4XIFA

Human ogt in complex with udp-5s-glcnac and substrate peptide (keratin-7)
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
717
structure length
702
Chain Sequence
b'SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title The active site of O-GlcNAc transferase imposes constraints on substrate sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 268
structure length 702
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xifA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xifA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4xifA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4xifA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xifA03
3OKAA 3LYAA 1PN3A 3MV2B 4N9WA 4MRAA 3ESKA 5D00A 3EBOA 1FC0A 2AMVA 4NESA 2FETA 2HY7A 2X0EA 2WPVA 3G2KA 4GZ3A 1NZNA 4J8FA 3GUHA 3MA5A 4L22A 4X7RA 1GPBA 4UQYA 2OFFA 3CVPA 4PQGA 3RT1A 3HBFA 2FEZA 5ARFA 1O6CA 5HQ8A 1FCHA 2QRPA 3CEHA 1NA3A 4LEIA 2GT1A 2F3PA 3CK8A 4M83A 4JL0A 1RRVA 3S7BA 3L7DA 3BCUA 5M72A 1Y6FA 4HORA 1PNVA 3HBJA 1NZFA 5CCMA 2BFWA 4CDRA 3CUVA 3Q4AB 1P2GA 2PYDA 3L7BA 4YI3A 5A6CA 1FTYA 4G26A 5KJKA 3T5TA 4N5CA 3U3WA 1NZDA 4B94A 5G05C 3WC4A 2O6LA 2XA9A 2GPBA 2QRHA 3PE3A 1A17A 3ZCUA 3QWWA 3CVQA 2P6PA 3TGOA 3FP3A 3CEMA 3LPZA 2VG8A 4JHRA 3G2LA 3WADA 2XPIA 2WQHA 3OTHA 3CV0A 5DIZA 3NCHA 2X6QA 5BNWA 4U0UA 1JIUA 4I9CA 5CCLA 3RU0A 1XOIA 4CGWA 2C0LA 2QLLA 2IYFA 1A8IA 1FU7A 4I1AA 4N39A 3UUXA 3COPA 3ZPJA 3MV3B 2QRQA 3BCSA 2UY1B 1Z6PA 4RBNA 2GM9A 1XKXA 5TMBA 1L5QA 3ZCVA 4I9EA 3CK9A 2FF4A 3S27A 3CUYA 1BX3A 3ZN3A 4Z5XA 1F0KA 3C4VA 1E96B 3QOUA 4U0SA 3TG4A 1VGVA 4RIGA 4GA2A 3E4BA 4UQZA 4YVQC 4GYYA 3VTXA 4XI0A 4G1TA 3MT9A 2GEJA 3PE4A 5KJLA 4M7PA 1E4OA 1WM5A 3MKRA 1GG8A 4RIHA 5EX3A 1HLFA 3DDSA 5DU2A 6GPBA 1NLMA 4FKZA 2C4MA 2F3UA 2JZCA 5IKPA 5FZQA 3G2NA 2KCLA 3CEQA 3T3EA 3D1JA 4G23A 2R60A 1PSWA 2NC9A 1UZUA 2Y4TA 1WAO1 2QLNA 4EKYA 1FU4A 2X6RA 3E3NA 1UQTA 4J0UA 4H7YA 2C1XA 3NB0A 3D0RA 2R5SA 4M60A 2SKCA 3FFLA 2SKDA 2JLBA 3MQFA 4YI5A 2FBNA 1XL1A 2IV3A 4N2QA 4GYOA 1C8KA 5KJNA 1ZU2A 1FU8A 3OY7A 3RSZA 2HO1A 5DBKA 5KJMA 3CVLA 4KQ2A 2BISA 2GPAA 4EL0A 1Z8DA 1KT0A 2XCUA 2PZIA 4AN4A 4F9FA 3DD1A 3OT5A 1Z62A 4GPBA 2OOEA 4GCNA 2UY1A 3LY9A 1H5UA 1ELRA 