4XIFA

Human ogt in complex with udp-5s-glcnac and substrate peptide (keratin-7)
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
717
structure length
702
Chain Sequence
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title The active site of O-GlcNAc transferase imposes constraints on substrate sequence.
pubmed doi rcsb
source organism Homo sapiens
total genus 268
structure length 702
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xifA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xifA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4xifA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4xifA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xifA03
3TOVA 4J0UA 1UQUA 3CUTA 5FT9A 3OXGA 3Q47B 2MHKA 1JIVA 1K06A 3NC4A 2F3UA 2IW1A 2SKDA 3L7AA 2R66A 3ASHA 2SKEA 4YUAA 3CKCA 1P5QA 3BCRA 2IYFA 3NB0A 1QM5A 4NESA 4QLBA 3CK7A 2KATA 2Q7FA 3MS4A 2GPAA 3GPBA 4PQGA 3T5TA 4I17A 3RSZA 4EKEA 3ZCSA 4O6FA 4L22A 2FBNA 3CKBA 3WXXA 2PQRA 1Y6GA 1PNVA 3TSAA 3RKVA 3MTBA 2BGUA 4MHOA 4BTAA 2KS6A 4EQFA 4CTOA 2AVPA 5LQDA 3RT1A 4YI3A 3JYSA 1IYGA 1XV5A 5LCWJ 4G2TA 2VSNA 2F3SA 2QN1A 3BEEA 3O48A 3U4TA 4BQIA 3CUYA 3MRTA 3S2UA 2F3PA 2G9QA 5G04J 2QFCA 1E4OA 5FTPA 3D0RA 4ME2A 2KCLA 4RENA 2R4UA 2ATIA 4G23A 5FJYA 3CEQA 3UQ3A 3CV0A 2C0MA 3QWPA 4RIHA 3LPZA 5EX3A 2GM9A 4HOTA 2IV3A 3AS8A 3LKUA 5HQ8A 4I9EA 1FTWA 3RO3A 3TG5A 4G26A 2Q6VA 3MT7A 2P6PA 1VGVA 4EL5A 2C9ZA 2XGSA 3K9IA 3GZ2A 1ZU2A 4JL0A 2LNIA 4BFCA 4N3AA 3CK8A 2LSUA 2XA1A 3PE4A 5CCMA 4JA7A 3OTIA 3C4QA 2GJ4A 3MTAA 2SKCA 3WAGA 1L5SA 2FFRA 5JJ7A 3FROA 1FCHA 1Z6PA 2FI7A 4GZ5A 4N9WA 3PDNA 3NAZA 4RIGA 3SZ7A 1NA0A 1A17A 5TVGA 7GPBA 5JJ6A 3S7JA 1UQTA 4GZ3A 3UPVA 3S29A 2XA9A 1TJCA 2AW3A 3ZCRA 2PL2A 5FZSA 4WHMA 2WPVA 1K08A 3EBPA 1FTQA 2R5SA 3ZCQA 1Z8DA 1Y8MA 4GCOA 5IKPA 1GGNA 2VSYA 2GPBA 5BW8C 4RELA 2XEVA 5D00A 3G2LA 4GA1A 3EDTB 1L6IA 3RJVA 3G2NA 4AM9A 5HXAA 1PYGA 2QRHA 4MRAA 3MRXA 4EKYA 2HR2A 2R68A 1C50A 4H7YA 3ZGQA 1E1YA 2UWJG 1BX3A 3E3LA 1WAO1 3ZCTA 1JIXA 2IV7A 1FA9A 3MV3B 4JA9A 1HZ4A 1XKXA 1B4DA 3MSCA 2VGXB 5KJMA 2PYIA 2GW1A 2JZCA 5CHEE 1XL1A 3BCSA 3RIBA 1IIRA 4Z5XA 1B89A 2VQ2A 5KJNA 1JG6A 3CVLA 4A1SA 1EXVA 1OUVA 3OTHA 2XGOA 3Q15A 3IA7A 4YI5A 3ZN3A 4AY6A 4RG6A 2JJMA 5IKOA 1NOKA 3CEJA 2I6HA 3OY7A 1KTIA 2KCKA 3D1JA 4YVOA 4GPBA 4I2ZA 5D0OD 2XPIA 3ASDA 2QZSA 4M60A 2ACWA 4RIEA 1GPBA 2QN7A 3VUFA 1FTYA 1P2BA 5D01A 3T3EA 4BQEA 5KJKA 3OKCA 3GUHA 3Q3EA 2E2EA 4RG9A 4WNEA 2H1FA 2QLLA 3NCHA 4MHSA 3BD6A 3GYZA 3IEGA 2BFWA 4EL0A 2GPNA 4LEIA 2NC9A 4F97A 4APOA 1KT1A 2VG8A 2XCUA 2IEIA 3S28A 4CGWA 4UI9C 3H4TA 3LYAA 2FO7A 4IN3B 4U04A 1NOIA 1GPYA 4UQZA 1HLFA 4REMA 1RRVA 3L7BA 5I45A 5G05C 2OFFA 3KS2A 1UZUA 2QRMA 3TAXA 1KLXA 2KC7A 1P4JA 3S7DA 2YHCA 3T7DA 5DIZA 3IAAA 3ESKA 3MS7A 3MA5A 1PN3A 4WADA 3G2KA 1ELWA 4W9RA 3CVQA 5DXFA 4X7RA 1A8IA 3G2IA 3CEHA 4F96A 3CUUA 4MI9A 4GYWA 3NP7A 1XNFA 1L5QA 2G9RA 4AIFA 2C0LA 4Y6WA 1EM6A 1IHGA 2X6QA 3Q49B 2F9FA 1J39A 5DU2A 4CTMA 3RO2A 4G25A 3FFLA 4FKZA 4G1TA 3O3CA 4GCNA 3CEMA 4FZRA 3COPA 3OTGA 3MTDA 4BTBA 4CDRA 5GPBA 3ASFA 4X6LA 3NF1A 1XOIA 1SXQA 4KYOB 1P4GA 4RIIA 2XA2A 4N2QA 4XIFA 4XI9A 4G24A 3RU0A 3LCAA 3QWWA 2IYAA 1O6CA 1XC7A 3QKWA 4KQMA 4I1AA 2O6LA 3Q3IA 2PRJA 4XI0A 5JTTA 2QRGA 9GPBA 1WW3A 1YA0A 2UY1A 4LEUA 1LWNA 1H5UA 2OOEA 3T3HA 3HBNA 4UQXA 3QDNA 5C1DA 2AV6A 3QKYA 3TGOA 3SYMA 1FS4A 3OKAA 3HYMB 4X7PA 1NOJA 3AS5A 1M5RA 3S0JA 5BNWA 5JJTA 4HLNA 2X6RA 2QRQA 4NEQA 3C4VA 3OY2A 3LY8A 4UI9K 3RSCA 8GPBA 5TMBA 3MS2A 4AY5A 3BCUA 4GYOA 1F6DA 3DDSA 4AMGA 3EBOA 3OXLA 2X0EA 3BD7A 4U0ZA 4GA0A 3L01A 3MBOA 3MT9A 5EX0A 2PQNA 4WACA 3UYKA 4U0SA 2VGYA 2VYIA 1RZUA 2FEZA 2ACVA 3MRVA 3Q5MA 4J8FA 4BT8A 4BT9A 1P29A 2QLMA 2VCEA 4AMBA 4B94A 4GPKA 1AHPA 3VTXA 4YNDA 2ECPA 2WTXA 1HXIA 4CGVA 3D0QA 1ABBA 3MV2B 4RBNA 2L6JA 3DD1A 3NP9A 1C8KA 1NZNA 4GYYA 3NPAA 5DLDA 4N5CA 3S7BA 1KT0A 3SF4A 2R4TA 1YA6A 1LWOA 2G9UA 2WQHA 1C8LA 4HOSA 3OKPA 3MKRA 1WUTA 1P4HA 4HORA 2F3QA 3AS4A 3RHZA 3CV3A 4W6QA 3AMVA 4NQ0A 2QN3A 3KD7A 2ONDA 2FF5A 2XMPA 4NC9A 2ASVA 4UI9J 5EKQD 5TMEA 1E96B 3HBFA 1FU7A 3QWVA 3HBMA 2PZIA 1Y8ZA 2XCCA 3CK9A 3FWVA 5DBKA 1W3BA 3VDMA 4Y6CA 1WW2A 3R9AB 3S27A 4U0UA 5G05J 3VUEA 3E3OA 1QKJA 5ARGA 4LDPA 3CVNA 1PSWA 1AXRA 3T3DA 4J8DA 2HYZA 2QN2A 3Q3HA 4M7PA 3URZA 1NZFA 3H4IA 2J9QA 2XCBA 3MEKA 3GZ1A 4KXKB 2IEGA 3ZHEA 2YJNA 2IFUA 1ELRA 1FU8A 1L5WA 2UY1B 5TMDA 3DDWA 1NVKA 1HH8A 3BD8A 2H1HA 4WNGA 4WNDA 2V5FA 1XL0A 3U3WA 3OXFA 3TG4A 3L79A 1FC0A 2BGTA 2G9VA 5HI7A 4N2SA 4AN4A 2VGXA 3LY9A 1WV0A 1QQEA 3QOUA 4I2WA 3KAEA 2X0DA 1C3JA 1GG8A 5CCLA 3CX4A 1L7XA 4WUYA 1NA3A 3CVPA 4HOUA 4JHRA 1NLMA 3SYRA 4N3BA 2DBAA 4I9CA 1JIUA 3E3NA 5LCWC 1JEJA 5A7DB 2GEJA 2AMVA 1QZ2A 2KCVA 3N71A 2QN8A 4WNFA 1GPAA 2HO1A 3BDAA 1F0KA 3L7DA 2GT1A 5G04C 3T3GA 2ZB2A 5KJLA 4RIFA 5JTUA 3ASGA 4HOQA 3ZPJA 4N3CA 2FF4A 2JLBA 2VCHA 5FZRA 1YGPA 1Z62A 4G2VA 2QLNA 6GPBA 4KQ2A 3BEOA 2XGMA 4U07A 2AZDA 2Y4UA 2C4MA 3WC4A 4KQ1A 5D0QD 3C48A 4KBQA 5BT1A 2FETA 1WV1A 1P2DA 2XCIA 3CUVA 4GZ6A 3WADA 1L5VA 3T3IA 4M83A 2QN9A 3ZCPA 2C1ZA 2X0FA 4GA2A 5A6CA 1GFZA 3PE3A 5ARFA 3VTYA 2C2LA 1JG7A 2HY7A 3UYLA 4BWRA 3ZFWA 3ZCVA 1NZDA 4F3VA 4N39A 3UUXA 4CTNA 4YVQC 3L7CA 2PYDA 3HBJA 4BQFA 1L5RA 3VDNB 1FU4A 3G2HA 2Y4TA 3ZCUA 1Z6QA 2QRPA 2P58C 1IXYA 4J8EA 2PQ6A 1Y6FA 2IF4A 3GW4A 5AYWD 3E4BA 1ZBPA 2GEKA 4MI3A 2IUYA 1P2GA 3CUWA 3ZHEB 5M72A 3MT8A 4UQYA 3DZCA 4HWGA 2LSVA 4EJ2A 3LY7A 3MQFA 1WM5A 4NRHB 2BUGA 2YQ8A 1V4VA 2BISA 1WUYA 3QHPA 1RZVA 4MICA 4ABNA 3G2JA 5FZQA 2R60A 4X7MA 3Q4AB 4H7XA 3S7FA 2C1XA 2QNBA 2PRIA 1PC2A 3OT5A 5ENZA 3FP3A 1GZ5A 1SXPA 3ULQA 4MI6A 4F9FA
