4XIFA

Human ogt in complex with udp-5s-glcnac and substrate peptide (keratin-7)
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
717
structure length
702
Chain Sequence
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title The active site of O-GlcNAc transferase imposes constraints on substrate sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 268
structure length 702
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xifA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xifA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4xifA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4xifA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xifA03
3UYLA 1RZUA 3L7DA 5ARGA 2GPNA 5TMBA 2VGXA 1ELWA 2C0MA 4KYOB 2XA1A 2VCHA 3G2KA 1JIUA 2KC7A 3MS2A 2XEVA 2I6HA 4BQIA 1QZ2A 2IFUA 3Q4AB 3RIBA 3SZ7A 1C8LA 1O6CA 4GYWA 3Q15A 4GZ3A 4UI9J 3Q3IA 4G26A 3G2NA 5FTPA 4BFCA 2H1FA 3BCRA 5JJTA 3L01A 3RKVA 4EKEA 4BTAA 4YVOA 3LY7A 3ZCUA 4LEUA 1FS4A 4N3BA 4RIGA 4M83A 2R60A 3R9AB 4RIFA 1K06A 3CUTA 3HBJA 3Q3HA 4AY6A 1QQEA 2VYIA 3QWPA 2LNIA 2WTXA 4GA1A 4BT8A 2KCVA 2IYAA 3C4VA 4LEIA 3KAEA 3NC4A 1F6DA 5I45A 1E4OA 4JHRA 1PC2A 2ACVA 3BEEA 3SYRA 3L7CA 2R68A 4RIEA 3Q47B 3T3HA 2OOEA 2VQ2A 2LSUA 5IKOA 3OXGA 1GPBA 3RSCA 5CHEE 4YUAA 2IEGA 2F3SA 2O6LA 3MBOA 4AMGA 3CV3A 3T3GA 1F0KA 4KQ1A 3ZGQA 4CTMA 2JZCA 1AHPA 1XC7A 4KXKB 2YHCA 3MV3B 2NC9A 3K9IA 1FTYA 4N5CA 2QNBA 3MQFA 3MEKA 1KLXA 2FEZA 1XV5A 4QLBA 1XOIA 3DDWA 1PYGA 3RT1A 2WQHA 3TG4A 3SYMA 1HZ4A 1P2DA 3Q5MA 4G2TA 4KBQA 1NA3A 3JYSA 4G23A 4U07A 3S7DA 4HOTA 2IEIA 2C2LA 3CX4A 4REMA 4UI9C 4F96A 2VGYA 3Q3EA 2ZB2A 1XL0A 1IHGA 2Q7FA 4GYYA 4NC9A 3SF4A 4HOQA 4N39A 5EKQD 3WXXA 3MRXA 4NQ0A 2QRPA 3BD7A 1KT0A 2XGOA 5ARFA 3QOUA 4X7PA 4MI3A 2VSYA 4WUYA 1P5QA 2IV7A 4CTOA 3HYMB 1GGNA 1IIRA 1H5UA 3IAAA 1FA9A 3HBFA 1GPAA 2QN3A 3ZCTA 4J8EA 4Z5XA 5G04J 2PL2A 4GCOA 1ZBPA 3BD6A 2E2EA 5C1DA 2HR2A 2BGUA 3LYAA 3QDNA 2VG8A 1EXVA 3T3EA 4B94A 2ECPA 2F3PA 5M72A 2X6RA 3CVPA 5A6CA 2JJMA 7GPBA 4O6FA 3CVQA 4H7YA 2H1HA 4BQEA 1IYGA 4CDRA 2AW3A 5HXAA 3CK8A 5DU2A 4G25A 3O3CA 1NVKA 3BD8A 3ZN3A 5FZSA 3C4QA 3ASHA 4I9CA 3WADA 3CUUA 5IKPA 2L6JA 2R66A 2DBAA 4I17A 3CUVA 3CK7A 4GZ5A 4EL5A 1PNVA 3MV2B 4HOUA 3U3WA 1JIXA 2QN9A 1QM5A 1A17A 2F3QA 3UUXA 6GPBA 4GYOA 4AMBA 1IXYA 4F3VA 2R4UA 3VDNB 2V5FA 2XCBA 3CV0A 5LQDA 1PN3A 5CCMA 2GPBA 4M7PA 4YI3A 3GZ2A 4GA2A 4CTNA 3BDAA 4EL0A 2BUGA 2PZIA 2Y4TA 5DXFA 1YA6A 2FO7A 2YJNA 5KJKA 2QRGA 3MS7A 2XCCA 4N2QA 5KJNA 1J39A 3NPAA 3FROA 1HH8A 5D0QD 3RO2A 3QKWA 4X6LA 3FP3A 1JEJA 2X0EA 1JG7A 1WAO1 5A7DB 4YI5A 2VGXB 3D0QA 4X7RA 4UI9K 3G2HA 4M60A 5LCWC 4GZ6A 1YA0A 3N71A 3GUHA 3Q49B 3T7DA 1NA0A 2QN2A 4WADA 2C1XA 1W3BA 5G04C 2HY7A 3T3DA 3VUFA 3OT5A 5BW8C 4XI9A 3DD1A 1AXRA 3IEGA 1WW2A 4WACA 4RIHA 4HLNA 1K08A 4N3AA 2XA9A 3OXFA 1L5WA 3TG5A 3T5TA 1SXPA 3NP7A 2ACWA 1LWNA 3LCAA 1NZFA 3ZCRA 5CCLA 4WNDA 4F97A 1PSWA 3RHZA 3MTAA 3MT9A 1C8KA 3GZ1A 3DDSA 1E1YA 1V4VA 2SKDA 4KQ2A 1NOKA 3PDNA 4RENA 3S28A 2XA2A 4EKYA 3EBOA 4MICA 4FZRA 1GG8A 2FI7A 4UQYA 3LPZA 4UQZA 1XNFA 2BISA 2FETA 4ABNA 3ULQA 3NCHA 5FZQA 3GYZA 3AMVA 3OKPA 5EX3A 3MA5A 3AS4A 4I1AA 3S7JA 2XGSA 3MTBA 3QKYA 1B4DA 1B89A 4W6QA 2OFFA 4G1TA 2KS6A 2R4TA 2MHKA 3UPVA 3CEHA 2ATIA 3CEMA 1C3JA 3MS4A 8GPBA 4MRAA 1RZVA 3BCSA 1L7XA 1E96B 2BFWA 3CUYA 2QZSA 5JJ7A 3D0RA 4MHSA 1FC0A 2LSVA 4WNEA 4BQFA 4G2VA 2ONDA 2KCLA 1A8IA 3QWVA 1KTIA 3CVNA 2QRHA 2X0FA 4CGWA 1YGPA 2FF4A 4JA9A 4BT9A 1NZNA 4AM9A 1ELRA 2BGTA 4RBNA 3PE4A 1Y6FA 3NP9A 3E3LA 1HXIA 1Z6PA 2PQRA 4AIFA 3OTIA 5LCWJ 1WV0A 5BNWA 2AVPA 1Z62A 4A1SA 3L7BA 4BTBA 4WNGA 2PQ6A 3FFLA 4X7MA 3O48A 3GW4A 4RG6A 1Z8DA 5KJLA 1P4HA 1WUTA 2X6QA 2C4MA 3ZHEA 3HBNA 1UZUA 2AMVA 2PYDA 1WM5A 3CVLA 3ZPJA 4HOSA 4FKZA 1RRVA 3EDTB 1NZDA 3OTHA 2FBNA 2QN8A 2QN7A 5DIZA 5AYWD 3TSAA 4EQFA 5FT9A 4XI0A 2FF5A 2SKCA 3MRVA 3MKRA 4U0UA 3ZCSA 4F9FA 2GM9A 2PRIA 3H4IA 4NEQA 2UY1A 3ASFA 3NB0A 3RJVA 1ZU2A 3VDMA 2VSNA 1FU4A 3MRTA 2F3UA 3S7BA 4XIFA 4N9WA 4GPKA 1WW3A 3RO3A 1GPYA 5FZRA 3UYKA 5KJMA 4RIIA 2C0LA 5D00A 3ASGA 3KD7A 3D1JA 2IW1A 5TVGA 4HWGA 1P4JA 2IYFA 5GPBA 2UWJG 4YNDA 1TJCA 1L5QA 1FTQA 3TAXA 1XKXA 4HORA 4RELA 3S29A 3LY8A 2J9QA 2KATA 4RG9A 2IV3A 5JTTA 4L22A 5DLDA 1NOJA 2GEKA 3QHPA 3ZCPA 3HBMA 2R5SA 5JJ6A 2G9RA 3E3OA 2P6PA 2QFCA 5DBKA 5TMDA 5HQ8A 1P29A 2SKEA 1FU8A 2GT1A 1FTWA 1L6IA 1P2BA 1C50A 1EM6A 1UQTA 4WNFA 2GEJA 3RSZA 1JG6A 4J8DA 5D01A 3U4TA 4U04A 3OTGA 3AS8A 1NOIA 3LY9A 1ABBA 4MI6A 9GPBA 5EX0A 2Y4UA 3NF1A 3L79A 4J8FA 1Y8MA 3VTXA 5FJYA 2PQNA 4AN4A 1SXQA 2YQ8A 2XMPA 2IF4A 3CKBA 1OUVA 2ASVA 2G9QA 3ZCVA 2FFRA 2X0DA 2P58C 3TGOA 1L5SA 2XPIA 2QLNA 4JA7A 3URZA 1FU7A 2IUYA 4MHOA 3MT8A 2JLBA 4EJ2A 4W9RA 3LKUA 1XL1A 4APOA 3CKCA 1LWOA 3VTYA 4MI9A 3QWWA 3G2LA 2XGMA 2VCEA 4PQGA 2XCUA 4Y6CA 5G05C 5HI7A 1QKJA 3MT7A 3CEJA 1P2GA 3OKCA 4GA0A 3ESKA 1WV1A 3OKAA 4ME2A 4N3CA 4WHMA 2KCKA 1FCHA 3H4TA 3OY7A 5ENZA 1Y6GA 3MSCA 3ASDA 4BWRA 2XCIA 4U0ZA 4NESA 4U0SA 2WPVA 3PE3A 1HLFA 2G9UA 4CGVA 3T3IA 3CUWA 1BX3A 2PYIA 3S2UA 2QLMA 5D0OD 1L5RA 3FWVA 2C9ZA 3L7AA 3S0JA 2QRMA 2PRJA 3OY2A 3DZCA 3NAZA 3BCUA 4N2SA 4G24A 3ZCQA 1JIVA 1Y8ZA 3CEQA 3IA7A 2AZDA 2G9VA 4J0UA 1NLMA 3GPBA 4GPBA 2QRQA 3S27A 3VUEA 1L5VA 2GJ4A 2AV6A 4GCNA 3CK9A 2HYZA 1GZ5A 4LDPA 1KT1A 3E4BA 4IN3B 4I2WA 2HO1A 2Q6VA 3EBPA 3E3NA 3ZHEB 3TOVA 3MTDA 5TMEA 1VGVA 3BEOA 2GPAA 4KQMA 3S7FA 2QN1A 1Z6QA 3WAGA 4I2ZA 2F9FA 3COPA 1P4GA 1WUYA 3RU0A 4AY5A 3AS5A 2GW1A 2C1ZA 5G05J 4H7XA 4I9EA 3ZFWA 4NRHB 3G2IA 1M5RA 4UQXA 5JTUA 2QLLA 4JL0A 3C48A 3OXLA 3G2JA 3WC4A 3KS2A 1UQUA 2UY1B 1GFZA 4Y6WA 4YVQC 3UQ3A 5BT1A