2PQRA 4I2WA 2IFUA 1L5WA 4KXKB 3OTGA 4H7XA 3QKWA 2G9UA 2LNIA 5TMDA 4XIFA 2IEIA 3FROA 5LCWJ 1XNFA 5FT9A 3R9AB 4WACA 3BCRA 5G04C 1P2DA 4BT9A 2AVPA 3CUUA 3BD7A 4GA0A 5AYWD 2DBAA 3WXXA 2IW1A 3VUEA 2PYIA 2G9QA 1W3BA 1PYGA 2PQNA 2PQ6A 4BQIA 3G2JA 3PDNA 1FTQA 3OY2A 2VGXA 3DZCA 4IN3B 5FZSA 4X7PA 4BFCA 3LKUA 2JJMA 2P58C 3ASDA 3ZCTA 4I17A 3T3DA 2XMPA 4GZ5A 3CVNA 3C48A 3DDWA 4G25A 5HXAA 2IV7A 3QDNA 4GPKA 3OTIA 3C4QA 1V4VA 2AV6A 3QHPA 4N2SA 2KCKA 2ONDA 4CGVA 2R4UA 3JYSA 5EKQD 3S7FA 4BT8A 2F3QA 3MTAA 4KQ1A 4YVOA 4APOA 3OXLA 1E1YA 3ZFWA 1K08A 3GZ2A 4MHSA 4F96A 1SXPA 4U04A 2KATA 2XA1A 2KCVA 1Y8MA 2IF4A 1L5VA 2YHCA 3ZCSA 3BEEA 4BTBA 4FZRA 3LCAA 2XCBA 4N3BA 1WW3A 4N3CA 2AW3A 3RSCA 5FZRA 4NC9A 4J8EA 1OUVA 3CUTA 3L79A 3VDMA 3L7AA 4X6LA 4RG6A 3RHZA 1HZ4A 3LY7A 5JTUA 3WAGA 3IA7A 4GZ6A 2IEGA 2I6HA 4KBQA 1B89A 3ZHEB 1WV0A 2J9QA 2Y4UA 4YNDA 3NPAA 3ASHA 2ASVA 3RO3A 2FF5A 3T3HA 4WNEA 1LWNA 2ZB2A 5DXFA 1KT1A 1P4GA 5JJ7A 3QWVA 2QN8A 3AS8A 1FA9A 5LQDA 2HYZA 2KS6A 3BD6A 4CTNA 2C9ZA 2VYIA 3SZ7A 1IYGA 3Q15A 4HLNA 1WUTA 4AM9A 3MSCA 4O6FA 2VQ2A 1PC2A 3VDNB 4XI9A 2XEVA 3QKYA 3RIBA 5TMEA 4G2VA 4I2ZA 4A1SA 3NAZA 1AHPA 4EJ2A 2XCIA 4NEQA 2ACWA 1XC7A 2QFCA 1WV1A 2E2EA 3VTYA 2VSNA 5G05J 4ABNA 1Z6QA 3CKCA 2LSUA 1WUYA 3Q3IA 2G9RA 4WNGA 4AIFA 4Y6CA 2AZDA 4MI9A 3ZCPA 2IYAA 2QZSA 4KQMA 1NOKA 3HBNA 1UQUA 2XGSA 3GW4A 5TVGA 3LY8A 3MBOA 4WHMA 4QLBA 3URZA 1NOJA 1IHGA 4RENA 3TSAA 3CUWA 1L5RA 2ATIA 4RIIA 3VUFA 2Q7FA 5FJYA 2LSVA 3MT8A 2C1ZA 1JEJA 3MTBA 2FO7A 4BQFA 3CK7A 5HI7A 2GJ4A 3SYMA 3E3LA 3S29A 4MICA 3Q5MA 3H4TA 2X0FA 3BD8A 2GW1A 4HOTA 4BQEA 4NRHB 1TJCA 4GA1A 3RO2A 5JJ6A 2XGOA 3NF1A 2ECPA 4WNFA 2QN1A 3GZ1A 3T7DA 3N71A 8GPBA 1HXIA 3RKVA 3AS5A 3KS2A 4JA7A 4UI9C 1C8LA 3MRTA 3TAXA 2FI7A 3AS4A 3IEGA 2QN7A 3O3CA 4WUYA 2R66A 3ASGA 2R4TA 1JIXA 3SF4A 5I45A 2QRMA 5D0OD 3KD7A 4NQ0A 3ZCQA 3K9IA 2V5FA 1J39A 2GEKA 2GPNA 3CX4A 3UYLA 3QWPA 3H4IA 2QRGA 4GCOA 3EBPA 1F6DA 1KTIA 1AXRA 2QN9A 3CV3A 3S2UA 1RZVA 3NP7A 1P2BA 4ME2A 2VSYA 4Y6WA 3MS2A 1FTWA 5D01A 3GYZA 3S7JA 2C0MA 3HBMA 4EL5A 4JA9A 1FS4A 2KC7A 5GPBA 4W9RA 1P5QA 3UQ3A 3MT7A 2X0DA 4GYWA 3KAEA 4RG9A 1SXQA 5CHEE 5JTTA 3MEKA 2VCEA 1XV5A 4RIEA 1HH8A 2PRIA 3IAAA 4UQXA 1GPYA 1P4HA 4MHOA 3NP9A 3G2HA 1EXVA 