4XIFA

Human ogt in complex with udp-5s-glcnac and substrate peptide (keratin-7)
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
717
structure length
702
Chain Sequence
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The active site of O-GlcNAc transferase imposes constraints on substrate sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 268
structure length 702
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xifA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xifA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4xifA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4xifA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xifA03
1ZU2A 3MS4A 4Y6CA 2C0MA 3NAZA 4REMA 1PSWA 1UZUA 1Z8DA 3OTHA 2JJMA 3NB0A 2IW1A 1E96B 2VGXB 2ECPA 3CK7A 3N71A 4FZRA 3G2LA 4M60A 3RHZA 3VDMA 4GZ6A 4N9WA 4AM9A 1KTIA 3PE3A 4HWGA 3OTIA 4I9CA 5D0QD 2QN1A 2F3QA 2FETA 2UY1A 4G23A 4KYOB 4NRHB 3AS4A 3MV2B 1WV1A 3R9AB 1B4DA 2BUGA 3MT7A 3SYMA 1NOIA 8GPBA 3T3GA 1PC2A 3OKAA 2KATA 5FJYA 3G2IA 3NP7A 4W6QA 1O6CA 1L7XA 4AY5A 1ABBA 3ZCSA 4RELA 3ASDA 1HH8A 1VGVA 2C9ZA 4X7RA 3OXGA 3MEKA 3MTBA 3VUFA 4HOSA 5C1DA 5LCWC 3EBPA 2XGSA 4H7XA 2PRIA 2GEKA 1OUVA 1F6DA 3GUHA 2ASVA 3C4QA 3OT5A 2QRHA 3OXLA 3T5TA 2QZSA 2XEVA 4GCOA 5FZSA 4BQIA 3SYRA 1XOIA 1FTWA 3L01A 1SXPA 4WHMA 5CCLA 5D0OD 4G2VA 4YUAA 4HOUA 3PE4A 3ZCPA 2KCVA 1LWOA 4KBQA 2ONDA 1C8LA 5JTUA 4GZ5A 2X6QA 5AYWD 4JA7A 3RIBA 3QKWA 3OY7A 5DBKA 1Y6FA 2XGOA 2QRQA 2IV7A 1NZNA 1AXRA 3C4VA 1E4OA 3TGOA 1P4HA 2PQ6A 1KT0A 3MQFA 3C48A 1IYGA 3ZPJA 1YA6A 3SF4A 3PDNA 3UPVA 4N2SA 3VTYA 2FO7A 3IEGA 3WXXA 3AMVA 2G9RA 4UI9C 4MRAA 4I1AA 2R5SA 5KJNA 2HY7A 5DU2A 4X7MA 1JIXA 2FBNA 3CKBA 3BD7A 1NOJA 5EKQD 2H1HA 2P6PA 3MS2A 2ATIA 4MI9A 2WPVA 3CK8A 3URZA 3S29A 1QKJA 2OFFA 4WNGA 5FT9A 2PL2A 2VCHA 3MS7A 3LPZA 1P29A 3S28A 1B89A 2OOEA 4L22A 3MBOA 1WAO1 4BWRA 2XCIA 1RRVA 4I9EA 4JHRA 1XL0A 4G24A 2BGTA 3GZ1A 1GZ5A 3CX4A 4RG9A 2H1FA 1HLFA 2Y4UA 3RSZA 2GW1A 4UQXA 2C0LA 3TOVA 1FU4A 1L5VA 3UQ3A 3L7AA 3MT8A 2LSUA 1NZFA 3MV3B 2BGUA 5ARFA 2VSNA 3U4TA 3OXFA 2AV6A 3BCSA 4ME2A 2IUYA 4BQFA 4LEUA 2AZDA 2C1ZA 2X0EA 3HYMB 2GPBA 1WW3A 4NEQA 1C50A 1FU7A 3CVLA 1Y8MA 4Z5XA 3ESKA 4RIEA 1H5UA 2L6JA 3QWVA 2XA9A 1W3BA 3O48A 5FZQA 4RIGA 4BTAA 5TMBA 1P5QA 2QN8A 5DXFA 1C8KA 2C1XA 5BW8C 1JIUA 3BCUA 2GPNA 3EDTB 5EX3A 5TVGA 4RIHA 3CEMA 3QHPA 2F3PA 3CUWA 3MTAA 4EL5A 4RG6A 1AHPA 1IIRA 3MRXA 5HXAA 2PQRA 1L5QA 2Y4TA 2VSYA 4XIFA 2VQ2A 5GPBA 1GFZA 3ZHEB 4WNDA 4YI5A 5JTTA 4BT8A 5A7DB 5KJKA 2Q6VA 2AW3A 3ZFWA 3RKVA 5KJLA 3LKUA 1FCHA 3COPA 4IN3B 5HQ8A 2PQNA 3MRTA 3NP9A 5LQDA 4RIFA 1XNFA 4WNEA 4AY6A 4WNFA 4WUYA 4J0UA 1HZ4A 1FC0A 2PYDA 2UY1B 3MT9A 1K06A 4GPBA 4JL0A 1GPYA 3MRVA 2VGYA 2IF4A 4CGVA 3TSAA 5BT1A 1XL1A 4GA1A 4U0SA 5ARGA 3ZGQA 4GA0A 1GPBA 3BD6A 2YJNA 4NC9A 1ELWA 2KC7A 4RENA 3HBJA 2XPIA 3S0JA 3JYSA 2MHKA 1NA0A 4G1TA 4HOQA 5I45A 1NVKA 1IHGA 3OY2A 4MHOA 2GJ4A 1RZVA 5A6CA 4I2WA 4CDRA 4NESA 3UYLA 4I2ZA 3RO2A 2J9QA 4G2TA 3E3LA 1TJCA 3CUVA 3S7FA 2HO1A 1A17A 3CKCA 3L7CA 4M7PA 2IYAA 4PQGA 2WQHA 1HXIA 3CUYA 3QDNA 1WM5A 3VDNB 4GPKA 2XA1A 3ASHA 4J8EA 1L5SA 4APOA 1FU8A 3ZN3A 2GT1A 4F96A 3QOUA 1JG7A 4A1SA 2C4MA 3DZCA 3S2UA 2VYIA 1P2DA 3L7DA 3EBOA 2V5FA 4WACA 4U04A 1WUYA 3TAXA 1WV0A 2PRJA 3CK9A 3G2NA 3BEOA 1EXVA 4G26A 1L5RA 2R68A 2VG8A 1P2GA 2R4UA 3CEHA 1NA3A 1M5RA 3UYKA 3VUEA 3WAGA 1Y6GA 1GPAA 2BISA 1LWNA 3NCHA 4G25A 1J39A 2C2LA 4UI9K 3Q3HA 3KAEA 4YNDA 4F9FA 4XI0A 5TMDA 2FF4A 3GW4A 2HR2A 3FROA 4J8FA 1PYGA 3T3HA 5KJMA 4MHSA 4GCNA 2G9UA 3LY7A 4RBNA 9GPBA 1FTQA 1P4GA 3DD1A 5DIZA 4CTNA 2DBAA 4UQZA 1XV5A 2FEZA 2IV3A 1KT1A 2HYZA 3MA5A 5BNWA 2KS6A 2IEGA 2QLLA 3CV3A 1UQTA 4GYWA 1NZDA 4F97A 2GEJA 2QFCA 2SKCA 1V4VA 3D1JA 2SKEA 1K08A 2WTXA 5JJTA 3MKRA 1Z62A 3L7BA 3QKYA 4BT9A 2R60A 4U0UA 3ZCRA 4UI9J 4GYYA 3G2HA 4Y6WA 3ZCTA 2QLMA 4N39A 1L5WA 4F3VA 1F0KA 3SZ7A 3D0RA 1SXQA 5G04J 2YQ8A 4YI3A 5M72A 4ABNA 4X7PA 3RSCA 1YGPA 3NF1A 2FF5A 4GZ3A 3E3OA 2P58C 3ZHEA 5HI7A 1QZ2A 5JJ6A 4CGWA 2F9FA 1KLXA 2ZB2A 3TG4A 2O6LA 2XMPA 1JIVA 3BDAA 4U0ZA 1ZBPA 3ZCQA 1XC7A 4EQFA 3IAAA 3CUTA 1JEJA 2R66A 3KS2A 3CV0A 5IKOA 4U07A 3AS5A 1PNVA 4EKYA 3E4BA 3ASFA 1QQEA 4I17A 4WADA 3T3DA 4KQMA 1ELRA 1L6IA 3QWWA 2QN3A 4B94A 4AN4A 2ACWA 2QLNA 2X6RA 2LSVA 3HBNA 1NOKA 2JLBA 5G04C 4GA2A 4KQ1A 1E1YA 2QRMA 4N3CA 3K9IA 2Q7FA 4N3BA 1FS4A 2UWJG 3Q49B 1WUTA 3U3WA 3Q15A 4LDPA 5G05C 1YA0A 3OKPA 4HORA 2PYIA 4EKEA 3S7JA 3S7DA 3MTDA 1NLMA 3WC4A 4BTBA 5CCMA 3TG5A 3ZCUA 5TMEA 6GPBA 4LEIA 3MSCA 5CHEE 3CVNA 3NPAA 3GZ2A 2VGXA 2XCUA 2QRGA 4YVOA 5G05J 5JJ7A 3T3EA 2JZCA 2R4TA 2LNIA 1FA9A 1PN3A 2QNBA 2SKDA 3OKCA 3ULQA 4HLNA 4KQ2A 3G2JA 5LCWJ 3RT1A 1RZUA 1QM5A 3IA7A 4GYOA 3S27A 5ENZA 3QWPA 4HOTA 3FWVA 3HBFA 4MI3A 1WW2A 3O3CA 2QRPA 3DDSA 3T3IA 4KXKB 3UUXA 4MI6A 4NQ0A 2F3UA 2XGMA 1UQUA 4X6LA 1A8IA 4N3AA 4YVQC 2NC9A 4FKZA 5IKPA 3T7DA 1P4JA 4O6FA 2ACVA 4M83A 5FZRA 1JG6A 3DDWA 4EL0A 3ASGA 4XI9A 3BEEA 5D00A 3RU0A 3Q47B 3GPBA 2I6HA 2G9VA 2X0DA 4AIFA 1C3JA 3CVPA 3KD7A 4RIIA 3G2KA 1Y8ZA 4BFCA 4W9RA 4BQEA 3NC4A 3S7BA 3CVQA 2XCCA 3Q3IA 2QN7A 2XA2A 2G9QA 2FFRA 5D01A 4QLBA 4AMGA 4J8DA 3RO3A 3FFLA 1Z6QA 2F3SA 3H4TA 3HBMA 3H4IA 2AVPA 1BX3A 3LCAA 3CEQA 1XKXA 2QN9A 1GG8A 2IEIA 3D0QA 1P2BA 2IYFA 2IFUA 3Q4AB 2AMVA 3E3NA 3GYZA 5EX0A 2VCEA 3LY8A 2FI7A 3LY9A 3CUUA 3Q3EA 1FTYA 3BCRA 4AMBA 2PZIA 3ZCVA 3VTXA 2KCLA 3LYAA 3FP3A 4UQYA 4CTMA 5FTPA 2KCKA 2GM9A 4H7YA 3RJVA 2E2EA 3Q5MA 4JA9A 4EJ2A 4CTOA 1Z6PA 5DLDA 1EM6A 2YHCA 2QN2A 1GGNA 3L79A 4MICA 2X0FA 3BD8A 7GPBA 4N5CA 2GPAA 3CEJA 3WADA 1IXYA 2XCBA 2BFWA 3OTGA 3AS8A 4N2QA