chains in the Genus database with same CATH superfamily
1Q17A 4Y2HA 4L75A 1DU4A 2B78A 1V55E 3JAWB 1HEYA 3CX6A 4OK5A 4V02A 5KSOA 1M72A 5LC1A 1K8QA 1JR2A 2M63A 2DIWA 2A1UA 4AMYA 2LZ0A 1TQ6A 3IAHA 4M49A 3D5EA 5SV2A 1YO6A 3Q6MA 3K8QA 2HKIA 2E5WA 2OENG 1V1RB 2Z98A 4MR8A 2OZLB 3WK9A 2GM3A 5JW6A 3TLXA 4DXAA 1ZA1A 3VV2A 2QF7A 2C78A 5GJBA 1K4MA 4ZVNA 1HETA 3BFJA 2ZATA 3Q9UC 1B1AA 4BVJA 5AQAA 4B3XA 1NN0A 5TIIA 1Y82A 2INGX 4DUIA 3B95A 1CR2A 2DPLA 1BHQ1 1KE2A 2W58A 3C5WP 1QK4A 4MW9A 2B4TO 5F76A 5GJWC 3TJZA 4HD8A 3PJGA 4I3GA 5FTMA 1Z5NA 2HLPA 1EE2A 3PNOA 3OU6A 3ISJA 1Y9EA 2AN4A 2A1TR 4B4UA 3FTZA 1HFAA 4P4LA 1NVMB 1ONNA 4L1KA 5CH5A 4DX7D 4D8YA 1PHRA 3B3FA 1IJBA 1CUUA 3QVUA 5TS2A 4YXWA 1MD9A 4E6HA 3H8WA 2EJUA 2AXPA 4IHKA 5DW3A 1BQ3A 1JVBA 4E03A 2PKYX 2AXNA 3B8EA 4YRNA 2IGBA 4WFKA 3KUUA 1I30A 3PUJA 2NACA 4WADA 5FQ6A 3HY6A 4PUCA 4GF5A 2AK2A 3AR5A 4ARCA 1REQB 4F97A 1RKUA 4C0SA 1ESEA 1NOKA 4N5LA 3QNKA 4JODA 3AL2A 3EQ8A 2VJAA 2MOWA 1ZPDA 4CQLB 1YFLA 1N0WA 5A62A 1NYQA 1BC5A 4DLOA 4KFUA 1TADA 4OX9B 4O1HA 4WMLA 4AJ1A 4INZA 2ONDA 2W6JD 2CXUA 2C95A 4MKTA 4R1NA 2DFDA 1YL5A 2G5TA 3KKMA 1R9JA 1XRLA 3SFVA 3WP0A 2BDEA 3V8BA 4MQ5A 5I4IA 1QYDA 3R7AA 1QH8B 4X9XA 3QFCA 3FRIA 3CNLA 1A72A 2W6OA 1HF3A 1MABA 2PZKA 3AF2A 1VI5A 3KWLA 4N9WA 4LZWA 5CVVA 4F86A 2X1MA 1XJ5A 5FH9A 1E6LA 1W76A 3T9KA 1JYSA 3FFBA 4M9SA 1H1LB 4I5DA 4FJZA 4ANUA 3DYVA 3ABKE 2ZIZA 5FP0A 3C24A 3I73A 4C4TA 1HQCA 2YYYA 4V1CI 4G9BA 3AXTA 3BMOB 4X24A 1HYQA 1H23A 4DJFC 2TRSB 1KO5A 4Q4DA 3FKQA 3RHSA 1IOWA 1KH1A 1N4QA 3TGOA 4JP5A 1SXHA 3CRMA 4A15A 2BMEA 3AEUB 3PDCA 1KMHA 5AKXA 2IZ6A 1FBTA 4RK5A 2D62A 2AEJA 2XB2A 4ZI7F 4BNYA 2QQEA 3THWA 1VPTA 4HWKA 3M4XA 3CEJA 1UP4A 1UEIA 5FOQA 4J1SA 3UGJA 4R9UC 2PT9A 1H6CA 3HDGA 2DX7A 1E94E 3NFRA 3H3FA 4EY4A 1CB7A 1SBIA 5B6JA 4ALLA 2JA1A 4BN4A 2W71A 4OXYA 1A8SA 3I2GA 2I9PA 3E3NA 1MC8A 3SWWA 4B3HA 1TJ4A 5LQAA 3BXGA 3K5WA 1UBRS 3C3QA 3HNRA 1I0ZA 3I9KA 2E4WA 4ZAYA 3T5VA 1YWGO 4ZK2A 5EJGA 3UYLA 3LUFA 1E3JA 3TD2A 3A1DA 5BVGB 1LDEA 4MUBA 3DL0A 3K2IA 4PCVA 4QU9A 2COEA 4NV1A 1RWBA 2Y05A 5T6BA 3FU6A 5HK8A 1OWLA 3UM0A 2WU8A 1X7YB 1I2MA 3S2GA 3F49S 2FN7A 1YH3A 4G8JA 1UBFA 3J81k 4IRMA 2RGYA 2CLSA 2ACKA 3WAJA 1P80A 2V65A 2FSFA 1BEEA 2BPOA 3CB4A 4I1OA 3PC2A 5FBHA 2B1RA 1CF2O 1T2NA 2YZNA 1LLQA 3ZXYA 3P0JA 1Q3KA 3H8SA 4DN6A 5ARDA 3TMYA 2P7IA 2ZBGA 1U1DA 2C2OA 2IX9A 4KRFA 5CYPA 2B20A 3BFKA 1MNQA 4UI9C 3F4KA 1KQNA 4M55A 4QU8A 3OZSA 2ZIWB 2QN6A 3AG6A 4RETA 1Q20A 1LV7A 3LFTA 3OIYA 3ZQJA 1Y8QA 2K4NA 4YV0A 2PL2A 3MUFA 4WRRA 1E8YA 2I1VB 2ZIRA 1Q7TA 1IMOA 3BOSA 4RGBA 5FTLA 2V6GA 4I50A 4J4BA 1JPNA 2W2XA 5ESXA 5TC4A 2VTDA 1YZQA 1AKRA 1XNGA 2FCAA 1F0YA 5IF3A 1PN3A 4BZZA 3QU4A 4G8DA 1LDBA 3BDAA 5CNKA 5I5GA 4DDWA 3AVYA 3ZWOA 1ZK2A 2V5QC 4KWTA 5BN4B 4JMPA 1MAAA 3WYGA 4RQTA 2NN3C 1YMUA 2PBRA 3DO6A 1I8TA 3FWPA 1JEYA 3RSQA 1R5NA 4PAOA 3ZX5A 3FPEA 3SF8B 1YL7A 5K3BA 5TB5A 3QG5A 5IYZA 3QHAA 2E85A 1Q95A 3FH0A 2BKUA 2PU7A 4HQFA 1G8FA 4U3JB 1NE2A 2XA2A 3E7PA 3D59A 4BBPA 3RSEG 3KJGA 1CQIA 3MA5A 2ZEJA 4HXFB 2UDPA 4KVAA 3D64A 4ZU3A 3V6LA 2JD2A 2GYUA 5I7EA 5AICA 4AVYA 1N2SA 1MP0A 2GCNA 2MINA 3NHKA 3KYDB 4QUEA 2FSVC 4D0GA 1I1HA 4X3CA 1Z7EA 5EIFA 2OT3B 2EFGA 2A9OA 1GNPA 1XNQB 1SQMA 3KXLA 3HBNA 1QTNA 3EASA 2IY9A 3TGLA 3TIFA 5AYWD 4QDKA 4ZQBA 4PRYA 3CLJA 5BPFA 5IFKA 2Z5FA 3IIKA 2GM9A 3E53A 1VIDA 2CLIB 1WSWA 5DMHA 4BHTA 4Z4EA 3QV2A 1K0UA 3EXAA 2E87A 4PZ9A 3G17A 1G5TA 3VBEA 1VOTA 3AETA 3AX6A 4F72A 1CUSA 2NWQA 4UARA 2YDXA 1KO8A 3MJEA 2DWPA 4J1QA 1WP9A 1L6IA 1G38A 1UJRA 4G84A 4J8DA 2G5CA 2ET6A 3FCXA 4L3WA 1YZUA 1DG9A 3ABRB 3DXYA 1X8JA 3RYFB 2YV1A 4FNMA 2GCOB 3MX3A 1T1IA 1LUAA 3KZVA 2BGMA 3O4FA 4P35A 1YB2A 1I33A 3P9PA 2RKKA 3MT7A 2W4IA 1OA0A 4MW4A 1Q0TA 5LMZA 4BPBA 2VP6A 1MX9A 5IZCC 1HDIA 2PMBA 4MHTA 3L22A 3ENKA 4MIEA 1NPDA 4GLLA 3CHQA 1YBHA 3QJGA 4U0SA 1K98A 4NYJR 1NNUA 2LO6A 1I4OA 3DV2A 2AUMA 4UBNA 2ACEA 2FN8A 3BZUA 1II9A 1DGQA 3FZYA 1EBBA 3OX4A 2ZGDA 3LCJA 4YMLA 3LLMA 3BMCB 2BEWB 6CHYA 3DWLG 3VPGA 2WMYA 2G77B 1Y7PA 2RKWA 1VG0B 4MVCA 4TM8A 2GLUA 3R74A 3I30X 1Q1EA 4JL0A 3S1LA 2QRNA 3RSOA 4EHFA 4B81A 3TPFA 4GKJB 1KYYA 1RZRA 4HF7A 4IV8A 4ND8A 1PLJA 3U13A 2P3SA 5IBQA 2C3YA 4XD7D 4D96A 3D9NA 2ZU0C 4HFMA 2XNCA 4EHAA 1OWOA 1DO2A 3H7IA 5HQJA 5EA2A 3CA8A 1S3IA 4B6PA 4BBZA 4YVFA 4G65A 3WV4A 1BWRA 5CM8B 1WJGA 1OYYA 4K9PA 2RGEA 2D1QA 3QAQA 4E5PA 3NASA 2VHYA 1NVTA 4UDOA 1EB8A 3R20A 5KTKA 4F2DA 2PD4A 1D1PA 4WZBA 4MQEB 1D3AA 5CAEB 1E9CA 4CMGA 1XZHA 4RX1A 5EI5A 3QC1A 3W06A 3SU8A 4DI3A 4JI6B 3W2EA 2FUG1 1TNBA 1WPGA 4MV3A 4IXMA 4ESEA 3SN6A 2QT1A 3WJ7A 1BS9A 1KR5A 2X6RA 2ANBA 3THYB 