2HR2A 1JG6A 3U4TA 2SKEA 3MTDA 4AY6A 1QQEA 4HOUA 1GFZA 1NOIA 4RIFA 2VGYA 3Q3EA 3G2IA 2F3SA 2L6JA 5A7DB 2XGMA 2YJNA 3ZGQA 3UPVA 4CTMA 3S28A 4G2TA 4CTOA 4MI6A 4LDPA 2QN2A 3SYRA 4HOSA 2WTXA 5EX0A 1GPAA 1WW2A 2BGUA 2QN3A 4J8DA 4BTAA 1ZBPA 3ULQA 1JIVA 3O48A 3OKPA 5G04J 4HOQA 1QZ2A 3EDTB 1Y8ZA 2PL2A 1KLXA 1NA0A 3T3GA 4F97A 1M5RA 3HYMB 2H1FA 4X7MA 4EQFA 4WADA 3UYKA 1YGPA 4KYOB 1XL0A 3MS7A 5LCWC 4UI9J 3ZCRA 3D0QA 2FFRA 3FWVA 1L7XA 3MRXA 7GPBA 4F3VA 4EKEA 1RZUA 3L7CA 4MI3A 2IUYA 1L5SA 5IKOA 1LWOA 5D0QD 5FTPA 3OXFA 3TG5A 3BDAA 2VGXB 1ABBA 2VCHA 2C2LA 2BGTA 1QM5A 4G24A 4N3AA 4AMGA 2H1HA 4RELA 3AMVA 1JG7A 1IIRA 2R68A 1L6IA 3MS4A 1P29A 2ACVA 2QNBA 5DLDA 3OXGA 3L01A 3NC4A 3OKCA 3GPBA 1P4JA 4W6QA 3ASFA 5JJTA 5BW8C 2UWJG 1C50A 2F9FA 5C1DA 3CKBA 1IXYA 1YA0A 4HWGA 1ELWA 2QLMA 3RJVA 1Y6GA 3S0JA 4U07A 1EM6A 4UI9K 1NVKA 2MHKA 3Q49B 5ARGA 4AY5A 2PRJA 3Q47B 2BUGA 1GZ5A 4YUAA 9GPBA 1YA6A 2G9VA 1QKJA 4LEUA 2YQ8A 3BEOA 5BT1A 4WNDA 2Q6VA 4U0ZA 4BWRA 1C3JA 4AMBA 3ZHEA 3CEJA 3Q3HA 1K06A 1GGNA 3E3OA 3MRVA 1B4DA 3TOVA 3S7DA 3T3IA 2XCCA 5ENZA 2XA2A 4REMA
chains in the Genus database with same CATH superfamily
3DSVA 4E1VA 2FZLA 3ESKA 5JAPA 2HIAA 1K9VF 5ARBA 1VG0B 3JV7A 1OKKD 3TOSA 1MEOA 4QYIB 1LSUA 4IIGA 2NV0A 3QGMA 5G1PA 4YRZA 1CCWA 1HDEA 3HS3A 1V9CA 5IZCA 5B3SE 3LL7A 1H0RA 3V7YA 4M89A 4E70A 1MTOA 3DP9A 1DLIA 1R5OA 5EPEA 2QTGA 4ZVLA 4O0MA 4HXFB 5DVZA 1YYHA 2R5WA 2CJWA 4P3XA 2NOAA 4AS1A 2OAP1 1CT9A 1A1SA 2RFAA 4F6LA 2MHCA 3G0HA 3APDA 1QP7A 1Z3CA 4UVDA 3F1KA 1DKUA 4DANA 3TXYA 3HCDA 2IKQA 3THXB 3UH1A 4QYIA 1FZQA 2B1QA 5I9IA 3ML8A 3H13A 3D6TB 3SVTA 3TGPA 5K0EA 2VSFA 4BO8A 4YV2A 4YFVA 4OO3A 4AKGA 1HL3A 1V2HE 1UBHS 4NYIQ 1K7FB 1MUUA 4KJXA 5KOYA 1NFIE 1B23P 2Y99A 3D9NA 2Z6AA 4HR7A 2HSDA 3FUXA 1ZUIA 4RKYA 2BLLA 4NE7A 1FUEA 5G04C 3RIGA 1EP1B 1BVRA 1LH0A 5CMLA 3UG7A 5TARA 2DT5A 4U1RA 4I17A 1Z2CA 1E7VA 3DOHA 3IBGA 4IXNA 4JWTA 2IV7A 4CMKA 1GKYA 4DSZA 2LRHA 5IT9A 1XQ1A 4YVOA 3DLIA 1Q84A 1UBUS 1IEWA 5ENPD 1NXQA 2E18A 3RK1A 4FYKA 4RJLA 3ZNOA 1FDIA 3C74A 1YONA 1X81A 2QI9F 3RHZA 1QIHA 3VAAA 3DT6A 3PZ1A 5ER9A 3ZDQA 2ASVA 2R59A 5JJ7A 1NNI1 3BA1A 3HDGA 3KQQA 1SUAA 3V7WA 3V4VB 5GZ6A 3RIBA 3ACBA 2RDMA 1RHJA 2D3WA 4ZAXA 3B6KA 1E2GA 3DMRA 2NWQA 