4XIFA

Human ogt in complex with udp-5s-glcnac and substrate peptide (keratin-7)
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
717
structure length
702
Chain Sequence
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The active site of O-GlcNAc transferase imposes constraints on substrate sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 268
structure length 702
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xifA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xifA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4xifA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4xifA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xifA03
2QRQA 3KD7A 2IEIA 2KC7A 2FBNA 1HXIA 3L7AA 3LKUA 3AS4A 3FFLA 2JZCA 3DZCA 4APOA 2F3QA 3CVNA 4G26A 2C0LA 1JIUA 4U0UA 3MTDA 3QWVA 4CTOA 5JTTA 3D0RA 3NAZA 4KQ1A 3T5TA 1NVKA 2R5SA 3ULQA 3C48A 8GPBA 2JJMA 2SKEA 3MV3B 3EBPA 3BDAA 2IV3A 3MBOA 2GM9A 3VUEA 3S7JA 2OOEA 3MTAA 4CDRA 3NC4A 3OKPA 2XEVA 3TG4A 1FTYA 2ACVA 3ASDA 4WADA 2WQHA 1P2BA 2C0MA 3RHZA 3GW4A 1KTIA 4MICA 3CEMA 2KCKA 1JG6A 3MRVA 3QWWA 2QLMA 4GPBA 5AYWD 1LWOA 1Z8DA 4GCNA 4RG6A 1ELWA 4CGWA 3WXXA 2VCHA 3SYRA 1ABBA 3RIBA 5EX0A 2QZSA 2KATA 3U4TA 3O3CA 2JLBA 2UY1B 3TG5A 1UZUA 5D01A 5EX3A 5KJKA 1L5SA 3OKCA 1NOJA 3Q3IA 3MS2A 2G9VA 2VGYA 3RT1A 3ESKA 3RU0A 2HY7A 3WAGA 4B94A 1WV0A 2XA9A 3OTHA 4I17A 1OUVA 1KT1A 1GFZA 2GPAA 3ZFWA 3AMVA 2BGTA 5TVGA 1NZNA 5FTPA 5JTUA 5TMDA 5FT9A 1L5RA 3G2IA 1B89A 4KYOB 3Q5MA 3NP7A 3Q3EA 1JIXA 4EKEA 3N71A 3NPAA 3UYLA 3Q47B 3TAXA 4WNGA 1GZ5A 1HZ4A 3OY7A 3ASGA 3FP3A 2R4UA 3CUWA 3DDSA 4FZRA 3S7FA 2X0EA 2ASVA 4F9FA 4F96A 2ZB2A 3BEEA 4NEQA 2FEZA 1Y8ZA 3S0JA 3CUUA 4WNEA 1YA0A 5M72A 4KQMA 2FI7A 4YVQC 1P4HA 4LDPA 4N9WA 3RSZA 1KLXA 1J39A 1L5QA 5DLDA 1P4JA 3TOVA 3GZ1A 2C2LA 4G25A 3CV0A 3RO2A 2P58C 4KXKB 4EL5A 2YJNA 4UQXA 3HBFA 2E2EA 9GPBA 5G04C 2QRMA 3ASHA 3BD8A 4N5CA 3E3NA 2X6RA 3NP9A 1P2DA 3ZHEA 4L22A 2PRIA 5DXFA 3T3HA 1F6DA 4XI0A 2HO1A 2R4TA 1Y6FA 1YGPA 4BWRA 3CUTA 2QLLA 4CTMA 4WUYA 4ABNA 3MV2B 4N2SA 1AXRA 1PYGA 2C9ZA 4JA9A 2GW1A 1WAO1 3CUYA 3Q3HA 4HWGA 3VUFA 3BCUA 3ZHEB 2FF4A 1L5WA 2H1FA 2VGXB 4N39A 4NQ0A 4W9RA 5FJYA 3H4IA 3G2JA 3S7BA 5GPBA 3BEOA 2XGOA 4FKZA 1SXQA 5A6CA 4EKYA 1XC7A 4EJ2A 3E3OA 2IW1A 5DIZA 1NA0A 2HR2A 3Q4AB 2GT1A 1IIRA 3G2NA 3COPA 2MHKA 3ASFA 3S7DA 1NZDA 4GA1A 1XL1A 4X7RA 1XL0A 1WM5A 4BTBA 4AIFA 2VGXA 5CCLA 3T3EA 2QRHA 4H7XA 1FC0A 5FZSA 1ZBPA 1Z62A 4AM9A 2FF5A 4N2QA 1A17A 2G9RA 3VTXA 3L01A 3OKAA 1GG8A 2IEGA 5G05C 5ARGA 3CEQA 1FTWA 3E3LA 3IA7A 1GPBA 5HQ8A 5BNWA 4RIFA 4NC9A 5ARFA 3GYZA 1BX3A 1P2GA 2R60A 1P5QA 2KCLA 2NC9A 3ZCSA 3CK9A 3MT9A 2XA1A 3PE3A 1K08A 2GEJA 4MRAA 1PSWA 3VDNB 2Y4UA 4LEUA 4HLNA 4M83A 1FA9A 3FROA 1XV5A 1Z6PA 4AMGA 4G1TA 3NF1A 4CGVA 3H4TA 4HOTA 1LWNA 2QFCA 2FO7A 2BFWA 3C4QA 2AZDA 3DD1A 4PQGA 4GCOA 3GZ2A 2VSNA 1WW2A 3L7BA 2OFFA 3CX4A 3SZ7A 3MRXA 2LSUA 3PDNA 4NESA 2ACWA 2PQNA 4N3AA 3UPVA 3VDMA 1F0KA 1C3JA 3S29A 2KCVA 4G23A 2BGUA 4UI9C 1H5UA 4A1SA 4I2ZA 1EM6A 4HOUA 3QHPA 4I1AA 4MI3A 3ZCVA 2O6LA 5IKPA 4JL0A 3C4VA 3ZGQA 4KQ2A 1QKJA 4JHRA 1Z6QA 4GZ6A 4MHOA 3ZCPA 2F3SA 2GPBA 2GEKA 4AY6A 3OTIA 4M60A 5ENZA 3R9AB 2Q7FA 3Q49B 1PN3A 5JJ6A 4Y6CA 1XKXA 3NB0A 3RO3A 3OTGA 5FZRA 2C4MA 4RIEA 4XI9A 3ZN3A 1NOKA 1WUYA 2C1ZA 5BW8C 5CCMA 4GZ3A 5LCWC 1PNVA 3CK8A 4H7YA 4CTNA 3QKYA 4X7MA 3S2UA 2IV7A 1GPYA 4BTAA 2PYDA 5D00A 3MTBA 3PE4A 1L6IA 2C1XA 3UUXA 5HI7A 1QM5A 3ZCTA 4BFCA 3QOUA 5HXAA 2R66A 2IYAA 2F3UA 3L7DA 2GPNA 4RENA 4F3VA 3OXFA 3TGOA 2XGSA 1C50A 5IKOA 3G2HA 1FTQA 4RG9A 2UY1A 2P6PA 2VCEA 4N3BA 4G2VA 2QLNA 4KBQA 5JJ7A 4QLBA 2R68A 3T7DA 1ELRA 2PL2A 3QWPA 2LSVA 3CKBA 3FWVA 4I2WA 1WV1A 1E4OA 4MI9A 3HYMB 3CK7A 2DBAA 2XCIA 3JYSA 1B4DA 1YA6A 1P29A 3MS4A 2QN1A 2F3PA 3BD7A 4U0ZA 7GPBA 2XCBA 2VG8A 2SKDA 4GYOA 1IXYA 1RRVA 3CEHA 4GYYA 1XOIA 1EXVA 1HLFA 1V4VA 3LY8A 2QN3A 3SYMA 4RIHA 2FETA 3BCRA 4J8EA 2QN9A 4GA2A 1L5VA 3LYAA 1GGNA 4RIGA 4UQZA 2WTXA 4J8DA 1JIVA 1PC2A 3O48A 3AS5A 4WNFA 2V5FA 3LPZA 5D0OD 4YVOA 3HBNA 5TMEA 4HOQA 4REMA 4AY5A 3DDWA 4I9CA 4WACA 2H1HA 2PYIA 4RIIA 2IF4A 5DU2A 3TSAA 4AMBA 3IEGA 3CVQA 4GZ5A 3CUVA 3MRTA 2Y4TA 4JA7A 3RSCA 1FU4A 1K06A 2XA2A 1FU8A 3QKWA 1KT0A 4MHSA 1SXPA 1FCHA 4WNDA 1RZUA 3CKCA 3T3GA 2F9FA 3MT8A 3KS2A 4RELA 2BUGA 3QDNA 5G04J 2ECPA 3CV3A 4U07A 3UQ3A 1FU7A 2X6QA 3WADA 5KJMA 4UQYA 2ATIA 4YNDA 2WPVA 3OXGA 5C1DA 3G2LA 4EL0A 4G2TA 4M7PA 1HH8A 4N3CA 5A7DB 4BQIA 3T3DA 2PRJA 2QNBA 2L6JA 2PQRA 4ME2A 3LY7A 1JG7A 4MI6A 5TMBA 2Q6VA 1NA3A 1P4GA 3GPBA 1UQUA 1XNFA 3OT5A 5CHEE 4GPKA 4X6LA 3ZPJA 1IYGA 4WHMA 4G24A 3MS7A 3LCAA 5KJLA 2QRGA 2X0DA 1Y6GA 3MA5A 2XCCA 3AS8A 1E1YA 3D1JA 1A8IA 1FS4A 3K9IA 4BQFA 4IN3B 5LCWJ 3L7CA 1VGVA 5BT1A 3G2KA 1NZFA 4F97A 5I45A 3VTYA 3URZA 1NLMA 1W3BA 2VYIA 2PQ6A 5JJTA 2PZIA 2J9QA 1E96B 5D0QD 4HOSA 4U04A 4J0UA 2IYFA 3BD6A 1QZ2A 1IHGA 3ZCRA 4Z5XA 4GYWA 4UI9K 4NRHB 2YHCA 1Y8MA 3ZCQA 3KAEA 2FFRA 1ZU2A 3RKVA 3BCSA 1AHPA 2I6HA 4EQFA 1NOIA 3SF4A 1M5RA 3Q15A 2X0FA 4BQEA 2QN2A 1C8KA 4AN4A 2QN7A 6GPBA 4O6FA 3CEJA 3L79A 3CVPA 2KS6A 3EBOA 2XPIA 1WW3A 2ONDA 5KJNA 3CVLA 2VQ2A 4BT9A 1L7XA 2IUYA 2LNIA 4Y6WA 3ZCUA 4U0SA 3D0QA 3S27A 3MT7A 2UWJG 2G9QA 3U3WA 4XIFA 5LQDA 3IAAA 4X7PA 2GJ4A 4J8FA 2QN8A 3GUHA 3S28A 4I9EA 4YI3A 4HORA 2IFUA 5FZQA 2XMPA 3WC4A 4YUAA 3T3IA 1RZVA 4UI9J 3EDTB 2HYZA 3OY2A 2AW3A 2XCUA 3HBJA 3MEKA 4GA0A 1TJCA 4W6QA 1C8LA 5G05J 1UQTA 1O6CA 3E4BA 3MSCA 2AV6A 4LEIA 2AMVA 3UYKA 5EKQD 2BISA 5DBKA 2QRPA 3HBMA 1JEJA 2AVPA 1QQEA 1GPAA 1WUTA 3LY9A 2XGMA 4RBNA 3NCHA 2SKCA 3MKRA 3RJVA 2YQ8A 3OXLA 4YI5A 2G9UA 3MQFA 2VSYA 4BT8A
