPX 1NE2A 5AQ7A 5KHOC 3L0ZA 2BAGA 4KVZA 3ZV4A 4JITA 1EWRA 3QUAA 5EJMA 1JIVA 4ACLA 1Z5UA 2I34A 2N3ZA 4UUAA 5GGYA 5HF8A 1FFXB 4X20A 5BSMA 1YZKA 3E33A 1YIAA 2PT5A 2KW5A 5E6RA 2IXTA 2WSLA 5I3ZA 1WZEA 3PNBA 4NYJQ 3WDLA 1D6NA 5K0CA 3MBOA 4OHBA 3U64A 1AJEA 2J3JA 1V71A 4PZLA 4KXQA 1H6BA 5CXSA 4XQCA 5DYTA 2L82A 2RKOA 2RKWA 3R6WA 4MLDA 4D25A 1H93A 3SJCA 3T0GA 1WXFA 2B1IA 1IRXA 2IYOA 2X7JA 4B6QA 5K6AA 1AF7A 3FTWA 1IATA 2F90A 4D80A 4TUYF 4IIYA 3SICE 1R0ZA 1XCPA 4BFZA 1V8ZA 3HP4A 1JXAA 2CUKA 3T5BA 3PCTA 1HXIA 1YACA 2ZS9A 4EHFA 1QHGA 1SCNE 3RVQA 1DTSA 3ZHOA 2M1ZA 3AF1A 3P2IA 2OSBA 4CV1A 2E82A 5ISMA 2J31A 3K70D 1O1TA 1T2NA 3S6JA 1J5EB 4PUCA 3LPDA 4ZCRA 1XHEA 1EWKA 5EIBE 1BIFA 4UPEA 3IPCA 2Q4TA 2LW7A 4HB5A 3EOBI 1X2BA 2HTFA 3U19A 1CYDA 2CSXA 3DDCA 5HWSA 1KVSA 2IZ1A 4YP5A 1E0AA 1JWLA 4W99A 2YOGA 4NMMA 1LJUA 3JZMA 5KNGA 1IM8A 2AK3A 2NACA 3D7KA 1DEAA 1R4AA 3O92A 4KE6A 3ZWDA 2FJBB 5I7SA 3OMWA 4OGLA 1T5BA 3CWQA 4EX7A 5DNYB 3LVQE 1K7YA 3GAZA 1ND5A 4DNPA 1U0TA 2PX8A 4BZWA 1XZKA 2C42A 2HIAA 4IV5A 5I51A 1KZOA 1M5UA 1NSFA 4HQKA 4K88A 1GPAA 2E4ZA 2GARA 1TUGA 4YRTA 3V2OA 3T7IA 1YYHA 1NC1A 3G5MA 2PVPA 1PV2A 3ID6C 3O8CA 5JHGB 1ZICA 3FNQA 2H11A 5AKHA 1WMSA 2ZVDA 5IASA 5FWYA 1I7QB 5GINE 1MZCA 1QH1A 2J9ZB 1R6AA 3G2LA 3MPOA 5E6UB 1XTIA 4TMWA 5THQA 1G8AA 1X42A 4MWEA 1IIBA 2VA8A 4KB5A 1PU2A 1NGSA 4KXVA 3UMCA 3MTAA 1FT1A 1JLKA 3VU0A 1YRHA 1S9HA 1XNHA 4LOKA 1WB4A 1QDEA 3C3DA 4H7FA 1XZIA 4HQ0A 5DWQA 3GY0A 2VQFB 4I99A 3FTFA 1PN3A 3KWLA 4Y30A 2J4CA 4ZP1A 4N39A 1LDGA 1NNLA 2IEYA 2WR8A 3BL6A 2WJJA 3WY9A 4D9MA 1XWFA 2I7XA 3KR0A 5A4FS 2W9JA 5F5XA 2ASEA 5KOJA 3ESLA 1Z4PX 5LL6P 1NW3A 4FLMA 5FO1A 3RSLA 4D57A 5AW3A 3FTXA 1EJ0A 1NVVR 3P2YA 1U0HC 3FUNA 2G5CA 3ZNOA 5LP6F 4MW6A 4LJ7A 5K51A 3W3AA 3KYJB 1Q0RA 1T1EA 1NXQA 2OLJA 3FCSB 5LQNA 1YKSA 2GRJA 1QPGA 1B41A 1ZJWA 4QUEA 5LCWJ 4HOSA 2O8VA 3I45A 4E5DA 2QRKA 2QPOA 2ETVA 5A5VA 5L7WA 2E4WA 2CKDA 1GKUB 1KEWA 1P4AA 2FZKA 1ZN2A 1F4LA 2B4YA 3GBVA 2ZR8A 4URKA 4G0ZA 3OECA 2JEKA 3AVPA 1U2SA 1FLNA 2R2GA 2CHXA 3FGOA 4RZUA 4WVFA 1I3NA 5BN4B 2XGGA 4GZ6A 1U1EA 3Q5MA 3O8QA 4GWLA 4J16C 3CR8A 4IOLA 4QXAA 1RZRA 2WWGA 3RG8A 4TYMA 4ZVPA 1H0KA 5ILGA 1M2GA 4I14A 3TTYA 3QWBA 3C5VA 2W6ZA 4WOBA 5FQ7A 1W9HA 4MVJI 2FZEA 5L53A 4S12A 5IM4F 5BNIA 5EKUA 3LCCA 3FPLA 4L3OA 4NK4A 3TRIA 2QTVB 4LF4B 2CZCA 