3AB3A 3QEKA 3UCEA 1R4AA 3BCHA 3LT5A 4I8IA 3AVQA 3KTDA 3S2EA 3ERCA 3WLKX 2LE0A 5JOQA 3O4GA 1SVLA 1OFUA 4I2NA 3LA6A 1AHIA 1QG6A 3E3LA 3OZBA 1DC2A 2V7GA 1R37A 4EPYA 1E2KA 5D85A 4K5QA 2Z2IA 1W85B 5J90A 3KS2A 1SKQA 3NZEA 2AJCA 3A2KA 3DMTC 2AG0A 2PS9A 2FN4A 5DDIP 5BWNA 4NYJR 3FBGA 3CJQA 2QRKA 5FULA 1T5HX 5H3HA 3NOGD 2NSLA 4M7CA 4EF6A 2CV1A 2C4VA 2FMHA 2A7XA 2J5QA 1MAAA 4UM9B 2QROA 1UWKA 1S3GA 1XHFA 4RVUA 1RAHA 1S2LA 2VPXA 3GRRA 4QICA 4WNAB 1WTAA 2OQ2A 2HR2A 5I3ZA 2L6JA 4HLLA 2ZIAA 4ER3A 2Q1UA 4IS3A 4CT5A 1CUBA 2PX2A 4YJ2A 4F71A 4BGUA 4MKGA 2AR7A 1KH3A 1W85A 2B6NA 2L18A 2QJRA 1LQ2A 3JTMA 3DDUA 5E6RA 3KEFA 2IPMA 3LYLA 1TLFA 2MR6A 2WHYA 3IE2A 4QYWA 4G9EA 1O54A 2Z2ZA 2HWKA 4QBFA 3ZGVA 4ZEWA 1Y7PA 3KXPA 4QD3A 1GSOA 4IOKA 5FTKA 3CSFA 4DLSA 1MJFA 4WNAA 1FDOA 1KFJB 4Q24A 5JBQA 3DOFA 3LT4A 3QELB 3BXXA 4DLZA 1MD9A 4G5RA 3K2BA 1XJCA 4KB5A 4HH3C 1PUJA 4Q7LA 5LB4A 3QVSA 5IUNC 2PRZA 1Z4OA 3I53A 3BORA 1E3TA 2UZ0A 5GIOE 3A14A 3N8IA 4K5BA 2I7CA 3HCPA 3F6CA 4A0SA 2DZDA 1AUPA 3WISA 3RV3A 1AKYA 1B1AA 3L40A 3ANTA 1J22A 4B93B 5F51A 2J85A 2V7QD 1RI5A 1GADO 2AXPA 2AYXA 5EIWA 4QOGA 3PUYA 3QJZA 3LSTA 3D3MA 2WM3A 2F1KA 3GEGA 2TRSB 1TUBA 3QELA 3ENNA 4PSCA 1YUNA 4C08A 1F0KA 3BH0A 3H2GA 4FCCA 3VI4B 4OQXA 1KZ6A 3GDHA 2PKXA 3M5CA 4BMVA 3R09A 2PL3A 3EVTA 5ENSD 2AX3A 2BF7A 3HXLA 5GVRA 4ALNA 1LBHA 4QTZA 1MU0A 1EPUA 1TMOA 1XRJA 4OMCA 5BQ3A 4U3JB 4DI3A 5L7YA 5TR9A 3ZZUA 4X94A 3KXLA 3CQGB 1Y6JA 2XKBA 1XZGA 1NMYA 1K1EA 1MORA 3OCWA 1Y4UA 4WERA 4RZQA 2P2GA 4G56A 5ESXA 2X6HA 2H1SA 4GP6A 3X2EA 4MGYR 3KSAC 4UHBA 4BT9A 1GAXA 1SVMA 5BN3B 1E9VA 2KQUA 2PYIA 5F5LA 2QX4A 1WSBA 2P5UA 2DKNA 1JIJA 1HO3A 2NXJA 2J33A 1LLCA 4G25A 2IOHA 3D9QX 1UP6A 4CGVA 2IZ5A 2BZ1A 3KBBA 2AHOA 1KQOA 2HZBA 3DZGA 2QGFA 2RG8A 2XF2A 4GEGA 5LQMA 5FWYB 3AKCA 3DAYA 2O9JA 4DJTA 4ZO7A 1BCRA 1GNTA 1Y63A 5EKSA 1RKXA 5BN3A 4DSUA 1Z5PA 2HYZA 5K20A 2C2ZA 1OXSC 3K1JA 2QFCA 3GBSA 3N05A 4S24A 2MTBA 4KIUA 3IEUA 1M5UA 5HKBA 2GH1A 4G89A 1BGVA 1X1EA 5C5CA 3ZCPA 3QAQA 1P0MA 1B1CA 1YC5A 3QMVA 5T4EA 3OZXA 2C4NA 1S2OA 5JV5A 1JEJA 3TIXB 2CXPA 2IEZA 2QT9A 2OORC 3OQ1A 4G81A 1QKKA 2HBQA 3BDIA 3QX3A 3ROTA 1OZ0A 1UK6A 1T1GA 3GLHE 3QLUA 5LVAA 4OX9Y 4OKIA 5JFTA 1Z0DA 2H2GA 3FDXA 3FPBA 4G1EB 2F1JA 