chains in the Genus database with same CATH superfamily
2J5KA 4O08A 4D7AA 2OCDA 4BMZA 1F2VA 3C3RA 1FBNA 1JZTA 1Z8DA 2B8NA 1UAYA 2FPGB 1U6KA 3RT7A 3CK7A 1JPUA 1UBJS 5DM2A 4Q96A 1S2IA 3VDMA 1DP4A 4IJWA 3WHLA 3GP8A 2NUTA 4LF9B 4Q5IA 2NVUB 1FP7A 3B3QA 4IDFA 3CHQA 1YDWA 4HWGA 5J2UB 3GVPA 1Z7YA 1NQVA 2JCXA 1QIIA 4RGQA 1MB4A 1VJCA 3PZ3A 1XGWA 1NSTA 3ZU7B 1MJGM 5EMLA 4N4AA 3RARA 2X6TA 1U0BB 4JY7A 2OBMA 2YL2A 4O1IA 4OA5A 2PT7A 4OI0A 5CX4A 3L8YA 3UOWA 4E6EA 4FHJA 3AY3A 1CSEE 1M1YA 1UK6A 2VTEA 4G5GA 3OCWA 4YGYA 5CEEA 4ZMRA 1B8NA 2KM4A 1JYSA 1RZRD 1Y1LA 1OPRA 1U6IA 3U7EB 5KO2A 3EEBA 2EWMA 4PG5A 5HQ3B 1EUDA 3ZY3A 1BDBA 3K0EA 3JQGB 3A36A 5AKYA 3ZCSA 4D4KA 2D74A 1SU8A 2BHNA 4EMSA 2BBOA 1HEUA 1L4BA 4AD8A 2ZROA 4V0OA 4TPKA 4YAIA 4MKHA 4XWOA 4AUEA 4Z8XA 1NMSA 3WZ2A 1TEHA 4DSOA 3W7AA 2VTDA 1U80A 1D03A 3GFTA 3HO6A 3WNVA 1MX3A 2W11A 1RXUA 2JNWA 1E8OA 3C4QA 3GJ8A 5CJ2A 5DGCA 1CPYA 3UAXA 3OE7D 5E6UB 1YA8A 2KJZA 4AJ4A 5J1TB 4K46A 4BQIA 4XEHA 5K8VA 4CEHA 3K6SB 1KH1A 1ZD5A 1KA9H 1H6DA 3ZQ4A 2NYJA 1DE0A 2B99A 3D3EA 4HTAA 3TW6A 3P2JA 4YUAA 5I7EA 2BE9A 3CUKA 3HWSA 1MIOB 4OREX 5AOCA 4NG4A 4PLYA 3LX5A 3V1KA 5JXIA 3TFOA 1XAJA 3EXEA 4J75A 4ACBA 5CXXA 2P9TA 3BFKA 3FSEA 5AVUA 5CG2A 3L4JA 1YL5A 4R51A 2V9PA 3QSYA 4MYSA 4X3OA 4Z4CA 4AZVA 5CLJA 5AI9A 2Z6UA 3QU5A 4IKEA 1GCGA 2Z0MA 3KR2A 3SSOA 3AI1A 4BYGA 1I3OA 3LO5A 4ERXA 4YHHB 3IEGA 1XI2A 3CZQA 5ALKA 4D57A 1KSHA 5JS8A 1W52X 2W6CX 1RJDA 4RJKA 2GMWA 3QV1A 1JA1A 1KP3A 1MB9A 3HYTA 3KC2A 2V1UA 3O31A 2QQ0A 4GUDA 4LW8A 1UF9A 3WK9A 5LPNA 2E4AA 3DEIA 4ACKA 4YP5A 1Y9AA 3MUFA 5FBLB 4ZKEA 2VNJA 3RVDA 3EPHA 1NM5C 1H2ZA 3SICE 1OZ0A 1RE0A 4TQAA 1L5HA 1YQEA 4GTRA 1YWGO 2VBGA 3FUCA 4MVXA 5F35A 3RYTC 3V46A 3K5HA 4NCXA 3U5TA 5K0NA 3ZWWA 4KH1A 2F1OA 3MS7A 4WZBA 5IBPA 4F45A 2O3JA 2OVBA 1LFAA 1DO0A 1OJ7A 4GZDA 1WAO1 2ROQA 5BY2A 2ZWAA 5B58T 3I4RB 1T6NA 3ZOZA 3MD9A 2GA9A 2ID7A 1Z5NA 3TQRA 4JHRA 3ZTTA 2ZUFA 4M9ZA 1NBHA 1MRNA 3NH9A 1YONA 4R0VA 4ZQEA 1US8A 3VNQA 4D10C 3C3KA 3AJRA 3W8EA 4LZJA 3TOVA 4M22A 2I4TA 3LC2O 4EZLA 2H4YA 3DE5X 4OGWA 5EZYA 1TI7A 1W35A 2OV2A 3G2UA 2FMFA 1W1WA 5FWQA 4OQLA 2H9YA 3NHFA 4UMFA 3FCUB 4G4GA 1U7OA 5EZQA 4UOEA 1G20E 3SEFA 5LB4A 5I9IA 5TQ2B 1PBNA 1FFCA 3EWIA 5LZ8A 4LEUA 4Q34A 3JQEA 1JJ7A 3FR7A 4BGUA 4K5CA 2DY0A 3H0EA 4H2DA 1BDMA 3SHTA 3KKOA 3UUGA 2POCA 1T8TA 2WEKA 2J33A 2WT4A 3DW3X 4C04A 1A98A 1DL5A 3DH0A 3T5AA 3KQNA 3RS0A 3JZDA 1U04A 2JJ2A 3O6VA 4P98A 3ESZA 6PFKA 1J0CA 3ZHRA 1J42A 4G0MA 4P29A 2Z8XA 1DTWA 4W1QA 3NHYA 2VF8A 1E4YA 5IP5A 3E9DA 2DXIA 1B6GA 1JIJA 2C83A 3V1YA 5KNDA 3PD7A 5TEVA 4PQEA 4RHXA 3RD5A 2IJGX 3EASA 3WMGA 5KPJA 2F3TA 3N2EA 4LNBA 1CB7A 2FZ4A 4Q1VA 4BX0A 4PLFA 1XNHA 2WT9A 2ZT6A 1Q12A 4XASA 4ERNA 3EIQC 5AVQA 2G0TA 2X6FA 1BJRE 1XE3A 2NTYC 5CERB 3E5RA 3KPWA 3PTLA 4ANFA 2W6QA 4E08A 5C7LO 5KS2A 4F7DA 5LWQA 2BAGA 4WXPA 3GRPA 1GFZA 3R5KA 4MWGA 4Z0NA 4YALA 1NPTO 3IPRA 2X5JO 1RAGA 4LQLA 3WTBA 3G1TA 2FUG1 2Q50A 3R5HA 4XDZA 2O0HA 4AJLA 4QUKA 4GX0A 4L72A 2PQNA 3UT5A 4TL6A 2DLCX 2PX5A 3DE7X 2CK3A 4P3OA 3KVRA 3ADCA 1XA3A 3W5SA 5C52B 1PGNA 3A70A 1X9GA 4HXEB 4FUTA 3VYUB 4BLRA 2X1MA 2DB3A 4NIKA 2QUKA 1T5BA 2IE8A 3HDVA 3ROXA 3I6MA 2GCPA 4UARA 4K9LA 1Q2UA 4U7PB 4RMGA 4XJVA 2C84A 3DHVA 3RGGA 5FWXB 5HGXA 4Q82A 4JC8A 4HQKA 3HWRA 4WD3A 4HI9A 2XMZA 1W5SA 3ZJYA 3M1YA 4FFBA 4A2PA 1DEAA 1FYWA 3N3AC 4EF4A 4BQQA 3T1TA 2R9VA 4O8CA 3SHQA 2ZJ0A 2NO1A 5ARDA 4N0PA 5LKRA 1ENOA 2DBRA 1H4VB 5AXBA 2WZDA 5EQTA 1W59A 3GEDA 1V54E 2XPIA 1IEVA 4DV2B 2UYHA 3RWMB 1NTOA 2KSQA 1SQ0A 1M75A 3KOOA 3RC9A 3NIBA 2EZ8A 3GFSA 4QDUA 1RAAA 3ESLA 3L0IB 2GNAA 2PDAA 4TSFA 4YDYA 4YJ2F 1TT5B 1BIFA 1YHYA 2XE8A 3C8MA 4E09A 2XTJA 3K73O 4YQFA 2D59A 2H6IA 7ADHA 1Z4NA 1Q1BA 3WWOA 3OX3A 4C6RA 4R6WA 3R5XA 3EZ7A 2F9LA 2AR7A 3OSUA 3A05A 3HRAA 3GUCA 3ZV6A 5K6TA 4BNJA 3ERCA 2IYAA 6REQB 4OLHA 4XGIA 2OL4A 1OH5A 3ACBA 3ETHA 3A6PC 2G4LA 5JHHB 1WM5A 1YAHA 1Q11A 1L8XA 1XEXB 5C37A 3L7MA 3GELA 3HUDA 4ANXA 3G2PA 4OV6B 2Y77A 4WVFA 5AKHA 1NI5A 5JY1A 4YDEA 3HU5A 4I9UA 3F98A 3QHAA 5LQUA 4D9JA 4C0EA 2ZU6A 2BEUA 4N9QA 4IGKA 3DZCA 1V48A 3CT4A 4UREA 3S2UA 2ATVA 2VYIA 3E37A 3UATA 4HI8A 2VKTA 1T2CA 3K72B 1VLMA 2G06A 2PWBA 3A1WA 4ZCTA 1GSHA 3TMKA 2FR0A 1Z6YA 4Q9DA 3D8UA 3GEGA 5AXDA 3T35A 3D7SA 2CLFB 5K2MA 2H1OA 3SIXA 4FJZA 1TVCA 1KH2A 3MD0A 2F67A 2HD4A 4JNCA 4L0CA 5FO1A 3UJ6A 1CDDA 4ECAA 4JYPA 3BJMA 5J1SB 2P6OA 4NACA 1N2IA 4L8GA 2CGEA 4WK0B 2FCAA 5F12A 1HEYA 4JP1A 5F76A 1CJUC 3VUEA 4E70A 2ZCUA 1XCBA 4P8RA 1QR6A 1PV2A 2NZWA 3F6EX 3X2EA 3DV0B 1XJ5A 2GEVA 5M34A 3EFBA 4N7BA 4XI0A 5TMDA 2RHBA 3W04A 5LOVF 2X41A 3EJ6A 3QYAA 5AKLA 1P72A 3STVA 5UKDA 