chains in the Genus database with same CATH superfamily
5EHZA 2AW5A 3I5PA 4I4IA 3WQRA 5B2FA 4HLUC 4ZC1A 1NJFA 5KBAA 3KJIA 5ARDA 3UWOA 3ANLA 4KQ6A 1A98A 2V5UA 2JZCA 1XALA 3S2YA 1Q1ZA 2WFAA 4CMIA 2X0IA 1JNXX 4KITB 4TZTA 3CSDA 3NKVA 5AM2A 1XZBA 4CEJA 3OM0A 4OHCA 3BZWA 4PFSA 2VAMA 3ODPA 4FUTA 4KQ1A 5HWSA 4C6RA 1NVKA 1OWLA 1MO2A 2RHWA 5ALSA 5I9SA 1JWGA 5JYEA 3CX7A 5CA1A 3NS7A 2B7BA 3E58A 3TN7A 5ALZA 3WIOA 3Q98A 3LHKA 4MRVA 2P5TB 2ON6A 2X5JO 3KXLA 9ATCA 2AUMA 3FUDA 3KXPA 5U9CA 1SC9A 3FZYA 1PSZA 4ZT5A 3OZDA 4UZSA 2OOEA 3JALB 2XEVA 3FH8A 1XTVA 2XQ0A 3GEEA 4Q4JA 2VUSA 4OSOA 1P2BA 4FDVA 1C9DB 1D07A 3L1KA 4NKRA 1MC8A 2OB2A 4MEBA 4GVLA 4RETA 2FGJA 1E4EA 1G6KA 2BM1A 3MRVA 3A7EA 4MLZA 3I5XA 2QMHA 3EB9A 4FW9A 2D59A 5LDDC 4RG6A 4YRRA 1V11A 1Y6ZA 3ZC3A 4LXGA 1OZHA 1QHNA 2R02A 2BMJA 2VH5R 3ICPA 3WK9A 2G07A 4YJ3B 2QBYB 4QWWA 1E64A 4PZLA 2DFPA 2QUJA 1GCGA 3O4HA 2AZTA 4X3OA 4D99A 3U4TA 5CBPB 3O3CA 1HX8A 4IG9A 4GL2A 2VDOB 1ZM2A 3FHEA 2WJHA 3BXGA 3H87A 3FGZA 4LGMA 4HBZA 3IVRA 5BN5B 1XB2A 3W5BA 2C9DA 4Y1FA 3PGJA 3DO6A 3MS2A 3B1KA 4ZXPA 3TIXB 3ZWOA 3LUDA 3N1UA 4Y9SA 1NWCA 1P72A 1Q3KA 1QFSA 1LB1B 3NHLA 2WJZB 4XJXA 3BRCA 3OEWA 3C3RA 1I24A 2V4MA 4WLVA 5D7BA 2G5TA 2ZVPX 4DQUA 1SIUA 1ADCA 5FA5A 5T64A 3N3AC 4A91A 4AP5A 4K86A 5JH7B 1QP0A 1SCQA 4BV3A 2IYZA 1VTKA 1NHGA 2YZMA 5HX7A 2NYRA 5HQJA 1B89A 3QV2A 2W93A 3DSTA 3DUFA 1UJKA 3HUUA 1G8PA 4L4YA 1QRRA 2ZPUA 4ERNA 3UCXA 3T0IA 1N3BA 4D92A 1NBAA 3I61A 3CR3C 3HV2A 3PYLA 4O6VA 2GERA 1YUMA 3SR0A 1IN4A 4DJ5X 2B8EA 2Z3VA 2Z43A 2HADA 3QIVA 5FYQA 4R71A 3MAJA 1Y3AA 1PO7A 3DNPA 1DDIA 5CFNA 4H3VA 2A30A 1UP4A 1BA2A 2B69A 2R5WA 2RKWA 2VNSA 5K3FB 3WLPA 2GK7A 4Z86A 4KIJA 4JJZA 2P90A 5F9HA 2D06A 1P7YA 1S8NA 4LY6A 3RARA 2XITA 3UJDA 2QTAA 1SBYA 5JE8A 3LFHA 5A04A 4KMOA 5T8IA 1O87A 5CVJA 1QKKA 3IBFA 4FINA 3UJ3X 1CEYA 1QSGA 4DNXA 3PA6A 1KI1A 3PGKA 1V43A 4RA9A 4YVQC 2D1SA 1RWXA 2PRSA 2QUBA 4PXAA 5K3FA 4KDFA 3JV7A 1GAJA 5JSZA 2W58A 2WWHA 4N54A 1JWBB 3SXUA 1K4KA 3A6PC 3FJ1A 3WAKA 4RDCA 1UXOA 3NBAA 2SHKA 3GP3A 2FSHA 1G9XA 4OQDA 2H0RA 3EXHC 4G01B 4CM1A 5KTKA 4C7OA 3UCFA 4AF7A 4QOHA 3WAJA 1XJ5A 3B5JA 2IGBA 1W5SA 2IXDA 2QENA 4B3BA 3CEPB 4K3VA 4ZTZB 3NXKA 5U4XA 1GZUA 4J7UA 1ZK4A 3EN0A 3FW1A 4CI9A 5TXGA 3E3NA 3I1IA 3OP1A 3VYRB 3JARA 2TMKA 3W77A 4C4ZA 1HNXB 1W581 2PS9A 2MYPA 2WM9B 4UKDA 1XLUA 3H97A 3X1KA 5I5EA 5KNBD 1WZCA 1PR9A 2VS1A 2Y71A 3IRUA 3E48A 4NRDA 4IVNA 2J0UB 1S7GA 4ZVNA 1E5LA 3OH8A 1ZNQO 4XXHA 4CTMA 3DV2A 4QU5A 5KSYA 1ZR4A 1ZNXA 3M9LA 3VI4B 5AKYA 5BNFA 3E4CA 4JOBA 1T8PA 3UGTA 5I7VA 4ZAGA 3PS6A 3JARB 2WG0A 4O4LF 5BWNA 3LIPA 3V7YA 1J5XA 1MH9A 1U04A 2FFJA 3EMVA 3GGGA 1XA0A 2H1FA 3QLUA 1EVJA 1G3IA 2IHKA 5FJYA 3H9UA 4H7HA 3KZ1E 4Z9YA 4JT2A 4K26A 5DTQA 2RGNA 3WRYC 4AD8A 1U0OC 2QD4A 4TMTA 5HUJA 3LC7O 2GAOA 4QHTA 4ZOAA 5TRTA 1V3QE 4CDNA 1PQWA 1DKQA 2GT1A 2VZ8A 1PNTA 4DLNA 2BFCB 1WLSA 3CSSA 2RHTA 3TO5A 3F8WA 2ZIAA 5FWXA 4AIFA 1E8DA 3A1DA 1CUFA 3FBGA 5CCLA 5LYYA 4I1RA 1J20A 1KJZA 1LI4A 3I73A 5B37A 5LP6F 2VPPA 5JLJA 2NIPA 2VK8A 3KVVA 2FHPA 4F6RB 1EXDA 3DMTA 1T2VA 2OAQ1 3GUYA 4Q48A 2I4IA 3O8BA 4NNPA 3ST7A 3N3BC 4NWIA 4JH0A 3QVLA 4JBGA 2OCKA 1QRUA 3BH6A 1ZESA 2H3HA 3M70A 4RABA 1S2DA 2LBPA 2XMSA 3VZDA 1N92A 1SB8A 1XYYA 2PUJA 3C70A 2D7CA 2OXRA 4R9NA 3C3CA 1BX3A 2OV2A 2HUPA 4PZZA 4CKXA 1L3IA 2PX3A 3BDVA 5G4LA 2CXPA 2GA9A 4BNGA 3F49S 1JVNA 4P08A 4BLPA 3HNPA 4FFNA 2B20A 4IRXA 3AVVA 4PLPA 4G89A 5AKKA 4AMGA 1JHMA 5BYJA 1N2CB 1UBFA 4KMRA 2XS1A 2P40A 3AT1A 1RADA 5FJJA 2FF7A 4XUCA 1LWNA 5HJ5A 4PLVA 2Q4BA 4GWLA 1ZC4A 1ODIA 1N2OA 3RKSA 4F5YA 2DQSA 3O8CA 4JXXA 4A1GA 4QREA 3TLMA 2IH5A 2VSNA 1KZ7B 4B43A 2BKVA 3NW9A 5ILQA 1OBCA 2JATA 4HDQB 3A6DA 4YDHB 1YJ5A 4RTLA 3GOHA 2QTFA 2PZJA 2XMQA 3DGEC 3K1TA 2AF3C 2WT9A 3B7SA 3DT6A 3ONNA 3VPDA 1PDOA 4ODIA 3ZZTA 4JR1A 3SJ7A 3N2GB 4BQRA 5BN3A 3AX6A 1CZHA 2ZAYA 5DK4A 4D44A 1XVTA 2OKCA 1EM6A 4L50A 2OFXA 1RWBA 1EDOA 2PMBA 2RHDA 2D0PB 2XUQA 3SG0A 5IDQA 3JYOA 2DJIA 2HWUA 4X63A 3P2MA 4NOLA 3WB0A 4KODA 1A7AA 1OXJA 4TWBA 1ZEMA 1XEXB 2GAFA 4PC2A 3UN1A 4DLOA 2Q7FA 2H18A 1UPTA 1AUXA 1R50A 1JFTA 5J23A 2C4MA 1U11A 3OQIB 2R87A 3K3PA 1RSZA 1AZWA 2A1UB 2J3JA 4O08A 3U4DA 4LNHA 4CTNA 3SD7A 2G1JA 4AZ0A 5M34A 4FN4A 2FR8C 3V31A 3TXAA 1H2TC 4I36A 2RAPA 2CWDA 2DBVO 2GD2A 4HXGA 1ODSA 1EK0A 1WG8A 4US1R 3BRQA 4YP0A 2IYLD 4ZV7A 4RWZA 1U7IA 4A26A 2Z30A 1BQEA 1EVEA 1R64A 4HB2A 4AUKA 2CMGA 1Y7LA 4HDKA 4PX5A 2PUTA 3EXIB 1EFHA 2V8BA 3GPLA 1L5YA 4L28A 1JU4A 5JPIA 3NBFA 3NJ8A 3AV0B 3CH7A 5LP1A 2X3FA 4QUHA 4UMEA 2WXHA 3HBLA 4G2VA 5GINE 3PREA 1E3TA 2GSWA 3I6MA 4INOA 1GDHA 5BMOA 1EJ6A 3HU3A 2OMKA 1WBJB 5BSKA 