5KX5B 4WKOA 4IZIA 4P8RA 4DQXA 1Z63A 4KXYA 4YAWA 2W71A 4G0MA 1T8PA 3EF1A 3FBTA 4WWPA 3LRPA 1Z5WA 3VNSA 5IF3A 4EYGA 4TXHA 2EFYA 1XPRA 2NXEA 2VJQA 3VMMA 2J9GA 4F86A 4QJ3A 4FHDA 1W1UA 3MIZA 4NH0A 5KMGB 2QRMA 2OGZA 2RHOA 4F9TA 3O4VA 2AG5A 1NT4A 1D8TA 2PUCA 2PM7A 2HR1A 3KL2A 4KDRA 1MJGM 3HC7A 2G1AA 1GCGA 1T8RA 3S8YA 4H6VA 3GVPA 3KEZA 2XOKD 1FFWA 5AESA 4DB4A 1YRYE 2YVQA 2FFGA 4LYAA 2L0TB 3VKWA 3ACDA 2NXCA 1H1TA 2Z83A 3UWOA 3A9TA 2Q0XA 5J43A 3NHUA 3ICQB 4QPDA 3WB2A 4B6OA 2ZRKA 4UUPA 2XZDG 1LFDB 2A5GA 1QZ2A 1MH9A 4M1TA 2IPXA 1SQFA 4EATA 3FVRA 4JD5A 2X6TA 2YWBA 2H4ZA 2ZBRA 4Z9YA 5IKMA 5SZHB 5LP0A 1MKYA 2VP2A 5FL3A 3WADA 4QIHA 2GS9A 5KDLA 4MRUA 4QUKA 5BSEA 4DCOA 1V5GA 2HMWA 3N5KA 2RGWA 1HDYA 2QAGC 3GJ8A 4DCNA 1CUCA 2WWRA 4CM4A 1JFFB 3E9CA 1I13A 2RH5A 2VJNA 4BBPA 3ITNA 4RBNA 4R41A 3MX3A 1KPGA 1L1QA 4KYTA 1TEZA 3P2OA 5AOXB 3OQJA 2XNKA 3OCWA 4BMXA 5CB4B 1KYQA 1L1RA 2YMPA 3NBAA 4MXDA 5DHTA 1FP4B 1FB5A 4PX5A 4MP6A 1TRKA 4U1RA 1GDTA 4J4TA 1M6WA 2O7VA 3IV0A 4QUBA 4DY6A 3BMCB 3AG5A 3W4JA 3EXFA 2E2WA 3AQ4A 4BLRA 3HADA 2A1UB 3OFKA 3RFTA 1QG0A 5LZ2A 3ZUVB 2J33A 2CL5A 3EZGA 2DLDA 2PMKA 1ZOIA 3AJDA 5MFPA 3H2GA 2VBIA 1RI5A 4GKAA 2X9VA 3ZV6A 1BQ4A 4OG2A 1TJYA 5A9SB 3KKQA 3RAJA 1E6CA 2IA5A 1E3LA 2FSVC 1YE5A 2C92A 2PBLA 3GJ4A 4Y2RA 3OAAD 5DK6A 1E2FA 4DGSA 3A1CA 3ER8A 2ETCA 3DC7A 3G2IA 5EMHA 4TKZA 3AI3A 3CK9A 2DVMA 4WTOA 3PNKA 3FKSD 1X13A 2P2CP 1DCEA 4P33A 3BTVA 1U5CA 4D9IA 5IFKA 4FI3C 4DCGA 4DNXA 4RTJA 2D0IA 1PNOA 1K8KG 2IEDA 3BWBA 3EH2A 3N6VA 4FZ3A 1LSSA 4RJKA 1XYYA 4GPIB 4IEIA 5LZ9A 1N57A 1LWOA 3FCAA 3GMSA 3GDWA 3EY9A 1S8FA 5JJBA 3I4FA 3QNUA 3VR5D 1M1NA 4HNRA 3DBOB 2O3SA 3LZ6A 4MPPA 1FFHA 1N6LA 2JGFA 1IFXA 1XJ0A 3IODA 3KWJA 3M33A 2XE7A 3PHBE 5DJ5A 3VBCA 4CMIB 4F1WA 5JEDA 1E2NA 1W5BA 5U9CA 3B1KA 5D7NA 3FOFC 4BNJA 2FDCA 4MQLA 2QMUA 2VF2A 4BNYA 5IPFA 2ZJOA 2OENG 4PS8A 4RK5A 5C7IO 1SUFA 3ZU7B 4TSFA 4ZVSA 3AM1A 1JFSA 5JAPA 4JUAA 3K9CA 3LTEA 4N47A 4D43A 1WOYA 4GTPA 4UD2A 1NXSA 3FY4A 1YL6A 1F17A 1VSVA 4QUGA 4ZV9A 4OHCA 5TQ0B 1BN6A 2PHZA 4NAVA 1P9NA 4EI2A 5T4EA 1E1NA 2KB0A 3PC2A 4K9MA 4MI1A 1SKUA 3CHMA 3DOUA 5JMND 4F21A 2C99A 3GAMA 1Q2ZA 2AOTA 3A6GA 1IULA 4GPKA 4LXIA 3BTSA 1GWNA 3U7JA 3KDAA 5EYPB 1YVUA 3EC1A 1OYOA 1NN5A 3FRIA 4E7OA 5DN6D 2OV2A 1NJFA 2GPYA 3UQ3A 2W9XA 3CSDA 1WUKS 3RIYA 3LXXA 3MAAC 