2Q0HA 1HF8A 3EUWA 5JO9A 4PHHA 4BQEA 4G25A 2QVGA 3BGSA 2I54A 3UWOA 5JRZA 2CNDA 4J8PA 5ICSA 1TVKB 1Z4OA 1EZ4A 1G59A 4PGHA 4DQUA 5IABA 4YRAA 4JI7B 1K5GA 1XZAA 4GG1A 4HFGA 2OYCA 2O8BB 5T6MA 1XEXB 3ROPA 5TPZA 2VDRB 4U8YD 3ZE7A 1DTSA 2HK7A 3AFIA 2QTBA 3EF0A 5EUCA 3UICA 5JD4A 2HT6A 4MLZA 4Q4AA 1TM3E 2C4WA 5BN3B 3R6GA 2Q3CA 3I01A 2IOFA 4M9UA 3TG8A 2P9IG 1H22A 3IHYA 4TWIA 1DDGA 3ZHRA 1RPAA 2QX4A 3GLGB 1XRJA 1LWNA 1NZFA 2QPAA 2WUFA 3F4BA 3L1UA 5CM9C 3OEED 1YDMA 3DPSA 3HJTA 5IC6A 4FFPA 2YZMA 1V8DA 3OHSX 4QU0A 4GVLA 3TNDA 2FK8A 2RK6A 4EKNB 4ILEA 1V16B 1P7VA 2BE7A 4QPCA 1X7XB 3NV7A 3FLMA 1G1MA 3RNLA 1LNQA 5MFZA 1VLMA 4D4JA 2R47A 4LW8A 3RVQA 4CGWA 3PRKE 5AVXA 1EFDN 2Q8QA 3ENNA 4Q7MB 2QUZA 4BNDB 4X63A 1FRNA 3GCDA 5ENVA 1LI5A 4II2A 3JQGB 2BT4A 4Y98A 3Q8WA 3H04A 2X0IA 5FTWA 4H17A 1U28A 1X15A 5TQVA 3K0HA 1FTNA 1A4UA 3AVVA 2O8CB 4CF5A 4I5IA 1QBKC 2AC2A 4DSUA 3F6QA 2B4AA 4DCOA 3FTVA 5CNMA 1L5FA 3T35A 2F00A 4ND7A 4FFVA 4HI9A 5JC8A 2WQ6A 1WCYA 3LDHA 2RAFA 3L8CA 3AF4A 1N5DA 3U37A 1HFJA 2C5AA 1EFVA 1KARA 3SIXA 821PA 4LHWA 2EFJA 4KXWA 4DEVA 4E46A 3NF1A 4NCAA 5K8TA 2YQ8A 4UPDA 4BLUA 2JJ2D 5AW2A 2EWVA 1A9RA 2H92A 1W34A 5MDHA 3RVDA 3DTVD 4NG4A 5LQSA 1VB5A 4DCTA 4RULA 2WPNA 3OE4A 3MILA 2P9YA 4Z4HA 1EM8B 4O2BA 3NB2A 3OP4A 1QIHA 1EUQA 4X71A 1OXKB 1SUIA 1RKQA 4Q4JA 3N2KA 4KLCA 1CR6A 2P2ZA 1D7OA 1II0A 5F23A 4EGAA 3EFBA 3PF9A 1GG9A 1TK2A 3WRYC 4HGPA 5JMTA 4JQOA 3L7AA 5IC4A 2FR8A 5CXQA 2WYOA 4B6SA 4OTZA 4RCVA 2XNDD 4DSAA 2XPCA 2ZRHA 3C3BA 4J9UE 3GMDA 3SCZA 2HIGA 2BVNA 2ZS7A 5JQGB 3AU9A 3WL7A 1T2CA 4BZPA 3J7TA 1JR3D 1WRBA 4Q3CA 3I32A 5GOTA 4RHCA 2A9QA 3C5HA 5JMOA 3QUAA 4JUAA 5AH0A 3TW8B 3EFHA 1Y34E 4K03A 2GERA 2H8GA 4TSKA 4LGYA 3E05A 5BW6B 2XEVA 1ZISA 5KSZA 3RYHB 3DMGA 2AL7A 4OVVA 1U8CB 4J7UA 4GEKA 3HSSA 4EARA 5BSRA 1YQDA 1DC5A 1XK6A 4GMRA 4XGIA 1MJGA 2IT1A 3G1UA 2Q4RA 3PZDA 3IRVA 2AEMA 5K8JB 3QH4A 4UE6A 5F7ZA 3ZBQA 3I0MA 3ZBPA 3CVUA 4GZLA 5CTJA 4R0VA 3KQSA 3GFSA 4MLPA 1H4TA 1XG5A 1B6RA 2EGGA 4F11A 4KN8A 5JU6A 1GAXA 1N7IA 1AM4D 2IEYA 2YXBA 5CBPA 3K16A 1U5BB 3MB8A 5CPBA 5ARBA 4OAQA 2XE8A 1GXSB 1ACJA 3Q87B 2ZJFA 3FUVA 1C3EA 2QZPA 4YQZA 1NL3A 2ZUTA 4YP1A 1EGHA 1QMOE 2CXHA 2AW3A 3KYBA 3O3CA 4IDAA 1PR2A 2L6JA 5C8DA 1QS0B 4EJSA 1P8JA 2DCPA 3WLPA 3SE7A 1W1IA 1R4MB 4ZAVA 4LJSA 4BB9A 4XARA 3UTDA 2PL5A 2IZZA 3ADDA 5DASA 3AV0B 3AKZA 1X8LA 5HIIA 3A11A 2OP0A 4JT9A 1EUCB 2JRLA 4MKFA 3DD1A 1KEWA 4GP6A 5FHQA 3MELA 4MP3A 1CW2B 4OMFG 3D8HA 3OE7D 3AYXB 2QTVA 2PM7A 1PDWA 4Z7QB 5BV8A 3H4VA 2B4RO 4JW1A 3S8MA 3ULQA 4B3TB 4EMTA 2J3LA 3GDGA 4CF4A 5JNLA 3D3WA 3I53A 1Y4AE 4GSKA 1WBDA 1WY7A 2RG8A 3NWOA 1E96B 4NMLA 1V7CA 2LTAA 3JQ9A 2ZCJA 4G2VA 1M3SA 1XRRA 4XYGA 3H2JA 3GN2A 1WV0A 1XBTA 4BNFA 3ZHZA 1MENA 3KSRA 1N0IA 3ONKA 1M34A 2HU2A 3OIFA 4BNKA 1IN5A 1YD7A 4C2BA 5CEDB 4Q3OA 2GETA 3NIFB 3C8HA 3K9FC 1OY1A 4OEHA 1SBNE 1X7HA 1JUDA 5F5NA 1U2RA 3MRTA 1EUZA 3BM5A 3L8YA 4FFBA 3RGWS 1M76A 3R5JA 2E4AA 2IW1A 4GYJA 1Y9ZA 4GI2A 3CZ4A 1TB4A 2J8SD 1HQDA 2LE0A 3Q6IA 3K32A 3D9HA 1TXGA 3NWJA 2UUAB 5A6SB 2PX4A 3BJMA 3P7MA 2ZSKA 3RODA 3GCZA 3PA8A 1CUWA 4H4CA 2IV2X 5JISA 3GCWA 4KR7A 4N0DA 2RHMA 4X84A 1NG9A 2IUEA 3A1TA 1ZSNA 3JQFA 5CXUA 3VVLA 1KVUA 3L8GA 3GLFB 3EGEA 1ZRSA 4POAA 2GM4A 1X1BA 2GS9A 1VMIA 2W2KA 3L9XA 4YH1A 4BFVA 2ZBFA 3DHWC 4Q6WA 3U3XA 3EG5A 2ZYUX 2VPPA 2RHGB 4BWRA 4RESA 2ZU6A 2FF7A 1EXDA 1V7PC 2UYYA 3DZCA 5BV1A 4CKBB 4M89A 1LTXA 4B44A 3G49A 2F1RA 4EPTA 3FJOA 3MGAA 3VV3A 4WLUA 3WTBA 2QUJA 4MV7A 1P4AA 3JTEA 5K8VA 2GYWA 1ZOOA 1PQYA 2C7BA 2VUIB 1FRQA 2GLTA 4DMFA 2WKSA 1OA1A 1NI4A 4BO4A 1ZMOA 2AF4C 4U9UA 1TUBB 3ACCA 1X92A 4JVOA 4RKWA 4HDSB 4X8LA 1KHTA 2GTPA 4UM9B 3T5PA 2FWIA 1NIJA 1LRJA 4YREA 2ZUWA 4HNAA 3PFGA 2G0TA 4YBZA 1W0JA 2R7KA 3F8SA 4K0RA 5F98A 4EGFA 2O1WA 1RJDA 4HEA1 1Y3BE 3P9ZA 4JXXA 1EQAA 5AOAA 1U4NA 5AW3A 2P9GA 5K0FA 1K3FA 3ZHOA 1PC2A 3HEMA 3RUAA 2ZWOA 4PX9A 1TT5B 3LOPA 2A0WA 1J2YA 3OXGA 2YZ7A 1OD6A 7AT1A 2IU1A 5GGXA 1YJ8A 4NABA 2Q3JA 1N6LA 2AIRA 1ZNXA 1RXUA 4UTOA 1RWWA 2ORYA 4YJHB 4FU0A 2QAGA 3H2SA 3RV4A 3DGEC 4Z3KA 1LBEA 4E08A 4RJIA 2Y1LA 3ZKAA 3AEYA 2E6UX 2ZB3A 1X39A 2Q4OA 2KB0A 2PEYA 3FLBA 4BXOB 1L6RA 2D1RA 4B6JA 3JALB 1S8FA 1P2SA 5JSZB 5KNDH 4ZQIA 3RKUA 2FHPA 3FY4A 1VSBA 1HR0B 3VDXA 1J8FA 2EFHB 4B93B 3GRAA 4I4LA 2BJVA 3WLMA 3PEVB 5ANRA 1O94C 4B3SB 2LKCA 4QUGA 2PH3A 4ZO9A 1U2DA 3GFGA 1T1RA 4P53A 3OSZA 3X2EA 2H1OA 2PYZA 4F5ZA 4C4XA 3PYXA 2FW6A 1XDSA 4A6PA 1EDBA 2WT9A 1QGUA 1WM1A 3Q4GA 2ZRLA 2ON6A 2P9TA 1L3BA 3H9BA 4BMXA 3TZCA 2R25B 4KVGA 3AERB 2E0IA 5CFNA 5E4YA 2I22A 4ND1A 3MINB 3CLTC 3ASUA 3EC7A 4AJ2A 2HSZA 1HC7A 4FD3A 1P1CA 1T3SA 3E2MA 2ZSJA 5KYYA 3MS4A 2FUEA 4K9KA 3L41A 3VHXA 3S1SA 2Q8NA 1P2VA 3GJ8A 3GI1A 2O23A 4U2CA 1KIFA 3D4BA 1ELRA 1HFEL 2XWBF 4A3SA 3A10A 4HDKB 1JT9A 1J1UA 4G4JA 1FP7A 3O4RA 4WNGA 1PZHA 1MG0A 2EEZA 4RG6A 5BOSB 4RNCA 2COUA 5DHSA 1COWD 4HOSA 2ZJ4A 3ZYMA 4C0AC 1TKAA 2B0CA 3TSAA 5KVCA 1BPOA 5JSQA 2FSHA 2Y0DA 3RSFA 4GOKA 2VSNA 2C31A 4D4MA 2WU4A 2H2DA 3ZTYA 3UWSA 3ANNA 4EPWA 3WKDA 2OAQ1 4X8MA 3TBFA 4NOKA 1G6KA 1Q84A 1E5TA 1GN9A 5KPDA 5LX8A 3UOWA 2BR3A 3K20A 4X1IA 4HHEA 4EHBA 