3OVMA 2PZFA 4XLLA 2XT9A 2GBFA 4CDMA 3L7LA 1MW8X 4XUGB 4QECA 2R2LA 4M21A 5HYVA 3HJTA 1XA4A 1CUSA 1DKMA 3CNBA 2OV1A 2Z8ZA 1G8SA 3HVIA 3IDSA 1J70A 4GYJA 1WO8A 4OHXA 3S1AB 1E2QA 4OPMA 3MS4A 2DWOA 2DBQA 4LOHA 4CKEB 4US2R 2BUCA 4ZAYA 5KDOA 3T95A 2WTEA 3VKHA 2HMTA 4DA8A 1JHUA 4BLSA 4WFJA 3MX3A 5D6NA 3GGPA 3ML9A 3BK7A 3P9PA 2A5DA 3HR8A 4YUYA 2WUFA 3CA8A 1QIKA 2BEVA 1KWGA 2BN4A 1HRDA 5AI5A 2HK9A 2D2FA 4P7JA 2WAMA 2G40A 3EW9A 2J5RA 4CM9A 4HQNA 1Q12A 3ASYA 2X76A 4FLFA 1PP4A 2H4HA 1MXHA 3M6VA 5TQ0B 4W5QA 3JYPA 2YJ6A 5A06A 3LVBA 5C3UA 3KJZA 3DE6X 4E2YA 1REQB 2RGUA 1JLKA 4QASA 1DQZA 2VHJA 4FQ5A 5TMEA 1MJGA 1S3FA 1A5ZA 1ML4A 2C97A 2CB0A 4R7TA 4OHBA 3LNTA 4P82A 4QOEA 1A7JA 1KETA 1KMNA 2C9MA 1GPUA 1DC6A 1X14A 1TF7A 2C20A 3AI7A 1GKIA 2IHUA 4KYVA 4RIIA 2ZXUA 2IF4A 1QOPB 4GIBA 1Y5RA 1HYHA 4QUKA 4FGSA 1HI9A 4MS3B 5FTNA 1PL6A 5JISA 1DWPA 2JI9A 3VRHA 1LKZA 3QKTA 5JAQA 1S1CA 5CTJA 1QFZA 4NE2A 1PX2A 1KT0A 4GNKA 2JLZA 1U8TA 2H29A 1OSNA 1L3CA 1I80A 1LW6E 1Y9ZA 2GASA 2VDUE 3T3GA 4UC0A 4GSYA 4H18A 3VSEA 4EO9A 3CX3A 4EGFA 1NT4A 1QIDA 3DE7X 4C6SA 1F1BA 4WOJA 2F8SA 2O0KA 3KPUA 2O4UX 1UOEA 3KQQA 3HDYA 2N75A 1KEUA 2WM8A 2PBLA 3HLKA 4LYHA 4JI7B 1PSDA 3C8UA 3KUKA 2W70A 1FUUA 4MV1A 4YR9A 2FJ0A 4ESEA 4US0R 2I1JA 1MZCA 4L23A 1IN6A 4Q39A 1A1VA 2YWJA 4TLMB 2FPPB 4MIKA 3VNAA 1QNFA 1M33A 2C95A 2RCYA 3SS7X 3UT5B 1THMA 1GQRA 1XRQA 5DNVA 4BFYA 4DT1B 2HO5A 4WWNA 1NTRA 4G2TA 3WL6A 2YWFA 4J49A 1JWLA 1YR9A 4N3CA 4M8SA 1SG0A 4X41A 4E5SA 5BUCA 4Q93A 2FKAA 2FSUA 2P9CA 3QFTA 4ME2A 1F8FA 3ICVA 4NCNA 2E5WA 3C5RA 2MSCB 3RNLA 3SQXA 4M9RA 5EKSA 3PVLA 1JJAA 3GWGA 3IAUA 3GYXB 3APDA 1DIOB 1W4RA 2B9VA 2QGNA 4V0KA 1OCZE 2OVBA 2FPPA 4KN8A 4MIOA 4XDZA 3UVEA 4BMSA 4H6WA 4WKOA 1UAAA 4LMPA 2JCVA 3C3JA 2CFCA 3E8XA 4OQEA 1E1KA 1PJ8A 3HJCA 5IC5A 2N9UA 3KVOA 3PNQA 4JXTA 4A3SA 1Z4OA 1PL0A 2MSKA 5I7RA 2ACEA 4DR6B 1EI9A 3HHMA 2OCIA 2OHHA 1WXWA 4Z7NB 4U3JB 1FCJA 1MC4A 1GUFA 1UBNA 3K73O 1DBPA 4JB2A 1BRMA 4PSKA 5EXTA 1N0QA 1J6UA 2GOYA 2AUTA 2ZPAA 3O4VA 5KJFA 1UKZA 3RT9A 1RZ3A 5L9AA 3M1IA 5EDSA 5T4BA 3N76A 1A4IA 4CETA 1Q17A 4PRZA 3TBKA 3ZVVA 2ZJ6A 5ENDA 3QYPA 3PD0A 3BRWD 1Z0FA 2GFHA 3EJNA 3LLUA 4ZANA 4E1BA 3SQNA 1WUIS 4P35A 5CP8A 1QZ2A 1V9LA 2VRNA 4K6CA 4ZO8A 5DWQA 5BNTA 1K3TA 2NQ8A 2GHTA 1MN6A 1VJTA 3C24A 1B74A 5JATA 2IE8A 1C5KA 4J94A 3BE5A 4NY1A 1PW7A 4BEPA 4J1NA 2VZLA 1TM1E 4F85A 4FB5A 1OT3A 2UZ1B 4TV9F 1J2JA 3EUEA 1SPBS 3EXEA 1FBNA 4ZCQA 4IFEA 3AU5A 1U7XA 2KHZA 2Y0DA 3K5PA 2LD4A 3AOEA 4ZOLB 4OHYA 4PRKA 4ZV4A 2AEFA 2KS6A 3INTA 2GUGA 4QDTA 5GONF 4H7PA 4S05A 3QY9A 4BFWA 4LF4B 1VE5A 4XQCA 3SU8A 2ONKA 1WMAA 4FT4A 2CG3A 1QXSA 4KYUA 1N33B 2YMPA 1SULA 2PE5A 1JA0A 2UZ1A 5AI6A 3DC2A 4YJ2B 3GDFA 3LH5A 3S27A 4H4DA 5FBRB 1PQ4A 1LF8A 1RQLA 1B0AA 1SU8A 2JRCA 5FO1A 1IMJA 1U9YA 2DHDA 4GPZA 4ZHQA 3JASA 5BQFA 4FLEA 2X6FA 3TUIC 5BOSB 3U44B 4IGFA 4YUAA 1GTRA 4ZCLA 3R41A 4M9UA 3D8BA 1AXEA 4B8YA 4E70A 5EIFA 1HL3A 1SXJA 1H5QA 4M1SA 3OY2A 2A0WA 4JUBA 1L4KA 3HZOA 1TYCA 4C4TA 2PMCA 4ZKEA 5AJYA 1U9JA 4C21A 3PR3A 1IHXA 1X87A 2HQSA 3CF2A 1QFJA 2Q2QA 2NZXA 4PZ9A 2I91A 4GMGA 4GTSA 3MSCA 3PC4A 4DL9A 2AR9A 3WYBA 2E5LB 3RSFA 4HVAA 3N0VA 1C8BA 5EKQD 1TQ4A 1ZMBA 4LX0A 3AVOA 5DT2A 4BO2A 3GJ3A 4L9WA 1QQ7A 1AM4D 3Q6MA 3PX3A 5T67A 3AJ8A 3D31A 1CQPA 2HLDA 1YZUA 2BW0A 2JFOA 5ENQD 4MR8B 2B6NA 5IEBA 1JAIA 1Y8QB 3GLVA 3MOSA 3HU2A 2VTVA 4G5QA 4L75A 5B36A 1TZMA 2W2KB 3ONEA 4ZJUA 3FUCA 3C2QA 2QL5A 4L5CA 2GEUA 1LSSA 2C78A 4BT8A 1V41E 2ZU0C 5DMHA 1JG2A 1H93A 4BIIA 4G1VA 1NVAA 3FLEA 4P3NA 4R01A 3PNYA 3V55A 5A5GA 5MHTA 1OAOC 1PNQA 1PR1A 1ZOPA 3OCYA 4HDCA 3D9OA 1VDMA 2I7VA 4DSTA 3NWOA 4E5DA 4REQB 2CHEA 4H0FA 3RBAA 4LBYA 3GEDA 1NRXA 2B2CA 3R0VA 3JQ7A 4NLLA 5JNVA 3G2PA 1I5OA 4RHFA 1A4RA 1FLVA 1T1GA 1KZGB 3D0RA 4I2NA 4NJMA 2NXPA 3S4YA 3UGKA 1NPTO 4IIUA 1PFVA 2HHJA 3GR6A 4CKCB 4U39A 4Y2SA 3GARA 2B83A 1PWXA 2X3YA 4WRRA 4ZARA 4EPTA 5CG2A 4NCKA 5L40A 2VSOA 1XMOB 1E7UA 3BDAA 2PWYA 3LQQA 3RRMB 1BWSA 2OECA 3K1YA 4U5XA 1NVEA 3ZY2A 1AURA 2ZCVA 1QOQB 3NFRA 4JVLA 3LWDA 3SX2A 4QTXA 3VYWA 5C5EA 1W8IA 3HP4A 2ORVA 4LJ9A 5B6IA 1QV7A 1TO6A 1U6IA 2KI5A 3JTEA 4XASA 2WWVD 3KRTA 3NV7A 4UVIA 5H1YA 4HRVA 2AHRA 3HJAA 4MLCA 3DV9A 4K9QA 2DFDA 1KBQA 1Z8DA 2FUNB 2JEYA 3QA3E 4ND5A 1ABBA 4FSDA 2I2WA 3WL3A 1K68A 4IV0A 3ULKA 2XHEA 2H5LA 1SM4A 1WU7A 3OLQA 3V1LA 5CT8A 1RQRA 1YMVA 2H59A 3L08A 2OL4A 1JB9A 2QZSA 4JNCA 3D9KA 1DAKA 1UUFA 3MAGA 4KN5A 2PQ2A 5IAOA 2H1VA 2UY1B 1Z4LA 1RPNA 1UZUA 4FYYA 2ZDGA 2O5CA 1YI1A 4NX2A 2FWJA 1UJMA 4TGLA 4WAFA 1MKYA 2CK3D 4NU6A 1NOJA 1TAHA 3Q3IA 2G9VA 1LH0A 5FBLB 3OZXA 3COYA 2ZGGA 3P5SA 5DRYA 2AXUA 4FIZA 1A72A 4J0QA 1AB5A 4UUCA 1SPXA 3UKOA 4N6OA 4A8PA 3T15A 4A23A 4KPYA 1QJCA 1DAMA 3PL1A 3H5NA 5EE3A 4F38A 3A3PA 1DUSA 4DUYB 4I17A 3B60A 3AFOA 2X77A 3AHJA 3ZU7B 3ETCA 3CQ9A 3N59A 1H42A 3AMVA 3FJOA 3KD2A 5ALOA 1YQDA 3WXMA 3I01A 2VNKA 5TMDA 3Q7IA 3OPQA 3AB8A 3PA8A 2ZIZA 2CXTA 3UV6A 2DFNA 2JEOA 1CUXA 2C59A 4FOLA 4XB6B 1JIXA 5B1IA 4AS2A 2IX3A 1EZ4A 3UT6A 5BWMA 3UYLA 5BVGA 1NDQA 3H6KA 4Q4AA 5AO9A 5J9FA 4TOIA 5FHRA 3UFXB 4EUFA 3KQKA 4UTOA 1UEIA 3SS8A 2AUNA 4TXLA 2D3TA 1W47A 