chains in the Genus database with same CATH superfamily
2VHWA 1S2NA 2R2LA 4G2NA 1FB5A 5CX1B 3QLUC 3H5OA 3GBSA 3DNFA 3R3ZA 2YICA 1OBHA 2R97A 2IPLA 4CDGA 4WN9B 2VJNA 2IP4A 5BY2A 4IMPA 1Z75A 4A6EA 2YWFA 3I3SR 1VLQA 3PQ5A 5AUPB 1E1QA 2I34A 2KS6A 3AYZB 4Q3DA 4EZLA 1AUOA 2D54A 2OZVA 2BGKA 1U1GA 5JEDA 3R7DA 5DHUA 4CEMA 4X3PA 4TS3A 2FQQA 1A0OA 2DETA 4YO8A 4B3XA 1FK8A 1SM4A 5FJYA 3ZZMA 1TLFA 3RRXA 1ZZEA 2M6LA 2X13A 1DKLA 2IZZA 3CT6A 3U7RA 3FUVA 5EP2A 1KVSA 4IDPA 4IQ8A 5LP0A 3DBRB 3VZBA 3K9IA 4PSDA 3KYIB 3RRBA 5J4VA 3WO0A 2DF8A 4ZIRA 2IHJA 2DEUA 1Q2ZA 1TU4A 1NQTA 2HQBA 2ADOA 5IASA 1LY1A 4DX7D 1PR0A 3PCRB 4E4TA 2IYUA 2ZSEA 2G7ZA 3JWHA 4GYKA 3QNKA 2MSLA 1G5FA 1EIZA 3GL9A 4MVYA 2AEEA 4ER7A 3SQMA 2X5TA 4LYYA 1RM5A 2NO1A 1A72A 4WE3A 4Y6QA 2O2ZA 1YKFA 5ALOA 5CJJA 4ARIA 2Z8YA 4NOKA 1JXMA 4WFKA 2RK4A 5ENTD 3D3KA 3RTEA 2CJXA 1H2YA 4DS3A 1T35A 2WWFA 3HEAA 4IZHA 5T67A 6ABPA 2IZ1A 4FDUA 2IUUA 3ZBPA 3AG6A 3LYAA 1JLLA 4XCXA 3CNNA 1K5DA 1P7CA 4GRDA 1NR7A 1KKLA 3VVBA 3CZRA 3RIXA 3PZBA 2VQDA 1EESA 4OSEA 4Q3BA 1H2UA 3P9NA 4A0HA 2J3EA 2W2KA 3RIEA 3GP3A 5F5LA 3C8HA 3ONEA 1KK2A 4IV0A 2R1UA 1RXUA 3OLXA 3H8JA 1UDCA 3WLLA 2Z9DA 1OIXA 4H3HB 4NKRA 5LBUA 3OQNA 3CLSD 4FJZA 1L7EA 2J3IA 3HJAA 3K8QA 1SVIA 5B1YA 3C0KA 3LI2A 3OY2A 3BH6A 4JT2A 3BE4A 3S7ZA 1P6UA 1U4NA 4FQ7A 3UXGA 2WDZA 1ZNWA 1G5IA 4PFKA 3VI3B 4OP3A 1QPBA 5EIEA 5G1PA 3DMPA 4L7QA 4U2FA 4E1AA 1A7AA 1WLYA 1A4IA 4MUAA 3PZ2A 1MVLA 4P3KA 4QQIA 4DNPA 4YHBA 2V5UA 2PZIA 2FEOA 1U2EA 2JDID 4ZCIA 3MW8A 4GB9A 4HF7A 2XPZA 4A1GA 4G0PA 3P20A 2WJAA 2ZUSA 4G84A 3H4IA 1M8PA 4PLCA 4JD2G 3RYHB 4R2JA 2RGUA 2J9RA 4LNHA 5DX8A 3UAZA 2NO6A 3LCCA 4OXNA 1FYEA 1Z4LA 4AG5A 1BYUA 4DIMA 3TTUA 3R44A 5B7QA 3OC0A 4JBNA 3K9GA 3MTQA 1N32B 3AVVA 4FMDB 2AI1A 4JR2A 4JVSA 2Y3AA 3H6GA 1CLUA 2R2AA 3GFQA 5FZRA 1T36A 4CV2A 2AXQA 5BN4A 1NTRA 3EGVA 2OVFA 1PT5A 1YQEA 2PLRA 3HJCA 4FEAA 1E2BA 3VJMA 5EIAA 1ABFA 1G66A 2GVDC 2Z2IA 4EFDA 4F3VA 4OKSA 5HKKD 3F6EX 2JNWA 5ADVA 4QDZA 1ZD9A 1FU4A 2Y4TA 1VTKA 1EDUA 3C3DA 4RD4A 2X5JO 3EVFA 3G59A 2ZSAA 3AEUB 5L3SA 1KEKA 2E4ZA 3U37A 1ZKMA 2Q3CA 5KNCA 4MR9A 1QIJA 4FQ5A 4MR7B 1R9MA 1F60A 2OYCA 3WMGA 4FC8A 3R2JA 3NT2A 1N92A 2DY0A 3UGTA 3PHIA 2GEUA 1X2EA 3B6JA 1MD9A 1SHZA 2C2GA 3LQ2A 1MB0A 1T5TA 3WP1B 5IBPA 5ALFA 2NPIA 3LC0A 5KJ1A 4UBMA 2BLNA 4FADA 2XB4A 3N3AC 5JD3A 1PJSA 3G02A 3CXUA 2GFIA 4UM8B 4EI8A 1JPUA 3NBKA 1VBMA 4DYVA 1GEEA 2NV0A 3UQ3A 4BQOA 4F56A 3J5PA 2P3SA 3FWYA 1X5BA 1NVWQ 3NJ4A 3BHJA 2YW2A 5B6IA 2I4TA 3KDAA 3SPXA 5ARDA 3T38A 1EK6A 3FUMA 3PA6A 4R7ZA 4FLMA 1XMJA 4QUBA 4AWBA 2RHHA 1B8VA 4JOCA 5JT1A 1UC8A 4BLUA 3EDTB 1J0XO 1YHNA 4RW0A 1BU9A 5C3UA 4EJSB 4ZI5A 1DFGA 1I5EA 5DF1A 3ZU2A 3GLIA 3L6EA 4R1QA 1YXMA 3I61A 5HKAA 4A82A 1Z2NX 1UXGA 5CT5A 3CVLA 2GN0A 3UFBA 2PIAA 4G0OA 2GILA 4ZV7A 5J9FA 2AH5A 2Y66A 4KV9A 2FUG6 4RZIA 1YF3A 2A0UA 4HZIA 3KVVA 4GHWA 1BHJA 4IDGA 2B21A 3DF7A 1NNLA 1T0PA 3BL6A 2AFVA 2Z09A 2A5LA 1D5CA 4NU0A 4HEA1 3U9LA 2DQ4A 4J1QA 3R7RA 2UVDA 4NTZA 4RVGA 3WYGA 1ONSA 2H08A 3PUHA 5LZ5A 5FO1A 1NLFA 2VTKA 4IDDA 2OPHA 1PHRA 2ZJ4A 2IEAA 4PZ9A 5F1OA 1QC5A 1BN7A 2CDBA 1Q2XA 4DRYA 3AL2A 3K71B 4PTLA 1CQWA 1AH2A 3HB5X 2NNWB 1S01A 3GMIA 2PRJA 1E8ZA 2A9VA 3WHPA 1RFLA 3WK7A 2HE0A 3E05A 4IGIA 3PC4A 1DIGA 1LNQA 1FBNA 5EE5B 1LF8A 1T6ZA 1T5IA 4UI9K 1LK7A 3ABSB 4QFDA 5TMBA 3EBOA 4PAOA 3MUFA 2CVZA 1EA7A 4I9GA 1DOAA 4EDFA 2WP8J 1AKTA 1V6CA 6REQB 5JMND 2WTXA 2FJEB 2YY7A 4I8XA 1AMNA 3NNDA 4WCVA 1YA8A 2D2IA 1TEXA 1DEXA 1KMQA 4BE9A 3TJPA 5JDIA 2QTTA 4Q1CA 2V7WA 4DLZA 4XX5A 3PDCA 1MXHA 4C7VA 2CYAA 1T3GA 3C98A 3HKCB 4BX0A 5G05J 3HACA 2Q7OE 3KTDA 4H16A 5K4GA 5IEBA 2PWPA 5IK2D 1IZ9A 1VJ5A 1N9GB 4ZYXA 3JR7A 3VNAA 2Q8PA 5G41A 4UXJA 4EITA 3WB2A 4AY4A 2BEJA 3LKBA 4LYFA 2JI8A 4N3BA 2I3BA 1JHRA 4OHWA 1CQIB 1CYDA 4X24A 2RGBA 1F0KA 1NXXA 1KI6A 1T0BA 2HMVA 4HOQA 1JP7A 1Q20A 4KDRA 4BSXA 4FN5A 3QVUA 1DCFA 2DWQA 2YIVX 3V5NA 1JG1A 1ZMOA 5JI2E 1RYFA 3BGWA 4UWLA 4WLUA 1UG3A 8MHTA 1CE8A 2YQZA 1U5BA 1WY7A 2HREA 2HC9A 2IQIA 3VTYA 3H13A 2OMKA 2YXEA 2XRFA 5J1TB 3KTOA 3TWWA 2LIPA 3ZCUA 4DSAA 1V5IA 5BV0A 4LMPA 3KLPX 2IU1A 1Y7LA 2DBQA 2E4UA 2IYWA 3PXDA 3QKUA 1GOTA 3ABOB 1BEEA 1WUYA 1PX0A 4L1BA 5JS1A 2VAWA 3TXAA 2V1UA 2R1TA 1QM5A 3R74A 3VNBA 3HPRA 2JAUA 2QLBA 2H1WA 4ZOBA 1QLHA 5EMLA 4NYMR 2CNLA 4NEHB 1RXYA 3K6SA 4FFBA 3ZNGA 1XJ5A 4BNDB 1U7OA 3L6RA 1WQ4A 3AOEA 1SCUB 2BF4A 1E5LA 1ZIPA 4FWTA 2WWXA 5IYZF 1SBTA 1JEAA 3MILA 2B36A 3L82A 3EGOA 1NAHA 2IU0A 3FIJA 3N2EA 4V1CI 3WGYA 2PNJA 3TBKA 3W0LB 4CL8A 1HFEL 2NACA 2ODAA 3C7AA 5LU8A 1PNTA 4CR6A 3FOZA 1YB2A 1BHSA 1YRYE 2DWUA 1IN4A 2JJ8A 1BDJA 4OQMA 1Q15A 