1EM6A 3HXBA 1F3OA 1G21E 1TYDE 2W7TA 1GN8A 2I99A 2O9JA 4TYPA 3MKQB 2VDLB 2OXCA 1NW7A 3H87A 1KH2A 5LDHA 2HD4A 3PNVA 1MIOA 1KZ7B 4CNBA 2J0UB 5FQ4A 4EAQA 4W9RA 1E3EA 1U02A 1XL1A 5JZSA 1T6NA 5BRAA 1ZO8A 1QXSA 3CVOA 4ZIRA 4TKZA 4PQGA 4IX9A 2WAYA 5HI7A 2O8DA 3NS7A 4P93A 2H0QA 2AOVA 1OF1A 1I7PA 1T24A 5AT1A 3DOEA 4C21A 3GJ7A 4AX8A 1TEZA 3L1KA 5CHYA 4EFLA 3H5RA 1HURA 4YGXB 7YASA 2OGSA 4IIJF 2C54A 5AJLA 2PRZA 1R8YA 1KHHA 2YMLA 3IB6A 4HEHA 1IPHA 4MWOA 2V58A 4ZJYA 2TS1A 3C3JA 2BEUA 2HV8A 2OK8A 3Q85A 1IK4A 2XVAA 2Y1DA 4JYAB 2EQ5A 3FPCA 1SUPA 4NOMA 3BMNB 3FXAA 1NW6A 4TLAA 1WUYA 4OLHA 4QSHA 2Y4NA 4BO5A 4YRKA 3D2BA 3WC4A 1OWMA 3ANLA 1CJCA 3QKSA 2IYYA 2Q49A 1R6BX 5LYJA 1WEKA 4OHVA 1OAOA 1GNLA 3SQOA 3KWJA 2ILVA 1C8LA 1QMPA 4DXHA 3G2NA 1JH9A 3JR7A 4NARA 5M5BA 3FWNA 3R9AB 4DCVA 2N75A 5I4CA 4XGRA 3OFND 2HA7A 4TROA 3NBNB 1HNNA 1H0AA 2WEKA 1ZUNB 1URPA 5GV8A 2XYGA 2LSUA 4CEIA 1S9HA 3TW4A 4H27A 3IODA 4H7DA 1E89A 8ABPA 1C1DB 3KUXA 5DSTA 1SQGA 4PSAA 3WGHA 3KAQA 4QQIA 2JVKA 4NPCA 4FQ8A 4ZOAA 3FI0A 4N8DA 3FE2A 3QB2A 1MORA 4JL8A 1SCUB 3RVOA 3LBIA 3SSOA 4J0GA 3N2GA 4AJHA 3FHOA 3GNSA 2ZBDA 1DOAA 3LP8A 2BFAA 5ENDA 1RWMA 1SZDA 3KQHA 3H4MA 4JD5A 5E6RB 4LRZA 1PLKA 2O8VA 3MOGA 1WQ3A 2CD7A 3KDAA 6ADHA 4R6WA 2PUGA 2XS8A 1RMTA 1G17A 5CK5A 1JLRA 5JCPA 5B1YA 4B3JA 3CHSA 5KNDA 5KAMA 2RHCA 2P2CA 2VWHA 3R0XA 4MTLA 5HYVA 1JQBA 3TQOA 3B6IA 4XB1A 2Y27A 5AKKA 4HNSA 3UFXA 1OHHD 5LCWC 4G8CA 3EC1A 3GARA 2I7VA 3RVLA 2Q4EA 1Z26A 5L4LA 2H6HA 5HRYA 2RBKA 4V3IA 2KBFA 2AR9A 4F7WA 3MA0A 4FINA 4ED9A 2ZIVB 2N1BA 3MCUA 3T7JA 1MAWA 2A9JA 4IIHA 3NRCA 2DULA 1ZCJA 1CJBA 4I43A 3RRNA 1RZVA 2C3PA 3S2EA 4CDNA 3WB0A 2CHUA 2N47A 1KYQA 4CEHA 4YJGA 2BGTA 1TM2A 1QGAA 2AVPA 2JHFA 3GC6A 1E2IA 4PAWA 4QYTA 2W6ID 3JW8A 2R00A 3GJ3A 4PV7A 4DQ0A 4NY1A 4JLVA 2ETXA 1EZZA 3FPKA 1OFUX 4L78A 5E9JA 2NSJA 4MXDA 4MWSA 1NJFA 1ZUIA 4W5RA 4X6UA 2NO5A 4KV9A 4Q9DA 3NBZC 3ECCA 3GRKA 3BWVA 4AKSA 5AD1A 3ZZTA 2PSDA 2VZ0A 3HYCA 3UQZA 1G3QA 1TD1A 1HI9A 2Y92A 2Z43A 2GXUA 4WERA 4WASA 1LXCA 4Z7JA 2AXVA 3RUFA 4AZ0A 5BT9A 1E2FA 1NKSA 3SYLA 1JG1A 4U1RA 1EGQA 3ETGA 3DEOA 5JAQA 3ZCVA 2R2LA 1ZNQO 5ANLA 5H70A 2WG0A 3OC0A 2EX1A 1CE8B 3EXEA 4U2KA 3V32A 1NW8A 4MLDA 2PCJA 4XIIA 4O4LB 2VPWA 4LE0A 1N0VC 4R81A 3TIVA 1E1DA 2Z8YM 3UW3A 2FFJA 2R8RA 1X80B 4KBYA 3SS7X 4Q02A 2AFRA 1WG8A 2ST1A 1BX3A 3GJXC 3OOYA 2DR3A 3GDHA 3EQ9A 3CE9A 4EB6B 3DMDA 1IKND 4ODIA 3TQTA 4IILA 3ZK7A 1G66A 2X15A 4FU3A 3LXUX 2CG2A 2GPAA 4NAVA 1M6HA 5T3RA 3H8JA 2VSXE 2YICA 3BB3A 1TKCA 3ICCA 2WLTA 3DP9A 4XGQA 4JJ6A 1WSAA 2RAPA 4LDAA 1AQJA 5EQJB 3CEAA 4TUYA 3LVRE 3HCCA 4AXBA 2X77A 4HWTA 2PMDA 3DEKA 4CKYA 4L8WB 5FI3A 5JEDA 4HCJA 1XELA 1A9PA 1XU7A 4YVOA 4JR1A 4AP5A 4PXSA 3HYRA 4GICA 1CSEE 3A2LA 4IVRA 3DHNA 5CT9A 3OX2A 2VYND 1P9LA 3O91A 4KE7A 3IQZA 5KVVA 2IHJA 2BFEB 2P6NA 1LS6A 4KQ1A 3VH1A 3ZGXA 3UAGA 2QZZA 3D3KA 3A9WA 4L8VA 4D9FA 5LMUB 1YS6A 1IHDA 2PX3A 1XO1A 1TNUA 2WSSD 3GFBA 3PEYA 1ZHOA 5HRAA 4LISA 2I65A 3GJQA 2RHJA 4R9NA 4X8OA 2PKCA 3TQSA 2XE4A 5LDGA 3N76A 5IJ9B 2CUKA 2IEAA 4J8EA 3U9LA 1AKYA 4Q15A 1Y4SA 3OECA 2DMRA 2X6IA 3SKYA 3M89A 1EIWA 4JENA 1IYGA 1OTXA 1THZA 3SXUA 4UQLA 1LD7A 2UUCB 1IHOA 4GZ5A 4EEZA 3LCRA 4LOHA 3DL4A 2OYRA 4G6ZA 3W3AA 4FX2A 1NSFA 1GTVA 4S0XA 1NV8A 2DBRA 5IEJA 5JS6A 3A27A 2IP4A 1J7JA 1YRQA 1WAMA 3D9MA 4IDDA 4EAAA 4FB5A 4QDTA 4R16A 1MHPA 2E2WA 1DC3A 7MHTA 2A5LA 4I4CA 3LKBA 2JA2A 4JEUA 3ZUGA 3SZLA 3O03A 3F9IA 3FAZA 4RV5A 3W6OA 2C20A 2XZLA 2D2VA 1QCDA 2Z95A 2PLFA 3WA7A 4XASA 2CVZA 4NJOA 3UJCA 5D5QA 4C5BA 3W77A 1ZOIA 3FNFA 2CMHA 4JUBA 2Q46A 2XUJA 4B46A 3ZNNA 5FFMA 1S3SA 1MZVA 4MKZA 1LTHR 2PQRA 4LYGA 4BAZA 5FOTA 5DVZA 4AP9A 4ZVSA 5BSHA 4PSDA 1L5KA 3ZHEA 4ITVA 2Y0CA 4E1VA 4HZUB 2H11A 4K87A 1JA1A 5CB4F 3EJNA 1NXSA 5HZMA 1G5FA 3E6AA 2M9MA 2M1ZA 4FOOA 5FFNA 4ECEA 1N4SA 5A2GA 5JNWA 3F67A 5CLLA 1LI7A 3ZHYA 2BKLA 2XMBA 2D0PB 4XSVA 3G6KA 2HSJA 4QZVA 2C5HA 4F7DA 3HV0A 4RJLA 3EGDA 3FAKA 1SY7A 2HR1A 3AUSA 4GLBA 2FMFA 3A32A 3ESBA 3K1ZA 1JT2A 1K7SN 1R3DA 4CT4A 3RQSA 2WXQA 4NOJA 2CB0A 5JARA 3EUAA 5JADA 2DWQA 1AQUA 3N5KA 3B3QA 4Q93A 4PFJA 3AHDA 5I3ZA 1EWRA 2JANA 4PIMA 3VC2A 4BV3A 3L07A 1W2HA 1ORIA 3NBKA 3D9LA 2NLOA 2O2EA 4WOJA 2V6FA 1X13A 3ZYCA 5ENZA 1N75A 2G9NA 3NATA 3M6MD 2E21A 4V0SA 4ZEOA 1Z5GA 5J47A 3IUJA 1Z6YA 2B2CA 4N7MA 1TJYA 5DGHA 4GRIA 3TL3A 1KQFA 1FDSA 3LDGA 3T1NA 3CEQA 3OLVA 4ZO7A 1JHXA 1PNOA 3L5OA 3TYXA 1UDAA 2HA2A 1JKXA 5DGIA 1YUNA 4JJKA 4HOYA 2IZ0A 3IMCA 2W6CX 1JWFA 3PUIA 5DWDA 3KM0A 3V7UA 4WOPA 3JQEA 2P8JA 4U96D 5DTQA 3RTAA 1E2KA 3AF0A 2ZSUA 1RM3A 3ISVA 2J3DA 1D2RA 1EU1A 3SFTA 3C3AA 4KBFA 3ZWCA 1M8FA 2PUHA 3EGIA 5YASA 1QYVA 3U7QB 4CFZA 1L9KA 4RUKA 1RYMA 1ZRNA 1VG1A 2GYVA 2P0EA 5UKDA 2YV2A 1D4FA 1E7RA 3IBGA 1YNOA 3CSTA 3PUVA 5TQ0B 2PSFA 4O33A 5B3LA 4RO0A 3HPRA 3TZHA 2ZPAA 3ZIUA 2QJFA 4UCFA 1ZR2A 3DFZA 3KAEA 2CYCA 1NSTA 4TMKA 1C2YA 2A7QA 5AM4A 2NMVA 1Z2AA 1R0CA 4G5GA 4LHEA 1W75A 3IMGA 4RQAA 1KZHA 1Z33A 1X1QA 5EYPB 1VXOA 2ABWA 3KL4A 5KCZA 2VC2B 1LRKA 3IOEA 4ZV7A 4ZT4A 1N95A 4IPTA 1PQWA 1AUQA 1U28C 3FDFA 1G9TA 4UFOA 4I4TA 3ILHA 3H9CA 3ZX4A 3IP9A 1NAIA 4UXIA 5KYKA 3GJTA 