3WISA 3HCEA 4BFSA 4UASA 1CLUA 4IKEA 1YOVB 4U9IS 1AKNA 4S1VA 5HIIA 4F96A 3L4KA 2R8OA 1F3OA 1RKBA 4WLUA 5LBTA 2GXSA 2FUG1 2QPTA 3CRRA 3LUPA 4GR9A 3RREA 1JR6A 2FPIB 1TUEA 5TV2A 4LY0A 3D4PA 5LD2B 3CRZA 2HA7A 1WKBA 2MOWA 3D6HA 3T9KA 3PC6A 4UQPA 1AP7A 3G13A 1CY7A 4WEQA 2Y2UA 1VMEA 4Z4HA 5JZVA 5HKKD 2H6GA 1JN0A 2GO1A 2G77B 5ECYA 2F1OA 4TQUS 4EQ6B 3EPKA 3IEUA 3IELA 1XXHE 2DX7A 5A4IS 1UH5A 1MX1A 2GJSA 4CG0A 1EGHA 3SF8A 4ER5A 3DFIA 5CHYA 2O2JA 1RXCA 3K0KA 4GE0A 4C1BA 3OICA 1CS0A 1RJGA 2J32A 3HU1A 4DWOA 1KVUA 3DZKA 3JQ8A 1WMFA 3MXTA 2E2EA 1C7EA 4I8DA 1X80B 3HCOA 3GRFA 4JMPA 3QK0A 1Q5PA 2VJNA 1AUOA 3RU7A 1XWIA 3VYVA 5C8YF 3NALA 1AMOA 1YBHA 2HH9A 3FBWA 3T9FA 3BH0A 3QXSA 4DNFA 3DP7A 1RAFA 1V71A 4II3A 1E6LA 2J4FA 3QG1A 3TKAA 2HGSA 1LDMA 1MJ5A 4DB4A 2Q99A 1DG1G 3RAUA 4DLSA 2MYNA 1XVUA 2FOLA 2TSYB 2RSFA 1NVVQ 2RJNA 1AXRA 2XECA 4MA5A 5A7GA 3KZXA 5KVAA 2ZB4A 3U09A 3V1TC 5C8YA 1QBQA 4A1FA 3AG1E 1JKJB 1PR2A 3FZNA 3ZZUA 1T9HA 1NULA 2GZHA 1I6WA 2H2GA 3UX4A 3LX5A 4V02A 3B7UX 2A1TS 4R31A 1AF7A 3DOUA 4YRTA 3ZV5A 2WXNA 1AGXA 4EBFA 1ZCZA 2IHJA 1KARA 2XT0A 2ES4A 4LVCA 4UOZA 2FPWA 3TQSA 1Y7TA 3D6FA 3E3OA 2GJ8A 1EYHA 3AOEC 4RULA 3ZHXA 2AMLA 4O4HB 5GONB 3VM6A 4NONA 3DFMA 1JKJA 4KWCA 3PNVA 3VHRA 5HA5A 3P4XA 3ROKA 3RS0A 1CR4A 2QX8A 3IVCA 1CDOA 1XDUA 1UJ6A 2QP9X 3C3XA 1XDDA 3FTDA 1EVIA 3G8DA 3LBYA 4HQ0A 4TKVB 4WY8A 3RHFA 1K0FA 3FY4A 4EARA 3U7RA 2ZYIA 5IAJA 4CG2A 2A14A 1L5LA 3SHOA 4E94A 3NEYA 1M1UA 1Q92A 1Y0BA 3KQTA 4Q1VA 2J9FB 1IK4A 4XRGA 4YY3B 3DEIA 5CFOA 4Z3OA 3WIBA 4D8WA 2VJOA 3CEQA 1I3MA 1M2GA 5EWMB 3QQ5A 1FJGB 1Z0DA 1ZD5A 1KH3A 1LNQA 1TVKA 1V55E 3DS8A 1HFEL 4UM9B 2IHNA 3K09A 1NF3A 5I4BA 2AD5A 3EMBA 3O9ZA 4DWJA 2IODA 2G71A 3GN2A 2XVZA 2KCLA 4WZAB 3LDAA 2OD2A 3HI4A 3WYFA 5TDHA 1QUFA 4JD5A 2A33A 1K8RA 5DBHX 3KUCA 4BQNA 1T8UA 3IOEA 1Z2OX 1DWUA 3L18A 3SK1A 4K6GA 1GUDA 2JIRA 2W5UA 4L0MA 4I4TB 1IEXA 4C0HA 1Y48E 3L6CA 3L6DA 3N70A 1VE6A 4ZVOA 4UAJA 1TA0A 2VXCA 3LG2A 4BUZA 4UBNA 2EAUA 4BFXA 2J48A 3UKJA 3QXCA 1CJUC 5AQEA 4DKJA 5BSRA 1U8FO 1LY1A 1JIJA 3H2IA 3IB6A 3OZTA 3IQZA 3P19A 2OFFA 121PA 2ZSJA 3RVSA 2Q4TA 1MABB 3AW8A 2RI1A 3PGLA 5EIBC 5DNUA 3R3YA 1OFVA 3IIKA 4H0CA 4Q9DA 2KQUA 3TL6A 5DM70 1US8A 3GLFE 1L5NA 3II6X 4OGFA 3OLWA 5AN8A 1Z4JA 1GQQA 4ON9A 1T8WA 4RK1A 1U8CB 1OI3A 4BLVA 3FX2A 2WXOA 3A6JA 3RAGA 3RJMA 1BMTA 2FMFA 1SBZA 2O9JA 3ZE0B 4IDAA 4OLFA 3SPXA 1ISFA 1HLGA 4HAZA 2AZXA 1XPUA 2YN4A 1ZMRA 2IUTA 2OCLA 1DFIA 1JALA 2GN6A 4QPZA 5KTSA 3DAPA 2F48A 4QXPA 3RYFB 5C52B 5IX8A 3WDKA 4JHRA 1RLUA 1UWKA 4ACBA 4Q4CA 5K8JB 2PUFA 4DNPA 4DPRA 1RC0A 1EXMA 4B3RB 4ZJZA 5TGZA 1TUBA 4PFQA 1YMUA 1YK1A 2JLSA 4HDOB 5JEEA 5CCXA 4KNYA 4LDQA 4Z2YA 2HF9A 4XYGA 2Z5FA 1P17A 5LCWC 2UZ0A 4NH4A 1JEYB 1TCUA 1X7ZB 4CR6A 2ZJ3A 3CRMA 3HJUA 4KO2S 3IERA 2OGSA 3UJ7A 2X2FA 1EYZA 2FMUA 4LA4A 2B1JA 4PGMA 4Q19A 2IV7A 1RBQA 2O5VA 2WJ4A 3GJSA 5ALQA 4DI3A 3LDGA 5FUVA 3RO7A 4C3ZA 4YXFA 5ABPA 3G0IA 4F6RD 1HUQA 4L72A 4MB6A 4ACAA 4DMHA 2NSHA 1JR3D 2IYAA 2R66A 4IIGA 4WOCA 3X0DA 4HX9A 3ZV7A 4K46A 1P9WA 2IFTA 2ZR0A 1PS9A 3OX3A 5DCLA 2XGSA 2I7TA 2YNMC 2EATA 1EDZA 1Q0TA 4M9CA 4H08A 1HDRA 1MRZA 1X9GA 4NS1A 3ZGOA 4BFLA 2DWPA 1YUNA 3QBTA 4J7CA 4QC2A 4GMXA 3K15A 5IC6A 5IYZF 3X1YA 4EZEA 3B5IA 2GNPA 2IZ6A 3Q8XB 5E7MA 2CZGA 3AUKA 1RCUA 2IT1A 1PZGA 1LNSA 3HYSA 1M2EA 4QSMA 3B82A 2PXHA 4BWVA 4YAFA 3CXRA 3AEKB 2IX9A 2QY9A 4C89A 4Z0HO 2YJ5A 1OI4A 4N5QA 3PFGA 4EYQA 3K4PA 4RTQA 4IIDA 5KREA 5IARA 2XCIA 5TQJA 1F8GA 1OPRA 2AOTA 3QNUA 4YQYA 1ZW6A 2XB6A 4G8LA 1MW9X 2C83A 3DKPA 4G0QA 4OHVA 2XCBA 4R1NA 7GPBA 4G0WA 3PC3A 2OSBA 3TKYA 1KY3A 5HQ3A 2WZBA 4KWHA 3SI5A 1ACMA 1UK7A 4QDJA 4DABA 3CEHA 4K88A 3GLIB 4AG3A 1KFKB 2FLWA 2R48A 3D6MA 3QPBA 1O9BA 4LTNA 3HEBA 5B3AA 1V0JA 3STVA 4EZBA 3V1UA 2EKBA 1SC3A 2NYJA 1G3NB 4MV8A 5B7GA 3ZRHA 3E5RA 3PF9A 5CBPA 1LA2A 1V37A 4XB1A 2GZ3A 4G1UC 1XD8A 2NQ2C 4FZJA 4LZLA 2AMJA 3IKLA 4ZYVA 4DLZA 2AZ4A 1KSGA 1YXMA 1X1TA 2Q0XA 2V9CA 3EXHA 4LGCA 3K9GA 2YL2A 5AXDA 1N9AA 3AS5A 3AU8A 4J9VA 4ZI3A 2YIJA 3GC6A 2PGOA 3GLHE 5C80A 2P0YA 3AHHA 4NV3A 2LPMA 4Q1FA 2HA4A 3E61A 3SC3A 1CB0A 4U2KA 1G55A 1CVLA 3TJMA 4AJPA 2QW1A 1VB5A 2VBIA 1X19A 2P8JA 2PYIA 4OUDA 3A6ZA 1PTJA 4RJIA 4UATA 5K6TA 1YQWA 1D6MA 2R6DA 3ORYA 4PLHA 3TB4A 3CUVA 2Z4TA 2CNWD 3E30A 4R7LA 2R1VB 4NFHA 2BLNA 3THXB 3PL5A 3CNHA 4MV9A 1O95A 1OLSB 1XD2A 1P2SA 4O02B 2C7BA 1XBTA 1OA1A 2PSDA 3C3PA 3PITA 3STHA 3LBHA 3E18A 4QXQA 1CD5A 3EIQC 3IR5A 4QTUB 2XUGA 4ZYXA 1GM5A 1R3DA 3LT1A 2C7VA 3RYCA 3H5TA 4HAVA 4DLQA 2EF0A 3I30X 1KAQA 3CF6R 1V4BA 1Q3TA 1YYHA 2FWAA 3L9TA 2Y6VA 5D84A 4N6GA 1J56A 1COWA 4QEZA 1B16A 5KWEA 1MG5A 2BFNA 2RGNC 3OTWA 2Y76A 3ASNE 5J4LA 3OXGA 4WW0A 4YREA 4E5YA 4P38A 1JT9A 3NDBB 2Q4OA 2FX3A 5D8DA 4FDLA 4NTZA 3K96A 4R6XA 5JR3A 1CWUA 5F35A 1XKQA 2FOXA 4AQYB 1M0SA 1IAVA 4N82A 4ZMBA 5F2EA 3O4ZA 3SHWA 3DL4A 4HX2A 3KO8A 2LIVA 1BQ4A 2HHCA 3AVQA 3E1KA 1FFWA 4MARA 3OT5A 1IAQA 2XUFA 2EQAA 1KK0A 2QD5A 3DBHB 4FBLA 4AJIA 4BZZA 1BIFA 3G6KA 4H60A 2PPLA 3I2GA 2QE7D 2GKSA 3LE8A 3P2KA 4JLPA 4KSBA 2WP0A 1USIA 3CHPA 3MA5A 1AA9A 3D5TA 3GRUA 3AS8A 2HZ7A 2IQIA 1DRVA 4E6PA 4DCTA 2QJFA 