4TYMA 1XJQA 1L6RA 3FHCB 3O8DA 4LXGA 2W9JA 4PY2A 3RVPA 3S2YA 3C87A 2DQKA 2HU8A 1XCOA 3S2UA 4ME2A 3D8HA 3HO8A 3MS2A 1VKJA 4ZT7A 4L7TA 2PV7A 4HS2A 4GMXA 4I50A 3C3YA 4XGKA 1Z75A 3RCBA 1HS6A 1E2LA 1SCDA 3C3BA 5T3YA 3RVBA 1KOFA 4COKA 4LQCA 4EG3A 4IIDA 4YRPA 1A95A 1ZA1A 5KSZA 1AGPA 2P90A 1ZUHA 3AJAA 3HYMB 1P7VA 1JQKA 1KSFX 1II8A 1H19A 3IDZA 3NEPX 5AVXA 3OCVA 3NATA 5ERGB 1OJLA 2TECE 2Z56A 3I3SR 1TCAA 4INZA 1DXOA 1Y3DE 2VBCA 4JVOA 5IDWA 1C3XA 1QHSA 1TNYA 3SMVA 1REQB 3S5JA 2CL7X 2FW9A 2FQXA 1NZJA 1NJFA 4LTMA 3DKVA 3PHLA 2REXB 2R6AA 4G0PA 3DTYA 5E4JA 3FUKA 3NPMA 2Z30A 1UBEA 4BYMA 4WN9A 5ENZA 1B8PA 1U0LA 2X6TA 5KNDD 2BC9A 2Q5QA 4Q9DA 1FF9A 2Y0EA 3C3AA 4CMEC 1E89A 4E09A 4A26A 1N7IA 3AU9A 4LY6A 2IYNA 3CF0A 1L2TA 3W5HA 1KZ7B 3ZBTA 4ZHQB 2GF2A 1S4MA 4HOYA 1BEZA 1ZRSA 2LPMA 3ETEA 1TEVA 1REQA 3L4JA 1SUDA 4PANA 4MYSA 1L4MA 3RRUA 4YQFA 2WDZA 3QXCA 2DULA 4CL0A 4S1VA 4JJ8A 1NQAO 1C0LA 3FTCA 3ZPJA 4I1MA 4H7IA 4DPLA 4GTRA 2R65A 2JAQA 1U0RA 1WL8A 4KBFA 3CH5A 4DCPA 3UX4A 5AVSA 1WLYA 1B0PA 1WPRA 3ZVVA 3ZHCA 3CSSA 4FZ3A 5LZ8A 1GSHA 2ALJA 1WB5A 3PUIA 2JFUA 2DB3A 1JQ5A 2W93A 3MQFA 5BMOA 1UK7A 3DSXA 3QJYA 3KOXA 1TM1E 5JHGB 3AB8A 3ANLA 5E3HA 2DYRE 1XXLA 3K0HA 4IEEA 2YVQA 1CLUA 3DD1A 2BHRA 4RF2A 3A9CA 3OCZA 1H5UA 4UMDA 1ELRA 2VPQA 2JD1A 1C4OA 2ZRCA 1JMYA 1OB5A 5AO9A 1RWWA 1YR8A 1ZL2A 2ZU6B 3C6XA 4D80A 4LX0A 1TF2A 5ESDA 4EB0A 1Y6RA 2ZULA 2PQ6A 2WMDA 3O4HA 2PUFA 4B7ZA 1T0HB 4GH5A 1ULHA 4KLRA 2I3GA 4IGFA 4ANWA 2X2PA 6YASA 4MX8A 2C8JA 2GN1A 3UB2A 2FEMA 5DH9A 2AV6A 1JCRA 4J8YA 2YY6A 5JR3A 4H7EA 1HNZB 1XTUA 2HMYB 1MC1A 3OQVA 2P9GA 1O9BA 2JJ8A 5LN1A 3GPIA 3W3AA 3FUNA 1RYZA 4P08A 2YJTD 2P69A 2XB4A 2VK8A 2PM8A 2FPMA 3LPNA 3MWGA 1NUUA 2R7LA 2ID9A 3IHYA 4YNDA 1DXHA 2ZU6A 3W34A 1ETUA 4LWZA 1S63A 4PYNA 2FZKA 4O8ZA 2D2XA 2G77B 1PJCA 1OD6A 2WVAA 2HCJB 4JZYA 4C14A 4R8RA 2R87A 4C4ZA 3OZSA 1X39A 1XTSA 1V16A 2IYAA 4BTEA 4NEHB 4O4IB 5ALPA 1XDWA 1AKUA 4LF4B 2G5TA 2Z4TA 4DZRA 3LU1A 4R16A 1QVRA 4L9PA 1M66A 1TUIA 1G4UR 4B87A 4HB4A 2B4RO 1YHNA 4OCZA 3QFCA 2SECE 4O4HA 1G20E 4JR1A 4DAOA 1RKQA 1NM5A 1NDQA 1HTTA 4HNAA 1KOLA 2CB9A 1RXSA 2ZJZA 5ALMA 3WGUA 3YASA 3R4VA 3B8HA 3THSA 1NN5A 1I36A 2XTMA 1JW9B 3HBMA 2XVMA 1Z35A 5FNZA 4JBLA 1RHKA 3V1YA 2AWNA 