1FSPA 4J8FA 2ZP1A 4MQMA 3ROKA 3U9LA 3T3NA 3FTDA 4ESEA 3T3HA 1GUAA 3ZKWA 5C7IO 3MYYA 1BX0A 2ZU6B 2F64A 5EP1A 3TPFA 4Z7OB 2QTMA 3DD1A 1EE9A 4F4UA 1A8HA 2CYCA 5ICFA 1H0AA 1MQSA 1I3LA 3RSSA 4Q47A 5KC8A 3BH7A 1H2EA 4KXWA 4X54A 3MELA 1XEXA 3M83A 2D2EA 4TTJA 4EB3A 4DCGA 1X8XA 4L9RA 3OQ1A 4QOGA 1DT5A 1VFPA 3KU1A 4JJ8A 1YA4A 3AYZB 3PC3A 4HDOB 3VDXA 3L77A 4G1BA 1EB9A 2AN4A 2K4MA 4JKOA 5LM3A 5EJ9A 3SOZA 3KOYA 3COJA 2F1IA 2VP3A 1U7WA 4RX1A 4ZJYA 4NZMA 4TS4A 1I9CA 1QG4A 1TVKB 2GEJA 3H4VA 3MJSA 1JLMA 1I4EB 1L5ZA 3UJPA 4A5OA 3IPCA 3D1JA 3MCWA 4HNHA 4QASA 4U5QA 4B4DA 2XMQA 1C3OA 1CVIA 3QKYA 4IIFA 5FWXA 1UM9A 4DG9A 2EBUA 2X3UA 4F04A 4V0KA 4KO1S 1F8FA 4S0XA 5CVJA 1FQOA 4DXAA 3M34A 3HVEB 3F5MA 3S5UA 4F3VA 3SZ7A 1KBZA 1BXGA 1XXLA 2TMKA 2YVAA 3N87A 4MDHA 4MVJM 5THQA 4D8TA 1A9OA 4J3JA 5FUWA 3V2UA 1J9GA 3W34A 3VLEA 3LUKA 5LUAA 1CNMA 2GN9A 3GNLA 4WOBA 2O7SA 4NJEB 2Y68A 3STYA 4FFBB 4QSMA 4EUSA 5IMSA 3AFGA 1FMCA 1YB7A 2DTEA 4TUYB 4CT0A 4FZJA 1RJFA 1A7JA 1JHDA 1HY3A 4J4HA 4TTSA 4RTSA 1YDMA 2BPOA 3V2OA 2FRVA 5EOVA 5JPCA 5LIPA 2JEOA 3UBMA 2IYNA 2W2NA 2VPZA 1PZEA 1WEKA 3AU8A 1RWMA 3DTYA 1R5BA 3GGJA 3WRYA 3ACCA 3AKYA 4QYXA 1RR6A 4FPXA 5C2JB 5J63A 4CR8A 4FFPA 4DA6A 2CXRA 4FP9A 2FPIA 4IIJB 1SQ6A 1IULA 3GFRA 1CWUA 4LRQA 4IXDA 1IEXA 5BUZA 3B7TA 1IM5A 1L8LA 1Q16A 1X7HA 4F3TA 4Q03A 4CIYA 1KZ9A 4IV8A 4I17A 3I8XA 5K3SA 3ND9A 4D6YA 4F6CA 1XWWA 1QH1B 3AEUB 1EFHA 3HDGA 4MQFA 5DHRA 1KQGA 2RH8A 2FPMA 4XUEA 4JSRA 3CEAA 3E0XA 3UJAA 4PG8A 1XZPA 3WJ1A 3HBNA 3HXFA 1RJ9A 3VO9A 1II0A 3WL7A 4YT2A 10MHA 3MX3A 1TCAA 4KQ1A 3CGGA 4AFNA 5MFZA 5AFSA 1QHXA 2ZRBA 4KN8A 4W8OA 1UPBA 2PNFA 4C0WA 1JEDA 1N4PA 2IXDA 1SU7A 1F4PA 2RI1A 3C6QA 3BMCA 4QGFA 1I6KA 2L0XA 2LGJA 1BXKA 4HAXA 4TL9A 5HDBB 4YN3A 5KDLA 5FTLA 3C3QA 3QJGA 3GEIA 3HKEA 4LDPA 5HSGA 2FPWA 2B4YA 2RAFA 3LLMA 2MRIA 3OIDA 1TN6A 3TL3A 3KTAA 1TM2A 2ZRJA 5SZJA 3TQQA 3ZWAA 3GLFB 3TEMA 5CCBA 4RCYA 2HB6A 2CUKA 4PS1A 5CT8A 4ZQGA 1EUQA 3AG2E 5SYAA 1GR0A 4C7OB 1GRNA 2FLKA 4QXMA 1PV1A 1T9AA 3DQQA 2D7JA 3P0EA 3OAAA 5C8YA 4ENSA 1MO3A 4U02A 1NAIA 1J97A 4P4NA 1OV4A 1VI2A 3NJ8A 5CVUA 4YQZA 4BLTA 3MTIA 5BN3B 3M6IA 4FIZA 4Z9FA 2DERA 2I8CA 1QKKA 4YT5A 5I7UA 5DVZA 4HSGA 4BAUA 5LCWJ 1N5LA 4H7JA 5F64A 4C0AC 1BDHA 2OK7A 5AQEA 2XECA 4YUZA 3OEHA 3OF5A 4GL4A 1AQ6A 1PWHA 2C5GA 2FUG6 5G41A 2CBXA 3FWZA 3PS9A 4G0YA 4GGMX 4G6ZA 4EIWA 4F3CA 5K05A 5KYUB 2AJDA 1PQWA 4F1PA 1PD0A 3D1LA 3VO8A 3HA5A 4MCJA 1UQUA 2WM9A 2IVZA 5JROA 1GM5A 3P5BA 2C3YA 4UUCA 5KPDA 4M83A 2O1SA 2WIBA 1HTWA 4CV1A 3LJ3A 1JHUA 2BR5A 2VSOE 1VM6A 1GG2A 2QM8A 2PS9A 4JB8A 4TMXA 4B45A 1AUPA 1AHHA 1MZCA 3I01A 3OJWA 2X0DA 1JNXX 4D9HA 4NBVA 3E7WA 3N2GA 1W29A 3KD7A 5CK5A 5AK5A 3RS7A 3NG1A 2FTKE 3PPXA 3ZU4A 4DR2B 2Z6AA 2ZT7A 8ABPA 3AF4A 4KREA 1TIBA 1WBJB 1X2BA 2O1XA 4RMHA 4KXMA 4QUDA 5AQ1A 4JI4B 3OVMA 4N18A 4CT4B 4MS6A 3ICVA 3AVVA 3BKWA 3ADBA 1F3LA 1U1FA 3I3NA 1B0AA 1SUSA 3AZQA 3LZ6A 2RHWA 4ME6A 3B7GA 4K87A 4L0MA 3FFLA 2A59A 3M1LA 1Z6AA 1XKLA 5GMOA 3W4JA 3RAFC 5IHXA 2H6HA 4BFSA 2EFDB 3BKXA 2OC9A 4ND8A 5F7OA 4EWLA 4C6HA 3E7PA 1XKXA 3N3BC 3VNBA 2HREA 1SCBA 1E61A 2VF5X 2GA8A 1PVDA 2QT9A 4MRRA 1RYEA 3YASA 2C8KA 2LKCA 2JFBA 4RTLA 4OHWA 4C29A 1EEHA 1KJYA 4OHKA 3VDRA 2C2HA 1K75A 3ISVA 4MIKA 2OP0A 5DNUA 2CXNA 2YRFA 5C8VA 1L7QA 2ZTUA 3HJUA 3K2QA 4PINA 1HV8A 1ZIOA 4LRTB 4XE0A 4RVGA 4MQEA 3DMTC 2P11A 3MCZA 2A1UB 3CLJA 4UHEA 5ALDA 3WGKA 1FPQA 4A10A 1QGDA 1E8OB 1ZM2A 2BUCA 3LHFA 4URHA 1XDBA 5J4KA 3QFFA 3E2PA 1WSDA 1Z74A 4MICA 2R6GA 3NJ4A 4N5CA 2DOKA 3P52A 1FW8A 3AV0B 2Q1WA 3AFIA 1G4HA 4GKAA 2GO7A 3KEQA 3AS8A 1E1KA 2Z98A 4M8KA 3VRHA 2FMHA 5HEKA 1FFEA 3MS4A 3AT1A 1G60A 4EOGA 4Y6CA 3TXXA 1NVXQ 2Z58A 5I9NA 1VYUA 1UZUA 2B25A 3HCBA 2Y9PB 2AEEA 2LWIA 3HA7A 3K5IA 4LJ7A 8OHMA 4YIHA 2KZTA 1TK2A 1VJTA 3TU3B 2IA5A 3G2LA 4FFLA 2MCFA 3RHZA 3TNYA 4F9EA 1T9GS 1M34E 1GPUA 1ZX1A 4MSUA 4YO8A 4XGKA 3DQPA 3LUFA 1ZY2A 3FBWA 2QN1A 4KAXA 3K5PA 3TSCA 4ND7A 1U4NA 3NORA 3ILYA 1DHTA 3M1AA 4J2HA 4BEJA 1RYNA 1PZMA 1Y33E 2D2VA 1RT9A 5ITWA 2GZAA 2Q5JA 4E11A 4NONA 1KOJA 3K9LA 4F2GA 1B1CA 1MG0A 5BMVA 1U0NA 5IF9A 1FFHA 4UNNA 4Y1EA 5JBQA 2P9ZA 5JG7A 2FFAA 3N6VA 2V6GA 4NCJA 2O2XA 2JZOA 2O7NA 2FDCA 4RVNA 2I7TA 1WUHS 3OBBA 3ASDA 3FULA 3HXCA 2C5SA 4AO6A 1GCIA 4JI3B 4EJSC 4C14A 3BJEA 3MEKA 1KBQA 4K6OA 1V8DA 3NHSA 1I2DA 1UXKA 1Z26A 3MCAA 1IRIA 1G9SA 4I1OA 3TM5A 2P79A 2UUBB 1P7CA 2GEKA 2YHBA 4BASA 1K89A 3EVBA 1FFAA 2WWXA 4IDEA 3WYDA 4C0JA 1PZXA 4A0SA 4DR5B 4JLPA 3KO8A 2P4EA 2ADMA 1Z4MA 3NT2A 5CM8B 2UYQA 3ITEA 3NWBA 4MVJE 5DE3A 5B58C 2C94A 2CJYA 5B1YA 3EPKA 2YHIA 3EEYA 1U0LA 3JSXA 4XD7D 3RTGA 1W7AA 2HLDA 3WMRA 1LVHA 4ZZIA 5IM4F 2OBYA 3QNKA 2H2IA 3PXBA 3A1EA 4KNYA 4AP9A 3TD9A 2HMVA 2RGCA 3N0WA 1GUFA 3RIBA 3VU1A 3H5TA 1OLXB 3C3JA 3KJEA 4L76A 4CMAA 1Q0TA 1WXGA 1Q0QA 2IV7A 1U8FO 1YSCA 1L4MA 2ORWA 2W48A 1UP6A 2VSFA 4KVZA 2GHQA 3L6CA 3TGOA 5ICSA 3C1AA 4XM0A 4NJMA 5KYWA 4W5TA 2JJ8A 1QQAA 2TS1A 1IN8A 5IEJA 3U4IA 1UR5A 3QVXA 1D1QA 1BKDR 3EAFA 4QDZA 3WIEA 4CF7A 3ETDA 5IM5A 3RIYA 2OZLA 3RS9A 4DCOA 4UBLA 2HU2A 3OIUA 4UBIA 1IZ7A 4YO7A 2IYRA 3ST7A 1C4WA 2NWQA 4TTQA 3VR6D 1JWLA 