5B3KA 4LYFA 4I4LA 1ACLA 4MKHA 1I9GA 3NONA 3RHSA 3SBXA 3HCWA 2VZ9A 1A9QA 1JECA 3V8QA 4EJSC 3EIJA 4HB0A 5K05A 1WMEA 1IC6A 2QT9A 1FFEA 2PZIA 4N6NA 4R9SA 3SHQA 1E96B 1WOMA 1FMTA 2LCFA 3EQ9A 1E1RA 2V9PA 1NQTA 4WBNF 3GLRA 3N86A 2XNDD 3ZY5A 4BZQA 3D43A 2UYCA 4R8SA 1KYVA 5LZ5A 5BYAA 5C7IO 5AQAA 4RHTA 5IUJC 4KIUA 3EFEA 2O2GA 1Y9DA 6CHYA 1QHFA 2FYTA 2G6TA 2JBHA 2YBDA 3O90A 2JGFA 3H42B 4U6QA 4EPVA 4FADA 1JFFB 1P60A 2GO7A 4L08A 4EY8A 4DXDA 4QG3A 2HIAA 4OM7A 1HNZB 5I3ZA 5LA6B 1UQRA 4QFMA 1Q0UA 4G56A 10MHA 1WPQA 3V97A 1OT8A 4JSTA 1QC5B 3GT0A 3D7MA 1VB3A 3PQDA 1MENA 4MQEB 3WGNA 4X5OA 2FEOA 2QRUA 3WKCA 4PZ0A 1P5RA 3PR1A 1IB6A 3H1BA 4KL8S 5DI9A 5T3YA 3ICEA 2HPVA 1KRWA 3L2OB 4PRYA 2O05A 2VF8A 3KYCA 4H35A 4BT9A 3O73A 4GOLD 4HUQA 5KQSA 3AKCA 2VIIA 2E4AA 2VA8A 3DWIA 2ZRBA 3DEZA 5LA6A 3FEXA 1MOPA 4HJRA 2KSQA 4HLLA 1Q21A 5A4FS 3AF5A 1YQUA 4X45A 2XENA 3NJ4A 2HBZA 3VR4D 1OJLA 5ENPD 3CZPA 4R41A 2EIME 1EBFA 5FOQA 1XRJA 1CR6A 4TTJA 5H7PA 4HFRA 5HBGA 5FZQA 3V4OA 1P33A 4FS8A 3EGDA 3AI1A 1Q1GA 5HUQA 3ETLA 4JWKA 4NOJA 2BFBB 2CXUA 3EX7C 3VR0A 2HT1A 1O1RA 4BVJA 1F0YA 2F1IA 3MLBA 2XCQA 3T3PB 4UPEA 2A7XA 2YRXA 1IZ7A 3S2AA 3NVAA 3AR2A 1Z0JA 1I4EB 3OOWA 3WJAA 2P2DA 5FPTA 1Z82A 2VF7A 2Q5QA 4HZGA 5A0TA 2XWQA 3DM9B 3EGDB 1TYBE 3JD1A 4II2A 1A5BB 4TKLA 1KR2A 3ZHCA 5K01A 1M1YE 4F2WA 5KQGA 7MHTA 1NJ2A 1OBVA 2FN3A 2OGWA 2VNJA 3C3AA 3ZHTA 1KFBB 1U2EA 3U7QA 1KI2A 5IZCA 2XGMA 4E4RA 4IIFA 1DTEA 3WK4A 4RSRA 2GK4A 2PLNA 5LQMA 4E14A 1M2VA 4EG4A 3TQRA 2DGDA 5CVTA 1Z47A 2XNDA 3ROXA 3MCWA 2O0HA 3RKRA 2FBNA 3IT0A 5H81A 2ZU6A 5EOVA 4LFCB 3AS4A 2GAJA 4F4UA 2BAGA 3DZCA 3T38A 4EUHA 2EL7A 1A8SA 3PS9A 1WDYA 4HBGA 4RS4A 3BWBA 2A9VA 3RM3A 2P9EA 1BX1A 4QEDA 2IYUA 2QJWA 5FO0A 3P0HA 2GNOA 1WZNA 2B78A 1WMDA 3GQVA 4PCLA 2DFLA 2YDYA 1YRYE 3AP1A 4D25A 3QFHA 2XB9A 3GEHA 1J2YA 2B25A 3REQB 5LQCA 2EARA 4G5GA 3SSAA 1Z33A 3DPYA 3ONLA 2IV3A 1XZGA 5FTKA 4ZGBA 3PZDA 5A23A 1NT2A 1VSTA 1YHZA 2IDKA 3E7FA 3QOFA 3KFLA 2ZROA 2H4ZA 1DRUA 1YVDA 3NC4A 3IDAA 4IFBA 1KOGA 3NIDB 2ACVA 3X2FA 4BPBA 3KCQA 3WKEA 3U3DA 1J33A 5J08A 1CUZA 2R47A 2NSZA 5KNGA 1E6EA 1TF5A 1DAPA 2PS0A 2HMAA 3HHPA 4KVZA 4QOJA 1XLWA 3UIOC 2PIDA 4RK5A 5LYJA 5KYXB 1QP8A 4UHKA 3TK1A 2PMFA 3KKPA 4DEXA 3OE7A 3EXIA 4L1KA 1W52X 1LQ2A 2AS0A 3IH5A 4EZJA 4B82A 2AXZA 3JATA 3CX8A 4HJXA 3B1VA 3U9SA 5BYKA 1HSOA 4KLRA 4N5IX 4RD6A 3T1QA 5LQRA 3HEMA 5GGXA 3TG8A 3LGSA 3U3RA 4JLVA 3JZMA 3OIVA 5F1KA 2NXWA 2P8SA 4KH1A 1YCGA 4FXPA 4L8WB 5JW6A 5G41A 5KYXA 5LYJB 5FXMA 5B3SE 3JQ1A 3FYDA 2XBMA 4AKGA 4M9SA 3M9WA 3UPDA 2BI4A 2C84A 2HIMA 2AG1A 1EG2A 3QLJA 4OCZA 4I7EA 1JZSA 3PCXA 4MUHA 4OKSA 3CZAA 3U3JA 2AFHB 2B3DA 2XA9A 5JAHA 1ZD3A 1TXGA 5A4MS 3JQBA 1ZUWA 2QXUA 4CEHA 2NU8B 4HQOA 4BMOB 1W2GA 1YB1A 2B92A 2LGJA 4OOFA 3SBTB 3ZFWA 1U0EA 3GZ4A 4RF2A 1M2KA 3BX1A 1QRTA 4E85A 1B42A 1KTVA 3KKQA 5E9JA 3TTUA 3ZV6A 1L5RA 4C0QC 2G1PA 4FTWA 2QSYA 2PUAA 4JXJA 4TWAA 3EIQA 2XYQA 5AKHA 2ZSIA 4HWPA 4MUKA 3QX8A 1MX6A 2VSXA 1VIVA 2SNIE 1RHRA 1OX4A 1EFCA 8MHTA 2WJ6A 2P11A 3ASGA 2VJDA 4DC0A 3NOGD 1VKHA 3E5HA 3HVRA 5BXOA 5IG2A 2VEOA 2I62A 1R9JA 3L0CA 4OA8A 4HADA 3TLJA 4H0NA 1U28C 4IKPA 3WK5A 5AK5A 3FN4A 4TMXA 2QD2A 4Q3BA 2P9YA 4UWFA 2IV2X 2HYIC 3PHGA 3MJEA 3OQBA 1T6XA 4DDMA 1JSXA 4L8FA 3FCSB 2XE7A 4MRNA 2EZ9A 4NF2A 4RWEA 1O1TA 5BQPA 3S0JA 1OWMA 4M1KA 3H5RA 5CX1B 1K89A 3TW8A 5CAEA 5BR8B 1FJ2A 4OX9Y 4HHEA 5KTYA 4Q9JA 2NXCA 2O8EB 4GMLA 5AJXA 1OXMA 2PR7A 5BW6B 4R9UC 5TPWA 4P4TA 2WT4A 1RLIA 5FPPA 2ZZNA 4Y30A 2BP7A 4RANA 3QKRB 3QFRA 2J31A 4LTMA 4O8ZA 1YASA 5IAKA 5L45A 4EJSB 4J1TA 2RAUA 2V4HC 5JAIA 3L17A 4L5BA 1UFOA 2XDAA 3HNOA 4IEFB 2ECQA 2MYUA 2E89A 3JQDA 3KB8A 3C0KA 1K3UB 1SOWA 1XZHA 3PR2B 1DT5A 1B15A 3QWFA 3TBFA 2RG8A 2EXXA 2HTFA 2PJUA 2Z0MA 1WD7A 3AFMA 3V34A 1E2FA 3ASHA 3IP5A 2CHUA 3FPBA 1DKNA 4PTYA 1GPMA 3NP9A 1FUIA 2AXVA 1E2PA 1VMDA 4QYXA 3TAUA 4EJSA 3GP8A 4W7SA 4G5FA 1UFQA 2PZKA 4JBXA 3WG9A 3JWIA 1ZCJA 2V0PA 3L5OA 1YRQA 4G4IA 3F47A 2HO1A 3IP8A 3TGLA 2WMNB 2ZYWX 4DJFC 3UZUA 5GAJA 1CUUA 3FVVA 1PYGA 3JU3A 1ZUIA 4Q9KA 4YB8A 5JMTA 4K9SA 6YASA 3DVLA 1OZAA 2QYOA 5AYVA 1NI1A 1D1SA 2H2DA 3CUYA 3EUAA 3KQOA 1W44A 4LJ8A 4DIOA 2W90A 5K0JA 3UKUG 2Y0BA 3BCUA 5HGXA 5JWRA 4CW7A 5F76A 3IQFA 4DQVA 1HF8A 4HWTA 4KGZA 1QIHA 2XOKA 3QX7A 1INLA 3P4UA 3DE1X 3OEED 2WMNA 4IJMA 4X0EA 4YCAA 2WZCA 2QTZA 1U2QA 4IOJA 2FSVA 3C3KA 3IUJA 4QJ3A 1RVDA 3BERA 2EP5A 1N5IA 2YY5A 1TJ4A 1DBRA 1VBMA 3K9CA 3LP8A 2L69A 4ZYUA 7REQA 1EXWA 2ZIGA 3RVMA 1NYRA 1ZJ5A 4X7RA 3DR3A 2H16A 3LUHA 3AWDA 1QG2A 1G6HA 2UUPA 2WFLA 2RKBA 5DEOA 3WB9A 1V5WA 3PCTA 1AMUA 3KTDA 1E3MA 1EDEA 1RXWA 5DGTA 3CLSD 4MH0R 2B5VA 2RHJA 4D0GA 1RRFA 4C5AA 2ZOSA 5DO9A 5G2OA 3R8FA 2IEGA 4BAUA 4P31A 1P74A 1WXIA 3E2MA 3STWA 2AHOA 1SAYA 3MPUA 4ICIA 5D5QA 7REQB 1MHPA 1P5FA 1KPSB 2G4CA 3LCCA 2ZRPA 3TU3B 3B6MA 2FG5A 1Y6RA 1E3EA 1M10A 2XRFA 3DLIA 3OA0A 5EKUA 1PJAA 2REBA 3GN1A 4K6KA 4C4OA 1G21A 2ZE8A 4RZXA 3SF0A 3DZBA 2PUWA 5LP6A 5ENSD 4B3FX 4GQAA 1G4HA 1ZK1A 1XVIA 5IAEA 1R0WA 5KTTA 1HX7A 1IQPA 2GAAA 4RESA 2AC2A 5CM8B 1UL1X 3P5BA 3KJXA 3ZE7A 2V0CA 3FGPA 5KTPA 2ZIUB 3ZWXA 1P4RA 1WIWA 2QQ5A 4MCJA 