5AM4A 1H2XA 1WXDA 2OZLB 4ZT2A 4M55A 2AG8A 4FW9A 4GI3A 1XMSA 3RD5A 3RU0A 1AURA 2F3RA 4QBTA 5JS2A 1GL7A 1OGJA 3O4GA 4P86A 4U02A 5JHBA 5B7QA 5LXTB 4V0NA 5DMXA 4Z0NA 4F2WA 2PDAA 1AM4D 1XD9A 3EXG1 1WKCA 3IDFA 5F7ZA 5FUMA 4DV5B 1MD9A 1XU7A 4KGVA 1J7JA 3MFQA 2CWWA 3VZQA 2YMQA 1JIQA 5FT9A 3IQWA 1Q3KA 1SUWA 1B6TA 1ZI8A 1L3BA 2BFMA 1ONPA 4OY3A 3HEBA 2J30A 4RTQA 4TMFA 2C3UA 1ISFA 3F2VA 5TVKA 1SKYB 1FDWA 1XO1A 2IGBA 1EB8A 1UK8A 5AQBA 2QOEA 4MQFB 1W25A 4TXPA 1ODKA 4K6FA 5KNBD 1UBJS 2CSUA 3HRHA 2WXPA 4KQEA 5BO5A 4E85A 3SLGA 2QJTA 3L7LA 2QL6A 4C4AA 5JVDF 1SU6A 3V32A 3ZJ4A 3KAKA 4M1SA 3E53A 4PPQA 4WV3A 4GZCA 3U9WA 4J8PA 3T7SA 5HRAA 3L08A 1VKZA 1NKSA 3OFSA 4OJQA 1P2UA 4LNUA 1SBQA 2E4XA 2Q5IA 3FYHA 4N6GA 5DK4A 4QOEA 4ZAWA 5SICE 3DCYA 3NFYA 4MUYA 5CA0B 2GYYA 4CGZA 3K8YA 2JEYA 1N77A 5K0GA 1QYMA 3CEJA 3GEBA 1JIIA 4TKVA 2ID8A 3MA5A 2Q49A 3G9QA 3F90A 2I4MA 2C5BA 3IO3A 4DDVA 3LLVA 3NHMA 5SV2A 1NI5A 4A1FA 3CX4A 4A36A 4B74A 3BJRA 3ACCA 5G05J 2VWHA 1MU0A 1IVYA 5FI0B 2Z3VA 3KJEA 3KG2A 1PFYA 3IVCA 3AVYA 2MR6A 1UOOA 5HQ8A 2FW7A 3ENKA 1JAZA 2VDVE 1W7AA 1F7VA 3OPYB 3R4VA 4NENA 3MTJA 1THMA 3KZXA 4G4GA 4LBWA 4RADA 2EERA 5DASA 1CPYA 1GN8A 2AFIB 3RS3A 4QT4A 5C8DA 1ZJ6A 1JEYA 1Z2PX 6REQB 1C30B 1YFZA 2ADOA 3HU5A 3W2GA 4QDTA 4E94A 3UKJA 4DJEC 2BV3A 4BZPA 4RZ3A 3NW9A 1E3WB 1S7GA 1X1EA 3W0LB 3AT1A 3QF4B 3KQOA 1T0HB 2E6UX 2R7AA 2YHUA 1GARA 2P58C 1ORDA 3K9HA 2BCGY 2WHEA 1R88A 2ZRFA 3PEVB 4Q05A 3OFNA 3T9KA 3VKGA 2HIMA 1XL0A 2KCVA 2I66A 5HJ2A 2QYTA 2GZ2A 2LD4A 3D31A 3EHDA 1R6VA 2H4WA 3UATA 3R44A 1N11A 1P2FA 1OBCA 1UPCA 2ZDQA 4MTLA 3SFYA 2GCNA 1SOMA 1VDZA 2WB4A 5BUQA 5IEJA 1Y8ZA 1RPTA 3VHQA 4LY6A 2EG9A 2WWYA 1QF6A 1C50A 2JLQA 4M9RA 2XYRA 1WY7A 3OUUA 4YRJA 4N2SA 3TCNA 2QTAA 2ZIAA 3W6OA 5CVEA 2R1ZA 3ZW3A 1A2BA 2NM0A 3VZRA 1U7UA 3GVIA 4BWYA 4JI6B 2PSDA 3D4NA 4BGDA 4TL9A 3ZZ1A 3WP1B 3QLTA 2QY7A 1YCGA 4P53A 1QOZA 3HFJA 5CK5A 3U4IA 1YJCA 5JJIA 3HDQA 5HHTA 3GAAA 2WU8A 3ZD9A 3FF1A 1ZGJA 3OJ0A 2O1EA 3GEEA 3VC1A 2OG1A 4CFSA 4RVCA 2FWIA 3PXAA 4L85A 2ATCA 1WZNA 2ICAA 2NC9A 2EIJE 4EHKA 1QP0A 5DBKA 1XTBA 5DTQA 1BEUB 1N92A 2C9ZA 2L0XA 3RUFA 1PCXA 1ZMRA 3FJ1A 4LJKA 2KYRA 4L5IA 1J07A 2BFCA 3BTOA 3SYRA 1LF5A 2IUYA 4DB2A 2QMZA 1Z62A 5BUZA 1Q77A 4KDFA 4S24A 2IPNA 4B09A 5DHPA 3TR5A 4C89A 3CRQA 3UT5A 3F47A 4GXNA 4AG6A 1KJ8A 3TCKA 