2BZGA 2ZTUA 2IITA 4ZOAA 4KGZA 4X0EA 2PL2A 4DILA 1JSRA 5AARA 2R5SA 2QL6A 1QYRA 1JT9A 1GPMA 2HMUA 2RGXA 4XSGA 3UMYA 4L27A 5HXAA 1IXVA 5BPFA 3K15A 2Y99A 1ENZA 2V9PA 1KEZA 1IHUA 3ND6A 4V0KA 2BUBA 2PM8A 1HDEA 2HO4A 5ELMA 4EY6A 3LDHA 3R7FA 3K0EA 1DUIA 3VZCA 4MAAA 3KQQA 2MYTA 1Q0RA 2H1FA 3NCHA 5AVXA 4QXQA 3T0FA 4LBVA 3GJ7A 4BVBA 5COQA 3M5WA 2KB0A 4ZT2A 3PRZA 1JSCA 5F1YA 1N6OA 1JYSA 3O0DA 5D84A 3DXMG 1SKAA 1QHNA 5K6AA 3L6AA 2HSGA 3KHTA 4WZZA 5AOAA 4I1OB 2CDCA 2X6KA 3E0XA 4RF3A 2ZAIA 3G2VA 3WXBA 2RHBA 3MJTA 3TFOA 5AUQA 3TWOA 1KDTA 1IDOA 5SV2A 4D46A 2ZANA 4LV8B 2DWZA 3V6MA 2FR8C 4Y9DA 1DOHA 1WDKA 3LUDA 1O9HA 4EG4A 1E3EA 4BKUA 4RFSA 4TXMA 5HR5A 2X0NA 2RE8A 2BTOA 2IYRA 1VSVA 3FUIA 1QANA 3OEWA 1NNI1 1XT6A 4AJJA 2G1AA 3L01A 3OM8A 2CN1A 3Q75A 2FUEA 1JLLB 2W6PA 3E2IA 2VXBA 4RBNA 5EJ4A 3LK6A 4YROA 1Z15A 3NG1A 2QR3A 3ZWAA 1JHOA 3GXBA 1LX7A 3ANNA 4PICA 2CGEA 5JAUA 2R2GA 5IJ9A 2BGGA 4FS8A 1WCYA 4IRXA 2WM2A 2IV2X 2AXPA 3Q3HA 5FINA 2IYTA 3F8SA 1HX7A 2AMFA 2NZWA 4CMIA 1CQZA 3OFSA 3RE1A 4IIHA 1EE9A 1MA0A 2O54A 5EESA 3DZ8A 3K9CA 4E5PA 1WEHA 1AGYA 4LHZA 1W44A 3K4PA 2QL7A 2XYHA 4DZZA 3BDAA 4HAZA 2JKZA 3SLKA 1EI9A 3D8BA 2DQKA 4GEKA 4R98A 2CHGA 1TJYA 2HHHB 1NVMB 1HOTA 3T7JA 3WGVA 1E63A 5DBGA 1OFVA 3U49A 4RTQA 4JNKA 5AKKA 4GBED 2CXUA 4HVTA 4LC0A 3TUIC 3TOXA 4G36A 4WAFA 2DBZA 4ZI3A 4EHMA 4CTNA 2QJRA 5HKKA 3MWEB 2Q2QA 3CUSA 4IGFA 2W93A 2WPNA 5JSZA 1S2LA 3SS8A 1XNJA 3D54D 4ZC1A 5IAGA 3C5VA 3CH5A 4BAGA 2AW5A 2PQMA 1VL1A 4G56A 2WOOA 3QHPA 4JB0A 1QMPA 2HJGA 1YZVA 3C3WA 2GK6A 3OJFA 3WISA 4RTMA 2F8YA 5HZKA 2GK4A 4JYBA 1NY6A 1GUZA 4Z0TA 3WVNA 2PUTA 3P0EA 4AZ3B 1T36B 5TIIA 4L5BA 2YINC 3LPAA 1P74A 1E2PA 1FRQA 2VTBA 3NHMA 3LBIA 1ZWLA 3UKUG 2WTBA 3NYRA 4RHXA 2BFEA 1JBQA 1AXEA 5KZMB 3COVA 1YJXA 1SUFA 1R88A 2Y0DA 4GNKA 1T1RA 1PYDA 2GRLA 5CLJA 5BSTA 5GVSA 1E9EA 2C57A 1KWKA 1IB6A 2B99A 1I2ZA 2C1EA 4NBUA 3C4JA 821PA 2UV8A 3EARA 3VX3A 4DCTA 2QVGA 3WY9A 5K8VA 2X8LA 2QUHA 2RGAA 2KBXA 2P9ZA 4LRXA 5F78A 3GLQA 5GAJA 3VHXB 3QQ5A 3BM5A 5GJWC 4PPQA 3BTSA 2Q9AA 3G2QA 3B9QA 4NU8X 4D2IA 2OD7A 1VJTA 1ZQ9A 2B6CA 4RMNA 3NTXA 2OKCA 5ARBA 1P8JA 2XZDG 3WNZA 2H18A 2XNJA 4A36A 3L7KA 3ML1A 5JCZA 2X5XA 2W0MA 4YCLA 2UYCA 3GHHA 3X2EA 3F7NA 3SHFA 3QE2A 1EFPB 3O3MB 2VAMA 4ZAZA 3DBOB 5KYGA 3BIFA 4AXXA 1X8LA 2WVHA 2C96A 4MIOA 2NZJA 4BGIA 4D9BA 3TR6A 3HMQA 1AHHA 4QYTA 5EERA 2WD8A 2E5FA 3RGWS 5IRCD 1KRXA 1L5MA 3LJ3A 3RO2A 8AT1A 1G2OA 3PT5A 1K92A 5K3OA 1LVHA 2OV6A 2H7VA 1OX6A 4U5XA 3DE7X 1FP4A 4AUNA 3D8UA 4CKCA 3EGIA 1ONBA 3IPRA 3GLIB 1Q3TA 4UHCA 1J7JA 1A04A 1V5WA 5D1NA 2O48X 4W1PA 3O8OA 3DV9A 5DP2A 3R7BA 3DZFA 2HIAA 4A3TA 2JI6A 1Y37A 4WACA 1I1NA 1Z2PX 3P26A 4DUZB 3PDUA 4AULA 3ZBUA 1IMJA 2GHQA 3NJRA 4D3DA 1VKRA 2H6IA 4DV7B 3NHJA 2WPDD 2H16A 4Z9YA 3A6JA 3W5AA 3AMVA 4JOSA 3CGHA 1SZJG 4FZVA 1CUFA 3PUYA 5ENOD 3AM3A 3HKEA 3T9CA 1FT1A 5BOSB 2PBFA 2I8LA 3ADCA 3WLAA 1PQ4A 2KHZA 1DKRA 5FQNA 4P08A 2CCKA 5DGHA 4FDVA 5IK2A 3OVMA 3O74A 2C7PA 1R6XA 1UN8A 2ZUUA 2OQRA 4LJ9A 1KR2A 2AFIA 3L6CA 4FNAA 4NR0A 5CJPA 3SBOA 4BU0A 3HA7A 3H04A 3LLVA 5A9RA 5ERYA 1AKVA 3AEYA 5D1HA 4WCFA 4A55A 3PK0A 4C7XA 4QVGA 3VNSA 1X0VA 2X6IA 4IS2A 4IDOA 4ETMA 2EKQA 4UTNA 5K2MA 3ZXYA 5I4IA 4PSKA 1FSPA 3UK2A 2UYOA 5JBIA 2R751 4BZWA 2QTVA 3BUSA 3NHSA 2WTAA 1O9BA 4KVGA 1POWA 3G3EA 4FB5A 2R6FA 2C2WA 1VG9B 4X62B 4FMDF 1LPBB 1OCOE 4KB5A 4OJNA 4LJ8A 3GJ4A 4BBZA 1ZAYA 3VDNB 4L57A 4E13A 5A1JA 5L3VA 2PQ6A 4EK9A 1PZMA 5HP4A 2SCUA 3I3OA 4XEHA 4Q9JA 2QNIA 3UCEA 4DQ0A 2YNMC 3AWDA 1DAHA 2BISA 4Y2RA 5EHIA 3Q6NA 1TK2A 4MYDA 4K2AA 2Y1FA 1YACA 4RETA 3FVWA 4LSGA 3D8NA 3IUQA 1ID8A 4AKSA 4BUCA 1GT6A 4UC0A 3ST7A 3I2IA 1TM3E 4ASUD 3GN1A 1KI6B 1UJ5A 2F3TA 4X93A 3WGKA 1DAIA 3TWSA 5C8XA 3BHMA 2HXGA 1VDMA 2LDBA 4GTTA 3RVLA 4MLPA 4JASB 1U5BB 5H59A 5K8CA 1LNZA 2BDEA 3ZJUA 2AFHE 1JFTA 3FU3A 5FQ7A 1G5PA 2RIRA 3CLTC 5AHWA 1E8DA 3IUBA 4IXWA 3OX4A 2VZ8A 4MVXA 4X90A 4EI7A 5FOQA 1YGYA 1SOUA 4YDSA 2Q5IA 2V0CA 2H29A 1N9AA 1VPWA 4WFJA 2PT7A 2R1TB 4GZ5A 1NE7A 1DDOA 1KAEA 2XEHA 2O8CA 2XA9A 3HXFA 4TT3D 2ZPTX 4DV6B 1CVLA 4XUCA 4QXAA 2C3YA 4YO7A 5HK8A 1LS6A 4FFBB 3IPCA 4CDNA 1K2WA 3I5XA 5H81A 2F37A 4BX9A 1C50A 3HR8A 1KAOA 2GUGA 1RR6A 3TIGA 3L82B 2EJWA 4A1SA 1HDXA 1OAAA 3UWKA 1QH1A 3IA7A 3FFBA 5KB3A 5JUWA 4ZEOA 2GYYA 5CR9A 3UWMA 3VR2D 5T7BA 3TPZA 2KJQA 1ZITA 2FCAA 3PD7A 4HDQB 4GVPA 4MGYR 4N5HX 4S1VA 3E9YA 3I4CA 3A26A 3L7NA 4YK7A 2BR3A 2VS1A 1SBCA 1ZUHA 2DBRA 3DXZA 4L72A 4BLVA 4PG5A 5HF6A 2CLOB 4KTVE 3ESKA 3WSWA 5T6MA 1N2XA 3WG9A 5ENRD 3U7QA 2D5AA 3KSZO 5FWDA 2PYZA 2C5GA 4M3OA 4OXXA 4H35A 4DCCA 1WPRA 3PC2A 1V35A 2B82A 2W58A 2FSHA 2IHKA 4EGFA 1JYEA 3H7IA 2J48A 4EENA 2HJHA 5H3CA 4B09A 4PTZA 4FW9A 4MA0A 5ALPA 2C9CA 4LEUA 5CB0A 1HQCA 3LA6A 4P54A 2IU4A 3R8CA 3L8EA 2BFCA 4AJ2A 5HMLA 1NZJA 4DF3A 3G5UA 2MYOA 5LP6B 4TZTA 4XIJA 4F12A 1W94A 4M87A 1Z0SA 4D8WA 3BD7A 1LZKA 5C53B 1W2WB 5T57A 4OBEA 2QAGB 3KQPA 1IM8A 4RY8A 2GN8A 1H69A 3DBRA 3QOYA 3DTYA 4Q1VA 1NXSA 4G1CA 3P19A 4E32A 3NUZA 3PDHA 4C0XA 2UXCB 1BDIA 1X1AA 4G8CA 3FWVA 4NABA 3E3OA 1DX6A 1JDBC 1FQWA 3HGMA 3ZX4A 3P45A 2F00A 4PYMA 3WGMA 1KIMA 1CF2O 3OZXA 