1I14A 1DXOA 5E6UA 4B3HA 3E7XA 3C5CA 4C5BA 1P0IA 2RC6A 3F6YA 4OYRA 4MLPA 5TNXA 1HMPA 5FTJA 3IE1A 3NC1C 1L5OA 2EIXA 5IJ0B 1G8GA 3W90A 5F7JA 4QLAA 2CFSA 4O4LA 4BMPB 2VXYA 3PJGA 1KWKA 1FPQA 1EX1A 2PQNA 2ZJOA 3L6UA 3OMWA 2VL7A 3S99A 4ZHQB 2H4JA 1TQ2A 5EMNA 1NXSA 4CQMD 3OTOB 3ABRB 4LJSA 3EHEA 3K9HA 2VDMB 3AVWA 1QQ5A 1YFLA 2OP0A 3W8FA 1U8YA 3OIFA 3VAZA 5EP1A 3PLNA 2R6FA 4OQFA 2VP6A 3A9VA 3AK4A 2J6BA 1VCNA 4REQA 2ZVQX 4EHNA 3UATA 2XWPA 2HL6A 1PL7A 1Q16A 1J1ZA 1IPFA 2DHCA 2JGEA 2H2WA 3Q7AA 2R6HA 4LZNA 4JL0A 2YNMD 3C4VA 4PM4A 3W6UA 2E1RA 3GIDA 1W1UA 1R0BA 4EFKA 1SKYE 1BE8A 3R20A 4XKCA 3IAXA 3P2EA 3EZYA 4H6VA 3VQTA 4RD4A 4EK9A 2GVZC 5FPQA 4DS3A 3U4IA 2QRZA 4F6LA 1PV4A 5JT1A 1CUGA 4IAOA 4UM5A 3BG0B 1OVMA 4UHBA 3TB6A 4TRRA 4DJDC 5HKKA 1KZYC 4XI9A 4N0DA 1NOKA 1Z2NX 3ABSB 1JP7A 2ZYAA 2IBTA 2BFDB 1JUQA 2PLAA 1FB5A 4JC5A 4JJKA 4NULA 5CX4A 1CIJA 4QFVA 1CX9B 3NZUA 2PZ8A 3UHOA 3W2HA 4E2WA 1ECGA 1C2YA 1LLFA 1OX6A 2H57A 3A31A 1N0HA 1C4XA 2A35A 2IY0C 1PHRA 4NBNA 4DLWA 2V98A 3DBVO 1TNZA 1YIAA 2A3RA 2QG9A 2ZKLA 1MIOA 1IHYA 3DYBA 4F3VA 1ZC3A 3OXFA 4TZKA 4YRMA 4PU0A 4DEVA 2FI1A 2XRMA 1BU9A 2FUG6 5L3SB 2C7OA 1TPZA 3L8MA 3V1YA 4F46A 2BMEA 4FMCF 2W6JA 3QJZA 1XEWY 5ERYA 4E15A 2BGWA 1T4BA 1NRIA 5JH7F 1R16A 5HILA 1RQ2A 4M7CA 1AX9A 1M7BA 2WFZA 1N11A 4RVFA 2PYZA 1TO1E 1SUAA 1P61B 1PS0A 2EVWX 2RFAA 1BAPA 2QTNA 3EUVA 4V1CI 4YRJA 1FSFA 3QE0A 2Q1TA 5HIJA 3ZHYA 1W6RA 1C7ZA 1HNNA 3TRIA 1JEDA 1L4EA 1TIPA 5H8WA 1UXKA 2E0IA 4RK7A 3O4FA 3AUSA 3U48A 4FGUA 5CECB 1OW3B 5HRCA 4GKBA 5DM1A 1Z38A 4NH0A 5EC8A 3AUAA 1G8YA 2P2NA 5JSHA 4CL3A 3HMQA 1V95A 1TM5E 1PQYA 1WXDA 3G2OA 1Y8RB 2EC5A 4PPNA 4C7KA 1JDZA 2QXTA 2ZRMA 3DOEA 5DNYB 3PJRA 4EB8A 5A2GA 4DI4A 5KYUB 4ZALA 3GFFA 1V26A 3LPAA 1VA5A 2DF8A 3I5UA 4QYMA 4DPMA 4YV7A 2P41A 3NT2A 4EPYA 1G1AA 1JWFA 2CVPA 1XAIA 2B4QA 2VXOA 3UFXA 5U1PA 1L5VA 1MG0A 1ODLA 1DNPA 3M1LA 3SZLA 2DQZA 4LPSA 4OVVA 1GGKA 1Y1LA 2IOFA 3AG5A 4FYJA 4LMRA 3R8XA 1N9KA 1R4NA 1K27A 1HQCA 3EDMA 4AZSA 5KNCH 4L85A 4ZPXA 1S9HA 1NP3A 1JPLA 4P0PB 1VL6A 3ZJUA 3INYA 1N2SA 4O4IA 4BLQA 2F6RA 2B8NA 4KMMA 1EJ2A 3ZXUB 3AY6A 4CCWA 1NURA 4DMRA 4L07A 5F51A 4C0WA 2WXMA 3U1VA 2R8BA 3J7AC 2FW6A 4E4YA 3IEGA 1RPAA 5KU7A 3UH0A 2A0KA 1MORA 2O4CA 4FGJA 4P7BA 3TL2A 1BXGA 5A4AA 1FFHA 4EYEA 3TEMA 1KY2A 1B14A 3QKWA 4MWGA 4CQJA 4GU5A 1U3WA 4WNDA 1M6WA 1L7QA 2E9SA 2Z4SA 4JP3A 3UK6A 1FTGA 5AENA 3HKCA 3IQEA 4BFTA 9LDBA 3ZWPA 2J0VA 3Q9NA 4I50B 4RO0A 5CW2A 3S1LA 2TYSB 3FPLA 3BE4A 1KSJA 4Q3CA 4Q3DA 1GU7A 3BMXA 3ETDA 3LCVB 4PHGA 1K4YA 2QX4A 4XE0A 5DXAA 2F8XK 3QEAZ 1XMJA 3L4BC 2ZRNA 1UKCA 1BXGB 2FR1A 3LJNA 3WX0A 2VOJA 2V3WA 5GOZA 1GILA 3QWHA 3C8DA 3MK31 5ALNA 4U95D 1J0BA 3BB3A 5CM2Z 1E1CA 3ONKA 1XVAA 2PGAA 2CVOA 4PSCA 5CURA 1OH7A 3VKGA 3TKLA 1W8DA 2PRJA 4ZAFA 5BT9A 2JCBA 4GOXA 1GUAA 9MHTA 621PA 5EUMA 5JNRA 3W7BA 3NOVA 5KOHA 1N4DA 3WXBA 1EFRA 2C5FA 2GBLC 3FWPA 3P0JA 1I7SB 4DIUA 4M1ZA 3USCS 2N1BA 2W6JD 2FJUA 4GR5A 4WHMA 3QEOA 2FSVC 1CPYA 3NGXA 4PDXA 5BV8A 4ESVA 3HLTA 5AAOA 3O8NA 3K6RA 2R96A 1DIAA 4FFVA 2EEZA 3FLMA 1ZDMA 4TMFA 3ESQA 3Q8LA 5FPHA 2L0XA 1W5FA 2WLTA 3LZCA 3DEPA 1XXHB 1Y37A 2WSBA 4B7XA 5LCWJ 4JVNA 4TXNA 3RRZA 5BT1A 1Z22A 2D4AA 3KOMA 4MPDA 1EEXB 1LRLA 1NZFA 2RGDA 3UMCA 3N2KB 3VTYA 4GF5A 3I53A 2X86A 4C7OB 3ILXA 5TR9A 3M0EA 4B44A 2KM1A 1H65A 2WPNA 3ND8A 4EGCB 4DX2A 3QTLA 2I6TA 4BV8A 1NW4A 3MKQA 2J9FA 4FJ2A 1J0DA 1QYRA 4EB0A 4BN0A 5H80A 5D0QD 2A59A 1NC3A 2K6GA 2CCGA 2IZZA 1DRWA 5E3JA 4J0UA 1E5QA 3I9LA 1LSUA 3FTNA 3HCPA 5FOTA 1P1RA 2GRPB 3MTGA 3NQ41 1ZH8A 1QHIA 2FRVA 1EE2A 4OAUC 1U2RA 3K0SA 4F4HA 1JDPA 4UU8A 1BMDA 3OZGA 4RPGA 4D4MA 1U3DA 5JBNA 3QRWA 1DIRA 1VIMA 3DD5A 3BICA 1RM3A 2N47A 3BMCB 3DBLB 3ELDA 1S01A 4XYMA 4TS1A 5HW0A 4QJBA 3K9FC 2PFGA 3F90A 2L0TB 1CZKA 4QXMA 1EWYA 1L8QA 3ABLE 3EZ7A 2F3RA 3UCEA 1YZFA 2JIZD 5K3CA 4I4TA 2G08A 1GG9A 1ZPDA 2Q41A 4PZDA 2CDNA 4Y2UA 3RJ5A 4NZPA 1ZHOA 3KYJB 5BV0A 4TT3A 1TVEA 1W30A 3PEYA 1M6YA 3BMQA 4IV8A 2LNIA 4GP6A 4BLRA 3CFYA 3MT7A 1OQAA 4BCCA 4OM8A 3P0RA 4HLUA 3FWZA 2QV7A 2WU0A 4M0LA 1ITZA 1S02A 4Q12A 5K20A 4FA6A 4IRUB 3AR7A 3QMVA 1NMYA 1Z29A 1K9VF 4PTLA 4HRXA 2R11A 2KE5A 2WMOA 5CYPA 3BMQB 5H5JA 3UUGA 2AW3A 1RI1A 3GJ8A 1RIFA 3BBPA 4LOLA 3HBJA 1A50B 3T54A 4KIWA 1R6BX 3I4FA 1UF9A 3E32A 5HF9A 3IIEA 1QCZA 3RVKA 1UDRA 2FX2A 3B1ZA 3O7WA 4TLDA 3GI1A 1X1DA 1IY2A 3LC1O 3OOJA 4YRNA 4BBJA 5E75A 3D0OA 1I1QB 5ENVA 2JLQA 2C96A 3A9CA 2AV6A 4JLJA 2H6HA 2LWIA 8ATCA 1YQTA 2AMVA 2DKOA 3TTXA 1I36A 3CVJA 2MU1A 5JSQA 3VZCA 3IQWA 1PFQA 2ZYVX 2DR2A 2I2XB 3E70C 4E51A 9ABPA 2QTGA 1KK1A 4HQKA 2BMWA 5IULC 1E6CA 1VG8A 3DDNA 4LV5B 4XPIA 4DKXA 4UUMA 1A7KA 1QGED 3RADC 1QB8A 5FTWA 2VDWA 4GLLA 3O8RA 3TZ6A 1SBHA 1U2GC 1RRPA 3GLHB 4JU8A 3A26A 4X90A 1TYDE 1JTEA 2D4HA 3U5TA 3FPHA 4B35A 3ICOA 1U7DA 4XSHA 3T52A 2WM3A 4YVFA 2UXCB 5EXXA 1O5MA 2TMGA 4JV5B 1BLXB 3N07A 5IANA 3KDPA 1OVGA 1HE1C 3WHKA 1PGNA 1KK2A 2X15A 3BBLA 5FF9A 2RGWA 1WOYA 2XTNA 4BNWA 1UXGA 5ITWA 4DV4B 1U7TA 3KXDA 4D5EA 3DFKA 4GMHA 4NXMB 1WXFA 3O0TA 3C6MA 2WYIA 5ALWA 1GAXA 1NMQA 4OYSA 1S70B 1DKPA 1U5CA 1IHPA 2QRJA 4IINA 2JFZA 4Q02A 1II8A 1TCVA 