3QBVA 3SF4A 5JBQA 4F6CA 4UVGA 4OXRA 1MVNA 4TN5A 3BD7A 3I9OA 2Y2UA 3CVXA 1DHRA 1W8DA 3NTVA 2ZE8A 4JNCA 2PIAA 2N3ZA 1NYRA 4LQ4A 4PYQA 3UANA 5BMVB 1N6HA 2QYSA 4AQ7A 2QTTA 2JFXA 3TLMA 2ECPA 4D45A 2PGAA 3CVQA 3ZXIA 3TWRA 1NWHA 3BD8A 3MWJA 5KNGA 2HV9A 1T1GA 5IKPA 2QYHA 1U0NA 3I9LA 3MW8A 3EEQA 1USIA 3UUXA 5GONB 4XVHA 2GPBA 4TXPA 1PK8A 4PN7A 1UADA 4P83A 4PYIA 5EMKA 4YMIA 1VBMA 5CR9A 4B76A 1YVDA 4CM3A 4EUKA 3VHQA 2VGXB 4RF3A 4IWYA 5THXA 2Y0EA 5IVKA 4RJKA 1P2TA 2YOHA 4V1CB 3P2BA 1M6VA 4NNPA 3CR3A 2YCBA 4YMGA 4JPSA 5FI5A 1FSGA 3PXXA 2FR8C 4Z51A 1BIFA 4YMSA 2GQ0A 3OU2A 3FHEA 1JG4A 4HEQA 5G40A 2HQOA 2PKXA 3DOHA 4G3XA 2H16A 3V1TC 1YI1A 1PR9A 1SHLA 1G8MA 1VKHA 4LHZA 3OEWA 1ZSVA 5K4HA 5B1IA 4L9AA 2J4CA 5JD3A 2XJ9A 3R8FA 1CCWA 3WIUA 3SOZA 2YV5A 2GZ2A 3AB8A 1BU5A 2YV4A 4JEHA 3GVIA 5IARA 2OG2A 3K1JA 2A9KA 1AA6A 4KLRA 3RROA 4NAUA 4YAWA 4RMGA 3C43A 4X7MA 1E3WB 3UM3A 1WP4A 3GAMA 4ISCA 4XM2A 1NYTA 1HSZA 2DH6A 3CHPA 4ZOLF 4WK4B 4X6XA 3DSRA 3IXMA 3ASYA 1NATA 5CA0A 1VHJA 4BN5A 3KNZA 1WCIB 5ISMA 1M2WA 2P2GA 4HWOA 3NBXX 3K0EA 3DE0X 4YRTA 4C0HA 1CUVA 3RAEC 1PAUA 5D66A 2MTBA 3FYSA 3H5TA 2GF0A 3TOSA 2V9CA 3L9TA 1G7CA 1JIKA 3IEKA 1UQTA 1QB7A 4C3UA 5ED0A 4FR0A 1Y37A 3RYCA 2W6NA 1II8A 3H8VA 3R3JA 2OPHA 3H1PA 4K6KA 5KOYA 1M67A 1J21A 4GLJA 2IH5A 4N82A 5TPWB 1NXQA 4ZYUA 1QH1B 4ITUA 4X97A 3MAGA 1T10A 5B58C 4LNUA 2J5XA 3FTSA 4RSYA 3ER8A 3TEFA 2NO1A 5DHUA 3RT7A 1NBEA 3ZGVA 4DJ5X 1QOQB 4RGYA 1YQGA 3WWPA 1IRXA 5CLQA 3TOCA 3DFUA 4EJSC 2H29A 2QP4A 2DSTA 2VAPA 2YV3A 2GPYA 3EIQA 4K5AB 5B4UA 1UKEA 4BTEA 1H3NA 3GXOA 1S2MA 3VU8A 4ZAGA 1ZITA 1ZKDA 2FDRA 5IKEA 4D46A 2JLVA 1MCZA 1ZGZA 3OPMA 4PGAA 1Y4ZA 5BW4A 4PBTA 4J0KA 2IE0A 3MSXA 4OGFA 1IBKB 4OY3A 2REQA 4BCBA 3TTUA 5FBZA 3TW6A 5AQ9A 1BXRA 4MX8A 1AUXA 2R03A 5K6RA 5KU1A 4ZHQB 3ADKA 4EGCB 4TKVB 3V9PA 2XDWA 1ZUWA 1WW8A 2KWIA 3L2OB 4PLYA 3W5VA 3Q98A 3BFXA 3JQ9C 2PSHA 3HDVA 4PPNA 2V6BA 3TJMA 4U7JA 5FF9A 1OGIA 2QR2A 4BNWA 1Z0UA 2Z56A 4RH1A 1N8TA 4YCCA 3P9CA 3U4HA 1OX4A 2YTZA 3UIPC 1Q0HA 1KI6B 2I62A 2ZWAA 1BX1A 4EUHA 4YYZA 1RE1A 1LNSA 1JLMA 4URHA 3UK0A 1L4YA 1SC3A 4U7HA 3KTAA 3OZ7A 1KEVA 4LMAA 5DMXA 5J2TA 5HR5A 1QX4A 5EZYB 2NG1A 4DUYB 4JOBA 3KEMA 1W59A 4GL4A 1OX5A 1X94A 3GGSA 1C4KA 3KQWA 3HKCB 4X91A 2IV7A 3HYMB 4S1VA 2XXBA 4REOA 3FYCA 2BI7A 2D5LA 2NYUA 3G68A 3UIEA 3FNIA 2MYUA 1E5DA 1MO6A 5EAIA 3GT3A 3CKKA 2P9QA 4PQFA 1NKVA 4X61A 2N0SA 1X7GA 2E4YA 3IDOA 1CR0A 4PWYA 2ZXFA 1SZPA 5A02A 4J3JA 2ZKLA 1YMPA 1CP3A 3FHCB 1YJ5A 4EHKA 4K88A 2TMYA 1N5RA 2X58A 3JQFC 4KSBA 1G2PA 4H59A 2RARA 2O20A 2Q6LA 2ZE7A 2I4IA 3H2YA 1JIIA 2C2HA 4ER7A 3B1ZA 1OYWA 1MX1A 4LYJA 4UFPA 1CULC 1UMCA 3FPHA 4IDFA 1NA0A 2IELA 2OK7A 1CRQA 2CMGA 3NHPA 3AJ8A 3LEWA 2Z30A 5AXAA 3GOQA 4P2BA 2FSPA 4TVSA 3PUKA 4F7AA 1WMSA 1E66A 3IRUA 4WLOA 2QLFA 4EKYA 3OOWA 2OBBA 3WFJA 3RB8A 1E8OA 2HIMA 3QOFA 4CEMA 2FQQA 3R3XA 3KPYA 4B48A 4TMFA 5LA6F 3QUQA 1T2AA 1U0SY 2I7XA 2QZSA 3D0RA 3TF5A 1DELA 2ZJ0A 3JQAB 3S3TA 1K27A 3BE8A 5A4MS 3L92A 3IPLA 4O2AB 3U0BA 2XEXA 3DWFA 3D7SA 5JVDF 2PX5A 1EFRA 2WM9B 4PZPA 5IT0A 1LW7A 3KXKA 3S2IA 2DB3A 4MUIA 2V7QA 5I7SA 2CFCA 4KKXB 1B16A 3PR2B 1BDHA 2D1TA 1V7QA 2WHQA 4NEQA 4WZZA 3FFXA 3VR5A 4QRDA 4PO1A 4LUCA 3KVNA 2IYZA 1YDGA 5ALZA 3HDQA 3L0DA 3ZDDA 1K2WA 2XKAA 4GRDA 3PS6A 1HDOA 3VJMA 5JTTA 2ONYA 1X7WA 5FO1A 5LD2B 1U7HA 1YDWA 1S8NA 2CZCA 4F46A 3NG1A 2QAGC 1PJQA 2O3RA 4G9GA 3KE8A 2XX3A 5THQA 2GEUA 3NUGA 3PD1A 1QJCA 3AZQA 3MGKA 1SXQA 1AKTA 3FX2A 3ZHVA 4Q1CA 4MW5A 1TIKA 5BN5A 1GKYA 1OJ7A 3ZE1B 4KO4S 1DEXA 3SSNA 5TY0A 5EN5D 4AG6A 3RAJA 4Z2AA 4KVFA 4FJ1A 4F93B 2DVMA 3QEMB 4Q1FA 5E9QA 1P9WA 2XSZD 1OVGA 4F8EA 4MP6A 1FSSA 3T4PA 1AHNA 1GZDA 1TVMA 2NX2A 2MRIA 2XOKA 4NU6A 1K5DA 3NGLA 1CRPA 2PX8A 3A1FA 2PFKA 5ALWA 1E1RD 1SQSA 1E8WA 3RWBA 1U2DC 4LYAA 1RLTA 2J67A 3ASZA 4ALMA 4C78A 4QBGB 4HH4A 2AV6A 3R76A 2E49A 3MJSA 4YLEA 2Y9PB 2AB0A 2GO7A 3CINA 2O2HA 3EGXB 3CNBA 2C1ZA 5EJFA 4D79A 4MI1A 1W85B 2GN4A 5CYFA 1R6TA 4PBRA 3SLGA 1KDTA 1QP0A 1FFXA 3A4LA 5E7IA 4BEWA 2VHTA 4HZGA 3Q7EA 4NBTA 3E5HA 2E4ZA 3G2KA 4GZMA 1H94A 4KQKA 4RVHA 3H2KA 3LF2A 2O52A 2YVLA 4QG7A 2YRFA 5AOVA 3CLSD 2F62A 5L3SB 1ETHA 3SSMA 4RTMA 3UKUG 3O7MA 4H3VA 4TWZA 1JHRA 1CY4A 1FFDA 4GEGA 1RFGE 3IEMA 4MRUA 1HNXB 3AIIA 1YZLA 5FAXA 3BB4A 1ESDA 1Z25A 5AM0A 3BUAA 3WK6A 4BATA 4BOYA 4JBGA 3IMEA 1M7BA 4LMRA 5G1OA 1BD3A 1KZPA 5JXIA 1JALA 1QF9A 5EJMA 1B8PA 1IQPA 4EUEA 1JNRB 1M1XB 4C4ZA 1EHIA 1DBWA 4AS3A 4DZRA 4F56A 2NIPA 3OZWA 1O6BA 3AG2E 1PZMA 1E6MA 2FPPA 3MJCA 3QELA 4R2HA 2WM2A 2P9JA 4UNIA 1OWPA 1AVTA 4PX2A 3WDSA 5BY2A 3EOZA 3MZLB 4ZVRA 2NU8A 2QI9F 3LA6A 4I0WB 5AUOB 2BCEA 3OWHA 5CPFA 1P7ZA 3VPFA 5TS3A 1ZIXA 1WPXA 3Q7IA 3UCFA 2C94A 2V7GA 5IWAB 1H65A 3FROA 1VYHA 4W9NA 1MQAA 1KXJA 1IZ8A 1BFDA 1N6RA 3P4XA 4GTSA 4DDMA 3EZ6A 4DUZB 3PQ8A 1WCXA 3CVYA 3RKSA 2YMMA 3Q49B 1PUXA 2WVGA 1AXRA 2ZSDA 3GEDA 3NOGD 2CJFA 3CCCA 1W5AA 4PLGA 5A0VA 2V9PA 3GWZA 1Z07A 3CWZA 1UBEA 4Q3EA 2EJTA 4JC5A 4DV0B 4CT0A 4R68A 3ELYA 4DIEA 2CUZA 3AVPA 3K72B 2XTNA 3MHPA 2J46A 1DMRA 4WCVA 3T5AA 4HNTA 3Q12A 5B2EA 4BMZA 1KZOA 1QO9A 2BFFA 3SGHA 1T4DA 2PA0A 4ND4A 4BZQA 3ZJTA 