1QMOE 1E4EB 2JGRA 4Y2XA 4RPGA 4RFSB 3D2CA 3R5JA 1U2VG 5IANA 4O4LF 5IC6A 3K0CA 2FSVA 4HLUC 3T4PA 1T8WA 2CK3D 2CF5A 1ODKA 4AV7A 2J41A 5DYWA 4C3OB 3O6VA 2E4YA 4Z4IA 3SI5A 2FFBA 5DCUA 1C7FA 1F06A 2Q9CA 3GPIA 3A9UA 1DJOA 2OV2A 4F4IA 4WLNA 2YFKA 2ZB3A 3A1CA 5IJ9B 2C95A 3BGIA 4N3GA 1T2UA 3QARA 4YCSA 1IY1A 1U2SA 1NF9A 3K53A 5AT1A 2IP1A 1A9RA 3N2IA 3PNQA 1FDTA 3FM9A 2ID9A 3OC6A 3ROXA 1YO6A 2EP5A 4NE7A 4CMIB 3GJ0A 4D45A 2P9HA 3H2IA 5JS6A 1JFFA 3DL4A 4GTVA 4Q3EA 3JD1A 3HKDB 5GADl 1SIUA 3WNBA 1SQ0A 4UMEA 4C88A 3RFXA 3C8MA 4L6IA 3V1YA 3G0BA 3RJZA 3MYRA 2I9PA 4A2WA 2GQ0A 3H99A 4JZYA 4PR0A 4HRVA 4LOJA 2C4NA 2VSQA 3MF4A 2WRZA 2ZTHA 2FU5C 3KB2A 5EJEA 5AI0A 2Q5EA 4WXYB 2V3VA 4EBAG 3WG7E 3DO6A 2Z5LA 4EHBA 5JSZB 4O8ZA 2NZUG 4F6CA 1UKVY 2AG6A 1T0JB 3CN9A 4OQPA 2QGFA 1E6MA 3K8ZA 4QYXA 4MINA 3RWBA 3F74A 1P9NA 1ZU2A 1XCGB 1L5SA 3OE7D 1TK3A 3FROA 5JFTA 2OUIA 1RS0A 3RYHA 3GDHA 5LU9A 2IEJA 3FTQA 5ARCA 3DBSA 1BN6A 4ZAWA 3LPLA 1JQ3A 4TZ0A 2V8BA 1CDZA 2AXEA 5C7IO 1UMBA 2O2JA 3JZFA 4K6KA 4GF5A 2ZUCA 2QXUA 4WZAA 3U4DA 3X2SA 2G4LA 3EWNA 1B0PA 3V4OA 4DMCA 4OQ4A 4UDYX 2VTBB 5JNLA 1UL1X 3D6JA 3RK1A 1FYXA 3SM3A 4HRNA 2AA3A 2C58A 1PFWA 3H1PA 4C4AA 1HUQA 4XDHA 4GMGA 5M2QA 1EINA 4JB8A 4DLYA 3EIUA 1SU8A 4LEIA 1CG6A 1NKSA 3COJA 1OFUX 5E95A 2GZ2A 4FCCA 3IKOB 1RQPA 4G63A 3L8MA 3OLYA 1N5JA 3KETA 1JJAA 3UXHA 2WXOA 3AEUA 1V26A 4HPXB 1BKYA 1A8SA 4LUNU 2GGFA 2WF9A 4ZMBA 1EM6A 2CMHA 1VJ1A 4B33A 1NQAO 3S3TA 3U3JA 5G0WA 3CQCB 3AG2E 3K9HA 2JG3A 4ZVLA 5AM4A 4X6LA 5FXMA 4G24A 1ZH8A 3CF6R 4CL3A 3LUJA 1ML3A 1OBCA 4JD5A 1HDGO 5SZKB 4DIFA 1OVGA 3W8EA 4J16C 4GYOA 5ANRA 1P2SA 4AVXA 3DXXA 5TEVA 3SJBA 4BP9A 2XUFA 2XYRA 4F45A 3T4EA 3F4BA 5LQUA 5G1OA 4IIFA 3WGZA 2XCQA 2C82A 1AKYA 2WKPA 5KSWB 3PGXA 3OM0A 2WPDA 3D6MA 3VLFA 4HI8A 1FFHA 2VJOA 4II2A 3ELBA 3FX2A 2O5CA 4AJWA 4YAUA 2X9LA 1SVSA 2B35A 3QWVA 2CLEB 2VDLB 4OKNA 4ZI7F 2WIDA 2PKQP 1C3LA 2I7XA 2J6IA 3X2FA 1LXCA 3HXLA 1FP4B 1RTTA 3PUZA 4BNZA 2I9KA 2P40A 5LYYA 1FU8A 3AC0A 3L4JA 4TLDA 2WNIA 3DBIA 5CK4A 3HLTA 4LTNA 2B92A 1U2QA 1ZGGA 2FOIA 1K9SA 1U2GC 2H5LA 3WLMA 1Q0ZA 2JARA 2F8MA 4DSTA 4GZDA 3C7CB 1K0UA 1FTSA 2CL0X 2ZBQA 2MHCA 2ZYUX 2NUBA 4XJXA 2GHTA 2GRAA 3L5OA 1TQ8A 5CJ2A 5DISB 3C6YA 3ECCA 1TM5E 4E12A 4DI4A 3EGXA 2CVHA 4QECA 2NPFA 3VJRA 4G8LA 3ZJYA 3Q1KA 4OK3A 3SWWA 1R6DA 1AF4A 2CZCA 2HT6A 1XZDA 1FQJA 4Q9HA 3ZCVA 4FZ3A 3HDXA 1AC5A 1CR6A 2H1OA 3HKEB 1EFAA 4WXMA 1OASA 4GI3A 3PWZA 5CBNA 3KM0A 1FNBA 5AUNB 1H0HA 2XUOA 2P5TB 5ES4B 1PSZA 4D42A 1TNDA 5AQ9A 2WJVA 1YFLA 4TVBA 2AFIB 2DHQA 3A70A 4ERXA 4J1NA 1ZGHA 3QPWA 1LI7A 4MIYA 2ENUA 4WJZA 1Q0QA 1P77A 3CN7A 1QFSA 1DPFA 3BN3A 4RK0A 1UWVA 4ASUA 3AF2A 1T9HA 2CBZA 4MYRA 1KQNA 1Z17A 3OTNA 1VXOA 1PWXA 1ZLXA 3ODGA 4CTJA 3RAEC 4G2TA 3ELYA 2QTVB 5BSWA 4OOFA 4CG3A 2HSEA 2DFPA 1VB5A 4F5WA 2BTDA 1S4MA 1F1BA 1CY1A 3EPLA 4P4TA 3SBEA 2AD1A 2SCUB 1MQ9A 4LXIA 3MT7A 4YGYA 5DM2A 3WYCA 4HNUA 4O4LA 3STXA 5KQLA 4I4LA 4KPFC 4BO4A 2FLWA 3C4QA 5KEIA 2IO3C 2WXJA 2Z1MA 5E9QA 2DECA 4AJ9A 4B3FX 1N9GA 4KUGA 4MS1B 5KHLB 5FQ6A 2YV1A 4TT3A 4XFDA 5U9CA 4F92B 3K31A 3V3TA 1XMOB 4CMEC 1MFZA 3KSRA 4M37A 2NP6A 2YY5A 5DV9A 3GRVA 4H4EA 3MHTA 4RD0A 5IKEA 1GO2A 3VVMA 2HD4A 3NOXA 1A4UA 4B3DA 1U6JA 2NMVA 4XQEA 3FPFA 4K6FA 4N18A 3RNLA 3U81A 4HQKA 2BCJQ 4CNBA 4IDCA 1P1HA 4R5HA 2WWWA 3FFWA 3AM1A 1WF6A 1QLJA 3H2GA 3IP5A 3ABRB 1VZ2A 2ODQA 1OV6A 4JITA 5B4UA 2DH5A 3IP9A 4GOOD 3W6NA 3ETGA 4BNXA 3L7BA 5EJ9A 1NI1A 2PX8A 3V97A 1B6TA 2B1RA 1N7IA 3Q3GE 2NWQA 2VPYA 2FWPA 3JQ1A 2JLZA 1UPBA 3W8RA 3SE0A 3GVCA 4ZQGA 1GL9B 1SQFA 3OSUA 3MMSA 2H2HA 1SOWA 2H07A 3E0QA 4JYMA 1DFIA 2DPYA 3UT0A 1SUAA 4BNDA 1CPYA 4RGBA 3L02A 1WCIA 1U3GA 1SCUA 1T2DA 4P4LA 1QH1B 3QFTA 1Y1SA 3BG1B 4FR2A 4X3CA 2W98A 3PQEA 16PKA 5FBWB 4JLDA 3WBBA 2BC9A 4LDJA 1KZ1A 2C4HA 5BW4A 4NDZA 1U3UA 3UYKA 2FEZA 1W30A 2Y93A 1WMDA 4KQWA 3QHQA 3GFFA 1K8YB 4Q12A 4HYTA 3EIFA 1OXXK 2IXDA 2Y27A 2BI8A 2YIDA 1J07A 2FJBB 1WUTA 4HXEB 3RVPA 4QLAA 2G9ZA 2AJCA 4V0LA 4XA8A 4BCDA 2ONDA 2PH7A 1PJRA 3NBYC 4Z6KA 4MLZA 5TMEA 2ORWA 1JR3E 3N7UA 4Y6CA 3KYJB 2WUDA 3THOA 1QKJA 3EMKA 4Q82A 3WNCA 2DX7A 1KZHA 1EJ0A 3B89A 3HJRA 3H3FA 1QCDA 1N6NA 2AZXA 5FCDA 3EXHB 3N74A 3VAZA 3KU1A 2BFCB 5IH7A 5D66A 4D4MA 4M1YA 3UT5B 2O2SA 2GUWA 4NXNB 1RW2A 1KP2A 1ODFA 3RBXA 2CK3A 1TD9A 4UPDA 1DC2A 1ZUNB 2AWNA 3B1VA 5BT1A 1WP9A 3IQEA 1CNEA 4LHWA 1I3OA 2A35A 1YQ9A 3U3MA 1BVHA 1WSWA 1YCDA 3BJMA 2GXUA 1N11A 2VH1A 4I1OA 3LBAA 4X3OA 1AHNA 4Q9DA 3I8SA 1OGJA 4J1TC 1WCXA 1M6NA 3DVLA 4DMUB 3G2JA 3Q15C 1WQ1R 4DA4A 4HWTA 4XQ9A 3TQCA 3GUZA 5KWVA 3BC1A 2OC4A 4OYSA 3QVSA 3LWBA 3HM9A 3TXYA 1ZM4A 3LWZA 5FP0A 5K0BA 4LHSA 4JA2A 1RHUA 3O9VA 1YR1A 3RBZA 3VU8A 1T1EA 4ZI7A 1J21A 4ZTBA 4HGZA 1OYOA 2J46A 3CTPA 4MJ3A 5FUYA 4XLZA 2ZPAA 1E6EA 1KAGA 3MCTA 2AUMA 3R9WA 3PR1A 3VO8A 3B8EA 2B30A 4H31A 1A8HA 3TXNA 1JDUA 1ZGZA 2DYRE 4GICA 5EUQB 2IOQA 2C9YA 1NLZA 4AO6A 2NVOA 1JWGA 2O19A 4QARA 3IV0A 4PCLA 2Q21A 4ZVSA 1G8GA 4FFRA 4I1MA 1K9VF 3DAFA 3TW0A 1VCOA 1JFFB 3R6TA 2BMJA 5GV7A 1EDZA 5CVCA 1NA0A 1CQXA 4YJ3A 3BZBA 1KDOA 1K86A 4BB9A 2PMDA 1L9KA 5DHPA 3Q0EA 2WXQA 3PPXA 3PFKA 3E34A 4NDAA 