3SMQA 1IH8A 4M6WA 3SZGA 4BP9A 1DJNA 2B4RO 2EVWX 3A4IA 2QS9A 4IMIB 3ZQJA 4EMBA 4YRNA 1BVUA 4C21A 4FWBA 3ZVMA 5B7GA 2H1HA 2BSXA 4HVLA 2GHRA 4RKWA 4YVFA 2P2CA 4BQOA 1U1DA 1TDJA 2P68A 2RGBA 4FU0A 3H7IA 5HM8A 1FFSA 2HCBA 1G8AA 3AW8A 3EDOA 4JA2A 4YIKA 4KSBA 4UCXA 3W3ZB 5H4GA 3G2VA 2HPHA 3K0KA 3M2PA 5K01A 3S28A 3ANMA 5C53B 4B31A 4DR4B 4PBRA 2PWYA 1NQXA 3DWEX 2OV1A 4MP3A 5CAEB 3E4DA 2JZNA 3K4PA 2DGDA 2IHJA 1JV2B 1VRVA 4PZ0A 4ZAFA 5G1OA 4X8LA 2G7ZA 4XGRA 1NVEA 4ZVMA 4KODA 4MJLA 2I2OA 4ILIA 2E37A 1FP4A 2B4QA 4DR3B 2P3OA 1CQWA 1HMYA 2IH2A 3A6KA 1WABA 2JGDA 2MYUA 1IHDA 1YS1X 3DHWC 1X1EA 4ZU3A 2BHLA 3OXFA 1YRLA 1FK8A 2ZSDA 3U31A 3IEVA 2EFJA 3UMJA 1KO4A 5ECDA 2R6ZA 3WP0A 2OLJA 1N8NA 3I12A 2QAJA 2FK7A 4KLCA 3FUJA 3IGFA 2GLTA 4YY3B 4CMKA 3ZIDA 4A0QA 1XCOA 5B3LA 1K2WA 1C8VB 1M2KA 2HL6A 2R8OA 1UBCA 2EOAA 2WJAA 1FU7A 2CHWA 3OX1A 4MEAA 4Q3CA 4U2EA 2PKEA 5DCYA 4CMIB 5BMVF 1XQ1A 3JASA 1AGPA 2DX7A 2BWJA 3IAM6 1ISGA 3GFVA 1ZHHA 2L6JA 2W0SA 2VT6A 2XA9A 2EQBA 2FW0A 2XTZA 3RVOA 1XRQA 3RV3A 1DTEA 3CO0S 3UWKA 2QN8A 1A04A 2H1WA 3KJXA 4YV2A 3I1IA 4DSUA 1DDIA 5CLFA 3K32A 4FMPA 5ALQA 2IS2A 5BPPA 5ENQD 3EVCA 1Z3IX 3NKVA 4OGGA 4XVUA 4KPUA 4O2BF 5DGHA 3FPGA 4IUDS 3MWYW 2Q2WA 3JXJA 4L9PA 2IITA 3WIVA 5AH0A 1FVXA 1PGQA 1R18A 4DARA 1DAFA 2P6UA 3K94A 5EJ2A 1IZ8A 4WNDA 2WD7B 4IVQA 1FSGA 4BX2A 2QXYA 1CZKA 3C7TA 5KJLA 3K05A 1VI6A 3LKUA 1KZGB 3QBVA 5KWVA 4PSAA 1OU0A 1M2WA 1YMPA 2DFTA 1R3DA 3JW8A 4MUBA 2X40A 3DOHA 2WXKA 1MIHA 3M70A 5DT9A 1Z5PA 4NOJA 4ZT2A 2GN1A 5J2UA 1SQGA 3UOAB 4GDFA 4IINA 1P33A 3N0RA 4G1FA 2BRUC 3ZHTA 5JYDA 4D3ZA 2NAPA 1U9CA 5J2TB 3O4RA 3FMPB 3RSOA 4ZYLA 4J8SA 4C22A 5L6MB 1R0BA 2NXEA 2OZLB 1IU9A 4LXHA 3VU3A 3SS8A 4D79A 3W2HA 5C0OE 2WU0A 1YCFA 2BEVB 4YUYA 1YVRA 2WVAA 1J8DA 4YRMA 3AHFA 1VHQA 4K9OA 3T7IA 4CW7A 4RTPA 4O29A 4RENA 3EFEA 2CXXA 3HY3A 1ICIA 4GBJA 4H27A 3DZDA 1A0OA 2FN3A 3JYSA 4A0FA 1EA7A 1YB5A 4P93A 2PE5A 4LJRA 5MFPA 1KJ8A 4K9RA 4Q69A 4MW4A 2R8YA 4O2AA 1IC6A 2FSVA 5AIAA 4YS6A 1RXWA 2ZXFA 2GHTA 4OA8A 1MABA 3QVGB 1Q44A 4XX5A 3UYLA 1K6EA 2C4NA 3QPBA 4A3VA 3V3LA 3IDOA 4BP8A 3V2IA 3QOWA 5C8YB 4B3MB 2CDAA 1JDTA 4KDEA 4OK3A 4P7FA 3TMAA 4BO9A 2BMJA 2GBIA 3EVAA 3PFKA 4II3A 3EOBI 4OJYA 1V71A 2II6A 2OLEA 3MBKA 1K0FA 1AXGA 4ZD6A 3S68A 3QELB 5EHIA 5A9TA 3S7TA 3DSSA 3DYVA 4JFAA 4Q1BA 1GZ7A 1MDFA 2BC9A 5B1EA 1V1JA 4OJMX 2XA1A 1KFEB 4Q0MA 2VP2A 3DL2A 4BNFA 3FZEA 2FUCA 4A3TA 1XDGA 2EEPA 1PZNA 4DCJA 2GT1A 4ANUA 1U11A 1WS6A 2POQX 5T64A 5KYVA 1PT8A 3AEQA 3B1VA 3PZBA 4Z9AA 2BFBA 3TZQA 4J94A 3U64A 2ZIAA 2AT1A 2RGAA 3GJ5A 3OFSA 2WD9A 1ACJA 4DA0A 2V5FA 4AWAA 1GLGA 4X8QA 5E9JA 3PA8A 3G0OA 3E5MA 4BNKA 2GCIA 3QARA 2EW1A 1SOMA 1Y5NA 1TCVA 2G07A 2HJGA 2QDKA 3NEYA 3RUCA 3WBJA 4BVKA 5CB4B 3GLGE 2P4SA 3CTPA 4UTXA 5JISA 2B94A 2XZTG 2YCLA 2EIKE 4OVVA 4GZMA 3GVIA 3L4BC 2QE6A 4OHRA 1ZXLA 4LMPA 3L7OA 4LPSA 4NCKA 3M0EA 3IUQA 4Z1OA 3IR7A 1JDVA 2XVMA 1E98A 2XUKA 5JHBA 4Z0PA 3RVKA 2GXQA 1OFVA 3UJCA 1TIPA 5GONB 5EE1A 4C3OB 4H0FA 2HR2A 4JLMA 1T6BY 2XLCA 4JC4A 3INRA 4WCFA 5E6SA 1ZM4A 2CCJA 4WKCA 3PDWA 3PFNA 1SK8A 2AJBA 1KU0A 1Q1QA 1ZVJA 2CF6A 3CG4A 1R10A 1WZNA 2DR0A 1OBOA 1D8TA 2WDZA 4GI7A 4JUCA 4BO5A 5K0CA 5DIZA 1W87A 3DQZA 1WUIS 2QYSA 3E1KA 4Q05A 1Y1TA 4MWSA 4RESA 3ZY4A 1O6FA 3BBPA 4ATNA 3JQ8A 4B35A 3PQ8A 2AJTA 1DG1G 2HSEA 4YX9A 2H65A 3S7ZA 1O0SA 2A0XA 5FLEX 4WFQA 3IAUA 4M0LA 1KYTA 2NO7A 2CLMB 1Z28A 5L3QB 4OXRA 1IWBB 3OWXA 1GV0A 4ZTBA 4BAZA 3N2YA 4HO1X 5JSFA 4O4HF 4OYRA 4RHTA 4DA7A 4EGSA 1ZUWA 2FHSA 3CM0A 3HJRA 2VPYA 1WBBA 3B70A 1KAGA 2NUAA 3C3CA 3G7SA 1B8PA 1U2VG 2IY8A 1SURA 4MQ4A 2BTQA 1QP0A 4LKOA 5FR1A 1OXBB 4WK6A 3FN4A 5K0LA 5JLJA 5L45A 4BWGA 4EATA 2FW8A 1L7BA 1OZFA 1WZUA 3JCZA 1ODFA 3F5FA 3UT6A 2CKMA 4H31A 4NTZA 4GB9A 1MHPA 2H5EA 2BP7A 3L0ZA 3C5HA 4NE9A 4ODIA 5B4VA 3HXOA 3WGUA 1PZHA 1XXHB 2QB5A 3BEDA 4IKPA 5L3RA 5CEJA 2EZ4A 3FAZA 1YGPA 3TRJA 4JB3A 3WMWA 4B73A 1B74A 1M5UA 3PUIA 2YWHA 1GP2A 4O0MA 1U2ZA 3O2SB 4CGWA 3JQQA 4RTKA 4REQB 1D07A 3OE5A 1H85A 2DKOA 4EG7A 1ZBPA 2B3DA 2ZWPA 4BO7A 4LFAB 4J0FA 3RRYA 3FZQA 3X1YA 1HMPA 3A0RB 2R11A 1EE1A 1J2TA 1IQRA 2IPAB 4J8PA 1GQFA 1X80A 1SC3A 2XOKD 4O8ZA 2G8NA 3JQ9C 1F14A 3P9XA 1E0DA 5T4HA 2I0FA 4GOOD 2A5GA 3FTZA 3W9BA 3LYLA 2X9LA 1WHTA 2JD0A 4ND1A 3B7BA 1D8DA 1LDMA 3HGQA 3D3QA 3WXBA 4KQMA 1N7IA 4U8YD 4NMMA 4UXJA 2VAXA 3QXHA 4KGXA 2IZ1A 4IILA 2LSVA 4K81B 3FTFA 2QMZA 4TQUS 1UJ4A 2X5HA 2WVHA 4PIMA 1AHIA 5BURA 3N75A 1PJRA 2QYOA 3Q1KA 3RC8A 1CYDA 1DU4A 3FJOA 4YDRA 4ALIA 1IUKA 1VG9B 3BHNA 4BNIA 4DKJA 5FBWB 4NSNA 4N3BA 1LKZA 3GRYA 5T3YA 2V3VA 2FMXA 4P2BA 1MVLA 3OZFA 5F3RA 2RGRA 4US0R 2QG6A 3QPCA 4GTTA 2ORIA 3GZNA 4OEHA 1YOBA 4ARBA 1SXJA 1LQ2A 2W7TA 1WXXA 1M2OA 2E49A 2PYIA 5H80A 1W2GA 5KDDA 1NLMA 4LDQA 1GAJA 2QRVB 1PG2A 3ZDFA 1GAEO 3LP6A 1I7SB 3TW8B 2V65A 4N5LA 1P6QA 1U6JA 3TIXB 4XYLA 4CR7A 4IIDA 3ET4A 1EVJA 3T5XA 3R8CA 2J9XB 5LOVA 5GINE 3MIZA 4LXYA 3HB0A 3S1SA 5JASA 2CL6X 3VHQA 4M8NE 4LDAA 4EFDA 4DNPA 3GY0A 2I4NA 3MMNA 2GZHA 3IESA 1KKUA 2RBKA 5DASA 2FQ1A 4MB0A 2ZAYA 2CJXA 3T3OA 2WIKA 2IXFA 1RPZA 5KJ1A 1T9GR 1SJ9A 2MT9A 5JCPA 3PXEA 4HDMB 4MI3A 2V58A 1YNOA 