4RVDA 4H0CA 4O4IA 2G1AA 3NBAA 4W4TA 4KVAA 4WFQA 1AMOA 4P92A 3ZIDA 4FILA 2HNBA 1VGQA 1L7EA 2FSVA 3L8DA 5J5CA 4F97A 4QQRA 4EO4A 3HDYA 2A0WA 1WRBA 4CRWB 1JXQA 2FN7A 3KBOA 4GOXA 4W5OA 4NMWA 2BEVB 2BMFA 1JR2A 2ZUEA 5IASA 2QR3A 3OXFA 3SZOA 2ZGGA 3PGXA 2A5JA 3FLAA 5HFNA 2ZI4A 2WXOA 4EBAG 1PG5A 1U1CA 3OPVA 3K0AB 1IHPA 4INJA 5A0VA 5C1DA 3LWBA 3EQ6A 5DI3B 1ELWA 4QUHA 1PEKE 1YDGA 2FZVA 4GPEA 4CLOB 1Z8HA 2RGNC 1ODJA 1TO2E 1OWPA 1N0WA 3IJ5A 1ZRHA 3D7LA 2IUEA 1XZHA 2ZYSA 5DGDA 5AVTA 2AMVA 3KEAA 4R81A 2EKDA 3NDRA 4UQYA 4CRWA 4X95A 1J0DA 4IDPA 2BEVA 2GHIA 4LNHA 3F3KA 3E53A 3F6PA 4XKCA 3N2NA 5CYOA 5L3QA 3OD1A 5AAOA 2ODQA 4ZHQF 2OCIA 4RQTA 3FP3A 3HPQA 5JHBA 2VUUA 3U6BA 3K5IA 4HZUB 5FRDA 2IYFA 3EZFA 5LCXA 2YHUA 2FPGB 1W1WA 1NQTA 3CK9A 3HWX1 4XQEA 4QPPA 3QVVA 4WRRA 1V7CA 4F5YA 5L6LB 4C7KA 3HJAA 1I9GA 4ZQBA 2OBXA 2PZKA 3ULYA 3C3XA 4GUAA 4L4UA 1AF4A 4OYSA 2M1ZA 1R66A 1WY7A 3MZLB 4HI0E 2IZZA 2WUEA 1KORA 4BQPA 3W78A 4DV5B 2PAAA 3DCNA 4HZUA 4YK7A 1CUWA 1UJ4A 4QNMA 4XR9A 2O8VA 4XDHA 1W5FA 2HJSA 3H4MA 2CJYA 1G5PA 1BTOA 1ODFA 3CLVA 1M1UA 1QF6A 3Q88A 1Q44A 2C7BA 4NV0A 4P7KA 2WXGA 3PXCX 2C00A 4GNRA 1NP6A 3VR2A 1HBJA 1TO1E 4B80A 3R75A 3NM4A 1FNSA 1JLSA 4FFMA 1DBPA 2QW1A 4RVSA 1RFGE 2PUCA 5CH8A 2H54A 5I4KA 3GNTA 2OCCE 3BRQA 3A2MA 3TXNA 4KQ1A 3BQOA 4ESHA 1Y48E 5FAXA 4HO1X 2G4VA 2X7HA 1E1KA 3U2QA 2XCBA 2GRAA 1LGYA 3NRBA 4JEHA 3L7AA 1IMOA 1L4LA 1N6IA 4L50A 4PF1A 4EHLA 3OP4A 3GUYA 1YB7A 5EILA 4XPIB 1KYTA 2KE5A 4HGYA 3L6RA 1DWUA 4N5QA 4ZOCA 2IP2A 5IAGA 3PI6A 3R5TA 4JOBA 4HZIA 1LNSA 4BNMA 3EAFA 2H92A 1WUYA 2J3DA 4Y1GA 4XYEA 1G16A 2QJFA 4PG5A 1NOKA 3GW4A 3FTYA 1K8QA 3V79K 3U16A 5AKGA 5AVOA 2QEQA 5FI0B 2H1IA 4CG2A 1CJMA 2Q2NA 3T06B 3IQZA 1BFKA 1UPXA 1HYQA 4KQ6A 2FG5A 5CFRA 1LLFA 4Z7OB 2ETBA 1CD5A 4XPIA 2QD5A 2B2CA 1QXSA 4NBVA 3M1AA 3PWSA 2B8WA 2E1RA 4TT3A 1T24A 2QRGA 4A8PA 1NVBA 1V25A 1RADA 5DLYA 3D8RA 3TSYA 5EP3A 1OR8A 4W8HA 1XE3A 1V5FA 1JBEA 2WPNA 2I9CA 4HEA6 5LMUB 3PRJA 5DN6D 2EWWA 2IZ6A 3W5DA 4E4RA 1YK1A 2KM4A 4CLDA 3ONEA 1ECCA 3GT4A 3Q3EA 4C5BA 4GPTA 1IWPB 1NJGA 1EVJA 4FEEA 4G8JA 4ZMSA 3RUCA 4EKNB 1T0UA 4FYMA 2ES4A 4CI0B 1JTFA 3DLTA 3ZCRA 3F3MA 4BMDA 3P2YA 5LOVF 2IONA 4F60A 3VYWA 1RAAA 2RBGA 1NTRA 4MQ5A 1U0SY 4DLLA 2ZB3A 