1QONA 2GPBA 1W75A 1XQVA 2XWJI 1U11A 3C5CA 3BRWD 4LHEA 5JEEA 1DRWA 2QRHA 2HR2A 3V8PA 1OAKA 1BX3A 2XF2A 1OZGA 4NYJR 4WL0A 2AVNA 4L23A 4LHVA 4D96A 3QKSA 1EFUA 4J0JA 1T15A 2DG2A 3W7BA 2JJMA 1A98A 2H4FA 2I6HA 5FPPA 2Y1LA 1Z6GA 2ACWA 3KD3A 2KBEA 3Q3EA 4QHSA 3ER8A 3HVEA 1PGPA 1ECLA 3T9FA 1RIIA 1W5BA 5B3SE 3EMVA 4R8RA 5E0OA 3MWEA 1H2XA 3PA8A 1S0PA 4MUFA 3G9UA 3NOVA 2DZOA 1TYZA 1JNRB 4YBRA 2JD1A 2FPMA 4I5IA 5THXA 3RM3A 3RDPA 2RD2A 1KI4A 3SBXA 4LKRA 2O05A 3PGJA 4CN9A 1UMBB 3P2MA 2NT3A 4QPNA 3U19A 7MHTA 4WZAB 3ENNA 4FLEA 1VBNA 4L5JA 5DYGA 5H80A 4DMLA 2ENWA 3IQIX 2F43A 3KT8A 3UTMA 2OHIA 4M1QA 3PWSA 4AZ3A 3KFXA 3ZGZA 2EU8A 1ODTC 4J7WA 3DOFA 1YR2A 5DNVA 4JI7B 3F0TA 3UGQA 1WUIS 4EO4A 3Q2KA 2YVUA 4RZUA 3UH0A 3B1WA 3C8DA 1IBMB 1OROA 3UM2A 4JMLA 1ECJA 4K05A 3NH9A 3ERCA 4YUVA 3GVPA 2PIDA 3KWLA 1TAUA 4D6XA 5CFLA 5CVEA 3CA8A 1OA1A 3DC7A 3QH4A 5A3RA 3P4XA 1I6KA 4N5CA 1ZCFA 1SBZA 2CKMA 3HVKA 5LP6F 2HDWA 2MWMA 4MROA 2FF5A 3BWVA 1ZGBA 1Z63A 1WMFA 2X8BA 1AUVA 4OG2A 3DFFA 1SCKA 1WW2A 1LSUA 3KSUA 3I76A 2Q50A 2GWHA 2YRXA 4UUOA 4EPXA 1ADFA 1X86B 3QIVA 4EYOA 4WNGA 2VHTA 3WGOA 1T3TA 3VHXA 5J5AA 1MZCA 3OPXA 2QYTA 1OFUA 4IIXA 4V0QA 4NIKA 1QIGA 5ANRB 4LZPA 3N71A 1N2CA 3UMJA 3TDKA 3DB2A 4N5MA 3WGTA 3G0HA 4Q3NA 4YDYA 1JDTA 4NH4A 4HYQA 1EFPA 4LDQA 5BMOA 5KJ6A 2E7ZA 2B2CA 4RTJA 2QP9X 2J5QA 1I1OA 3BDIA 3IEVA 4GVLA 4ZQHA 2REQA 1VCIA 4H0CA 5KS2A 1CZRA 3E4BA 1D7AA 2OO3A 2G17A 1QB7A 4FJ2A 2BUGA 1AS2A 5K09A 3AJ9A 3ZW8A 1QOPB 2VHEA 4EAAA 5GJVC 5ALMA 5KPJA 1TKCA 5IAEA 4KX5A 4RPCA 4NXMB 3RVMA 2PZGA 3QFSA 5B55A 1HDIA 1JE1A 3D6UA 2XPYA 1RLUA 3F1LA 3V1LA 2GF0A 5AQ7A 1S96A 2GRQB 4OMUA 3O84A 1JIJA 2V97A 3F4LA 4FGLA 3EGXB 4A63B 3Q7TA 5DHFA 3LT4A 3TL5A 2HHCA 2WXHA 1X80A 1F3LA 4YASA 3RU9A 4J0CA 3HP7A 4UHHA 5G1NA 4MUMA 3C3KA 1TF7A 3ZS9A 2MYUA 4OM8A 3UIOC 5J23A 2OB2A 1SQ5A 4M0EA 1CUHA 4L75A 4DMGA 2XGSA 4LSZA 10MHA 5BOSA 2I2FA 1QO9A 2B3TA 1MC8A 1I01A 2DM6A 1I0ZA 5EVCA 3CHOA 5COBA 1SG9A 1RAHA 3DQZA 3DOJA 1YJQA 2MU1A 3Q7EA 4KAXA 1T9AA 1XPJA 4Z8XA 2Q1XA 3TWQA 5L7YA 5E38A 1OFGA 3WP0A 2H7XA 1ZM2A 4DZRA 2G08A 3AR8A 2EKDA 3OX3A 3C3BA 5DLPA 3B85A 3TSWA 1B89A 2VQ2A 2ILRA 1JG6A 5J63A 4GOJA 3C16C 4MRNA 1VLLA 2RCYA 4OYRA 3ZWYA 2IHUA 4QBIA 2QW0X 1TA0A 1S9HA 5H9VA 4FEEA 2XWQA 3AAAC 4O4LB 3KE9A 3D0KA 2DTXA 1J1IA 4UEWA 5HYVA 3CEAA 1PBTA 1RBYA 2AK3A 4M9CA 4FOOA 2FPIB 2J0QA 1P4JA 4WASA 1P61B 3T7DA 1F3OA 2F62A 4X65B 3MA5A 3T3OA 5DT9A 4MUNA 1ESMA 1X1RA 1A8IA 1KEPA 1Q1AA 4JJFA 5AIAA 4AN0A 4MARA 1Q7TA 4GMDA 1L5GB 4RH1A 2R6ZA 3M89A 2H3EA 3QKWA 1XZPA 4MHTA 1OH6A 2G1UA 1AQ6A 3EK2A 4TM7A 3OFKA 5AUOB 4IDHA 2OCYC 4NMMA 3TMYA 5C4GB 2UZIR 2Q5OA 3BZWA 1AZTA 1OXJA 1H2BA 3K05A 4BFRA 4QBHA 4U0ZA 2VNJA 4GMRA 1ZH2A 5J59A 4RH3A 3RHTA 5GP1A 1TZMA 3STTA 1ULBA 2FHSA 3OCXA 1L4LA 1YD7A 3VTXA 3PFHA 2FO1E 1R4AA 3NBMA 4QG3A 5ADWA 1U9YA 4ZCRA 1C3OA 4IQFA 2ZDHA 5JASA 1WKVA 1QHSA 1D4AA 3JQAD 2VAXA 1XI2A 4LE1A 1KJQA 3M4NA 2CFIA 2VYVD 1NQWA 4IJKA 1EXWA 3I5YA 4XGQA 3QUCA 1ZICA 3LWDA 5HCNA 3JRWA 1WCIB 4GAAA 1ZMTA 3AIOA 5BQXA 1QZZA 3ICPA 2V5FA 3E9ZA 1S8OA 3U39A 3LCJA 1NA3A 3SIRA 3KJQA 4RJLA 2BGLA 1Z83A 2QVYX 2RH9B 4N12A 1DRJA 3L7DA 4BBAA 3DT8A 4ARZA 3ZQJA 1ZJ5A 4JX9A 1Z3CA 4QBTA 3GFSA 3IMCA 4FUQA 4D79A 5DGCA 2OHJA 5CFPA 2DWCA 3F6RA 1LU9A 2DR2A 3M4ZA 1BSVA 3MOSA 4JQYA 4Q1AA 1RPJA 4M21A 4QDJA 1M75A 2H00A 1P7WA 5M29A 4Q93A 1EHIA 3RAJA 2XS1A 1O94D 4NZMA 1H5NA 5IXJA 1A7JA 1SEPA 1R66A 1RLIA 2NU8B 2FW0A 1NVTA 4FUTA 4X00A 2IVFA 4EKGA 4QDXA 5M72A 3DZCA 1Z5GA 3QOXA 2GX6A 4FFMA 2NV2B 1BJRE 1C9NA 3ED5A 1O54A 5AHKA 3I92A 3FVVA 2JFBA 1JXOA 4G4SP 4TV3A 4KPYA 1PK9A 2PSJA 2LCQA 3UJPA 3E2MA 1GZSA 1DFHA 5LP6A 4P84A 4BWYA 2WUVA 1NVVQ 2IH5A 2XBUA 3FMGA 4F85A 2XB8A 3RS9A 3UMBA 2O1XA 2HDNB 2GJAA 2VC2B 4XPZA 2ZDGA 1PW7A 3KAPA 2V96A 2QAGA 1SA0B 5HS0A 3SM9A 2ZRIA 2B98A 3RYFA 3Q78A 2LCFA 3QWPA 5IVPA 4QXPA 1L1RA 4DSOA 4B3JA 4I6JA 1XWFA 3WO1A 5JYBA 2C9ZA 1D2GA 4E7PA 1LJUA 2HU2A 4NZPA 3T3MB 4TN5A 1GTMA 2H52A 5CW1A 2NU9B 1HNWB 1SKBA 1E4EA 2AKYA 3VFDA 1DMSA 2ERCA 1QIFA 1VPVA 4RABA 2XX3A 3EIHA 2COEA 3LUBA 1R5BA 2NOAA 4JEMA 3R4CA 1WXGA 3SQXA 3AR4A 2RGGA 3INTA 3E81A 4QOGA 3RVOA 4EG1A 1I7PA 3ZD7A 4UVGA 3E3LA 2C59A 2GETA 3QUAA 2G72A 2Q2WA 4ZI7B 4YDEA 2BFBA 4DBVO 1DWOA 1XTSA 1U1IA 2I0FA 1TMOA 3VH2A 4ZGGA 4F4JA 5HZHA 1ZIYA 3ETNA 2YCBA 1V47A 3HSSA 1NOKA 2WF6A 3SEFA 4MGEA 3K1AA 1NM5C 1OH7A 3A6DA 1R0SA 3E4CA 4F97A 4APOA 3TRDA 5A02A 2JDIA 2P3LA 4WOPA 1MX3A 8ADHA 1O87A 1OAOC 2B0CA 1GPUA 4KK3A 3SXPA 4B1FA 5PNTA 1Z33A 1XVTA 2FNAA 4EYGA 3GVHA 4YJ3B 1C80A 4WADA 2R8EA 2R6GA 5DK6A 1YUMA 3VSAA 1ACMA 5EWJB 1JB9A 2VYND 2V4ZA 3V79K 3HKDA 4MWSA 3F73A 1P4RA 1DZ3A 1MJGA 3QKSB 3INRA 4JFRA 3ZYQA 4UQXA 4FNOA 1B23P 1MDBA 4UE2A 2GAAA 4M1EA 2NZXA 4I9NA 1SU7A 3ISTA 4ZYUA 4EZKA 4YDOA 1NX6A 3HVEB 3O38A 1QRDA 2F48A 1KK0A 2WHPA 1UBOS 3V7YA 5EYPB 1I4TD 4X5OA 5DMHA 3NTUA 4A27A 4I2NA 3OZIA 4PHHA 3MKRA 4BMVA 5INTA 3Q2IA 1XTVA 1IJFA 2BR4A 1TCUA 5DI3B 3KDSE 2XVMA 3AONB 3FGNA 1A76A 4J94A 5ALTA 2CL5A 2BRUA 1Y98A 2F43B 5BV2P 4HBZA 4K8OA 2GEDA 4I9FA 2UDPA 1OTYA 2ZSIA 3GWGA 4FS3A 3VM6A 3AFNA 1NVKA 1M5TA 3NT5A 3OH8A 1HTBA 