2AR9A 4PLCA 5D3MB 2CNNA 1C0EA 3B95A 1UBOS 2H1VA 1ORTA 3FUWA 4TT3D 2HZBA 3WQQA 1Y9DA 5EWMB 2DU8A 4JLSA 1E7UA 2J3HA 2UAGA 2VDVE 4KKXB 2P9SG 2VRBA 2NC9A 3D6FA 4FNAA 2Q3MA 1K8KG 3FVQA 3VYWA 2A57A 1O3YA 3TZ6A 4AYWA 3D6NB 5HTOA 4PCLA 3VJKA 3HJFA 2JCVA 2XT6A 1YRQA 1J0BA 5L3ZA 4MW6A 3O8QB 3EU9A 4JIGA 2LO6A 1PHPA 1XVUA 4MR9B 4Y1RA 4RIIA 1PRYA 3PNLA 2P0YA 4G8JA 1AK9A 4BB9A 2CYAA 2OA0A 4BFCA 5F78A 4CTJA 3T9KA 1P1BA 4J1SA 1I32A 1FZTA 4R83A 2OV4A 4L7VA 3DNFA 4IXWA 2NVOA 1VZ2A 4L4YA 4ITVA 4M9QA 1R88A 2GYWA 1TJYA 2Z2JA 5A3SA 2CDBA 4MKZA 3OM0A 2IOFK 5DT2A 1MH9A 3D7NA 4I9NA 4BKRA 1F20A 4HRMB 3NS7A 1WULS 1VJ1A 2Q3DA 3K1AA 1WQ4A 4ZEOA 4BNZA 3T4EA 3P2OA 2FFGA 3QKSA 3WLMA 5LFAA 1PJQA 2G36A 2HDHA 4NARA 4R54A 3MYRA 5E7MA 4B74A 1BXGB 1G55A 2YW9A 3LLVA 1Z2DA 3U6KA 4DWJA 3LRTA 4BVHA 2NNWB 1ZUIA 3H11B 4X1KA 3QIVA 5L51A 3N6XA 3J7AC 2Q99A 1W85A 4L6IA 5IMBA 2VZEA 1Z5WA 2VCEA 1JR4A 1WQ3A 4ZVNA 4ZEMA 2CXPA 3VYTB 2QC9A 4I6GA 3GRFA 4FLMA 1YS7A 5AI6A 2HW8A 3OPYA 2YCBA 2J41A 3DZGA 4XZ3A 5AI5A 3HVHA 2PZEA 1E3IA 2X0JA 5FPKA 2C5LA 2KCKA 3SJZA 2YHEA 4LECA 4QQNA 1YTUA 2X8JA 3VNSA 2BT4A 4Q7QA 3K35A 4JASB 4NR0A 4EMUA 4F1WA 1J5EB 5CH3A 4L74A 2RE8A 5HRAA 2Z08A 3NOVA 2WBLC 4WRRA 2LD4A 3DCYA 1A8PA 4TLCA 5GONA 4ILGA 5A7HA 3H2JA 2H0QA 2G3YA 2EKZA 2P40A 3HCPA 4ZC1A 1Y89A 1UADA 3H2ZA 3GC6A 3F8TA 3OZUA 4IXTA 4QNRA 3KFLA 4B4KA 4H77A 4LBZA 4OQFA 4DUIA 2GPAA 5HMMA 4A1GA 1NSFA 4E3WA 1U0TA 4GFDA 2XCBA 2MJLA 1CRZA 1H6BA 2H8KA 4C4YA 4ZIRB 1U8AA 1RLMA 3ZIMA 4N2QA 2J59A 4G0QA 4RM2A 5CX1B 4FZ5A 4AY4A 1G8JA 3B78A 3EA0A 4QTTB 4REMA 1AQNA 2B4KA 4JGGA 1A2OA 2FFQA 4MWEA 5BNTA 1Z5UA 1I4OA 3WWEA 3RFFA 2PS1A 3IHTA 2J6IA 2ZYWX 1KZOA 4B82A 1T8YA 2HU7A 4AM9A 1P5RA 5FQNA 1J2YA 1QO7A 1QMOE 1C7ZA 3DE2X 4W8HA 2WKPA 4G8CA 3Q8LA 1PFWA 1DDGA 1GL7A 2FZEA 1Q95A 2J5BA 2ZRNA 1CHDA 1JE0A 4L3VA 1FT1A 3UHAA 4F1KA 2A90A 3DYIA 3AS4A 3TR0A 4OI2A 3L41A 4JYBA 2GPTA 2JRLA 2XAAA 1IY2A 2H3HA 3L13A 4UM5A 2GYYA 2Y92A 1KGDA 4YP0A 4I1YA 1WCV1 3P0RA 3QELA 2IEJA 2XXBA 2R6JA 2Z1MA 3KPJA 3QPAA 4IJUA 2H4WA 5FEMA 1O6CA 2OECA 4RLSA 2JBAA 2Q3JA 3DT6A 2WSMA 3LLUA 1B15A 1QYIA 3AP3A 3G5AA 5E4FA 1MJNA 3RF7A 5C3MA 2A9PA 3MWJA 3OFVA 4IGEA 2V7VA 1JQLB 1P7PA 3KLOA 2XGSA 2P9IG 4H7XA 2HJHA 2XB6A 3ZGYA 6AT1A 5AW4A 2ZIGA 1S1MA 1T1SA 1O54A 3QNUA 5CH8A 1GRRA 6REQA 1GT91 1NL3A 2XWPA 4KE6A 4UC0A 3JVDA 3TWQA 1DAPA 2WXOA 1DWOA 3F3MA 5CA0A 3S1AB 4ZVUA 3CSDA 3KKKA 5JADA 4NYMQ 4P5PA 3ABME 1DZ3A 4WHMA 1H19A 2G77B 3IV7A 4OKNA 5KTTA 3KQUA 4BE9A 1BQEA 4QJ3A 2IHNA 4U8VD 1BS9A 1BYUA 4IZOA 1ENZA 1LWOA 3KPYA 2ZAOA 3L4KA 1C8LA 2H2DA 3OPMA 4GI2A 2J7PA 4UMEA 1U3FA 3GGOA 1SBHA 3QBTA 1N2HA 1KDOA 4FFNA 4N5NA 5ALJA 2R5WA 1G5PA 3R41A 3TQSA 2CE2X 3JU3A 5EILA 1RHMA 5G3YA 2Y93A 2BFCA 4D41A 2MOWA 2HLNA 2IIBA 3O84A 5AIBA 3LIPA 4YONB 3WFIA 4RKQA 4RQAA 1B2LA 5EIWA 4PRZA 1QFXA 2QG4A 2QKYA 3EHNA 1X80B 4LPKA 3GD7A 4YNBA 1EBBA 4N2SA 1VI5A 4CV2A 4E5NA 1SU6A 3WXXA 4UCFA 3TI7A 3PZRA 4DUGA 1Z15A 2N46A 5HE8A 3ZD9A 4EF6A 5C8YF 1G2OA 3ULYA 5DLEA 5PGMA 5KYGA 2QRLA 2ZR9A 4H17A 1WTCA 1YBFA 4M0CA 5F9FA 3NTRA 5KTYA 3KXIA 4YTEA 2FJEB 3L6AA 2WNHA 2HQRA 1NNUA 5HUQA 4Z54A 1QHGA 3V3KA 1I10A 3D7KA 3FKSD 2BGKA 2ZSEA 1QKJA 4IDCA 4FSXA 5IFKA 1SR8A 1R0RE 3K16A 2W70A 1IHXA 4CYMD 2I99A 2F55A 5IXYA 3KL2A 1AUVA 1BD3A 3KB6A 4GI1A 3TZKA 2P65A 4RCVA 2FI1A 3HVJA 4C0XA 4ENRA 4DEYA 5BYAA 5KREA 3KQKA 5ARBA 4FHEA 2WIGA 3CLSD 1E18A 1MFPA 4LBYA 2FF7A 1A4IA 4WLNA 2HXYA 2X22A 2O0KA 2BUBA 4GZLA 1AXEA 1P6UA 4UQXA 2XMCA 3NGMA 4PC6A 4V02A 5EJFA 5FOUA 2D4AA 1ZW6A 2PV7A 3I2JA 3KJGA 4OMUA 5FBQB 2DZNA 3UT0A 3ZDDA 3RREA 4H7KA 2VDLB 2C7VA 2BGRA 2J9YB 2JGDB 3B6IA 4KAJA 4QYIB 4HJXA 1E5QA 1G9TA 1V11B 1X1QA 4ETWA 4LF6B 3GBVA 1UPUA 2GAJA 3KSBC 3BCSA 2ET6A 2EF1A 1O08A 2J30A 2PBZA 4XWKA 4U3JB 5HRUA 3RFUA 3W2IA 2GARA 4J0KA 4DA8A 1G8HA 1THTA 2O05A 2JHCA 2ZW9A 3KKMA 5DBEX 3X2QE 3MZ0A 1TO2E 2GPBA 3UAZA 2YVLA 4E5VA 1T1IA 2JLYA 4L1KA 4EGJA 4XCXA 2WU8A 4ATGA 2EL9A 1MJ5A 3VR2D 1X1AA 1GTL1 1BGXT 2C82A 4AU1A 3K70D 4RMJA 1YE5A 2WTMA 3T0GA 1A9QA 3TZHA 3V6LA 5CIQA 1R16A 1ZMBA 5LP1A 3GARA 2PNNA 1Z16A 4YLYA 3GMSA 3QMPA 5K8JB 2RHRA 2Q8QA 3W5HA 1NHWA 5DN6D 5A3VA 1UJCA 4GX2A 4RIHA 5HIMA 1YF3A 2XUFA 1IFXA 1FFXB 1MGPA 1ZFNA 5ELMA 3MTAA 3QW2A 3M81A 1MRZA 2ZJ6A 1Z2OX 3B13B 3LK6A 3EISA 3MRXA 2UUAB 3Q41A 1E3MA 4ZT3A 2VSYA 4XJXA 5C32A 2B1GA 3EUFA 4EUFA 1IJFA 5KU7A 2QTNA 2NVUA 3ANTA 1P0IA 3CZ9A 3FPSA 3OLWA 2YNMA 4QHYA 4EHFA 3HIZA 4RD4A 3AXSA 2Q0SA 3WS7A 3IL2A 1SVNA 3LM8A 1TR4A 5EKXA 5JQWA 2QVZX 5JNTA 3CZ5A 1N2ZA 3FMOB 4YV1A 4KVFA 1DB3A 3MJFA 3P9PA 4L0DA 4JLVA 5I9SA 4EBAG 5B3JC 1CE8A 4GBED 4PO8A 4E15A 4AKEA 4WKOA 3KQYA 1U9JA 5B37A 3DLAA 3F1KA 1K06A 2E21A 3AR5A 3CKLA 5GJBA 2ECKA 3CCFA 2OHIA 4IS2A 5FBZA 2X23A 1AO0A 1I4LD 3MG9A 3WTCA 1EU1A 3A6DA 4I0WB 4KPGA 1HE1C 1T2FA 3FUTA 3EHEA 1I6LA 1RYMA 1H2VC 3IHYA 1Z34A 4FZ3A 4KLAA 4PAMA 5FX2A 4PIVA 2YWGA 3OJ0A 2HRRA 3DEYX 3CZMA 5DHFA 2C61A 1SCKA 1ZIDA 3C4JA 4I08A 3RYCB 3RYIA 3QWIA 1SG9A 3QEBZ 4N6NA 2VHTA 3WV4A 3KZKA 1HU3A 3OY2A 4LC0A 4XW2A 2GJ4A 5BWCA 5HRYA 4NABA 3U3OA 2I2CA 5AVZA 3R24A 1E6KA 2ECQA 4OQDA 1BJTA 5EPOA 2COEA 