2O2GA 7ADHA 1KEKA 1RRCA 3TZCA 3LW8A 4HRAA 1LSJA 1J24A 2ZJBA 1V11B 3OX2A 1S0UA 2XODA 4QU0A 5E2BA 3G5UA 1Z37A 4CG1A 1PKXA 1FUYB 5E9JA 3WGNA 8ADHA 1DT3A 2LXNA 2HJRA 2Q3JA 4AMZA 3PDHA 3RVPA 3Q2OA 3HMKA 4XUGB 2IUTA 3OIDA 4ZT7A 1SA5A 3S55A 3KAPA 4ACAA 2JGKA 3BH6A 2WIJA 4G11A 4C3VA 1YDWA 2X0EA 1ADBA 5C81A 2J0SA 4PYKA 3FM9A 1AGPA 5FORA 5KVQA 3TBFA 5IKEA 2HMVA 3NHAA 2VPQA 2IP1A 2AH5A 3TIVA 5HKAA 3CLUC 4U2DA 1JG2A 5BVGB 4MW1A 4LWOA 3IA7A 1Q0HA 1QVWA 3K30A 1ZK1A 3HJGA 1ORHA 1M2HA 2DTXA 4IOMA 1FS5A 2EINE 7YASA 3RNLA 4CW7A 2WYOA 3UWKA 1P5FA 5AJWA 1YS1X 3RO2A 3BILA 2W2OA 3WTCA 3VHLB 1W6UA 4NDNE 4PO3X 4QVIA 4OB7A 4W9NC 1LVUA 1WR8A 2ZGDA 1VJGA 2QX8A 4RVGA 5EIXA 3UNXA 4B46A 2BF4A 2QRLA 3PPWA 4XLZA 3VC3A 5AI4A 3UAZA 3QNMA 4HORA 1N6OA 4PNZA 3THSA 3UJ9A 2W8BB 4RW0A 1T15A 4B6GA 3VR5H 2M63A 2VATA 2VVTA 1VYUA 1EWTA 3N58A 4O2AF 1KZ1A 1KZHA 1AXRA 3G6WA 4DUYB 2BVNA 4RHXA 1EFPA 5IMBA 3ST7A 4HJRA 1CZOA 1I3MA 4NZNA 1Z8DA 5KTPA 1Z33A 3MW8A 2FZLA 1V96A 5AW4A 4JHJA 1JKIA 3PREA 3H1FA 5EJ4A 3H1AA 4YMGA 2P9JA 4YCAA 3W4IA 5DM60 1PQYA 1ZCAA 3BFXA 4ZO8A 3ZZTA 4Q19A 1V5EA 2HRRA 5ALVA 4C6TA 1I4OA 3KSQA 4XRGA 3U60B 1NFQA 1QONA 2R5FA 2VKQA 1L5OA 4DRXE 3ZH9B 1X1TA 1HQYE 2LCQA 1R4ZA 2RH8A 4A5SA 2PZAA 1QV7A 3MA0A 5FJJA 1XMQB 4LDJA 1GO2A 3PL5A 1ODTC 3QW4B 1VCNA 2XDWA 4GOND 3UFBA 1ILWA 3VPDA 2H2WA 2YS7A 3PD0A 1EVZA 1XTZA 3RFCA 3VLEA 4G0YA 1SUIA 3U2QA 1F1BA 1U2DA 2A57A 3AGPA 4ME6A 4QRDA 1A9YA 5COQA 3U0VA 3QJZA 1EX6A 4AM9A 2CNOA 3VOSA 5KU1A 1GU7A 1N6KA 1WQ3A 2HCTA 2IQ5A 2CG2A 1CUUA 1X1QA 1W85B 3FB1A 3PICA 4HRYA 4O33A 3TM4A 4H3KB 1JH8A 1Z73A 2BRUC 5A5FA 3TL6A 2H7YA 3ENVA 3V97A 4EQ6A 1MXHA 2FPGB 2R4UA 5TPZD 1GJRA 2VHWA 2HK6A 2Q5CA 3V3KA 4K05A 2FJPA 3T1VA 4E1VA 2IXBA 3TU3B 1JE1A 3NHJA 4DA7A 5BR8B 3NT4A 1WDTA 1ZPDA 4HQOA 4S1VA 4C4SA 1U1IA 3OOJA 1E96B 1UKVY 3M9XA 4OOFA 2HUPA 1NVXQ 3RRJA 3OJEA 2PFGA 5JTUA 1QCCA 3FUJA 1W36D 3JQFC 2HI0A 4R2HA 4B17A 1RC0A 2ILTA 2GASA 3ENEA 3GW8A 4WK0B 3EPJA 2QLBA 4PG5A 2XB9A 5MN6A 4PO8A 1QHHA 3FOCA 1IZ9A 1UC5B 1QUEA 3JQAB 3ZBTA 1QDUA 2OQRA 3JR7A 1KMCA 1Q57A 2FGJA 2PAFA 3LKDA 2FRDC 3NM6B 2WT4A 4GX1A 4BVJA 1YMPA 2B4QA 4A63B 1ZGCA 3A9VA 3C43A 2ZYUX 3ESYA 3OE4A 1KE2A 4NE2A 5JRDS 2PKQO 3FGZA 3QU5A 1FZTA 5EA2A 3HRKA 4HNSA 4UXIA 4KPFC 4S1WA 2R03A 3VYUB 5IC4A 3RUPA 1PSDA 1XJCA 1NRWA 2YC2C 4G8DA 1AKVA 