1FC0A 2C3MA 2BDTA 4KXLA 4F60A 4EUNA 1T2AA 4D81A 2A2ZA 4UULA 4B85A 1GUYA 5LB2A 4K9DA 4LRTB 4F7AA 3UJ7A 3DVAA 3BE8A 1Y8RA 5D0QD 1XJCA 1IHYA 2FETA 3GPDG 3NOOA 4Y2HA 1LLCA 1ZBDA 3BFKA 1QCCA 2YWXA 1XVIA 3ZFWA 2ZXFA 2YYSA 1RVV1 2QA5A 4C06A 4C7MA 1QVWA 3VOBA 3VR6H 2A33A 4RD1A 4GPD1 4YAGA 1J09A 4PNZA 3TEFA 3QKTA 1IHPA 1ISRA 5AOXA 1ND5A 1J20A 2EP7A 2JLQA 1WWKA 2XITA 4MKRA 1L1FA 4HWGA 2C2BA 4DLTA 3AKCA 1RZVA 3QBJA 2ODEA 3GP8A 1SC1A 3ULQA 3NBNB 3CUTA 3A1NA 2IONA 2XHEA 5JXWA 3O2QB 4MKZA 4C0MA 1N2CB 4UTPA 4GO1A 3T5XA 4AX4A 5EJIA 1V39A 2RHMA 3AYXB 3H84A 3GUCA 4ENRA 3O75A 4GKKB 1A2OA 4ILGA 2B7CA 2XLBA 4UBKA 1U0LA 2QLJA 2H6FA 3ESDA 3C39A 3W2GA 2AL7A 2J8SD 2WUFA 3CH4B 4OUDA 4R7LA 4B3CA 3PI7A 5H7XA 2REQB 1GG9A 4JLJA 3QW4B 1XMPA 5L3QB 3A9SA 4CFYA 5F4BA 5GMOA 3BVPA 3LKUA 4BFTA 1TMYA 2ACKA 4OGKA 3W4IA 1F14A 2AFHA 1KH1A 2FUKA 3KXKA 1AD2A 1CUIA 2ODTX 4PSVA 5T4HA 1SZCA 1X7ZA 1P1FA 2ZGGA 2C2OA 1E6LA 4BFUA 3SZ7A 3DE6X 4I14A 3PR2B 2XB2A 3FZNA 1WQ3A 5HBRA 1HTWA 3DWFA 2W71A 3U4HA 1VJDA 4TWZA 1WL8A 2FI1A 1ECGA 3CRW1 2SNIE 2NADA 4AP2A 4F1JA 2X4GA 1X80B 4UFOA 2XCTB 2EJBA 1GCGA 1EXVA 3HB0A 4AS1A 4I5EA 2YC2C 1SQMA 3GUYA 4KLNA 2OCDA 2GM4A 3O3NB 1WXEA 3F90A 4EVQA 3IIKA 4KYIB 3OKCA 3G2UA 3A9CA 3SEQA 4BEBA 1NFIE 1JNXX 1JH9A 4EEXA 2JZOA 2VVTA 2XJ9A 3L77A 4HAWA 4FTWA 3CC8A 3HDTA 3TEJA 5EWMA 4KL8S 2XT6A 4F8EA 3IBSA 5BN5B 2PY6A 2BKLA 3NPMA 1GGVA 2ZRAA 3BU8A 5B1BE 3CSTA 3KWMA 1ESEA 2BSAA 2CJFA 1M2HA 4PX5A 1XZBA 3P0FA 4AF7A 2ZAYA 1A1SA 4QRDA 3A4YA 1I2CA 4Q1BA 1H1DA 4KQEA 1PZNA 2ZP1A 4POOA 2H85A 3WZMA 1V25A 4TV9B 3JZAA 3I6QA 3NU1A 3O4IA 5FBRB 2BM8A 5T3YA 1YQUA 2HPAA 3BA1A 4EJ6A 1X19A 5B3JA 2OBMA 4TM8A 2ASEA 1Z4QA 4N5NA 2NVUA 2X5NA 4MNTA 4C05A 2ZUEA 3N5KA 1DQPA 1PTKA 1ZEMA 3OCUA 3PZ3A 3C3OA 2O9JA 4S05A 1ZG3A 1CEEA 3HY6A 3CKKA 4NQRA 3B38A 4IFTA 4DR2B 4RVBA 3PCXA 1A9PA 3ASVA 5BXYA 3SF4A 1QP8A 1SIBE 5EQDA 2ZW9A 1RE0A 4CF7A 3HY3A 3EXIA 2XMGA 4B7AA 1E2LA 3JQAA 3DCNA 4FCVA 3AZPA 3EWIA 1UK8A 4MS1A 4GPZA 3R9AB 3Q9NC 3KXIA 1UK7A 4BY6A 2ZKLA 4ZAYA 3C3JA 4HWPA 3LC7O 3C70A 2HW8A 2VK4A 4YV1A 2G63A 3TRKA 4KODA 4BBJA 1ULZA 5FHQA 1Q50A 2HU7A 3KAEA 1LQ2A 3HN2A 2V8OA 3THXA 1CNMA 1HG5A 1KS9A 4J0EA 4D6YA 5AK6A 2YN4A 2O2HA 1EUCA 1E9RA 2FQYA 2I8CA 4N3CA 2PZAA 4MP8A 1F0YA 3MUEA 4K6CA 3HFSA 5D3KA 2ILVA 1H8ED 2GK7A 4ED9A 3WK8A 1C3OB 2KM1A 3L0SA 4X1KA 4HH3C 1U9IA 2X41A 1FW6A 1PG0A 2O3UA 2LR0A 4Y9UA 5IBRA 2FPGA 2FDCA 1UPFA 4OFWA 2QDKA 5GIOE 3SR4A 1BE0A 3G2HA 2PM6A 4OHMA 1TAQA 4KH0A 3TTVA 3SIWA 3CRRA 4ALIA 1W4AA 3EA5A 4CF3A 5CAEB 2QI9C 1L8XA 2RGRA 1BKSB 5ENVA 3RJ5A 3NUQA 5AW2A 4PHGA 4RVOA 1ZW1A 2XCLA 5BVGB 1OGIA 2Y92A 4QATA 3W8NA 4WKOA 1T5DX 4ARZB 3FTYA 4A0GA 2VOEA 3QY9A 2GAFA 1ZWKA 3EFBA 3EUFA 3HG7A 4LDZA 3CKYA 5T3RA 4US0R 2BI7A 4LTDA 3AB8A 1X0XA 4RSMA 4QUEA 4I4CA 3KQMA 2NIPA 1CP3A 3MYYA 3ZNPA 4HNTA 4JI1B 5KQMA 2HMAA 1U0RA 4V2UA 5JS7A 2W2VA 1ZHFA 2CMFA 4UYJA 5DW3A 3B12A 2GZ3A 5ERGB 2PUWA 3PTAA 2JFFA 5CURA 4MXDA 3WAGA 4CKWA 2R62A 4ARAA 4MV7A 3EXHA 4MB0A 3UAXA 1UQTA 2VDQB 4QBFA 4OLHA 3EPRA 1R16A 3PFBA 1T1GA 2PPVA 1MO6A 2LVBA 3RTCA 4MOWA 1GGNA 4B44A 2CWDA 1RPTA 2FZ4A 2PGLA 4F8JA 1JPLA 3UT5A 5AK3A 4P9NA 4M0PA 1RZRD 4QSHA 4MQ4A 5C5DA 5BT8A 4XPIA 4GOXA 5BQ5A 3VKGA 2R02A 3KKOA 3RYFB 1ZUNA 4B8WA 2AN1A 2QQ5A 2ZB7A 1ISGA 3C2QA 3QSYA 4YVOA 1WMSA 4B73A 2APJA 4XQGA 4NX2A 1FTYA 5I5GA 5KSPA 5JZ9A 1FUYB 1T4CB 3ROPA 5KDOA 3CNLA 5HQ3A 3T4UA 3EW9A 2HMSA 2VJAA 1RTKA 4Q4AA 1CCWA 4MV5A 2XRYA 5SZJA 4N48A 2GJ8A 1O7JA 3IBYA 1YBVA 2X19A 4MEJA 2GYWA 2QW1A 2VPIA 5AH0A 2ZYVX 4GQBA 3ZVLA 2P0YA 1JUDA 1J39A 4M7RA 1T8TA 2VYNA 2VDKB 5FEMA 2BFBB 3I23A 2PR2A 1DIHA 5KYXA 5FOWA 4IYPA 3BHNA 3WYFA 5BV7A 3D4OA 4A5SA 1TN6A 3LGAA 2QSJA 1KRHA 3KWFA 4I1UA 2F1OA 1VPTA 2AI2A 4KQGA 4C3UA 1TZKA 1FRVA 5F2KA 3K1AB 2O2XA 2VP6A 2QOEA 4YLEA 4AJ4A 2WXKA 3PXGA 4EI9A 5HVNA 1Z8FA 1KO4A 3PEEA 2EJTA 2WXIA 3HLKA 3HDHA 4DI3A 4IHJA 4P3XA 4PYLA 4L8WB 1AF7A 3PDJA 1NZNA 4Z7NB 1W48A 3URKA 2C7BA 3C1AA 3KD7A 4HLDA 3PXUA 1WB6A 3VGJA 4M36A 4ENPA 1DL5A 3K7EA 1SD1A 5D2MC 1Q17A 3PPWA 2OHGA 2FLKA 1RJFA 2XQ0A 2X1MA 1S0UA 4M7PA 3ZQKA 4US2R 1P91A 5LKAA 3K70C 2GA9A 1TL7C 5JFOA 4PVCA 5HFNA 2BBOA 4O1HA 5BP7A 3AI2A 4QTXA 3PS9A 3DV2A 1M2VB 3QBDA 1A5AB 2RGDA 5C80A 4ZALA 3PX7A 2EBUA 1FNNA 3RTAA 3CSFA 2XD4A 4HUQB 4PGAA 1Z0UA 4IUYA 2WHPB 4M99A 1JCQA 4XRRA 4WWPA 2JEYA 1NUHA 4Z4QA 3KXLA 2E85A 1Z56C 3G7UA 1CUSA 1CV2A 4EPWA 2RJOA 4EY4A 3CX7A 3ZK8A 3NBUA 1IIBA 3NVMB 1EYZA 4EW3A 4QL3A 3M8KA 4V0OA 4TMZA 3SKVA 2PUVA 4LE0A 3MCAA 1VIAA 3MFYA 3BJRA 3GW4A 1DADA 1Q7EA 3I28A 1BWRA 1E8YA 2VQ3A 4PRYA 3WLQA 4EJ2A 5LQRA 1IXRC 4ROSA 1CY4A 4X7MA 2FHPA 3FPHA 2FK7A 4O4JB 1Q1ZA 1GSIA 5B58T 2HMTA 1O95C 1OT8A 1Z5WA 1JKMA 2VL7A 2ZQZA 2JHGA 3ZWPA 1G20E 3N9IA 5F9MA 2IKSA 1NFRA 4P5DA 3OZEA 1FFWA 4PIMA 4Q1EA 2OCPA 1NN1A 2BM0A 3L9TA 3DVAB 2F6RA 1D9ZA 1Y8RB 4WQMA 2YYZA 1IXZA 2BYTA 1KFBB 4WWHA 2IEZA 5LNK6 1OXMA 4DMKA 2IZ0A 4N6NA 3RYCB 2PUJA 1ODJA 2CZQA 3T1HB 1V5FA 5K3SA 1QGYA 1N3IA 5AOXB 1XK7A 1C81A 1GIAA 3DL7A 4YRMA 5HA5A 4B6QA 1J06A 2VCYA 3FNQA 1ZNQO 4A03A 1NKVA 3UANA 4DA7A 3JQFC 3NAZA 1QH0A 1A17A 1VKNA 5FUVA 1F5SA 