4ZO7A 1CR2A 1ZOSA 3BWMA 1BDMA 3EBPA 2Y0PA 3AJEA 3KOOA 3ORFA 4KRYA 3RQSA 3LYHA 1GTG1 2I4MA 2QAGB 2QL9A 2QMEA 4FKBA 4Z9BA 4A2QA 1D1PA 1Q83A 3GNSA 2B4RO 3OKPA 4O1HA 1NVTA 5AKXA 2IWHA 1ZVVA 2WQHA 5J59A 1J06A 2XZDG 4ZDKA 3FTVA 2AJ8A 1FPPA 2BMAA 4D0SA 3IKTA 2PFSA 2PEYA 4XD7A 1PUXA 4X95A 4ZCSA 3FWHA 3OPYI 2FY8A 5HBRA 1ZJYA 1T1RA 1UBLS 2D5LA 3MYYA 3S7TA 4L57A 2P4UA 3ESYA 1U2VG 2BHNA 3MN1A 5C3MA 5GM2A 2Q6KA 3V2XA 2CFOA 2OM2A 2E1PA 2ID9A 4MTLA 1BG6A 2CUTA 4OQ4A 4DA0A 2EYQA 3KX2A 4DA9A 5CXUA 5JUWA 2R03A 3CGGA 1GA4A 1U7HA 4BXOA 3QFCA 3H2BA 3KR2A 4PSVA 1CNEA 1Y7PA 4DK5A 3EASA 4LOKA 3W3AH 2JLYA 2W6CX 4ARAA 3IV0A 4NG5A 1OYVA 1KC1A 1XZPA 1J9EA 2YZNA 3PRYA 4WKCA 1IWBB 2FUKA 4IX1A 4TXMA 1WUKS 4WZBA 2CMHA 1ORHA 4TS9A 2W42A 1Q0RA 1EHIA 2MSNA 3CKKA 4E0BA 1MA3A 3KT0A 3N6VA 3DFZA 2XNSA 4AN1A 1QQAA 4HS2A 3CVYA 1LC0A 1T8TA 1Y4SA 4EZLA 1XKTA 1X8KA 2AQ8A 2JFQA 3SMVA 4MQ4A 1T9GS 2GVDC 3PKJA 5TVGA 5BR1A 2QD1A 2GXUA 1G8MA 1GN9A 2UVPA 4XIIA 3AEQA 4FFDA 2RIRA 3W9GA 4ZVPA 3Q5MA 2RBEA 1WZ2A 3M1AA 3MHPA 4F4FA 2JZOA 5SYNA 4L15A 5ICGA 3NHZA 4Y6LA 3W78A 3NPAA 3LF2A 5DHSA 3Q47B 3G8BA 1H2EA 3L7YA 4G84A 3SYTA 4M53A 2WWXA 2OBXA 3WRVA 3OY7A 1E9VA 1HY3A 3I2IA 3JQGA 5EINA 2DMRA 1HNWB 3CUWA 1QH8B 2CCKA 4GT1A 1ILEA 4JPSA 2NSYA 3ETJA 2IONA 4UPVA 1RP1A 1NG9A 2A90A 5BSEA 3LA8A 4QQRA 1ZGAA 3EOAI 5GM1A 3IUBA 3UAVA 4RVNA 5DLQC 2X5XA 3GT3A 3UJPA 4YJ2F 5IFKA 1KI3A 1IM5A 1EVZA 4J7XA 3LCRA 3SY2A 3D6AA 4KWTA 4IZOA 2C98A 5AK6A 4F1PA 1SHJA 2BFAA 5CLIA 1QHSA 3K20A 1AY0A 3DCJA 3RK6A 1OZFA 3WA7A 2W6PA 2ZYTX 2P6OA 4N9WA 1JYFA 4C9BB 1QVAA 5A3SA 1KLXA 3U4AA 1L5KA 1V3UA 4MRSA 2RAVA 3DBHA 2KZTA 4L7TA 5J1SB 2NUTB 3HWWA 1EQUA 3WGMA 3RYCB 1XDZA 5FNZA 1JKIA 3GY0A 4GM1A 4EL5A 2Q3JA 4UPDA 2OEWA 1IN5A 4JODA 4RHEA 3TZEA 3NYQA 5BN5A 1FNCA 1P8JA 4KXFB 1LRJA 1K63A 5K0BA 1AS3A 1BKSB 1E3QA 1IUOA 1JHAA 4H59A 4XWYA 1M8KA 1GL9B 2CNDA 2I6GA 1DO8A 2XZPA 3AQ4A 3BB1A 3MCUA 1H19A 3T12A 5K8VA 3DXMG 1X7HA 2V9ZA 1OZGA 1KIMA 1NBEA 4PN7A 1YQEA 1YVPA 2H5EA 2CXRA 3C6QA 4RNCA 4A3TA 2VBGA 2ZYHA 3FYUA 3OHPA 3BIXA 2HK6A 2VT6A 4HFJA 4D8UA 4GX0A 1IN1A 3C87A 4DCJA 2CD9A 3C85A 2O8DB 3O75A 3PXBA 4PLYA 3CB4A 4OLJA 3AM5A 3WLOA 4EITA 4DOMA 1CETA 1KE2A 4LQLA 1GLVA 3DHEA 5LZ8A 4KK3A 1RU3A 2IHYA 4JQSA 4EYKA 4HAUA 2VGXB 3TSWA 3ZK8A 4Q4HA 3EEFA 2F67A 4L51A 7MDHA 5B1AE 4QOGA 4X1IB 3ZJ4A 2CDAA 4DVGA 3URMA 5DM0A 4K28A 1DBSA 5KPJA 4GZDA 4I19A 2RI6A 3V48A 2Q2WA 2OOKA 4HPWA 2Q5HA 1OFUX 2H17A 2HJRA 4JYBA 4R2KA 1O2DA 4C04A 4UTPA 1G64A 1WDLA 1N0VC 4X1OA 4ZVQA 3WK8A 4IJVA 2IIPA 3V9AA 3FF1A 4YYEA 1XQ9A 3QITA 2VGXA 1GN8A 1FTNA 4QZVA 5I48A 4ZHSA 4R1QA 1VG1A 1G19A 2XZDA 3EIFA 1Z62A 4YAJA 4AMVA 5LSAA 3AM1A 4EB6B 4UU7A 3OIYA 3JPYA 3L01A 4KQFA 4DYVA 5FLEX 1Y1RA 4EP1A 5IDWA 3ROTA 1NNUA 3ZEAA 5SY6A 1GPBA 4DUIA 3EY9A 4RIFA 1MD9A 3DULA 3PP8A 1JJBA 4ZFNA 5CFRA 4OQPA 3GYZA 5KYGA 1Q7TA 2XJ4A 3SQWA 2NC9A 1CFZA 3T7KA 3Q7PA 4EG8A 1ZJ6A 2HU5A 3LOPA 3JXJA 2ZULA 5FWNA 2JAHA 4WLEA 1H6CA 3D1VA 2FZGA 3G1WA 2X40A 2UUBB 2V5AA 2QL7A 2ZTMA 1Z6PA 1DMRA 2PT7A 1NNEA 1QC5A 3TPCA 4CIYA 3M2PA 5AXBA 4L2IB 2JI4A 3P45A 3OQVA 2ZDQA 3KG2A 2RGGA 1KQGA 2M2IA 2QXYA 1DDOA 2ZFUA 5CVCA 1V35A 3TWWA 1J7KA 3N8DA 4G5XA 4I1YA 2BFEB 2C5BA 1U6JA 3KLNA 3QWIA 3L7BA 4NOMA 4BNVA 1U8EA 2G9NA 3VR4A 4Q16A 3MJDA 3M5PA 4UAGA 7YASA 3MRXA 5I8WA 4R54A 2Y1LE 2G8LA 2V7VA 3EA5A 3C97A 4UHFA 3V3LA 4QSHA 4Y3UA 2J4DA 4N3AA 2W6NA 3GPIA 4CV1A 2G5GX 3EBLA 3LOUA 1UN9A 3C7AA 1C3JA 2VHTA 5CT9A 3EEBA 1SXIA 3NYWA 4EHIA 3R09A 2HHAA 2X42A 3FUTA 4K1XA 4CPDA 4B3JA 2EINE 5TT1A 2OZPA 1BDJA 2RBGA 5E4YA 3F7OA 3FDXA 2EWVA 3JWJA 5C4GB 4PLTA 1SGWA 2FJAB 3O83A 1TUIA 4U2DA 5D5HA 4BNYA 5ADHA 2ZUCA 3NHRA 3O2QB 1JHQA 3MLAA 3FGOA 2OV4A 4W63A 2L42A 4Y2XA 3ZGQA 1YZTA 4KOAA 2UAGA 1P0FA 1W1WA 3O4RA 2F1RA 4J2HA 1L8LA 4LF9B 1Q7BA 1C2TA 1NJ8A 4M60A 5ALKA 3O2NA 4O1IA 4R8RA 5A9RA 2WQ7A 4G85A 2ZBRA 3EGVA 4IUYA 4DMKA 1O89A 1T29A 4UFNA 3CBQA 5HM6A 1NQOA 3E9MA 3QUTA 1P0CA 1QPBA 3Q85A 1PAQA 4LJYA 2PZAA 2XGJA 3A9TA 4Z9XA 4WDQA 2CNLA 1EFRD 5DSZA 3S2UA 2AFHE 3KL4A 4C4AA 3PHBE 1OFUA 2HOQA 3K6JA 5IVDA 3RCBA 4AKSA 3DVSX 5CDHA 4D9MA 3H16A 4CLRA 4Y18A 2KXPC 3QOUA 1Z13A 2W83A 4KPUA 2V65A 4OHWA 5AIJA 4PR0A 2VUIB 4WX2B 4Y9UA 2KX7A 3RIGA 1N36B 3OWOA 3MB8A 1K6JA 1SZPA 3CX6A 1EPUA 1RW4A 1ZOIA 2F9LA 1WSAA 1O94A 2HRCA 3EFOA 3TGOA 3OO0A 2K87A 4RXTA 4A9AA 2XYHA 3E9YA 4Z0NA 3MD0A 1FMFA 5BQ3A 3TXYA 5KNDH 1OTHA 2H11A 2P2GA 4B6JA 2CV0A 1MX3A 1YL7A 2DPHA 3CU5A 2YRFA 1QO0A 2BJHA 3T7DA 1TGYA 2RHRA 5IVHA 3EWNA 3N0XA 2PL1A 4HDKB 3UINC 3AR9A 2VSOE 4I2WA 3IPXA 5ALVA 2QWXA 1QH1A 1ZG3A 3FH0A 5KIAA 3C3OA 3BMNA 3IEMA 4UXHA 5T3RA 1GY8A 4UHJA 1WSWA 1ZIYA 2ERCA 1XLVA 4YBRA 5T7BA 5ANLA 2JJYA 1JQBA 4IHJF 4R51A 4V39A 4C2UA 3G6WA 4MW6A 2Q6TA 3ZVLA 1Z07A 4B0OA 2ZR8A 2G80A 3HFGA 3MC1A 2YKGA 1A71A 3AEZA 2ISQA 1SVSA 2XW6A 3MTEA 3S55A 3SZGA 1HM5A 2DE0X 4HI9A 3KFVA 1MAWA 1P9LA 2QIPA 4IIBA 2UYQA 4MO9A 5DLEA 3WYDA 3TWXA 5A5DA 2NP7A 1XZNA 3EIUA 4MAFA 4ZO6A 4OQYA 1I7NA 4IPTA 2YWEA 4KQKA 1Z37A 1P4SA 2EJBA 3QFFA 2P30A 4XDGA 1M1XB 1E2NA 2VOEA 1J00A 3WLNA 4EHDA 3ONWA 1J23A 1JFLA 4CM3A 2JCGA 1DG3A 5JPDA 3T5VA 