2G63A 1X92A 2XUIA 2Y71A 3ADKA 3I45A 1U9IA 4YCAA 1ZHOA 3B6EA 5EIEA 1S0UA 4GTOA 2BVNA 5K4HA 1HH4A 2O4CA 3KVNA 1O89A 4LHZA 4DEVA 5MDHA 4YEDA 2O8FA 4YRTA 3SJAA 1AV6A 1MRSA 1P0QA 4IW3B 3UOGA 4EK9A 2EWWA 1IDN1 4GOMD 4JYAB 3AY0A 2EILE 3OEHD 4YRLA 2ECFA 4J0GA 4RYLA 3VDNB 3N8DA 4MBGA 1AKUA 1NXOA 3N2LA 5LDGA 1GTSA 3U5ZB 3SQXA 1Z3CA 1G8FA 2AR0A 5J4LA 4PO1A 1L2TA 1JKIA 3BAFA 5HA5A 3IHKA 1BDIA 2B1QA 5F7XA 2IT1A 2ETAA 3UK1A 3NQ41 3Q7SA 1DZIA 3BUSA 4FOSA 4BBJA 3HB7A 1KRXA 1NWHA 1UK9A 4PN3A 1F06A 4IRXA 4MTCA 4HZGA 4B6FA 3E4CA 2SECE 4OXIA 2PRJA 3BWDD 2W2QA 1IK6A 2V7TA 3Q0IA 4IZHA 1BU8A 1A9TA 1DKUA 1NKVA 2VHYA 2VG8A 1FDOA 1P2TA 5FTMA 1AGRA 1V5EA 1KEUA 4YV7A 1CFJA 1M8KA 4R1QA 4LHWA 1LPPA 2PX0A 2VAPA 4RWEA 4X1IB 3CVVA 4UWHA 4JVOA 1SK9A 5JY6A 1OF1A 3FOWA 4EHNA 5LL6P 4V0SA 4NVRA 3ISTA 5B1DA 4DNOA 1D2RA 1VLHA 1PWEA 1VKNA 3JTMA 3KQWA 4XSVA 3TH5A 1W36B 4KLZA 1XG5A 1WLSA 1ABFA 1TYDE 1UCFA 4MRVA 1RWOA 4TL8A 3KD3A 2JGKA 3PJDA 3HUEA 1ZUNB 3PR2B 4R2JA 4TLEA 4UVEA 1W44A 4X3PA 5T6MA 3DLIA 3T4XA 3UXYA 2XGJA 2F17A 3WK4A 1IOWA 1JHMA 2F8YA 1XHFA 2AG8A 1Z29A 3AI7A 4LK2A 4PRYA 3DBLB 2FWJA 5TF0A 3ZHXA 1B8UA 1P5HA 4ZAYA 5LLTA 3Q11A 2JI4A 3R0JA 3BG0B 3OC0A 3QX3A 3AVXA 3UB4A 2FEZA 4A91A 1KT1A 1MC8A 1NUTA 2PH7A 3KKLA 3PHGA 4BKMA 3H17A 4DZZA 1R9MA 1YB1A 3WR5A 1F60A 4R31A 4Y2RA 3IYLW 3CSFA 2IEGA 1KMCA 1ES9A 4S3MA 4DLTA 1IK4A 4KU4A 3BF8A 4DM4A 2Z1NA 4LERA 1WO8A 1EVZA 3O4GA 1F2TA 3CB4A 3MIIA 1JS1X 4YCNA 2X8WA 4GYKA 4X5OA 1ZBDA 4UJ3A 5A5DA 4YRKA 4KPEC 4TUYF 4RH3A 4UU1A 3ONVA 5B64A 5JSZB 3DLBA 2IYTA 2BFMA 2NT3A 4MOWA 3G89A 4PXYA 2C9OA 1J49A 3WRWA 4U1RA 1GADO 1L7VC 1NF3A 1X6VA 3KVVA 4MAMA 1M67A 1ZD3A 3ASYA 3E8MA 1L4GA 3OCZA 4ZXFA 1QQTA 2Y9MB 3RGWS 4AJKA 4GLBA 3EDQA 4FHZA 3G2HA 1HEIA 2J0SA 3NIFB 3JATA 3WRYC 4HBDA 1EB8A 2EEZA 2CN1A 1VPDA 5FRDA 3Q7FA 1EI9A 4GNKA 5JQGA 3IPXA 4RFSB 4UULA 4D4IA 1E2NA 2ZXUA 1XLTA 1F1JA 4EUHA 2WV9A 3GAFA 3OUTA 1U5CA 1TZ2A 2GJSA 4HZUB 5KI6A 2AI1A 2I80A 2PD6A 1K6IA 1T9KA 2R1VA 3KWLA 5JZSA 2PTGA 3FUKA 3A14A 3QLTA 4OKIA 3ZBQA 3JS5A 3LOPA 1SBIA 1YV9A 3VNVA 1U99A 4WOKA 4S1NA 1DC3A 3G6KA 2QSZA 1E9RA 1RE1A 4EY7A 3SE0A 5D86A 4N5MA 1D04A 1P80A 1ZC4A 1RAFA 3IR6A 4I8XA 1SHTX 3RYFB 2OQIA 1Y7IA 3RS8A 3AXTA 3IVMA 1JQ5A 3VH3A 1NOKA 3K0AB 1OD6A 2NSDA 2HK8A 3EW9A 5EE9A 3RIXA 5B12A 3O91A 4ENUA 2CNWA 2HIMA 5A1JA 1JA0A 1JLKA 3ND7A 4U95D 1TZCA 3TLGA 4WNCA 5FI3A 3ZE7A 3HKEB 1E2MA 1NVMB 5BQXA 4D3YA 3BU8A 1DKLA 3TWXA 2G6BA 3ORSA 5CCMA 3RLIA 5KJ6A 2LBPA 6GPBA 1QH8B 4ZK2A 1ILEA 1NULA 3JQ0A 3FUUA 3KTFA 4NOKA 4RL6A 1VMAA 3SKXA 3VH1A 3ZE9A 3MCVA 5CMLA 5GV7A 4DQKA 1K68A 4CETA 4J0HA 2XCUA 1O6GA 1UBSB 3FPLA 4N0EA 3NHZA 2PSJA 3CRW1 3O26A 4GAEA 4Y6QA 3VLDA 4NOLA 1LDEA 3IP6A 3L17A 1UC9A 1U3UA 4MUHA 1L7EA 1HT1E 4GQIA 4HLNA 3ZHOA 4GTMA 3GR6A 1QP4A 3I6QA 4DX1A 3L4BA 3T54A 3QAQA 2OV8A 4HYEA 4G0WA 4ZHQF 3C98A 1EUZA 3P8ZA 3FUFA 2PZMA 1NRWA 3U17A 1EFDN 1ZLYA 3LTNC 3Q7TA 3WJ2A 4JKIA 4MPDA 1C3XA 4JHJA 3HEAA 3IMFA 2X9NA 3P2YA 3G7NA 3LBAA 1QNFA 2VAMA 3TO5A 2GN6A 1JKJB 5KSPA 1KDRA 2JGJA 3U4DA 2NUPB 4FDMA 1Z3XA 1NBMD 1ZWKA 3DDWA 3JCKC 5HKPA 1DVPA 2VAWA 2IHBA 3U7JA 4GKVA 4DC1A 4D56A 4IOMA 4JVSA 2R7AA 2RK6A 2XKBA 2QGNA 5JFTA 4IGIA 2AMFA 4GT1A 5B53A 5GGXA 2GZ3A 1OH8A 4I1PA 3TR5A 1EESA 3D64A 2JFPA 5IF3A 5KU1A 2ZBRA 5G1PA 2J9RA 1UBTS 2VTVA 3KEGA 4ZDKA 2GM4A 2OHHA 1HFAA 4L6CA 2AE2A 4X63A 3CF4A 4EQ6B 4P54A 4JFRA 1JCSA 3RB8A 3H9CA 1X42A 3DOUA 1ZM9A 2GTHA 3LI2A 1R8YA 3BAZA 1QOPB 3EZ6A 3FZGA 3Q9SA 4UUBA 4X20A 1V55E 1TYCA 1BXRB 1NQUA 3EZNA 4Q3EA 1EK1A 1MP0A 1Z0SA 2HGZA 2Q4OA 3AKDA 4WLFA 1VGRA 5DNDA 3V7UA 5JBNA 3UPTA 1CCWA 1ZDMA 3Q6IA 5EX0A 1KZ4A 2OEWA 4WN3A 3CJQA 3UMGA 3BCRA 3F6PA 1XMIA 4F3NA 3TX2A 3JALA 1YI8A 1QE5A 1TRHA 1Y1KE 2PZGA 4WY8A 2EW2A 3ZZNA 3R3HA 2HZ7A 1KTVA 2WJ6A 5L4SA 4G0ZA 4RMIA 2P9BA 4ZU6X 3DZFA 3PHHA 1RC1A 4D9BA 1SKAA 4JA9A 3IHWA 4ER3A 2Z2XA 1B76A 2Q3FA 4TRNA 4LNUB 4ZV9A 2BRUA 3W90A 3UV7A 2QTZA 4TV9A 4FN5A 1JNZB 4KTVE 3KKZA 5CEAA 4Q02A 3U7IA 3B3GA 3VPDA 3HXBA 2B4TO 1GUDA 2ILRA 4B43A 3TINA 1UPCA 3PZDA 4DBZA 4F3RA 3AF3A 3U80A 4TRMA 3ZEAA 1ZL2A 1ZNXA 1LVGA 4GXRA 4BJ5A 3EDCA 5J2TF 3WADA 3DXZA 1KYIA 5KX5A 1LSUA 4KZCA 1PQUA 5F51A 5FKJA 2H1LA 3PLAE 3WLQA 1AB6A 1C7JA 1CQIA 2GB4A 5HFJA 4DPKA 4CEIB 3RTCA 2VA8A 3PRYA 4KE7A 2ZM5A 3EY4A 3IO5A 1O5IA 3EXHC 4ARAA 5KSWB 5BV1A 4FZRA 1CG6A 3OUUA 2QI9F 1YOVB 5CITA 2WQ7A 1AKWA 5IKMA 1N2CA 1KJIA 1ECFA 2QX4A 1HYQA 3C14C 3ZXXA 2N0SA 2IFTA 4BFLA 2BEUB 3D8SA 1TA0A 4WN9B 1BEUB 2HA3A 1D2HA 1E6UA 1Z22A 5DBFA 2JG3A 3M5WA 4QG3A 4NRHB 3PHJA 2YH2A 1ZNQO 4D4GA 3TFQA 3KRTA 3PFFA 5ERGB 5TQ0B 3FRHA 4WLEA 3DLCA 1WV1A 4PFJA 3Q9NA 1QRTA 5LP6A 3M3PA 5CUQA 2V7QD 2XWSA 4PX2A 1TYBE 1CW2B 3OCVA 1JPNA 1BMFD 1J09A 2OV3A 3MT7A 1SOAA 4FYMA 4Y7DA 4F1JA 4HXGA 2V3CC 1BRTA 2W71A 2W6JA 4BATA 3RH0A 4MQLA 1LDBA 4HNTA 5KWIA 4W5OA 1Q7EA 2X7HA 1N2EA 2HUNA 4LXXA 1DXOA 5EKTA 3RUHA 5ADUS 4A8JB 1G6KA 1BA3A 2E4UA 1EHIA 1S8OA 3VUFA 4MGZR 3F73A 4FCTA 3R40A 1ADGA 3ZW9A 1U3WA 2HSZA 1BD4A 4ESOA 1O5MA 1M1XB 3GWGA 3C6KA 1A9YA 3OT5A 1PNOA 2IBMA 4UXIA 4XFDA 4BMYA 2QRHA 2E9SA 1A5ZA 4DCVA 3QLVA 4AKGA 1VE9A 3I52A 3OA0A 