4WZBB 2OCGA 2G82A 4YJ3B 2ST1A 3EPLA 4K1XA 3MJRA 3E9ZA 2EXXA 1V54E 2FEXA 3DVRX 2QMOA 3CG0A 6ADHA 4IDCA 4BLOA 3OZEA 1RWMA 1C4XA 4ZVPA 1WCV1 3GFOA 4DQDA 3AETB 4HNRA 1RQNA 2JPDA 4WAUA 4IL5A 3C5VA 3P0HA 1RW4A 2CF6A 3DC7A 2AG1A 3HJNA 5BPHA 3QXHA 4R0NA 5CT6A 1MKYA 2J46A 5FO0A 3R0JA 4L0DA 4XJTA 1LV8A 5C8VA 2ZITA 4RPLA 2C84A 1E1NA 1MX6A 2VDLB 4L4SA 5GQSA 3ZLUA 4AQDA 3ILHA 3IUPA 2IXFA 4OU4A 1HC7A 2WQHA 3ESBA 2HQ1A 1XNQB 3C24A 2B9EA 3D9JA 4CGWA 4GBMA 2OSVA 4I1AA 1D09A 1TX4B 1Z15A 3AETA 5JXHA 1XQ6A 3OFNA 3MKQB 5CDYA 5DBIA 1M75A 5TS3A 3IPCA 3EHNA 4UPDA 7MHTA 3NRCA 5AUPB 3CEQA 1P1CA 1FP1D 3TH5A 2JHGA 3S1AB 4KXVA 2QVBA 3C5EA 4F53A 4PIPA 4PLGA 3TD9A 1V8OA 3A1EA 4X8OA 2IK8A 3K31A 4JW1A 4H3VA 1YUBA 4XB6B 4IIJB 1N25A 3P9RA 3UAGA 2XZOA 4YRKA 2QRVA 2P1RA 3SXJA 4CHTA 2HH9A 3AERB 4LW8A 4DB4A 4UAJA 2RFLA 3RVRA 4B45A 1SKMA 2J0UB 5EPUA 1W35A 4BO0A 4DVGA 4IEIA 1MR3F 4NS4A 1P2DA 1KP9A 4LTNA 4EEKA 4LC9A 5IZ4A 1CNFA 5DBFA 2X58A 2NYJA 4MA0A 3SFXA 3NZSA 1H6KA 4J7UA 3S1AA 1VKHA 5LZ5A 4HNTA 2LGJA 3H4VA 4EHFA 1KQNA 3DL4A 1HKHA 4Q1BA 3BTUA 2QY9A 4NBRA 4RSGA 4JLBA 3AERA 1NL4A 2IDMA 1FFSA 1H5NA 2PJUA 4I4IA 4FDTA 2J0UA 3WGYA 4G0YA 3GU3A 5L7TA 4DLRA 1FRVA 5BW5A 5F52A 3U3MA 4ARUA 4ECEA 1VBFA 3RROA 3ZPXA 3L5KA 4G9GA 3PFFA 1YCGA 4EGFA 2GHRA 2I8AA 4WQMA 3IALA 1ZGBA 4GPMA 4LRWA 1NJ1A 2NVOA 1E5VA 3H5TA 1A8SA 3MG9A 3OJFA 2WSSA 2CXSA 4YBRA 2L0XA 4BSXA 3NLLA 1RJWA 4JI5B 3M34A 1V3VA 1NP3A 1O1YA 1MVLA 3P2EA 5EE5B 3ZWBA 2BKEA 2FCAA 3JQ8A 1NKSA 4E2ZA 2ZQYA 3GRUA 2ZTLA 3MJ4A 4QGHA 4L9AA 4KK4A 3QYPA 3T61A 4OQFA 4BRZA 2RGUA 4XVUA 3RH0A 2HF2A 1J56A 4FGKA 2YC2C 2WJGA 4J3JA 4URHA 4DPMA 3AY3A 1HV8A 3R9XB 1Q16A 2R96A 2YWGA 4TN1A 5JAQA 5ENNA 3GCZA 5EHNA 2CEAA 4YRTA 2QQ0A 2WLTA 4QRDA 4DY6A 4M1EA 3IH5A 1ZD8A 1T8PA 3HXBA 5FL7D 5KDLA 2Y1KA 3SPXA 2EFGA 2AD5A 5D51S 3WG7E 5CPFA 3LD9A 4UNIA 2QIPA 4PAWA 2VHUA 1N9GB 2HV9A 4QECA 4WINA 5LCWC 2QMUA 5JARA 2IH2A 3U4QA 2XWSA 1P75A 2C5AA 4ZICA 2G63A 2JVKA 4RJJA 1JSRA 4W8OA 4DTIA 1QRRA 3PQEA 3OKCA 5F5NA 1FQJA 2VJDA 1KP2A 4YJ3F 1HQDA 1NX6A 4FWIB 4WFJA 5HGJA 5DE3A 3NS7A 1JMKC 2QR5A 2XCSB 2X8WA 3FFXA 4AFNA 4CDGA 1HGXA 3EVAA 4B0ZA 2XA2A 4IH4A 4EF4A 1LJUA 4RPCA 4B3RB 3Q1KA 1N9GA 3S7TA 3B7UX 1IONA 1X8KA 1DQZA 4XW2A 4EG4A 