2AQKA 3IHVA 1QLJA 2X5JO 4WOCA 3QVOA 5FNVA 3VRHA 3SM9A 1KAGA 3V6MA 1FP1D 2C1ZA 2Q6LA 3Q0EA 4EG1A 3ROZA 1CF4A 4JB2A 5K8TA 2JH9A 3EVCA 1V95A 2Z08A 3T1HB 1XROA 4RM3A 1EGHA 1KEZA 2RONA 2QRQA 4CI0B 1ADCA 5H59A 5KYWB 4DJJA 1E2JA 1UM9B 4NJEB 1CQIB 3DMTC 1LF0A 3DCNA 4KYOB 2D5AA 4NX2A 1FPPA 1WRBA 3S29A 5JARA 5J5AA 3A6ZA 1NI4B 3STVA 1TOAA 3TQFA 4IH9A 1PJ8A 5KJKA 1OFVA 1XJQA 1GAXA 3UK6A 3AU8A 1JYEA 1EWYA 1ABBA 4V0ME 3BE5A 3BE6A 1XKTA 2FKAA 3FDIA 1TADA 5JD3A 5EJFA 4CKZA 4CZ2D 4YHBA 2IYRA 4DCSA 1AKUA 1F2TB 2CBZA 3BQNB 1QYIA 4G6ZA 4D0NA 1SVXA 1EQ2A 2WA2A 3L18A 1V5IA 4DV0B 3L46A 3B3JA 4LBVA 5AW8A 3FH8A 3KEMA 4MEBA 5EERA 1Z7BA 2G8NA 2NZVG 1G8MA 1YZUA 4WZAE 2PGJA 1Y3IA 3YASA 4OBEA 3LQYA 1FE8A 3NUQA 4A1GA 4JLJA 2NX2A 4DA8A 2H1FA 2NT4A 2Y4OA 3K8ZA 4EBFA 1ZO8A 4GE0A 2JFFA 1R8YA 2HMTA 4JDPA 3DDUA 3CLUD 2GNAA 2ISQA 3D4IA 1JTEA 3I01M 1AV6A 3RT9A 1Y42X 5FNVF 1OFIA 3H11B 2XCRB 3GLGB 1JQLB 1MPTA 1WTAA 2WD7A 1CW2B 3B3AA 1AD2A 4OK5A 4Q9DA 2JLWA 7MHTA 2QV7A 2I6FA 3NHRA 2OY0A 5AW9A 4A92A 4DNQA 4QQNA 3F67A 8ATCA 5K4GA 3SY8A 3D43A 1ESEA 1TO1E 4Y6WA 1Z82A 4H3SA 4NHOA 4HB4A 1CY4A 3TKLA 4AF8A 1FNBA 2WD8A 2I4RA 3PNLB 1EH5A 4EBBA 5L4LA 1HL7A 2HFKA 5LLTA 1ZXLA 2W00A 1LKZA 1NOKA 3P0IA 4C5AA 4BVHA 1G0OA 2BR5A 2XTNA 3HKEA 2FF4A 1YXMA 3VX3A 4FILA 1L5HA 1X87A 4JL6A 3IMGA 1S89A 2PRYA 2PZKA 3H97A 1BH6A 2P0YA 3OX1A 4KQ1A 2O0HA 3OZFA 4NULA 4OQZA 5AYWD 3RSSA 2ECPA 4BECA 1SHKA 5DBHX 3FFAA 3TTXA 1AUQA 4LDRA 2C4UA 1UM8A 2GFHA 2GEBA 1V2GA 2H29A 2UUPA 3QPDA 1SO8A 2KI5A 1NY5A 3JRWA 3NR2A 2NP6A 1Z26A 1BDMA 4ZDWA 3TM5A 2R87A 3NVKI 5TDHA 4O4LB 5AMXA 3SX4A 5FPKA 1EA5A 1ZHHA 3C2QA 3L7BA 3ZC3A 3LGAA 3LDHA 1XMJA 3FPAA 2C2LA 1NW8A 5KHLB 2B1QA 2CLFB 1QRAA 3CSTA 3GFPA 4PYIA 3CKCA 1M2FA 5H81A 4S3MA 5TPWA 2YNQA 3CNOA 4DDKA 5ITZA 3PKJA 2UYHA 3U26A 4AXXA 1OB5A 2IT1A 3EX7C 1DXHA 5JAMA 2CT8A 2I1JA 4A26A 1KORA 4II3A 4CV0A 3OF3A 5IXSA 1QNLA 3E5MA 3EEQA 2AJCA 2YHIB 1C1XA 1TN7A 1KIAA 3ZW9A 5BP7A 3I04M 4AJEA 3FUFA 1E8NA 2HHLA 5EMJA 3KZOA 3FJYA 1NZFA 2GRNB 4F7AA 3C3YA 3TMKA 4L0QA 1OX4A 1E4VA 2P2GA 4BKMA 1D2MA 2V7VA 1OWOA 5CNJA 4MBGA 3LK7A 4DR5B 1BDHA 4HK4A 1ECLA 4ZCMA 4XI9A 1GL6A 4DX1A 4IUBS 2WXQA 3T95A 2HU8A 1JLSA 4V1CA 4PZYA 4QBIA 2FSPA 4B4KA 4ETNA 5J90A 4W7HA 5SY4A 1R0KA 2OXCA 1ENZA 1VI5A 2CMGA 4ONEA 2H0QA 1BMQA 4LX0A 4FJ1A 4JHLA 3C98A 