4ARAA 5AUQA 4L28A 5EUBA 3VU1A 4QLOA 1OAOC 3IC5A 3MTGA 4B0ZA 2C57A 4GTTA 4NATA 3CS3A 3D2CA 3I83A 3MFQA 1NXPA 4PW0A 1K9VF 3I9FA 3H4IA 2ZM5A 1XALA 4RQBA 2G7MC 3HKDA 3TSYA 4OXXA 1PYDA 2WXFA 2VJMB 3ASGA 1SCBA 4GWGA 1P4JA 2GRMA 1L5QA 3TAXA 2P69A 2OUKA 4HUTA 4GOND 3OQ6A 1XYYA 3E3OA 5F1OA 2V6IA 1Z6TA 3HN2A 1GPH1 3I5PA 3LUDA 1J56A 4F3YA 5ALMA 1CYEA 3CWCA 4IO0A 4LF9B 1N2CE 3NC1C 3DMPA 1PBTA 3DUWA 5AYVA 4XJTA 3H84A 1Z15A 4IJKA 3SHOA 2GN8A 2FQ1A 2UKDA 5K4GA 1OE0A 3BHNA 5B6IA 3E8SA 1K5PA 4XYLA 1RBYA 1GWNA 3I5UA 4MWDA 2OCXA 2JIZD 1LW6E 1P1IA 4DHEA 1M2OB 3MTQA 3JQ0A 4TLBA 3QW4B 5B1HA 1JE1A 1SRRA 3QF4B 4B0OA 3OZRA 4CKEA 2KJQA 3FTXA 1RWOA 1MR3F 3K0AA 1L5JA 4WFJA 4RD6A 1VKJA 3FWVA 3Q75A 5EGSA 3CZAA 1CWUA 1F6WA 2DGDA 5AJVB 4PZUA 3IHVA 3WWEA 1KMQA 2PX6A 4ZT7A 3SXJA 2VH5R 4EBAA 2Q9CA 3A28A 4KGXA 2D3TA 1RLUA 1HYGA 4OH1A 5BQ3A 5KOIA 1Q2UA 5T41A 5C80A 3SF0A 5EWLB 3DPDA 1UQUA 2CL5A 5EIEA 5COAA 4YRLA 1QKIA 3TM5A 1YONA 2ZRCA 3PU6A 1UF9A 3OM1A 1IY8A 2ADOA 2R3SA 4Y6LA 3WLNA 4I9GA 3C3XA 1W96A 3O92A 5EKXA 3ZY4A 1TJ5A 3IYLW 3V4OA 3JYPA 1HK7A 3PP8A 1YB4A 4A1GA 3WYAA 2QD2A 3A1NA 1T8YA 3KQYA 3ELDA 2H2WA 4D4HA 1MX3A 4QUHA 4BU0A 3EPHA 5C9ZA 1JJAA 4OD0A 1JVSA 3HCBA 4HQNA 5CHEE 2FG7C 4W63A 3VKGA 4R5HA 3JRNA 4LI0A 1N9GA 5JH7A 4W5WA 2R00C 4W6ZA 3I64A 1P44A 5DYYA 3PH0C 1QORA 1M5TA 3HZRA 1T4CA 3MEKA 1Z4KA 4LXGA 1T3LA 4MYRA 1E6UA 4YT8A 4U8VD 5CB8A 4DAEA 3UI2A 1UPBA 5B5SA 1G19A 1FYFA 3R0JA 2MYPA 2I78A 2CXNA 1OBVA 3FWKA 3CRZA 3FCUB 2Y1EA 2L2QA 2AYXA 5KNCD 4JHXA 3STXA 1AGXA 5C0OE 3WIEA 3R9IA 2H1HA 3R6LA 2RFLA 1U8FO 1VE6A 3GZNB 3RVSA 1A71A 3GPDG 1LVGA 1L7AA 3MJ4A 1DEKA 3EXIB 1RKVA 5H7XA 3CTPA 1KETA 4GM4A 3LZCA 3N8HA 1ZIDA 2BZGA 2X7HA 3KQMA 1RMYA 1T6YA 4F53A 2D1FA 5JI3E 3IFSA 2R59A 3I23A 5H16A 4EGSA 3CVJA 1ZDMA 5H59A 4ZXFA 5K0JA 4FJYA 3R3YA 4XKBA 3X1KA 4D97A 3OHMA 2PR2A 2ONKA 3NV9A 1OXJA 3KJIA 2GUWA 4HN4B 3LIIA 1EX7A 3DDSA 1YKGA 3DDCA 4UQYA 2B2NA 3DEYX 1CERA 4ER5A 2MOKA 3IHKA 3M5DA 3HCPA 1WB6A 4YJ2A 3O8QB 5HF8A 4Q3LA 4BEPA 3FKSA 3WICA 2Z6VA 2ZTLA 1I5EA 2NSZA 4EHIA 5JZ9A 3DBOB 1C1XA 3C5VA 1AGNA 1J1ZA 1MX2A 2ZYVX 4HAWA 3DCJA 5INTA 4LWOA 1T26A 1R3UA 1C7EA 1LQUA 3HMKA 1J0DA 4WJLA 4NULA 5CRUA 2DHEA 2LBPA 1QDLB 3KQLA 2G17A 3PHCA 4PNPA 5E1DA 5BPPA 2Y71A 2QJRA 3TPZA 2AW6A 1T9ZA 4IGIA 4M0FA 1DPGA 3KBBA 5DM1A 3ICQB 1ZIOA 1JAHA 4WY8A 1EVIA 1A5ZA 1SG9A 5JMPA 3RVMA 2G6BA 2ODPA 5K6TA 3DOUA 5IDYA 2V6JA 3WRWA 2J6BA 1N0HA 1PRYA 4FNOA 3FG9A 2B7LA 5HNKA 1A0OA 1XTJA 1PG5A 3FUKA 2X0NA 1ZXBA 3MPOA 4D25A 2HRDA 3T1QA 2EYUA 3OCUA 3O8NA 3TKAA 2Z4SA 1SCAA 5BQ5A 5JEEA 3S1AA 3SEQA 4CRWB 3NBAA 4H6VA 4ZVVA 2ZVPX 2CXOA 1JHVA 4I46A 4APOA 4QBIA 3A6JA 2WHXA 1U2SA 2RC5A 3OUUA 3IDSA 4GB9A 4Q1DA 2VDJA 1TM5E 1F2TA 2IXFA 3UFBA 1Y6GA 1U80A 4QAJA 5FA5A 2EGHA 2CLCX 1YT5A 1C9YA 1Z7BA 3ZCQA 2C88A 2BJHA 2KSQA 1UKAA 3GCGA 1F5NA 2O8NA 2OV3A 4Z54A 3T54A 5AJHA 4HGYA 3UPDA 2FMIA 3ZDYB 1O5TA 5E1BA 2UYOA 2MSLA 3E5RA 2GXQA 2DFTA 5C8YF 4TMXA 3AS5A 1PWHA 2JIPA 4HUQB 4D5GA 4I9HA 2FEMA 2XPZA 3JY6A 1D7AA 4FMDB 4NZOA 5DEOA 3F6RA 1H8ED 1D07A 4F5DA 1MRNA 5AVQA 5DKFA 4N0MA 4FQ5A 2JI4A 5FBQB 2F4VB 2Y0PA 2VYIA 5HKAA 3N07A 1GU7A 4RA9A 1RXEA 2POCA 3WMWA 2ZG6A 3DQQA 3W5BA 1U0OC 4I50F 1N0UA 4X62B 3V46A 3W78A 4UOZA 1ABFA 3MD0A 4ZZ0A 4UTNA 4A10A 4J9VA 1QSGA 4KG7A 1TW3A 3AVUA 1FYXA 3EHQA 4XAQA 3VO1A 4EBAG 4JU9A 2HHJA 4C0JA 1NA3A 3L0CA 1T0HB 4AOFA 2NZ8A 3LPMA 2CJXA 4R69A 1P5QA 3LDAA 5DTRA 3QVOA 4RVCA 4WJKB 1M2GA 4EHHA 5DT9A 5IYZF 3IAEA 1WCWA 2VDMB 4CDRA 3FUMA 4G5HA 3I72A 3W9YA 3L4SO 4RQUA 2O2XA 1CDZA 4FGJA 3D8NA 1KAGA 1R6DA 2IEJA 5LZ8A 1UFQA 4GA2A 2Z2JA 3C1UA 4GMDA 1NUHA 3OWOA 3G8AA 5HJEA 3HYSA 2YJ5A 1FZQA 3OPVA 4RWZA 5LJLA 3ISMC 1IE3A 2FFBA 1Z0JA 1R9MA 1AS2A 4AULA 1Y7HA 3KFLA 5BSUA 3PR1A 2B0OE 4R5MA 4HAUA 4CGYA 4E11A 5LN1A 4EQ6A 3NH6A 2FMHA 2Z9DA 3AY0A 4H1HA 3X44A 1GP2A 1W88A 5DEIA 4QNRA 1NVDA 1QX3A 3BIXA 4TT8A 4WKPA 2B61A 1SRQA 2X14A 1W52X 4JXZA 3S8EA 1I9GA 1DC7A 4JI3B 4XRRA 2FPGB 3BD9A 4R8LA 1LBHA 2QTNA 1OXVA 4FGKA 1FRZA 1OYVA 1WM5A 3ZBTA 3ZPJA 1HT1E 4UVEA 1BE0A 5EE9A 5FT9A 4BNGA 3U4QA 5MHTA 1ZU2A 1ST2A 4S24A 3SOPA 1WXQA 2WB4A 4N3GA 4MZXA 3DE6X 3BDVA 3CFYA 2ZXWE 2AKAB 3ZK9A 4S1NA 4RLHA 4MV5A 4LK2A 1GITA 2ZDQA 5DYTA 5IANA 2NUTB 2AFVA 3RO7A 2YYAA 3WVNA 1MO3A 4DLBA 4JSRA 1J8VA 5ENPD 2JGMA 2VA8A 1V9LA 1OX6A 2UYHA 3TI7A 2IDKA 1JHAA 3PQ7A 2P5SA 2NO0A 4A6EA 3WMRA 4QX6A 4ZEVA 2Q6IA 4K5BA 1OJLA 4NYJQ 1GA1A 1TN7A 2V0NA 3DHEA 3ABOB 3NPMA 4PICA 5BQPA 4OHWA 4B89A 4BQSA 4ZZ1A 1R8SA 5JR3A 1IB6A 2Z2XA 1ARZA 1WSDA 4BKOA 3ABQB 4O3MA 5DNCA 3C3EA 4LYYA 3VCXA 2XHEA 3D7MA 2ZYTX 4HDRA 1X38A 4QHSA 1PFWA 3FB4A 1Y8ZA 3AOGA 3TWSA 4IIUA 3AJ9A 4HN9A 4JA2A 1IJKA 1ELOA 1FFEA 3LYLA 3HACA 5EKDA 3I45A 4KAAA 4YR7A 4ACLA 5EGNA 1JNYA 2EFCB 3W3AH 1TFUA 3EBPA 3D0OA 2IVFA 3UTMA 1GUDA 3CR3C 4HX2A 3V55A 4M38A 1RI2A 4RY2A 5E38A 2LD4A 2UY1B 2X3UA 2GD1O 1T6BY 2Z0MA 2SECE 4RTLA 1HKUA 4LXHA 4JKIA 2VCHA 1XTSA 1R0RE 3EE6A 2LKDA 5B55A 5JT1A 2OZVA 3UXEA 1LPBB 3DE1X 5AVWA 4G1BA 2BBWA 4HUJA 1YS4A 3AM3A 3P0RA 4E2WA 1SVWA 3C4VA 2WILA 4TSRA 2HT1A 5G2NA 4DGSA 1DJOA 1PT5A 1ZL2A 3C3OA 1GL3A 3FCAA 2QMEA 4IIVA 