1Y1LA 2B4QA 2BP7A 4N0EA 1NL3A 4H0FA 2M1XA 4GH5A 4GCOA 4F9GA 3JARA 1RWWA 3QJZA 4QAJA 4RAQA 1V54E 5CMWA 4ALKA 2VWGA 1P7VA 2P9LG 3IL2A 2IH4A 4UXHA 4YACA 2DBYA 3BRSA 3PXXA 3FNIA 5IUKC 4OUDB 2BHRA 4ZO6A 4Q5IA 2BWJA 2YKGA 3W05A 2QY7A 3ANYB 1SC6A 4URWR 5KQPA 2AFHB 5SICE 3U3RA 3KCNA 1X7ZB 3O3OB 1OC2A 2XUJA 2F0YA 3ISJA 4O25A 1Y1TA 4LRYA 2C5SA 2JW5A 1JAHA 5AHOA 3JQGA 3MWKA 2C4TA 3R7NA 2A7QA 4LNAA 4NDNE 2HA7A 5H68A 5CLQA 1MB4A 2CLKB 3S7TA 3OWOA 3SC6A 1P3JA 4QDOA 4YJ3F 4Z54A 1QBGA 5BR7A 1QU2A 1XLTC 1NQUA 2CXRA 3L43A 5T4BA 5EKTA 2OOEA 2FX5A 4KIFA 2CLLB 3TTTA 1KDYA 1CFJA 3OKAA 3OFND 4X95A 2COUA 3KZCA 1S8AA 4OFXA 1JLHA 4FMBB 1XPUA 5EWMB 4CKBA 4RSYA 1IUNA 1YL5A 2X6TA 3IVRA 4AJPA 1BDBA 3NALA 4DT1B 1RYEA 2FUG1 4CLEA 3HVJA 2WKQA 4UHBA 3R3YA 2CHWA 4OAOA 4AF6A 1Q7CA 1AOXA 1R3DA 3GFBA 2XDYA 3HY4A 3R1IA 2QXYA 1D2RA 3PQ8A 5JBNA 2A0YA 2JATA 1KQGA 4ZQFA 5EYPF 1DBVO 2OBYA 2RI6A 5AVSA 1H4VB 1E60A 4GQIA 3QK0A 4KGXA 2E9SA 1O2DA 5JWRA 3G1UA 2L19A 1C5KA 5IZ4A 5YASA 1VG1A 4EGJA 4K9QA 1HE4A 3OPYA 1ZRHA 4OAPA 2GO1A 5FPTA 5JZVA 2Y4NA 2FSFA 2RKWA 2CLSA 4GM4A 4NP6A 5J40A 2NVUB 1G7RA 3L1HA 4L28A 1XDUA 1RRCA 4RLQA 3OPVA 1UJJA 1H8EA 1PS0A 3K73O 3P71T 5M5BA 5JNTA 1NI4A 3TLEA 3EXIB 3QB2A 4ZDIA 1UZLA 2FPIA 3JQAB 1DHRA 1WG8A 5EIOA 3TNDA 3AHHA 3FUEA 3FH7A 2ZYWX 1OH5A 1Q6YA 4HTAA 3GCDA 2Z1DA 2WICA 2MOWA 3U3OA 1LJLA 1P5HA 3B7PA 5HE8A 4HXIA 2PLNA 1QGDA 4EHJA 3G6KA 5AM0A 2J3DA 4OHPA 1BFUA 4RADA 2Z3WA 4YLGA 3NH6A 3AGPA 3NHWA 3TOVA 4A16A 1A5SB 4LMBA 3UT7A 4NJOA 5HF8A 4BEVA 3THXB 4ZJZA 2F3UA 5ICGA 1G98A 1HG0A 3VR2A 1EUCB 1V4BA 4OUKX 1AMOA 4EF4A 3WQRA 5TS2A 4EKDA 4DJDC 1TQ6A 1THGA 3SLRA 3ZWMA 2R8RA 3GFGA 3QJ5A 4TMKA 1KYYA 4OAQA 4EEZA 2H2FA 4X1KB 4DWWA 3PQ4A 2PJRA 4H3KB 3ORSA 2G04A 1QH9A 1KQOA 4L15A 2FPGB 3RTGA 1UPCA 2PSEA 2DOKA 4U4AA 4L0DA 3VHRA 4ZAVA 2JIRA 1YQGA 4C4RA 2QIPA 1OZAA 4KN9S 3O26A 4ZYWA 1CRQA 3ZYCA 4B82A 4G5HA 1DAPA 3QM1A 5C4IA 2H17A 3WMWA 3ICVA 1WXQA 4LY0A 1AO3A 1DSSG 3KYDA 2P11A 2XVZA 4Q3AA 3CR3A 4ZT6A 1ZVMA 5CYPA 2R6R1 4IWXA 4KR7A 5FI0B 3LHKA 1QGOA 4OHXA 2DPLA 2EIKE 5AIBA 4CW7A 2J6BA 4H3SA 4ICIA 3MSCA 4KXNA 4B0ZA 4WI1A 5UKDA 4CMKA 3Q6IA 2AG0A 1BS1A 3BB1A 4D6PA 3CEJA 1SXGA 2EFJA 4QGBA 2QNRA 3PWKA 3JVEA 4G5XA 4QUHA 5LZ4A 3BD6A 1X8KA 2G4CA 4UYJB 3V4SA 4MWZA 3TJRA 2GJSA 5JYEA 1FNDA 5C1OA 3HCOA 4R83A 4CKWB 3HFGA 4JYCA 1QIMA 1RHMA 2L2QA 2NU8A 1O0SA 4B79A 2WB2A 2QRMA 1KLXA 1SW6A 1Y81A 4W7IA 4XVQA 4GM1A 1X1DA 1CQPA 4EIWA 1G64A 3IOEA 2XNDD 3K5HA 3IAFA 1EVZA 1JV2B 3QPUA 1J4AA 1H0KA 3LF2A 2E82A 1E3DA 4XI9A 4XPIB 3PFCA 3W9SA 3Q3IA 2BBSA 3QNUA 1PTJC 2UY1A 3S1LA 1KFKB 3UJNA 3IUNA 2NQTA 4TL6A 2P90A 1G17A 1ONOA 1ZBQA 2IYLD 2ZLBA 2GAIA 2P27A 1VL0A 1SA0A 3C4VA 4MH0R 4JT9A 3UG6A 2HPHA 1YBAA 4MCJA 1I33A 4J4TA 1PJBA 4TV9F 4PXAA 2QORA 1BI8B 4DE5A 4ISCA 5HQ3B 4Q4AB 2I22A 3IB6A 1ABBA 3ZKAA 2AD5A 1EWTA 2X0KA 2DUJA 4GYYA 1O9GA 3BMOA 3O8RA 3G0IA 2RGNC 2PL1A 2NU9A 1VKZA 4PLGA 3TZHA 1Z8HA 3DHEA 1ZVQA 3AHEA 5CLFA 3TPFA 3ORHA 5KYXB 2AX4A 2PG3A 2Z4RA 2ZOSA 1XXLA 1RPNA 4M1ZA 5TEWA 2QX7A 5I8PA 3ILYA 4FGWA 4ND5A 3RVQA 3P4UA 5IC4A 2C0PA 3ZHBA 2H0RA 2DCMA 3ESRA 4P98A 4TL7A 5LCWC 3ASZA 3CU5A 1WO8A 5AW3A 2QYJA 1LQTA 5CDUA 2ZJOA 3IKVA 1NNEA 1YCHA 4WESA 4IHJB 3QIAA 4B3SB 1PJ4A 2MJLA 1MO5A 1JG4A 3OE7A 1W46A 3UMSA 2ZYSA 1Q21A 5B2ZA 2ACEA 4FI3F 3HZHA 3RIHA 3PNLB 3OLWA 1VYUA 1P1IA 1Z88A 3PHCA 4C7OB 4PCVA 1J22A 5LM3A 3GRRA 5EWJA 1P2GA 3ZW3A 2VK8A 5E1MA 5J4KA 1Z0KA 3EHRA 3AF3A 1CD5A 2QX6A 4UE6A 1OWLA 1GGMA 4JLUA 4MW0A 5IVIA 4Y6OA 1HLFA 3E5MA 2RARA 3OESA 1LFDB 4QYSA 1T9CA 3ORFA 1GQRA 2TS1A 4HOYA 2Z8ZA 4AWAA 1RLTA 2ZUWA 3AV0B 3CK7A 2FMIA 4BMNA 2D6FA 4MTCA 2PE5A 2XQJA 3R8XA 3PNBA 4M1OA 4Q9LA 1AKWA 1NQXA 5JXGA 1SKYE 4EYQA 1T8RA 4HATA 3EQ2A 2TYSB 5EYPA 3AXSA 3FKJA 3K09A 5H0IA 2D0PB 3JALB 4PC6A 3TZCA 3LWNA 3HB1A 4UCXA 5AKIA 1ZVKA 3LOPA 1EPUA 5DI3A 4PIPA 2QEQA 3H8WA 2ZRMA 4XWOA 4LXXA 5CA0F 3MC1A 2AK2A 3TKLA 1EFVA 5TGZA 4C14A 3ZE2B 5KVAA 2XZDA 1QX4A 4JNCA 4B31A 3ZKJA 2EATA 3JQCA 2HUNA 1WW8A 4KLRA 1VL2A 3DUWA 4E94A 4GI1A 4HJXA 3SQNA 1FDIA 1WB4A 1D2AA 1YMUA 3QPBA 1P44A 3FVQA 4KR3A 1HTTA 3OX1A 3QXGA 4DR7B 2CG2A 1YQDA 3P94A 4RA9A 5AJUA 4NLLA 5AVZA 4L8YA 5AW6A 4Z5XA 2PX5A 1EZZA 4L16A 5JI3E 4EGCB 2IOHA 2DVMA 1KI3A 1S64A 5ILOA 5IN4A 1HK7A 2DQYA 3LQKA 1ZNXA 4M9XA 4BC0A 2ZRJA 2AF3C 4ER3A 4GOLD 3VR6D 2POQX 2F1IA 1LLDA 3UAYA 2AE1A 3CB4A 5LD2C 3EZYA 2YZMA 1KQFA 1MO2A 1UCFA 4Z53A 4P31A 2Q7XA 4R8LA 4XX1A 1GP2A 2F4NA 1Z4OA 2BP7B 4H7KA 1J33A 2OCXA 4YQEA 3JARB 4R54A 1XCMA 1QKIA 4IJ5A 4MGZR 3FEXA 1I7QB 3OJXA 2IGBA 2ZSKA 4NMWA 1LSOA 1WVGA 4JELA 5KCZA 4PPFA 3LUAA 1I4DD 1SKUA 2DLNA 1WY5A 3AIIA 3EDOA 5CT8A 4H1UA 3OFNA 4YY3B 4CM8A 4CQJA 1N3BA 3LY8A 2Z6UA 4FE3A 4FT4A 3MS2A 2Q5FA 4YXWD 3RVJA 3LT2A 4GA0A 1BWPA 4AUKA 5L3QA 1X9GA 5SY9A 1BU5A 1XF1A 4GTMA 1KK3A 3I04M 2Q9UA 2ERYA 4HOSA 2JKVA 1E1LA 3GBVA 1P4HA 5K8JB 3CV3A 4IRMA 3JQGB 3VOAA 1YJAA 1ZUWA 2E6KA 1OLXA 1W2HA 1W3BA 4F6RD 1T2CA 4LGVA 3DEFA 3WMRA 1AS0A 2PHZA 3HEBA 1FDRA 1VHLA 1TN8A 1YB5A 3QI7A 3CINA 5ITSA 4FYXA 2OT3B 1SCNE 3IV7A 4J6IA 3O1JC 3FMIA 1MA3A 1KAMA 1GM5A 3MFQA 3SC2A 4K5QA 5EE1A 4KI7A 