2QSYA 1CNEA 4EBBA 3DE6X 4FGLA 5FL7A 5AWFC 3VPXA 1DQYA 1GZDA 4B4VA 4OAPA 1BC5A 1KVQA 4XZ4A 1HG1A 5L7YA 3RJTA 4R2XA 3R6DA 1NXSA 2BMFA 3NH6A 3Q5GA 3EGWA 3MGAA 2H11A 1HL7A 3EGDA 1L5NA 4UWGA 2PGJA 2PZAA 3FVWA 3OFJA 4PEVA 1CP2A 5JTUA 2PUDA 1BE0A 3KJNA 3E9RA 3OY7A 1VHLA 2VLBA 4N8DA 1NL4A 1J0XO 4M1OA 4X1YB 4QFMA 5GOZA 5EE3A 2AA3A 3PI7A 5AJZA 1TNBA 3TX6A 4PNEA 3P20A 1E3JA 4DZRA 2IOSA 5CFPA 3LTEA 1PSDA 3C3WA 3LHSA 4DRXA 1W49A 4MR9A 3BXPA 1VL5A 3ZPJA 3UT5B 1TTPB 4UTPA 1G8GA 3PDNA 4ZRNA 5LUBA 3SSMA 2CLOB 1OXVA 2RAVA 3AMVA 2UVPA 3H3JA 4WKNA 5IUKC 2IY7A 3UM2A 3OEWA 4NHEA 3ND5A 1DWUA 1WDMA 3DMNA 5IHPA 1ZIYA 1H2YA 4WUTA 1CT9A 4I1AA 3C8ZA 3KEFA 3BFJA 3EQZA 4OYYA 2DBZA 4B3BA 4C4AA 4HVAA 4RV9A 3WRVA 2PBFA 4FINA 5DB4A 2DEUA 4RZUA 1XPUA 1RLJA 3FTCA 3OF2A 3ONEA 2P5TB 3DOEA 3OECA 2J87A 4UZFA 2EKBA 3H5RA 4P4GA 1HE8B 4UHCA 1OIXA 4F2DA 1DC5A 5CDYA 4JI0B 2O8CB 2XVXA 4WNGA 4NYJQ 2ZETA 3OBIA 2PL2A 3HVEA 3EXHB 1X7WA 3P9RA 4YRZA 5IM4A 1XMQB 3LPZA 4TGLA 2E7ZA 3ML1A 4C08A 3EC2A 3FOZA 1VGQA 4FEYA 4W63A 4G86A 4MHTA 5JSUA 1IN5A 4RZQA 4ENPA 2M9MA 2MSNA 4X6UA 1M6VB 4PLPA 3GLGB 1U3CA 1E3SA 1RRGA 1SULA 2O8BB 4GLOA 3LZCA 2O4UX 4QBHA 5TGZA 3AM3A 4LVUA 3O4JA 2WA1A 2W2PA 5BXYA 1OX4A 1L1FA 4FVTA 1Z56C 1ECGA 1P8AA 3UQ3A 4OH7A 2D3WA 2QM0A 3T1NA 3RVJA 3EVEA 1C9YA 2BGUA 4BUZA 4B09A 5ARFA 1Z7WA 3DFKA 3KQTA 2PCLA 3M9WA 1YBHA 3PPVA 4PF1A 3F67A 3LW8A 1FNSA 1YR6A 5DNAA 3S2EA 3V6MA 3G5UA 5EHXA 1QOQB 3QM1A 3APCA 4MROA 4TYPA 3N2NA 4BIIA 1I8TA 3PC8C 5K0ZA 2ZYGA 5KTSA 1UDAA 3GCDA 5MN6A 2A30A 3ZV4A 1YR7A 1M7BA 1KK0A 2YY6A 3LCRA 4TMZA 1H6PA 1C1DA 4Q6WA 4C4PA 5H82A 4DLXA 2CLSA 2XUOA 2JIBA 3SZOA 3R0VA 4Z5XA 1ID8A 1INZA 3ESKA 3REFA 3FYUB 5JQGF 1NRJB 1JSXA 5C1OA 3FH8A 2GKGA 2Q29A 4E88A 2UZAA 1U7DA 1P5QA 3HKCB 3UPDA 1U28A 2DG2A 4PR3A 4QGBA 3B8HA 3R8XA 2O2IA 2H54A 3AG6A 1PDOA 1VLJA 3ZW7A 2CFCA 1BH6A 3EQ7A 1F8XA 3H83A 4JXJA 4N7JA 3RAEC 4KX3A 4LCEA 5LCXA 1Z2PX 3QE3A 1BW9B 1EAYA 1RM5A 1WPRA 4LOIA 4ZO9A 1R4MB 5LKAA 3NONA 1NVBA 3U61B 1U2QA 4MITA 2XVYA 4DBLC 3B1YA 2WSSD 1CUZA 2FZVA 4ZI3A 2PLAA 2X0KA 1YJAA 5HFAA 4URZR 4NY1A 4WNIA 5DM1A 2AW3A 2ONCA 4YJGB 1DV2A 4EG6A 2I4IA 1U1GA 3JRXA 1ECPA 2XB9A 4Y6RA 4OFWA 1W36C 3SI5A 3LFTA 4G9GA 2CF5A 1SOVA 3LVRE 2G04A 3T5CA 1QYRA 4Y1GA 4W5QA 1AP7A 2J31A 3WGVA 2EKQA 4J0UA 1XRRA 1FC0A 2XDQB 4DCSA 3KKPA 1IJKA 1ZD9A 2O3SA 3QA3E 4IUBS 3TF5A 4DB4A 1WF3A 4WZAE 3VC1A 1LS6A 2XYHA 2OXRA 5FJIA 4CLEA 5ARCA 3TSAA 2V4MA 4GE3A 1Q50A 5JZVA 1IB0A 1OW3B 4KNVA 2KXPC 3A9RA 3N07A 2FPLA 4Q4JB 4HF7A 3ROFA 3UK2A 2O2SA 4C7JA 3CH6A 5DLPA 1N9GA 2QTWB 2C99A 1K7EB 1UT8A 3L5KA 3OH8A 3Q1LA 2PPVA 1URPA 4OOEA 5LQNA 4YMUA 2QTHA 3QENA 4RETA 3EARA 4YP9A 3NTQA 2FG7C 3NBXX 1EVYA 2CZQA 1CD5A 2BZSA 3O1JC 3MTEA 4HGRA 4JI8B 4NKRA 4EYGA 3BMOB 3R8FA 4BZXA 4HEHA 4PSVA 2YYSA 4FNOA 5AKXA 1E32A 2VO1A 5IANA 1I3MA 3ICOA 3JVVA 3H65A 1PVOA 3VVCA 3PXXA 1D8AA 3C43A 1MTZA 4Y6OA 2O20A 3BA6A 3ASOE 3MUOA 3R9XB 3AETA 3FTQA 1HGXA 1HYHA 1B6RA 3UW3A 1QONA 4N5IX 4H4EA 4M7PA 2V1XA 2O1WA 3GCXA 4ISBA 2JFFA 4Q18A 4YRFA 3TVDA 1VB5A 1W1UA 2ETBA 4IVRA 4U2BA 4PCUA 1JB1A 2MYNA 4LAFA 4AUKA 3ASHA 4LJ4A 4J8EA 3QVLA 1FNCA 2FSUA 1XX6A 4IEIA 5GM1A 5H59A 4EPRA 4N76A 2PR2A 5IZ4A 2TSYB 3FNBA 2YC2C 1SUFA 2NNLD 4J03A 3MXOA 4JXTA 4AX8A 4UBNA 5CNKA 3E70C 3JR7A 3K6RA 2W2XA 5KYTA 3CNLA 4X85A 4KT6B 2P0EA 3GOHA 4YCBA 1FP6A 2J8SD 4J76A 2YHSA 4MWOA 3FPBA 4MYCA 2WPDD 5LIRA 2FV8A 5EIHA 3URMA 4BGDA 4L8YA 4RJTA 4A9AA 2W43A 2Z2ZA 3OX4A 5BSRA 2OKGA 4WY2A 2F4NA 1WP4A 2WIFA 3B6ZA 3NHLA 2GCEA 3AVWA 2OO5C 3DMRA 3OZCA 4QYSA 5GY7A 3RQIA 4EHAA 5B55A 2ZGVA 2OFPA 4ZI5A 4YT8A 2DZDA 3W8FA 2BHSA 3P0FA 1YVDA 2CXSA 3MAAC 3PWTA 3W2EA 4PTLA 1I5RA 3OQIB 2RMKA 4PANA 3OQVA 1QHNA 2WHXA 2HA2A 3UCEA 3KZOA 2OBFA 4UI9K 1XFDA 3DXXA 3H9UA 2QRKA 3I73A 3RIGA 1PR0A 5BNFA 1S02A 2WG1A 4QOSA 3EOAI 1M54A 1E7WA 1R0YA 2WZBA 3PEFA 4BCDA 4E1AA 4HLLA 5KJMA 1ML3A 4RE5A 5IAJA 3W6NA 2JGEA 3FW1A 1JSLA 2MHCA 4MB2A 4IVNA 4MMXB 2JBWA 1DXHA 4MR8A 2DBAA 1XV5A 1ZZGA 4MRUA 1GIAA 3H8SA 3HDQA 4L4UA 3GYGA 3K0HA 3WVNA 1CBUA 1PUXA 3NIGB 3NAWA 4OHPA 2OY0A 1RCTE 1ID1A 3HI4A 3NWPA 4NNJA 3W6ZA 4L95C 4BCCA 2IBSA 2NZYA 5HPYB 2QUHA 4DV6B 1T3ZA 3H8JA 5DEOA 3OO0A 3ZVVA 4NE2A 3LUHA 1M2FA 4M9RA 2AXNA 1YCDA 3NWJA 3H2IA 4ZWNA 2OAP1 5JNWA 2IGBA 3GF4A 5H02A 1GFIA 3VHLB 1XZMA 4Q7LA 4RPIA 5IDXA 1I7LA 2VK2A 3RVBA 5D2CA 3MKRA 1KYWA 1Z62A 3EPLA 2V4LA 3VX3A 3C7CB 4HRXA 2R60A 2VYVD 4QGHA 4FGZA 1OAAA 2H3EA 2JFXA 2PZ8A 5D87A 1FFBA 5KB3A 4ITUA 2BGGA 3WGNA 3G0GA 3DOFA 5SY9A 2X5NA 2WLTA 5JVDF 1EQUA 4ZZ3A 1GTMA 1SCAA 3FDIA 3HABA 4UYJA 2CFTA 4XFKA 3B9PA 4NEHB 5BV8A 3NM4A 1QNLA 3TGLA 1RC0A 1WXFA 2HF9A 5GJCA 3R7RA 3PP8A 4GLLA 4NZZA 3O9ZA 4IY1A 3ZU5A 3OM1A 4IZ6A 2RB4A 1P77A 1M6NA 2XNCA 5FQ8A 3AUSA 3GA7A 4J43A 3BDAA 3A2NA 3MWEB 4B6PA 2QROA 4D9IA 2PAAA 1QAMA 2XNSA 2LIPA 1A7KA 1XALA 3B20A 4FEEA 4AJ9A 5B7PA 3TLYA 1N2OA 1QFYA 3Q0EA 2A0KA 5JAOA 2NXCA 4M7OA 3KFXA 2WTEA 2BZ0A 2XZDA 5GP1A 3W78A 4LVNA 3PEVA 3GDOA 4NS1A 2WQZA 1K86A 2R3SA 3F3SA 3E22B 5CVVA 3D9MA 4QJ5A 4CIDA 1PFKA 3OMWA 4FMBB 2FVXA 5LZ2A 3KSQA 1Z0IA 3GMIA 1D6MA 3QNMA 2RI0A 1K8YB 2BR3A 2Z9DA 