3UTCA 1MMFB 4BVBA 1T9KA 4X1IA 4TUYB 4JR1A 4FGJA 3M4ZA 1T0BA 4XQGA 4IJ6A 4B33A 2H1VA 2HWUA 4AYXA 3BZUA 2BN4A 3AHJA 4RXUA 3HI6A 5LWQA 1H2TC 4B4VA 5FBVB 4QRIA 3TZQA 1GLNA 1NJ1A 3AJ9A 5F33A 3HY3A 4EA7A 1GG5A 4EGAA 3AL0C 4DX2A 1HG5A 3WIDA 5F12A 1NV9A 3P0JA 3E8XA 4OTZA 3UYLA 4ABYA 2L9BA 2C7QA 1GZHB 2WVIA 4M87A 5A0TA 3NWBA 2NU6A 5AK6A 2V4LA 3FSGA 3DP7A 2YX1A 1KBOA 4TXQA 3FTYA 1P4GA 1DO8A 3KYDA 3UEOA 2FLVA 3ZX4A 1FXUA 2H1HA 5M72A 5JA4D 3M7IA 1IZZA 1I1NA 2ZYIA 3C7KA 4R5HA 3RC3A 3ORHA 2GW1A 4HLQB 5I7VA 1HE1C 2X13A 4HMOA 1EDBA 1U9CA 2XEVA 1B4DA 2ZJ0A 2Q7DA 1R16A 2X1VA 1DKQA 3RWOA 3DE7X 1I9CA 1J8QA 2Y0CA 4IS2A 2VBGA 3I2KA 4CIDA 2CF5A 1PGNA 1S6YA 1AGRA 2FEMA 3LV8A 3DYBA 4GSKA 4N5CA 4G2TA 4ZXFA 4S0XA 3TQIA 4JP2A 4FHEA 2OK7A 4RORA 3CEAA 1KA9H 5CH3A 1Z88A 1QQTA 1ZD2P 4HAOA 4LZLA 5FI1B 2WAMA 2FRVA 5ITVA 2BJVA 1QR2A 3UHOA 5FBHA 3CH7A 2P9GA 5DULA 2ZYRA 3QWVA 3GUHA 1MFZA 3TZHA 2G1UA 4KZKA 1ABEA 3KC2A 4K86A 4JLUA 5LC1A 3TXYA 5ENSD 3V2XA 2Y3IA 4XGRA 4F5WA 5KYKA 4P5EA 1XP8A 1ORTA 1MAUA 4LOHA 1E7YA 3H8WA 4PC1A 1XFDA 3SS7X 1GOTA 1VHWA 4UVHA 3R7BA 4S1OA 1J7KA 3VU9B 1MB2A 2XJ9A 3DTYA 3KYIB 4EWLA 1PJSA 1TAQA 1Z34A 4TMYA 1DJMA 3JS5A 1BMTA 3LFHA 5FAXA 5KNCA 1A4IA 3IV6A 4E2XA 2FV8A 2FSHA 3LMKA 3GYBA 5G0UA 4ILGA 4BPRA 1EA7A 3FKSA 1AZTA 2VPXA 3JAWA 3EHRA 3PRKE 3OO1A 4Q9HA 4WN3A 4ECAA 4YMTA 2R97A 4ZFNA 1OMOA 3KVYA 4P82A 5FUVA 4FMDF 1CWUA 4RFSA 1BDBA 2RBEA 1PR1A 2GA9A 3ETGA 5AENA 4RIHA 1JPJA 1YZVA 2ZBEA 4GZ5A 4I9EA 1M2KA 1RQLA 2AR9A 2HF2A 2Y1XA 4AY6A 2YV2A 2HV8A 4IJQA 4FR2A 3W9YA 4YCMA 2CLKB 3UF0A 1OI4A 4F45A 2NUAA 4A1OA 5T8KC 4EDHA 3C6MA 1DKRA 5EJ7A 4NOMA 2D7CA 2PMDA 4MGEA 2PV0A 4RENA 5AVTA 3G2MA 5FYDA 3MWLA 4HTFA 4N12A 2P5YA 1I01A 3TLAA 4BNWA 1IAQA 3EIQC 3LFUA 1M0EA 2JCBA 2R751 4L23A 1H6DA 2QP9X 1S2LA 1F5SA 1VG1A 4MUEA 2LUHA 3WNVA 4BO9A 2ZYTX 3IESA 3EPRA 5FTLA 3A6JA 1BKYA 1U1DA 2A9VA 3A1WA 4A5OA 2XGMA 1C0KA 3GLVA 5B1HA 3HA2A 3DWLG 3JD4A 3PC7A 5F3RA 1ZA2A 4KTTE 4U0JA 1Z0FA 1U99A 2I6GA 3PZDA 3CLHA 3DEJA 3UA4A 4Q9NA 2IODA 3R9KA 1V4NA 3Q3GE 2NU7A 3WYFA 2EDCA 2V7GA 4H35A 4HWGA 4Q3BA 3OEHA 1C3OA 5AJLA 4H0NA 4CT0A 1JJFA 3AL3A 3D6FA 1JPNA 1WMEA 2LWIA 2IEJA 5FINA 4HI9A 2VRNA 3FDFA 3N86A 4Q24A 2WPDA 3N53A 4DKJA 1GZ7A 2RC6A 2ODNA 3WLMA 4DL9A 4OHYA 1M83A 2X4GA 5T3YA 4G24A 3K0AA 3Q3HA 3KD7A 4KMSA 3K6KA 1Y3BE 