3ZDCA 4EX6A 3QE2A 2I29A 3CURA 5F52A 4CFZA 1HC7A 5ESXA 3NHAA 1BDIA 2IUSA 1SWVA 3C3YA 4ZV9A 3U4HA 5JS8A 4PIVA 5BWBA 1FXWA 3GGJA 4NZNA 4DV0B 5TQ0A 1W0CA 1NPYA 2JHFA 3TLZA 4X64B 5HFNA 2EJTA 3OZSA 3MZLB 4H2DA 4PH4B 2BM9A 4Q37A 3NUZA 2IHVA 2R8RA 4CI0B 3UBTA 4JOSA 3FUEA 1B0ZA 1RZUA 5I9TA 3MJRA 4MW9A 1OX4B 1BGVA 1UWLA 3SKVA 5H9WA 2ZI9A 2H06A 4HMOA 3FTZA 4JBIA 4UD2A 3UGQA 4DADA 2IDJA 1X7YB 3RAFC 4WXHA 5TS2A 3FCOA 1QORA 2R6AA 3FCEA 3AF1A 1EJ0A 3PIIA 2OUIA 3EMDA 2NNLD 1FU7A 3FNHA 4X8HA 4F72A 4XWKA 1D8TA 1BMFD 3WADA 2GCIA 1N7JA 2ZJ4A 3DZFA 4NOKA 2EYUA 3HDJA 4G4JA 1R10A 3HB4X 3K5IA 3S2IA 4BZWA 3NGMA 3BG5A 3W79A 3QVOA 2O8EA 1U3CA 3ET4A 1P6QA 1I0ZA 2OKGA 1BI8B 3MCZA 4GS5A 4LJ7A 3UV7A 3ZXIA 2PWBA 1JTVA 4URKA 2V54A 3KETA 1SXJE 4DRYA 1NA3A 2OVFA 4GZCA 1O94D 1P4GA 2V3VA 3AHFA 3O1JC 4MRRA 5TEWA 1RXSA 4TLAA 4ZDWA 3UKDA 3H83A 5COQA 1I7PA 5KKNB 3ZKAA 1YC5A 2BEVB 2Q5EA 3LWZA 4KGXA 5I7HA 1N5OX 1EVQA 5KCMA 1DIHA 1DIGA 2WJPA 1Y6GA 1ORDA 2REQB 4M99A 3FNRA 2LUHA 1CRQA 3EDQA 3Q40A 3BN3A 4AU1A 1ML3A 2G88A 3A1EA 4G5YA 5JS2A 3C98A 1FS4A 3M6XA 3TQHA 1K92A 5DX8A 4AJHA 1NXQA 1JPVA 2EW1A 3EXFB 4Z53A 3C14C 5CM9C 1SUBA 1QU3A 5FWYB 3G2KA 2JH3A 1CY1A 3WLEA 3EIOA 4MUAA 1ISJA 2XUKA 2ZJYA 4WLNA 5EMMA 3SOPA 3DCNA 3VR5D 1LPMA 1TMGE 4JKIA 5CRIA 3A70A 1T4DA 1YA4A 1ZL0A 3DQZA 1ELKA 2XUZA 3P1JA 2WSIA 1GL6A 3DNFA 3OZVA 2R65A 1A8PA 1J2EA 3RASA 4I3FA 3UWDA 5JANA 2WAOA 4KXUA 5SV2A 1XTRA 5HIMA 1BJKA 4FLHA 3HVEA 3DW1X 4OMCA 1NI5A 2W6ZA 3KSBC 4NBVA 4W9MC 2AC7A 3Q2OA 3BCSA 4EQFA 1LC3A 4NMWA 1FBTA 3AXSA 2QN2A 1LRKA 4JHXA 4M22A 4OQMA 5EJGA 2BEJA 1I2BA 3EAFA 3NYRA 5TLSA 3OI7A 1JHYA 5AQ9A 2HPHA 2BMVA 1ZIOA 2MWMA 2A57A 2PHZA 3FAKA 2EFEB 3G79A 4FFRA 4I5EA 4EVSA 3HVEB 4URVR 2F8YA 1Y7HA 2R1TA 1HFJA 1ZRHA 4R1TA 3LRPA 5CVVA 1VPVA 3DMFA 4NZYA 1T2EA 3J7TA 5L3QB 1IKND 3V5NA 4FHJA 2ZYSA 3T5CA 2PUCA 3WLHA 2AK3A 1KZ9A 3LXXA 3HDGA 3WB1A 1CEEA 1SCUB 4DR1B 1DINA 1NU6A 4L4XA 4YQEA 5DTRA 3LPMA 4BNHA 2R6R1 1UDXA 2B0JA 5TY0A 3DXFA 5IVIA 2E48A 1AN9A 3GAZA 2R1TB 3N2ZB 3R3XA 4YN3A 3PNMA 3KTFA 1AS0A 3KQPA 2FDCA 3ZZMA 1E8WA 2YJGA 1WSDA 1JCSA 4YCLA 2IQ5A 4LDAA 5EJFA 2VC2B 1QS0B 1R27A 4XUEA 3W3AD 1TJCA 2COUA 1L8AA 4J0CA 4W6QA 2IYYA 1UQTA 2WWFA 1VJDA 2H4YA 4FDUA 5CNIA 2GBGA 3M2TA 4MJ7A 4DARA 3BMOB 2CG2A 3ZXSA 5LFAA 3JQPA 1F48A 3U13A 4LNUA 3L6OO 4UNIA 2NQTA 4P2GA 1OKKA 4Q1BA 1NUUA 3G0OA 5ILOA 3H2GA 2VH1A 3RRJA 4S1PA 1CUIA 5E7QA 1BDBA 3VR5A 1U2SA 3U7GA 1N7IA 4L76A 1XQWA 4MW5A 3L84A 2IYOA 3FZQA 2IIVA 2JH8A 4BRUA 1QRSA 1N6PA 4Y1GA 5I5GA 3PUIA 4MRMA 4UCXA 1N6OA 2BUBA 2HU2A 2IKSA 4I46A 4PV7A 3L7OA 2C5EA 3E1SA 4OGLA 1GQYA 4AZVA 1B76A 1MIOB 2EFGA 4RPIA 3DMHA 3CCBA 3IBTA 4HDNB 2VQFB 4A0GA 4K0RA 2G0TA 3Q10A 2AWNA 4U2FA 5HKBA 2LCQA 3S2ZA 5JTTA 1U81A 1ICIA 5AW7A 3JAKB 1FPMA 3WYCA 4QGSA 3GAAA 1D5WA 4WKNA 4WN3A 3CR3A 1GYPA 2Q1YA 1LF5A 3V2HA 3K6SA 1ZJWA 1NY5A 1E1NA 5D3KA 3GFPA 5A7HA 4MQMA 5FDFA 2GM9A 3HG7A 2JHCA 2WXQA 4ASUA 3VUEA 1HKHA 2JL1A 1U0FA 3SKXA 2RK6A 2W2VA 3WQSB 4WZBE 2OHVA 2C77A 4KN6A 1XYVA 2Q28A 2VA9A 3EVBA 3JASB 4FR5A 4GI1A 4F92B 3KBBA 5BOSA 2BSQA 4GAAA 4MICA 4H77A 2QZJA 4CKCA 1K6IA 5BUZA 3KU1A 1DTSA 1FRQA 2HA5A 1QB7A 3Q1KA 3FNIA 4KAJA 3NMUF 1LBIA 5D87A 4JSRA 3MTQA 4D6YA 3NUGA 1EXNA 4J8YA 4DY4A 4DIDA 3D9NA 1IBRA 4HGRA 1BA3A 3FUMA 1FOEB 4I55F 2KBEA 3ZY3A 2FVXA 2REXB 3RTDA 1FX0A 2C3MA 2Q8QA 4MWEA 5EX3A 4LE0A 5LOZA 2P9GA 3WGTA 4I9HA 4TTTS 2O07A 4LNAA 1UPCA 4EG5A 1M74A 3K70B 4FYKA 3B3QA 1NP6A 4JVSB 4ILGA 4G0OA 4RDHA 2FGKA 3RT1A 3ZS8A 4JI4B 1TAQA 1D1QA 4IVQA 4MDHA 3IIJA 4B94A 4BDSA 4GH5A 5SYMA 1RT9A 3A4TA 4BNTA 1J2UA 1RAAA 2IYSA 2Q6IA 2W2KA 3P2JA 2HLHA 4FHCA 1KT1A 3GRPA 4KLNA 3AJDA 1Z74A 1N52A 1G63A 4ALKA 1YIDA 4BMZA 1DHTA 2FMKA 3GOQA 3LKBA 4OB7A 5FNVA 1DKRA 2Z04A 2PH7A 1FQWA 2G4LA 3NEPX 5JAPA 4TWZA 3R7FA 3ITDA 4FYIA 4C88A 4PC3A 3VA7A 2H6FA 1JDSA 3EGXA 2C2MA 1JDBB 3H2YA 4TUYF 3RE1A 3PT5A 3K8YA 1FMLA 4U0KA 4RH3A 2QZZA 4F93B 2YCBA 4I50A 1HKUA 4WNGA 4BHTA 4BYMA 4CMCA 3OT1A 3JQAB 4DMUB 2JJ1D 1CNMA 2ZI5A 3OX2A 3ZY4A 3VZRA 1LU9A 3OZ7A 5MN6A 1R0RE 1K88A 4CIVA 3W4JA 4DR2B 4EGQA 3FMFA 3K2QA 1GSOA 1ZN9A 4KPFC 2VJMB 3RUFA 4LC9A 1E5TA 1DZIA 5BVGB 4C1NA 1NVMB 1Q0QA 2Z1NA 2X6HA 2XCSB 4JA0A 4Z0PA 5L4SA 1H66A 1BD4A 1DWQA 4HN2A 3ROPA 3FTEA 2XQJA 1A88A 3TXMA 2I2FA 2V6JA 5B4TA 2ODEA 1NJSA 4BKUA 4M2LA 1BWRA 1J22A 2J59A 2R17C 3FSGD 3L46A 4GR4A 3WLJA 1S8FA 4BWYA 3D5QA 3PQ4A 1L5QA 4ED9A 1R00A 3CPEA 2OBFA 1G5QA 4P53A 1H9AA 4H6XA 3K72B 2Z08A 5JC1A 2Y1OA 3CT6A 5INTA 4ME6A 2KLBA 3DHWC 4ZRMA 5EY5B 3ZK9A 3TFQA 2G0NA 2PKWA 1R8YA 3PUJA 1T4GA 3HXEA 2WOJA 1XROA 2QR5A 3GJ6A 3R3UA 2I1WA 2FFHA 4AJLA 4V03A 4P22A 3RNOA 2GXAA 4L22A 4J6IA 2PRIA 4ETIA 4NACA 1ZK0A 3BFKA 1YCSB 3Q72A 2YC2C 4YRLA 1A9OA 4HZIA 1PLKA 3GMIA 2M63A 3C5EA 2JK0A 3IRVA 2ZGDA 4WUYA 4NK5A 1ZM4A 4ND4A 2DLCX 4TRMA 5FUMA 1CUCA 2GW1A 3B7RL 1YZNA 2QZ4A 3QARA 2BI7A 3F8SA 3FG9A 1DP4A 1WRBA 2ZJZA 4O29A 3VUFA 2OHJA 3AL0C 4KZ0A 4EKNB 1UPUA 1W4LA 1XU7A 2AT1A 2J7PD 5LN1A 4YALA 4EA8A 3LO5A 3L0BA 4QGFA 3S7BA 4N5MA 2CNBA 1K86A 3BEOA 5KO2A 4CTKA 4JBNA 2YXPX 4I4CA 2VSXE 1Y1KE 2IU4A 3EEIA 3GNLA 4Y9DA 1QYMA 1O97C <