1QZ2A 1XRRA 3R7AA 3EEYA 2H8KA 1PVOA 2C8LA 1ND6A 1NYLA 3DTTA 2YS7A 4CKBB 2YMPA 3DDOA 3CVYA 1V8DA 1SZAA 2Y0PA 3QNWA 1LF0A 2WP0A 5IM4F 3MZ0A 2EFYA 3F3SA 2E0IA 3GJYA 1Y5MA 4Q9IA 1YMVA 4XD2A 3SE7A 4FD2A 1N6IA 3ZOKA 1CJSA 1ST2A 1ZAKA 5BN5A 3GEIA 1XTIA 1G3MA 2JF0A 4GSYA 1Z6QA 5JISA 4MO2A 1IEVA 4ZANA 3FCXA 1FFEA 3EVNA 1VI2A 2HLPA 3EZ2A 4IUDS 4DIDA 5AOCA 2A1TR 4M86A 4ARUA 1GGFA 2ZTVA 4KZPA 2A5UA 3PF8A 3QYPA 3OPYB 1U8ZA 1W85B 1GDDA 3EVGA 4TV9A 4NENA 4PQYA 2HOQA 3SC4A 2D06A 2ISCA 2CVQA 2HAEA 1EZ4A 4IJMA 5DNEA 2RFAA 2Q5JA 4DLOA 3MAJA 5FPHA 1KNQA 3LTNC 3AG1E 2VF5X 3AHGA 4C5BA 4O4JF 2X9QA 1RYDA 2GRNB 3EIQA 1JR2A 4O1PA 4GU5A 5K0SA 2VTDA 4MV0A 3V1KA 2PO5A 4GPMA 1IDN1 4AMYA 4DGSA 4I8IA 1NI4B 3VYSB 3UQZA 4ZI2A 3RRJA 4AICA 1WXHA 1QRRA 5HIIA 3W6OA 2GPYA 5K3AA 2Y05A 1BD4A 2V7UA 2ATIA 1J2RA 3WWOA 3LX4A 5I7UA 4DNQA 4LE2A 3GCWA 1M1XB 4L8LA 5ECDA 1LC3A 4URKA 4HEQA 4RY2A 4B9EA 1E3JA 1FMLA 2GRRB 2O2CA 1BLXB 4YS6A 5TE9A 1QS0B 3I05A 4FR0A 1X3LA 3RKRA 4MDYA 1DEAA 3RO7A 2EJUA 1WXXA 3F71A 4CIYA 4P5EA 5AI5A 4YCJA 3AHIA 4NATA 3LQRA 4KNVA 4Q21A 4MP6A 1SPXA 3HN7A 3ORYA 5JARA 2HGZA 2VTEA 1HT3A 1KY5A 4ZFHA 4CCYA 3JQRA 2VUTA 5HG0A 1OUVA 5CNIA 2DHRA 2FW1A 1T2EA 4I81A 3H5LA 3RF6A 1AKUA 4XB2A 2OYRA 3WYDA 1TUEA 2JLRA 3OHSX 1XA0A 5JHAA 4PCUA 2PLWA 1WVIA 4HX9A 4F4CA 2IL1A 1SG0A 3I45A 3QU9A 3ZBQA 4DMFA 3K30A 1RABA 1YDHA 5HKLA 3KYDB 1LVUA 2J45A 5JNSA 5CA1A 4AJNA 2XR1A 3EGCA 3FTPA 1EX1A 1XNFA 5CAEA 3TOSA 2XNDA 1EVKA 2F9FA 3L0YA 4Z68A 4CCSA 3RAFC 3CIFA 1J25A 1UOOA 1YE5A 3O3CA 2PH5A 3MTDA 1IM5A 4JR0A 3WI7A 2XPCA 5BVGA 3AOGA 4K46A 4KQ9A 3AZQA 3MBIA 4TV8A 2VDVE 4XI0A 2AN3A 3VC2A 1BGWA 1YR6A 4A8JC 2A14A 4GZCA 3N1UA 2HUPA 1T5HX 5CA0A 4HQLA 4HLNA 4XOUA 4PZ0A 1U6KA 1XDSA 1HG2A 5TPWB 1PFUA 2D0OB 1KC1A 3BRCA 2AWOA 2V6IA 1C1DA 3GLUA 4TRJA 3K4QA 1KMIY 1NI5A 2A4KA 4M1WA 3OAWA 3CQGB 4UCWA 2JIMA 4CR8A 3SHQA 4K88A 3KXPA 3UUWA 1TA9A 3UUEA 2LUOA 5IMSA 1SXJC 4R81A 1PGQA 3NOCD 4KDEA 1ZK4A 5I9BA 5HM8A 3AEXA 3WBJA 3SX4A 3HV2A 4H60A 5BURA 1V5GA 2KWIA 5A2QA 4E14A 4ZVNA 4MPPA 2DUMA 2NM0A 2PV7A 2FX2A 2JFHA 1QK4A 2UY1B 1KERA 2WF8A 1MO4A 2P9JA 1AKEA 2I1KA 4ZRMA 1NULA 3LJKA 4RD2A 5I4KA 4HBDA 1ZM9A 4RDXA 2P3OA 1L7XA 3M1AA 3A2MA 4G8DA 4HFGA 3RR2A 1I6MA 1MB3A 3H9GA 2Q0SA 4JLBA 3P9CA 3AW9A 2Q6TA 1CJBA 4UAUA 1MT0A 4N0MA 1T4CA 1GRNA 2IZ7A 3BMOB 2YWBA 1SOAA 3I2GA 5CD9A 3MMNA 1M8GA 4KQ6A 5JE8A 2ZRDA 3QHAA 4KVFA 3IUMA 2O3RA 4FGJA 3L93A 2UZAA 2XZPA 2AZ4A 4L9WA 5COAA 4BQFA 3NEYA 1UP6A 4MV8A 4NL4H 4EBAA 4QM7A 3FPGA 1OUMA 1H42A 1GNPA 3BRWA 2HJSA 4ETIA 1NFQA 3LY7A 1AHIA 2B34A 3OZFA 4E4YA 1G3UA 1P3Y1 3GT3A 4K9OA 3KKQA 3TW8A 1DT3A 4PQRA 1NSFA 1Q77A 4BMOB 3WL7A 4NK5A 4BDSA 1LPOA 2IJGX 2OILA 4G86A 4QO8A 4WESB 2PUAA 1UBGA 3PUXA 5CW2A 5FLYA 2JAXA 5LQAA 2M63A 2J67A 3HQ4O 2V1XA 1N54A 5JCJD 3UCXA 4M9SA 4PC2A 1BH6A 3F2VA 4QFVA 3OG9A 3ZZ1A 4FNMA 4S1WA 3CV0A 5C1BA 4ENUA 2ZB8A 2I03A 5H5JA 2QYUA 1TT7A 2CB0A 3AVQA 4Y9RA 2B20A 1UOEA 5DWQA 2R1ZA 1M7HA 1JXQA 2VQ6A 3DFMA 5A0TA 1YSCA 4TYYA 4NAHA 2R8XA 1U1CA 1G2QA 1SXHA 3ELUA 1R5NA 4Y0NA 3EAQA 5AM2A 1XZNA 2WHEA 4FX5A 3KQNA 4PS3A 3W2EA 4IOJA 4M7OA 4TLAA 3DSSA 3D9OA 4YN3A 5IM4A 1M2VA 1ZJ4A 3G8DA 2GRUA 1EUYA 2JIPA 3DCIA 3G2NA 2Q3HA 1EEHA 1SCDA 3SS7X 4DDVA 1KZ4A 1MNQA 4HUQA 5F5NA 4X6YA 5TJ9A 1ENOA 4ZV9A 3W5JA 2PYIA 3ESXA 1LJ8A 1LTHR 1IB0A 4DA8A 2UUAB 4BWVA 1OWPA 1XRLA 1SBYA 3SAJA 2VDRB 4M8IA 4XYBA 4DLXA 3RQIA 4BQEA 2QZJA 4LOIA 3WBKA 1EK0A 3VR6A 3U1BA 1B6GA 1EFVB 1YT5A 3WFZA 2BEWA 2VQEB 1IKND 4LF8B 1FYFA 1OWMA 1DO2A 2ZBUA 3I9MA 1Y6RA 4IF4A 3BSSA 4NU5A 4E6HA 3ADOA 3PGVA 3B53X 5HCUA 4XTRA 3D4LA 1TAGA 5TVKA 4O4JA 3L07A 4GXTA 5E9JA 2JAOA 3HYTA 5BORA 4KAJA 3QPVA 4X1YA 3E22A 1P2UA 3PNTB 3WK9A 4RA9B 2Y1OA 3KUUA 1UKBA 1G8JA 3WX0A 1GLVA 3V2GA 2C77A 2Z2JA 3CJRA 3GR6A 2D1TA 2HRCA 3B3QA 1ATZA 1TECE 3ULEG 1GQOA 3PIDA 3Q9UA 1ZH0A 1P19A 5BW5A 4BNUA 5DGXA 4YXWA 4RF2A 5JFGA 1W5FA 4H17A 3RYCA 4CVNA 3NDIA 4QJ3A 3C8UA 1XEAA 3V42A 1AT1A 3QMVA 4N9QA 4YGXB 4AT1A 4AF8A 2O23A 4AS3A 3RG2A 1FUEA 2XMQA 1ZESA 3ZZ0A 3IH5A 1DKOA 2YWGA 1WX1A 4FOLA 4KXUA 5CFNA 5DBKA 3RUAA 4F6RA 4IEFB 5HFJA 4AURA 3OP4A 4CU2A 5HJEA 2B6NA 4Z0HO 4O1MA 3V8MA 1S2IA 5ABPA 1DRUA 3A6KA 1ZD4A 4BTEA 1ZMXA 5T8KC 3NFRA 1JYFA 5EVJA 1K5GA 4N2SA 2ZUBA 4KIWA 1UMKA 4MS4A 4AYWA 4V3BA 5FH9A 4CM8B 2AE2A 3QX3A 3KVRA 3HB7A 3AEZA 2WA2A 2OAGA 2F2TA 3W2FA 1NT2A 5ICSA 3S8YA 1RYNA 1GZ3A 4YMWA 1YH3A 3ADDA 2EBFX 1Y3FE 5K0NA 3OZDA 4QT0A 3JYNA 4YUZA 1OCZE 3OOEA 3FZGA 2R85A 1H6AA 3MJ4A 4E5VA 4LX0A 2JGNA 2JI4A 2I2AA 2WG0A 1KVRA 2GM3A 2EINE 4M8KA 3E37A 1OLXB 2C2LA 4MW5A 1SK9A 5E3IA 1CUDA 5CDHA 2ZJFA 2FDRA 3K1ZA 1P5JA 4IHJF 4WLOA 2P2ZA 3QOFA 3WIOA 3A4IA 5EMHA 5BRNA 4HI0E 4A8HA 4MPTA 1FTGA 3OTQA 5TT0A 2JD2A 3WHKA 3O2SB 4X91A 4KO3S 3O47A 1EVJA 5KVSA 3LGSA 1Y82A 1W0JD 2OWEA 2P2CP 1LBQA 1SXPA 2A1TS 2FR1A 5L7WA 2BN4A 3I6ZA 4C3ZA 3SC2B 3JRXA 1BMQA 2JS7A 3PGKA 4EPZA 1U2RA 1M2OB 2PD3A 1AZLA 4GIBA 1Q7RA 2V3WA 2BEKA 1V48A 4UNIA 3RWOA 1GGKA 4C6HA 3RV4A 3A6HA 2JHPA 4FU0A 2VBIA 3NAGA 1LD7A 4AQ7A 2JGDB 5D3MA 2B5OA 1TW3A 3L8CA 4DT1A 3U3KA 3R9XB 2QFCA 1RVDA 2BMAA 2Q4TA 4JW1A 5ALVA 1YWGO 2ZRQA 3V7UA