4IXDA 3LSTA 4ME2A 2A4MA 1K1BA 5FJYA 1A5TA 5FLYA 5KOIA 3F7OA 4DPKA 1Y5RA 1LPAB 2ZSDA 3G8DA 1W2WB 1PLJA 4P4TA 4RZQA 3A4NA 2H1OA 4WKGA 5A3JA 5GJWC 4WXPA 4NQRA 1SUAA 1T9GS 3Q7EA 4KE8A 1E8OA 1WW8A 5CHEA 4GPMA 1RWPA 4BLPA 4QYSA 2ZRQA 1SXHA 4FU3A 4LHWA 1U9ZA 3T5CA 5B36A 1TZJA 3ABME 5CDSA 3U81A 2FNAA 3T7CA 4F92B 1BDIA 1K7FB 2AEFA 2IXDA 2D6FA 2O8BA 1Z3CA 2DHDA 2ZWIA 4PXSA 4ZD6A 5IDQA 3CBQA 1D4OA 1N2OA 1YAHA 5BT9A 3Q15C 1V8OA 4XARA 3HVUA 1BC5A 1BGWA 5CDTA 4LFAB 1LBHA 3A7DA 4DRXB 4GLLA 1G8YA 2XQFA 5PNTA 5C32A 4PVCA 3ZY6A 3QWIA 3FE2A 3T0FA 2J7PA 3D5EA 2A78A 3HWSA 3LP6A 2JD2A 2X19A 3NLLA 4AX8A 5AIBA 2FX3A 1QBGA 2WQ7A 1H1DA 1I24A 2H5IA 4DI4A 2BELA 3HNRA 1CY0A 4XDYA 4A0FA 2QRVA 2HK7A 3AF4A 3EISA 4ZMBA 2AI3A 3I5YA 4F0JA 2O52A 3GZNA 5BV8A 3C5WP 2GVZC 4GOLD 4XUCA 3WFJA 5JAOA 2COUA 1P33A 2CXPA 3O1LA 4K9KA 4Q1CA 1F48A 1RWOA 2FSSA 3O0TA 4HUQB 3Q78A 3ZYKA 1OC2A 3DAYA 3QG5A 4C06A 5BN5B 5B57C 1HYQA 5IFLA 4PDXA 4KPGA 3UXHA 2X1MA 3COJA 1W4LA 2PGIA 3QDNA 2VI5A 3JQCA 4M8SA 3CH4B 1AN9A 3WK6A 4YUWA 3ERCA 3EGXA 2GN1A 4YCLA 1A8UA 2ZJ3A 4MHTA 1EM8B 1JG7A 3O6VA 4WZZA 3RVNA 2DWQA 5DLQC 5KTRA 3GLFE 2QJWA 4ZEMA 2EFEB 2RJNA 5D5PA 2DFKB 3PI7A 5FBWB 2ZYAA 4MI6A 4ZK6A 1CF2O 3PWSA 3OF5A 1W88B 3QYAA 4GSLA 4YV7A 1LVHA 2BONA 2COEA 4JT9A 1IUPA 5J1SB 3HKCB 1F8XA 1XNFA 3H3FA 1NNUA 2GA8A 2I9PA 2C4MA 3I3OA 5AKGA 5DI9A 4OUKX 2AFIE 3SIWA 3SXUA 4ZYWA 1CJTC 1KP2A 3X1DA 1U9IA 4Z9XA 4F56A 4ZJYA 3HY4A 4XWOA 2GESA 2QQ5A 3DMYA 2R96A 3OM1A 3D9PA 4OQEA 3H0EA 5D2MC 3GBPA 2IIPA 3QIVA 4Z3KA 3FJOA 5IC6A 3A26A 1G60A 1RLJA 4M1MA 1GTMA 4V0KA 4JI5B 5GIOE 2VUSA 3A06A 2ZJ8A 2DPGA 3B9QA 3GRKA 2XNDD 4KLNA 4YJ3F 2D0OB 4WWOA 1M2WA 4YYEA 2Z6UA 1YRAA 1K4KA 1TKBA 4JLMA 2VF7A 4YGYA 4E21A 1DP4A 2R1VA 1KQGA 4NIKA 1U0GA 2IW1A 1FJXA 3D4OA 3G2JA 2PVSA 4PZCA 2AN9A 2QWXA 3TR6A 3H9JA 4LUCA 2XI4A 3GFBA 3O0DA 2IEAA 2EIKE 3SYMA 1E9SA 1Y80A 2BISA 2IKQA 1L8QA 2QSYA 4YPFA 1Z0ZA 1ZHFA 1Z68A 2OGSA 3EW7A 4KBGA 4QTTB 2I4LA 4BZXA 2DBVO 1M8GA 1MDBA 1FBTA 1Z0JA 3BGSA 2XSZD 3PEFA 2RHDA 4GBED 4MYHA 4BLUA 1BCSA 2FR0A 3D8UA 1UM9A 3IEXA 1VSTA 2MYPA 1OJLA 1PFGA 3LCJA 4PXAA 4WIAA 1K0FA 5ALWA 5EWLB 1Q83A 2QLFA 2V5UA 3BSSA 4J0GA 1UFVA 4BC0A 4DEVA 5B64A 2H5LA 4B5KA 4F5EA 2Q1SA 2X8BA 1SBYA 4YLEA 2ATXA 3GFQA 3N2GB 3O8NA 2HX1A 1AP7A 1US8B 1F8YA 2BBTA 3DMFA 3AS5A 2VJMA 4Z2YA 5REQA 