3JCZA 1N6PA 3A6HA 4PQYA 3RT9A 1YFJA 1S1CA 1VHDA 2AE2A 2XUIA 4LRYA 2HLHA 4CUZA 5EHNA 2JBAA 3ICEA 1ZB1A 4LCEA 4E88A 3ZQUA 1M0SA 3F9RA 2B7BA 4WK0B 2WFMA 1T2VA 1QCZA 5EKQD 4MUJA 3D9IA 1AK2A 2Y4OA 4N5IX 3DMRA 3EPLA 4PO9A 1FA9A 4OHCA 4XB2A 3KSLA 3VYVA 2Z08A 4GZDA 2VBFA 3EGVA 2VG8A 1EXVA 4H1UA 2ADFA 3OT1B 2G28A 2O8EA 1U3DA 4GR9A 4LC1A 4ZCPA 4GL2A 1RRGA 3ZCXA 1XTVA 5EPUA 5CERB 3KQNA 5EJ6A 4I1UA 4F3VA 1M1YA 2WNSA 3KFXA 1HYBA 2DT8A 1RU3A 4RLFA 3ANTA 1PJ4A 3E23A 2PGOA 5IAKA 2PFSA 4XB6B 3A6FA 3ESAA 1N5LA 3MUEA 3LBYA 1E4EA 2XT9A 5GZ3A 1AF7A 1FFHA 5LZ2A 3WHLA 4L7VA 1GAEO 1G6OA 2BMVA 3LCCA 4TTAA 4P31A 1PWZA 3LCAA 1N8NA 1DAFA 2OC4A 3D6JA 3EIQC 2A14A 1TGYA 4L5YA 4XR4A 3U56A 4W1QA 2YN2A 3W8EA 3PGKA 5B7NA 2OLJA 1N77A 4MUAA 4AM8A 1V5IA 2EIKE 4L8FA 1XYVA 4MYCA 1YK0A 1LK5A 1GPNA 2NZUG 4QXMA 3CVNA 5LLTA 2P9LG 2AYYA 5AN8A 3GP3A 4QLAA 4UOEA 3GEGA 2ZANA 1W5BA 3U16A 4CQMB 3ACDA 3KQUA 3QEKA 3NORA 4KAJA 4QWMA 4DSNA 4KE8A 4YN3A 2JFHA 3BC1A 1ID1A 4WXEA 4YPOA 4BQRA 3OJOA 4RPHA 2QEQA 1AN9A 4GPIB 4UUAA 3R23A 4OOFA 4E5DA 4B6OA 1DL5A 1SVLA 1FJGB 4GKVA 4O2BF 4P3YA 3RW9A 4P4SA 4CIYA 3F1LA 2LDXA 4J7WA 1WTCA 1P60A 5MN5A 5DLDA 3VOAA 3Q1KA 4TT3A 1G16A 3DMTA 1EUDB 1N1MA 1M66A 3OMWA 4X41A 2OV4A 2O6HA 1U9IA 4BGUA 1RWPA 3TRFA 3A6LA 3EEFA 4IYJA 1JMVA 6ABPA 3QK0A 2ZTUA 5EJAA 4TSFA 2GZ1A 4S3MA 4RVSA 2ASVA 2G9QA 1BN7A 4MKXA 3TWOA 2GKSA 3IILA 4J0CA 3NOVA 2DPGA 3C74A 2JHAA 2P9CA 1SPXA 4NJEB 1QVZA 3FIUA 3DP7A 3L05A 4PZEA 3P9KA 3ZTTA 4DCCA 4HNRA 4WUVA 3I6ZA 2FOLA 2J1LA 3BTVA 1ECBA 4HH1A 5DF1A 1EFLA 3WWDA 2OFPA 3AP2A 2NVUB 2HJWA 3OO0A 4NECA 3OD5A 3SVLA 1H2RS 4WOBA 1ZK4A 4D7AA 2W42A 5TJ9A 3GRYA 5D51S 2XNKA 1XAGA 5COBA 2NU6B 5IBCA 5G0SA 1M2HA 2IYLD 1RWKA 1TTQB 2IHZA 4Q4LA 3D4NA 5REQA 1JFRA 3ONVA 3EVAA 4C08A 4B0PA 3ZYZA 2VQEB 1NMQA 3WAGA 4O4IA 4NENA 1VPVA 1V5EA 2OBNA 2Q8PA 5EE5B 4QAQA 4FBLA 5LBUA 2IIBA 3HB9A 3MF4A 3ZEAA 1GGKA 3ILSA 3MCVA 5K3SA 4GI5A 5A3JA 2JFYA 4Q37A 3M2TA 2JDIA 5B1SA 5CK4A 2WAXA 5GAJA 1DBIA 4HDNA 1J00A 4YCAA 5HHTA 1K97A 2IYOA 2NXEA 4D9IA 1CJKC 4M6WB 2XQFA 3TWTA 4WJZA 3QLVA 2YR0A 1U5CA 1JZQA 3U4CA 1NBMA 4P9NA 1LF5A 2BR5A 1YR1A 4CTMA 4WXRA 4NZPA 3UN1A 2HU5A 3O75A 2KZTA 2JGDB 4A0FA 4E2YA 3AF5A 2B4YA 3Q5MA 2CUNA 2R2GA 4MKGA 4JC4A 1FPMA 3K15A 3Q3EA 4M37A 2H9IA 3WXXA 2PKWA 1NVBA 3DB2A 5CDTA 2QUAA 4MV8A 1YIAA 3K5IA 3NQPA 2VDWA 3HWWA 2UVQA 4PYKA 3AT1A 2YZGA 4KDCA 3M33A 5BSMA 2VDPB 1Z2OX 1QTRA 2I6SA 3CZMA 2Y0BA 4WZBE 1KAMA 4EO9A 3MC1A 4D3SA 2R6GA 2ZI5A 5G02A 3GPIA 4YB8A 3MAJA 4TV9A 2CLKB 5JAPA 4QNMA 2XBLA 1A17A 4PZ0A 1AS3A 1GEEA 3U26A 2ZTHA 5KYWA 5IF9A 3B1JA 1HOTA 2ZQZA 2B6CA 1RP7A 2CJWB 3WJ2A 3BBLA 3H5IA 4G4SP 1FRFS 2HSGA 4QOJA 4CCAA 3I12A 3DAFA 1TYAE 5EXEA 4DW8A 1WXWA 1QH0A 4TWJA 3OPYI 2ECKA 1T34A 1MEOA 1OH6A 2A92A 3HUFA 2GDZA 4NE7A 2OO7A 2PU5A 5EEGA 1V3VA 2QW0X 1EK1A 1TO1E 4MICA 3KK0A 3IVCA 2GVZC 2RGNA 1TU3A 2PE5A 1JUQA 2VN8A 5JJ5A 3V8MA 8MHTA 2HYDA 2JJ1D 1UOHA 3EG9A 4LN1A 4AF7A 2P91A 3IPAA 3RM3A 1DDOA 5LQRA 2P11A 3PFNA 2DWOA 2FPOA 3WBJA 3MCTA 2Q99A 3BA1A 1KBOA 4DZZA 4L0DA 5LU8A 3ED5A 1WHSA 2X6QA 2OQVA 3C6YA 4OX9Y 3BSFA 4UATA 2OBYA 3ASNE 5ESWA 2FI1A 2E3JA 3VR6D 4EQFA 1NBOA 1A1VA 5ICMA 5HEKA 5J23A 3EPRA 3H75A 2VPZA 4BESA 4XLTA 3GMTA 2OCAA 4QXRA 3RUPA 2ZOSA 2QM0A 5C52B 1L7EA 521PA 5ICCA 5FUWA 4FBGA 2HCRA 2A58A 2K2QB 2N9UA 2VTBA 2QV7A 3PVZA 1Y1QA 1FTSA 5ITZB 1EWVA 1GZ4A 3D7RA 4S1OA 4WKBA 5CNIA 2QD3A 3ZD9A 2Z2ZA 1DOZA 1KYXA 4REQA 2YFHA 4RZQA 1NP6A 1XZFA 3TO5A 3QPCA 3V2HA 3SJUA 2JJYA 4QGSA 3R3HA 4PHFA 4Z1MD 3PEFA 4K6CA 3VGJA 2EFYA 3D7LA 5C35A 1X4RA 2BW0A 4CQJA 221PA 3ESKA 2WHRA 1EAMA 3OQVA 1LX6A 5CVCA 4NESA 3I6IA 2IXTA 2WVHA 5CDFA 2WKRA 4I1VA 1RYDA 2O19A 1J99A 2BMDA 2G72A 4C0EA 4B3FX 3K1TA 1L4BA 4RF2A 2ZETA 3AZPA 3R7LA 2ZRKA 4PS0A 4W9NC 2C2WA 5D3MA 1MX4A 1KK2A 5AVVA 2E18A 3FTNA 1RM0A 2G8LA 3ZWDA 4G0WA 1M6NA 3D3QA 1QNLA 4ABTA 1XXHE 2GRUA 1E1CA 2FPIB 3WYDA 1QFYA 1ITZA 3MCXA 2LVBA 1TO6A 2A2ZA 3T7EA 3SY8A 5LKRA 1A7UA 1FJ2A 4C3ZA 2ECQA 1XHFA 2WJAA 2HCFA 1SU7A 3CGGA 4QE3A 2XCOA 3GUVA 4M83A 4MGIR 5G4KB 1QK5A 3IPCA 2PQMA 3M6IA 3IVRA 3AJDA 2XMZA 4AN0A 2VNHA 5IDQA 1ZG3A 3BG1B 1UBSB 2DFLA 5F7OA 3KSMA 4JGIA 2E5FA 4R3NA 3WGOA 3E9QA 1KC1A 3PLNA 4G85A 4KN9S 1WO8A 4FOTA 3HU5A 4DCJA 3LPDA 3PCTA 4IEEA 1DJNA 3VR2D 3P96A 4H08A 1TAQA 3ZU3A 4O0LA 4EB0A 2VYQA 4G5YA 3VR5H 4Q00A 1VP3A 3H65A 2GKGA 5BNZA 1OXBB 2OKGA 2OCKA 3A2MA 3KQKA 4RTPA 3QTLA 3MLBA 5D5PA 1P2UA 5HXAA 2BKXA 1RLJA 4BY9E 3CLRC 3WFZA 2VNSA 4EPVA 1SQ0A 2Z9CA 4L27A 2DSNA 2QN9A 1WUHS 1MQ9A 4JLOA 4KO3S 2YOGA 3V8PA 1AP7A 1RQNA 5ENOD 4Z4GA 3SMVA 2X5GA 5JCOA 2P79A 2GGSA 2AH5A 4FPXA 2H1RA 2KBXA 1WAO1 4JBNA 2D5AA 4RDIA 4EGJA 2NYAA 1DKUA 1JJVA 4TQ9A 1CIVA 3Q3GE 1NNLA 1Q7RA 4RIHA 2CFUA 3PHIA 4JUIA 4I2NA 3TPCA 1GZ3A 3NWEA 3VGPA 2HDOA 3HJAA 3VQTA 1GADO 4RSGA 4XQ0A 2QTZA 4UMFA 1XNFA 4B1FA 3GJZA 1L4HA 4G97A 1KFCB 3Q10A 4B4DA 1VSUA 1N2XA 2IFTA 5LBTA 4E21A 5FNVF 1JDUA 1MQ8B 2XTZA 3AWIA 3OX3A 5FLYA 2G25A 1DIOB 4ZQHA 4HXYA 4E3ZA 1RXWA 3MJTA 4MPDA 1UXGA 3GNQA 5HKBA 4BFUA 2JEZA 1VRVA 4NNOA 3PJFA 3HB0A 3ROQA 5T4HA 4JBIA 1WDYA 3RJVA 3F8WA 2XENA 3T1HB 2SCUB 4OIFA 