4QNNA 1T3SA 1DLJA 4GVXA 4KWEA 4AN4A 4EGFA 1WCWA 3D4BA 4IFTA 3WK8A 1NNSA 1KI1A 4HDRA 4C4RA 1G38A 1VECA 2OMKA 2VHWA 4EYQA 2I2BA 4AOFA 1PDWA 3ORRA 3PKJA 2MSKA 5DCLA 3K6SA 3H87A 3HO8A 4AZ0B 5DHPA 2D1FA 3Q15A 4QOFA 3VTKA 5TGDA 1W5EA 3RS3A 2GM5A 2DK6A 3Q7PA 3ZNOA 4DPLA 3VKHA 3NCTA 5I9TA 3ZXUB 2QORA 3AIMA 3S2FA 3A9WA 1HFEL 2XXAB 4IULA 3N2KB 4MAAA 2DH5A 5I4KA 3NBAA 3DUFB 3LPDA 1FUKA 2D0PB 3LT4A 2H2GA 3DE0X 1V7QA 5BO5A 4MGIR 2EZ9A 5DFAA 5ILOA 3C1UA 3D6HA 2LAIA 1ZN8A 2PZBA 4IM7A 4WCFC 4YHBA 4A73A 5JJ7A 3G0DA 2YWDA 2JIRA 3G0CA 3ZKJA 3SDZA 1PN3A 3KQOA 4M7CA 2VJKA 1ONNA 4Q00A 1EVKA 3CPEA 2XAUA 1BI7B 5D2MC 1USIA 2FA9A 2QTTA 2GBLC 3AW9A 2BKVA 3K8QA 4J0EA 4WTOA 1NV8A 3IA7A 4POAA 2QYHA 2F43B 3TUJC 4XFJA 1GSAA 3I5XA 1ZGBA 3V1MA 4BP3A 2QRPA 3V4RA 4JHKA 1QZUA 1RACA 1IN7A 5CP8A 1JCQA 1G8PA 3KLBA 4D46A 4EO4A 4KOAA 3DTVB 3HN2A 5TY0A 4TL7A 1ADFA 2VPIA 1TMGE 4C5AA 1YQ9A 2QPLA 3T7DA 3B6JA 2HI0A 2AN5A 5TPWB 4CYMA 2QXTA 3BZUA 4K5QA 2Q1XA 4ARVA 2OAGA 3FGNA 3EQ9A 4ALMA 1WBDA 3DCNA 4P3KA 1BS1A 2QV7A 1JDNA 4YDWA 2NUTB 4F4IA 3ZHYA 5J58A 4H1WA 1TD1A 2HF8A 5K8TA 4Q7MB 5TT1A 1GA6A 1OYOA 3U7QA 4GX1A 4PM4A 2V7WA 4RY2A 3VYVA 3S7BA 2C2GA 4ZP1A 1VPWA 3IQGX 1UC8A 5LP0A 3F46A 2YYZA 1W2HA 3L0DA 3OZAA 5DI3B 3VX4A 4ZHSA 4RPGA 4BMCA 1HG5A 2WTAA 4W5RA 1YQWA 4B6OA 3LHDA 4OL9A 3TXAA 6ADHA 1CQXA 4IDOA 2IO3C 4OVUA 1XRPA 4CCYA 3PEUB 4IDDA 4AMGA 1HYEA 3BGOS 1Z6QA 3EMDA 3FNEA 4ED9A 3BM5A 3RK6A 3EF3A 2I1KA 3COZA 3KSMA 1YR8A 2AQIA 3C3MA 3MYVA 3HVIA 3QVSA 1A2KC 5JDIC 5KNDH 4JU9A 1BX3A 1TQ4A 3OETA 2EARA 5D7BA 5HTKA 2O3TA 3OSZA 3P9NA 4P82A 2QRNA 1IAVA 4FYXA 3Q79A 2OD7A 2Z3ZA 4HNQA 2B8JA 4LJSA 3H7AA 3LF1A 5G3ZA 4DRYA 2G1UA 4F4JA 3SEAA 4HDAA 1QQ6A 4M98A 4AN0A 2TMGA 1LZKA 3ZHSA 1VE5A 1VFNA 2OQRA 5JZBA 4L7TA 1PS9A 1G7CA 1J24A 2YTZA 1Y6ZA 2B8WA 1Z0JA 2OO7A 4PZDA 2JL1A 3CX6A 4ANWA 3MUEA 1OAKA 2GK3A 2WVGA 3BHIA 4OL0A 5JT1A 4HEA6 1J8FA 3CC8A 3UBTA 3BXFA 1YIOA 3BTVA 1KFCB 3QTTA 2JHPA 1D0SA 3I9NA 1E1QD 2EATA 3Q85A 4JYMA 2VGEA 5FWYB 1YKSA 2AVDA 2YV5A 2PGNA 1K4YA 1P7VA 1KS2A 2YNMC 4MUNA 4RGVA 5FEUA 1LW6E 2HTFA 3EEQA 2EP7A 5HOQA 3HEMA 4R1PA 3KHKA 3GP5A 4HVCA 2QJTA 1ZJ5A 2P35A 1FBTA 1X4RA 2BDTA 2AL7A 3JV7A 5L53A 1Y3DE 4K6GA 1IAQA 3NUZA 5TF4A 1WUKS 1E96B 1S3FA 2VGXB 2VSOA 3A11A 4GPTA 4IQFA 4PYNA 2Q6OA 2WLSA 2QY7A 1J22A 4K9KA 4LWPA 4ER5A 2DLDA 2NU9A 3PXUA 1KY2A 4CG0A 3HZHA 4GR4A 4RVOA 3WIDA 2PEYA 2PMWB 4Q1CA 3FCEA 1TB4A 1SUWA 4XQ0A 4HWRA 1THMA 2IZ6A 2Z09A 1PZGA 1PLJA 2QRJA 4CPDA 4F2PA 2PUVA 5KVVA 3QE9Y 2JDID 4HH0A 4KYOB 1O57A 1A8QA 1UBMS 1PJBA 4FYHA 2K6GA 3UC5A 1DJMA 1DO2A 4F3YA 2ZGDA 2D7CA 2A1IA 4BBPA 3WNQA 2YXPX 5GIPE 3SYMA 1LLQA 3O2JA 1P5FA 4OXNA 3C45A 2I3BA 1VHWA 3NP7A 2EYUA 3AR7A 4M3NA 5SZIA 4BJ3A 1YCGA 3VPBA 5HGJA 3ZLBA 3ABOB 2CXUA 1M0SA 4FLFA 4H1HA 3T7SA 5AI0A 2Q4RA 2ZJOA 2DYRE 5P21A 2ZSAA 3COYA 4NBRA 4W5NA 4QO7A 1FSZA 2AJLI 5LCWC 1J2RA 2JIMA 1X15A 4JEMA 4NBUA 4ZEXA 1VE3A 4P4UA 5DZSA 2IYXA 3AERB 3TZBA 3ZZ0A 3GLIE 2CFZA 5KTMA 3A1VA 3ABRB 3EMKA 4UM9B 2H51A 1EUCA 2GQ0A 3PT9A 3LLCA 3EQ8A 1Q1AA 2QZSA 4K5AB 3PC7A 3FTEA 3AUAA 4DKXA 2RJ3A 5LXTB 3CPSA 1CR0A 5JOQA 2J0UA 1HX7A 3ZDYB 5F4BA 4PAWA 1XOIA 5AM1A 1PAUA 1GQOA 1FTWA 1NJ5A 3AB3A 3SZRA 3P9CA 4EHIA 1Z25A 3ZWPA 3QTLA 3UTMA 1MB0A 1SD2A 4ARZA 4FLBA 2FH5B 2RGXA 3BHJA 3M6XA 3TOCA 4A92A 1XP5A 2WUEA 5J4HA 1O7JA 4RSYA 3UAOA 1K3UB 3I72A 2HWKA 5AYWD 4PZPA 3QFRA 5IJ9A 1I30A 4BN4A 2ATEA 1GOTA 2XGOA 1WCIA 4NNOA 1CX9B 2IUTA 1AXRA 2C95A 3C4VA 3HCNA 3NM6B 1EFUA 1KJQA 3R0XA 1J1ZA 1OFIA 3ZWOA 2VDWA 1JXMA 5DYTA 4BU0A 3OZ7A 3GVHA 3R9IA 2Z57A 3AIIA 1TW3A 3MVEA 1X7ZB 4XLZA 4XE5A 5JNUA 4B71A 2ONZA 5IAAA 1R8SA 2ZIXB 2C20A 2DWCA 2XNDD 4BMNA 1QYVA 4BX9A 3B9BA 5EL0A 4I1MA 3AZOA 1V2HE 1TLTA 1WA5A 3H1FA 4Y98A 5EXTA 1JI0A 3Q7IA 3SEZA 5AUNB 5C18A 5GVSA 1DJLA 4WK2B 3R3WA 1RWXA 3QYJA 2M32A 1JR6A 1KPHA 3JTEA 3RSQA 5GZ6A 5C5CA 3S29A 2A6PA 1J1UA 5KTRA 3KZ1E 1P39A 1DVRA 1WZIA 3PI6A 4BVFA 1E3WB 3CZRA 4DF3A 2BEJA 4JR1A 2HHAA 2ZULA 1U3DA 4MVJG 2BEWB 1KOGA 2VCHA 2V8OA 4D0GA 1N1GA 3RUFA 2XYRA 3GGDA 1TUEA 4XOIA 1PK8A 3ZJVA 3KBBA 1DEOA 4TLAA 2Z2IA 4LJYA 4I9EA 3OQ6A 4JBXA 4RPKA 1QTRA 1OCOE 3GZ1A 2AXPA 1R5NA 3NBKA 3AF5A 4RG9A 2DPMA 4KXQA 3U3ZA 2Y4UA 5KYYA 1OA0A 4GDMA 3CF0A 3UXGA 4PAGA 4EI8A 1KGSA 2XRMA 2C0LA 3CWZA 3BE4A 2QIPA 4YAOA 4GGOA 2CXQA 4DUGD 2R2GA 2BJHA 4KI0A 4PLVA 4RY9A 1QTNA 2GK4A 4I4TB 3Q87B 4JOCA 1WD5A 3P2EA 1E9BA 1OY1A 4G5HA 4URUR 3TTSA 1DKMA 3ZIAA 2C5AA 3DOIA 3PHCA 4DS3A 3F6QA 2GXSA 2XDYA 4R16A 3NC0C 4Z9XA 4O3FA 4BFVA 3TSWA 5HS6A 2I71A 3HYMB 3DBRB 1LVUA 4BKPA 1L4EA 2OCLA 2XRFA 3MW8A 1U7PA 5GGYA 2QUIA 4B81A 1EHYA 2VA9A 1BYIA 4QDTA 3MMPA 5JE8A 1QH1A 5LP6F 1QP7A 3Q7AA 4Y9RA 4RIEA 3D2LA 2G1PA 2XEHA 2NTEA 3HSKA 4RIGA 1SVXA 5ALSA 5GVRA 4JBYA 2DHCA 3SZLA 4V24A 4EY3A 5CMYA 2XUHA 3UKOA 4BL5A 2XB8A 3CRMA 3N05A 5D5QA 4PC1A 1W4BA 1N5JA 4G5YA 3C72A 1I5EA 2OEPA 2XQVA 1NFFA 4UYKB 4Q4CA 3FI9A 2J5QA 4P7JA 3WHPA 1L5QA 4LJ5A 1FJGB 4HUQA 4QUJA 3IP9A 3JQ6A 4Q12A 4YUVA 1VG8A 3IV6A 4YI5A 4YASA 3U37A 4CIAA 4KAAA 4G8BA 4OLFA 1WU8A 3DP9A 3FPEA 5J43A 4ND3A 3VAAA 4CF6A 1KPSB 1JLHA 3I39X 2GF0A 2HOQA 2ODEA 5DV9A <