5J23A 1OBOA 2HJGA 3RM3A 1VB3A 4FFBA 4EF6A 4ZMRA 2OT3B 4P93A 3SXJA 3VHRA 3Q7SA 4ZGBA 3AVXA 1TTHA 4JPSA 1OXXK 1CJMA 1EGVB 3W6ZA 3EZ2A 2EJUA 3JW8A 1XIVA 3WKEA 1OR8A 4TN1A 4ER7A 4EUKA 1U2EA 4EZLA 3DW1X 1B74A 4CNQA 1R6DA 1D8DA 1KEEB 2PMCA 1H9AA 1E6KA 2EVWX 3T7DA 4FMCB 4RQBA 5C51B 3TIFA 4U8GA 3PEUA 1V6AA 1W49A 3ZQUA 4BQEA 7REQB 1DG1G 5HZMA 1HQDA 1SKQA 3OZIA 1GVNB 4DS3A 2R84A 1SWWA 2VDUE 2ZULA 1G55A 3Q5EA 2I7TA 4IZOA 4BNFA 4KFRA 3I09A 4DSUA 2MIIA 4EZEA 5KO2A 2G67A 4F06A 3RIHA 4QEKA 1I4WA 4F9EA 5K2OA 5AAOA 2R8YA 4R9RA 2OD2A 1GTG1 2YV4A 1ANKA 2A59A 1KK3A 3A25A 4LSZE 4O1IA 4OJNA 4PCLA 4OIMA 1U8UA 1C2YA 1CZNA 3OSZA 4BZQA 1CDOA 2RG1A 2GN8A 4N5DA 4PZEA 3H5OA 3UG7A 5HFJA 2R6ZA 1DQZA 4NMHA 4CKBA 1PX0A 1KP3A 2CFIA 4HXFB 4IXNA 4MV9A 5EHNA 3IIKA 3NBFA 2VTDA 3QEAZ 1P0CA 4MQEB 3RRNB 1C0PA 1I3CA 3BH7A 1M74A 5IC5A 1L5YA 2D0DA 5F52A 3GP3A 3K35A 2JLBA 4YBZA 3RIXA 1SUSA 4ZIRA 4RDIA 4U7PB 5DOVA 4ZT3A 1OYYA 1U3GA 4DZTA 2O8FA 2I1WA 3TLGA 3UX4A 2OCPA 4I3HA 1M6YA 4GXRA 1JYFA 4BQRA 2A0WA 2G6BA 4O4JB 3A10A 3DOCA 5DDIP 2Q62A 1B8PA 4PZUA 1W36C 5ALOA 2NP7A 1JG6A 1JYSA 4IMPA 1UF9A 4PS0A 4AJJA 4FD3A 6GPBA 3EIOA 1EQUA 1RKXA 3ANYB 3EVEA 3M4JA 3WK5A 4CN8A 5JBIA 3ZLJA 4D4MA 5L3ZA 1YKGA 2QUKA 3C3AA 4JZYA 5M34A 1XXHE 1XVLA 3ETJA 4JX9A 5TMEA 4ZYUA 2NAPA 1TECE 1IBKB 2ES4A 1N0HA 4GA0A 1QP7A 5GAJA 4EGCB 1G3MA 1KJYA 1DE0A 1IOVA 4MKXA 1IXKA 4W1QA 3OCJA 3T9EA 5K9ZA 4TT3A 1GCAA 4BIMA 3H1EA 1JN0A 4MQFA 3KZ1E 1TMKA 3Q15A 1T0PA 2N46A 1A72A 3P0RA 5FA5A 4N7RA 1A5EA 4NDZA 3CVUA 3LT2A 3H84A 1O6ZA 4G0OA 4UNSA 2VZ0A 4TQUS 2BE9A 1TK3A 3V1LA 1VJCA 4ESOA 2FPPA 3ZUPA 1DEKA 3KU4A 1QCYA 1OZHA 2AD1A 1VI2A 1GA6A 1NW7A 3OJLA 5DXJA 3V4SA 4J8EA 4K9OA 2FQWA 5EQJB 5HCUA 3VM6A 4LZPA 4CTOA 5EHZA 4LYEA 1D4ZA 5LZ8A 2WFZA 1VKJA 3UJBA 3IELA 1AKTA 5LP1A 3EGXB 2HA3A 3QPAA 4BQIA 3T5DA 1EMDA 4IDQA 4MIOA 5J2TB 2B2NA 1T3HA 3SI5A 2DUMA 4PTYA 1OIVA 1PJRA 3X1JA 4P3YA 3W1VA 4YV0A 2HT1A 1P1CA 2YHAA 4JJZA 4D4JA 3L06A 1BFDA 4RFVA 2AEEA 2EGGA 1ULSA 2OGWA 3FNEA 2FJAB 1G0NA 1PHPA 5K7SA 3BXGA 2XKAA 5LQUA 2O54A 3K2IA 1N0QA 2C2GA 4EOGA 1MW9X 1RHRA 1Y33E 2R8PA 3G02A 3GU3A 1EJBA 1EAYA 1Z35A 2GF0A 4J8SA 2HADA 1OAKA 3BA6A 4PAQA 3CXRA 5IP5A 5JASA 1CIVA 1WDLA 2ZANA 3SKXA 1HTBA 3LUCA 3TEMA 4RGYA 4LDQA 4CCSA 1AIPA 2V6IA 4RWEA 4I0WB 3GUUA 3JALB 5JSYA 1ZIXA 4Q01A 3LM8A <