4NBNA 1UN9A 4YP5A 4CHTA 4IXTA 1IUKA 3WDLA 3Q7AA 2CXPA 5I5EA 3P97A 1MRZA 3OESA 3UT5A 4LJ8A 4PLHA 3B60A 2I1LA 5A4DA 2PT5A 2J0SA 1VSVA 4LVOA 3AR6A 2O3UA 5B4TA 1T4GA 2H1WA 3PKIA 4X1KA 3HE3A 1Y8MA 2VJYA 1C29B 1T0IA 2FKAA 3EDQA 1F51E 4W82A 5KSYA 3ZN2A 1JDBC 3VTYA 4B35A 4Z4FA 5DTEA 1NUPA 5G55A 5BYBA 3V42A 1W5TA 4U7WA 1DXYA 5LYJF 1GNQA 4ARUA 4O1OA 3VLDA 4BEVA 5DNUA 3FULA 4HS4A 5CJ2A 2GGFA 4JJGA 4W1SA 3ZXUB 5FL7D 5DTJA 1E3DA 2PAAA 4D99A 1UKZA 5FPYA 4GPBA 2XTMA 4C03A 1UN8A 3L46A 3QKUA 2OHFA 2YHSA 4P4GA 2YS6A 3ZU6A 3NKFA 1G3NB 5H8WA 5AK3A 1N5IA 1TFRA 4P2GA 4FOPA 3C16C 2B21A 4QPZA 3RUIA 2GHTA 1JIQA 3KVOA 1TU4A 2QX6A 1E2EA 1ZCAA 1JHYA 1PEAA 2JEKA 2PO7A 4DDVA 3ETLA 2RJ3A 3UB2A 1KO4A 4LZOA 4YHHB 5CIYA 3ZS9A 3WDKA 1N3LA 1X14A 4RTSA 4LX8A 2V7TA 2FA9A 2IDJA 3GFOA 1G0OA 1XLUA 1FFWA 2G5GX 4F2WA 4LERA 3JQQA 4ADSG 3VSBA 2NUAB 5AKGA 4BLQA 3IPRA 1HOXA 2ZJYA 4ZAWA 3L7CA 4NF2A 4W5JA 4W5HA 4AYTA 5FLKA 3KZCA 4EHLA 1P6XA 1FFYA 3IUSA 4AMGA 3CV3A 3VR0A 1KSGA 4OHFA 4DL9A 1XTQA 4CL0A 5C4MA 2FRDA 2IUFA 3MMPA 2CFOA 3VH2A 1C1YA 1CR4A 1P2DA 1VE3A 4IQFA 3ADCA 3ZY6A 1WUIS 3GYGA 3OCJA 2YFYA 2EHJA 3LZ6A 2JFWA 2XXAB 2BFDB 3GD5A 1ZMXA 5P21A 3CNQS 3T9CA 4EFDA 4NEHB 1ISHA 2BGUA 3L7LA 1TRHA 2EGUA 5DN6D 3KZNA 4H7YA 4Y7CA 3RSHA 1RCFA 3WRXA 5FDFA 3KV3O 4EZLA 4IICA 5K2MA 3ZJ5A 3JPYA 3Q1LA 1L2TA 1XPOA 1G18A 2EJWA 5AI0A 4BX3A 4XD7A 2F3QA 1SCNE 3CN9A 3B38A 2HBQA 3VNAA 2YY6A 2OAGA 1TVEA 5BORA 4FDUA 3OM8A 3JQ8B 5ALLA 2OTCA 3WQRA 1V35A 5FWYA 1AMOA 3FM9A 2W6MA 3S2AA 3SDZA 1DUVG 3GUHA 3QNMA 1Z2CA 2W2PA 1GV0A 4BQQA 1V25A 3DL7A 2YWXA 3UWMA 3FTWA 3FNGA 3AL0C 3T5TA 1CRZA 1DTWA 1Z5SC 1BCSA 1V4VA 4J2OA 2XZTA 4AY4A 5FJJA 2M6LA 5DWQA 4EYKA 1XQXA 2D0OB 2JFGA 5J59A 1T4BA 3FNRA 3SI5A 1NFQA 5I4KA 3C8UA 3OZVA 4Z53A 5H4HA 2XB6A 4KZKA 2Z2YA 2PWBA 5CVJA 1Z4JA 4LA4A 3HKBA 1KH3A 3ROFA 4DRZA 4XH9B 4YPFA 3IE0A 2GRAA 2QC9A 5K0LA 3TUIC 1Z4PX 2C8KA 2FBNA 1W25A 3QU5A 4L07A 2CKDA 2SKCA 4FHEA 1AK9A 4DARA 3W2TA 1JKJB 4IMRA 5HGJA 4KR6A 3EZLA 1Z29A 2AN3A 1WW3A 3FUTA 3CZRA 1QO7A 3LUAA 4F8YA 1EWQA 2I1JA 3LY8A 3WGIA 5BQFA 5EDSA 1PBNA 2G0NA 3ZI0A 4DYVA 2DCUA 4KQ9A 2SKEA 2IY7A 3UM1A 5KDOA 3OEEA 4NL4H 5BNIA 1OCRE 4QARA 1XJQA 3D4OA 3GB9A 1FYDA 1MC4A 1WX1A 2VNJA 2M98A 3G0DA 3KYCA 2XH8A 4X1OA 2ZUSA 5BUCA 4PZDA 3G9UA 4IXNA 1QFZA 1HDGO 4H7FA 3IKLA 1UBLS 1LWOA 4CPDA 4CMAA 1UBUS 1Z6AA 4GBGA 5B3JA 4YP9A 3UMVA 4QGGA 5CT5A 1WWKA 2JGLA 2OKCA 4TUYF 1DV2A 2J08A 4P6VF 1LU9A 4ZZIA 4PLVA 3R3ZA 2XCIA 5K0TA 4HSGA 3ANXA 3OQMA 3D6FA 4ZMBA 3IAFA 8ADHA 2I7DA 3E34A 2C9YA 4OQ4A 3B36A 1FCJA 1LK0A 4PYJA 1FK8A 1XD2B 1KAQA 5HDQA 2YMPA 5E9AA 3INRA 4MRRA 4AZ3A 3GFTA 4NV0A 5LCXA 4G8KA 4IMJB 1OZ0A 3O2NA 3KETA 1OI2A 1PJ8A 3E70C 3LA8A 1TJNA 5FI0B 2DERA 4RXMA 3ZE6A 3KXDA 1S3FA 2JC3A 3UK1A 3JWIA 5E76A 4WN9A 2XKJE 1QG6A 5IJWA 3AY7A 1W47A 2JAWA 4CW7A 5JA4D 4OQYA 2X2FA 3DT8A 1LFAA 3A14A 4I6JA 2Q07A 1D6JA 3G1TA 4D1YA 3ZI7A 5LQNA 3X1JA 4I3HA 5EQDA 1XOIA 3L0BA 4UHBA 4C0QC 4I5FA 1IHGA 1W4CA 2DF8A 2KBEA 1CUCA 1KT0A 5KQRA 3ZKWA 2ZFUA 1JR3A 1L4EA 2HI0A 3KB2A 4NPAA 1FIUA 1NVVR 2FWAA 4C0XA 1KYWA 2P8SA 4IS3A 5ARCA 1OT5A 5DU2A 3ZN3A 2ZGGA 3P0IA 3ZW7A 2IHTA 5ITSA 5JXGA 2R86A 4PLZA 2AMFA 3DLTA 2PH1A 2XYQA 4R0MA 4YI3A 2Z3WA 2H9YA 4NZNA 3UXGA 3VR1A 2CBXA 3F47A 1U7OA 4CG2A 1BXZA 4RK7A 3CUEF 1CDOA 1D2CA 1CQJA 1GZHB 3AP3A 3F8TA 1KI7A 1D9ZA 4ETNA 3K8YA 4JYZA 1B7GO 4IJ6A 4A73A 2IONA 2FRVA 1E18A 4Q96A 4QQNA 1EEXB 2A3NA 4EY6A 1P19A 4GWLA 2VTKA 2NAFA 4B6RA 5F12A 4K6OA 4XKJA 3LM8A 3U0VA 5DHRA 4G4IA 4M7CA 1XCPA 4NLLA 4M8LA 5ELXA 1J1IA 4UU1A 1NBAA 4WDQA 2EIME 2BBTA 4MBGA 1IIBA 3AEZA 4B17A 2HOQA 4WD3A 3UHJA 2ZWMA 3REQB 3CONA 3HHPA 3JAKB 4JB8P 2ZWIA 4PZAA 2ZR7A 1P0QA 2PRIA 4JVSA 5K0EA 2O0LA 4RD3A 1W0KD 2O2ZA 1GO2A 2HCTA 4QSMA 2X8JB 1V6CA 1C5KA 4AF8A 3SC2B 1DKOA 4QBFA 2QTHA 1O8CA 4H3HB 4G1MB 2V5VA 3O94A 2XZTG 3TWWA 3FUXA 4BCDA 1ZI9A 3L13A 2BMFA 1BKDR 5A0FA 5J4LA 3CKMA 3O21A 5JO0A 4Y9RA 2B8TA 3WLAA 4IBOA 1D0SA 2VXBA 1YDEA 3GY0A 1JFTA 1W94A 1PV4A 4PXAA 1P0FA 2CXRA 3ZWNA 2C8LA 5H9WA 4KK4A 1YZGA 1OZHA 1I6WA 1G3IA 2ZAMA 1W1WA 3O3NB 1T5IA 2WSYB 2IO2C 4UUOA 1JU3A 3SBEA 3CUWA 4ALIA 2X42A 5H3LA 3O9ZA 4P86A 1YVRA 3C41J 5GINE 1BFKA 4N9QA 3PGLA 3ZU7B 4WCFA 2CGEA 2H52A 3RFVA 2OMKA 3M83A 3C3YA 3P26A 2GJ4A 4KNWA 4CETA 1VYVA 5AW5A 1ML4A 4LJ7A 4L5CA 1UWLA 4LSZA 4LFCB 5H4GA 1MW9X 1ZJWA 3NT2A 5K0BA 4BFLA 3QX7A 4KTTE 3FZGA 1B41A 3RVJA 4JJEA 2WT8A 3HEAA 3F7TA 5H9VA 1TZCA 1XVUA 4IV5A 5HSGA 4TL6A 1TN8A 2LIPA 1D9XA 4BC1A 3KR9A 2F7SA 3HKEB 1XJWA 1O96B 4BT8A 1TYEB 3B7GA 3QFTA 1A5AB 2C9OA 2Y6VA 1NDUA 4GRAA 1Y9JA 4FHDA 2IHUA 3AGPA 4CN8A 3FPGA 4C22A 4JLAA 2GAOA 4JUFA 4M99A 3GEEA 3ZV4A 4C0MA 3HGQA 4L2LA 1IN7A 1TMOA 4OIMA 3OLCX 2WP8J 4US0R 1WXGA 2ZB2A 2BLLA 1IMJA 1I3KA 4CMIA 5FRDA 2D06A 3RC9A 4L1BA 4WUYA 3QPWA 3A1UA 1CFJA 3AI2A 1NFFA 3ZCTA 3JWHA 3HZOA 1V8OA 3DMTC 2KI5A 3B8HA 3ZZUA 5SY6A 4EPYA 2YW9A 1SO8A 1U9IC 3UF0A 3L4KA 1F2UA 3FKJA 1SA0B 4DMKA 1KEEA 2FN3A 2IHBA 2B1QA 1G8AA 1CVLA 4EG1A 1L8OA 3STVA 4P3NA 1ZNWA 3KP1A 4TWRA 1G21B 1XRNA 4RWEA 1I6LA 2CFTA 2TECE 3GZ2A 1SPBS 1TECE 3PTZA 3V7WA 2I6XA 1QGOA 3DOJA 4HFNA 3R9XA