1GV0A 3TWTA 3SO8A 4EPVA 1YVRA 4C3OB 2W48A 2UZ3A 4PSKA 2H63A 2CFZA 4BMOB 1J7JA 3W8RA 3N5CA 3QWWA 4CIWA 2YJ4A 4IGIA 4KMSA 4GP7A 2HRDA 4I3FA 3SVLA 4AZTA 1N4DA 2ZWIA 3SBDA 1HLPA 4P6VF 1HQYE 1C0KA 4TT8A 1VBMA 2BJHA 3ETHA 1E2BA 3C4VA 3VU0A 1KVRA 3OX1A 3ENWA 3KSRA 4Q3CA 4DYDA 1T8YA 3NXSA 2CWWA 4J75A 2IWHA 3CE6A 4B8AA 3GEDA 2ACEA 5D7NA 1IAVA 4JJ7A 1H4SA 2Q3HA 3GJ8A 3OVMA 1H0KA 2JIPA 5EI5A 1EBBA 2AEEA 4BNFA 3DGEC 3VOSA 1ZISA 3WSTA 2H5IA 3I32A 4IDEA 4I1OB 3E2MA 1QTQA 4XUDA 2GBIA 4IIJF 4KW7A 4D0SA 4QOSA 3NBXX 2GN9A 3WRXC 4Q82A 5L45A 3KYCB 4FU3A 2B8NA 1NKVA 3QE3A 2C4HA 4ID3A 2JCBA 1DJPA 4DUYB 3ENQA 3DUWA 2PUTA 4FS8A 3FWYA 3KU1A 3CR7A 4LGMA 3HEMA 1WNFA 3EGXA 2AUTA 4JC4A 2XMPA 3ULEG 3WZMA 3LXXA 1C7FA 2D13A 4X85A 4ZYUA 4M4SA 1NVVR 3RLFA 3PGLA 2HBZA 5BPFA 4I1OA 4AU1A 2OT3B 1YQUA 3KQOA 3IVMA 3AY6A 3LCCA 1Q0UA 1NDUA 3JZFA 3KYCA 2P2SA 4QUEA 1QNLA 3GQBB 1G5RA 1U3VA 4JSRA 5AOXB 2IEBA 4L78A 1K66A 3GCDA 1DZIA 2BCJQ 2J30A 5CNJA 3LUJA 4R2HA 1VPWA 1NC1A 3RKRA 4QYXA 3CJRA 1NSFA 3EHRA 4PFJA 4J0HA 3DLAA 2NP6A 4LZOA 4L08A 3HCEA 1C0EA 4KEAA 4PO3X 3H5LA 5FQ8A 6Q21A 2JFWA 3FUIA 3MT8A 4G11A 2J9FB 4ZQIA 4EEXA 4DX7D 5JD6A 4MGHA 4YWJA 1YUMA 1LDNA 1E2MA 4YAUA 3ZDDA 1KE2A 2PG3A 4WY2A 3I1IA 3GCWA 4TQAA 4K9KA 1W36B 4C0BA 1U3FA 1QWOA 4PHFA 3WNZA 2AXVA 2HMAA 1I6WA 1OKKA 4GXQA 1DEHA 5JHHB 4NU5A 4OKSA 4UE3S 3HJCA 1E1CB 1SXHA 1VI6A 5IVHA 3UOAB 1JLKA 2A0FA 3L8YA 3O82A 4Z6KA 4IX1A 5I51A 3ZHUA 1JEQB 1HMPA 1O6FA 1PJ2A 4JT8A 1SZDA 1M2WA 1A5ZA 2PZFA 4MHOA 4OQZA 2GUWA 2ZJBA 5JZSA 1U5BB 3KTAA 3STHA 3N8KA 3BFKA 4IIEA 1O9GA 5J43A 1CJKC 4ZQGA 3WJAA 1V5WA 4MGZR 3Q75A 1DQYA 4QFCA 3V46A 2KZTB 2IHBA 5FDFA 3ZRHA 4X3PA 1E1CA 1JQJC 1FSGA 4E88A 3SYTA 1OW3B 2CW5A 2VRBA 2UV8A 3L01A 3NYWA 4L7QA 4D25A 2P41A 2CL5A 1JEQA 4D57A 1TVKB 3C98A 4WH0A 4Z8XA 3UJNA 3VX3A 2FWAA 4XASA 1P6UA 2PRJA 1E77A 4U7HA 3K0FA 5M2QA 2FNAA 2QG4A 4YACA 3IMFA 2QD1A 1SQ0A 1G7RA 2P6RA 4N7MA 1KERA 3ZLBA 4KK3A 2KZTA 2EKBA 2VDQB 5L40A 1QZTA 3NTRA 5K6RA 3L7YA 3OIGA 3V32A 4BCCA 1T1IA 2WICA 1RZRA 1TVKA 2A1UB 4Z51A 4U8GA 1FX1A 3G2PA 4M6WB 2Y77A 3SR3A 4IYJA 2QGZA 5KHAA 3QXGA 1MJ5A 2DIWA 3Q6NA 2CKMA 2CDCA 2ZT8A 4DJDC 1IE3A 2ZIEA 3P0RA 3UUWA 3V4ZA 2XMCA 4GA2A 4MITA 4IIBA 3TGLA 4ZVOA 3ABSB 4WV3A 2BKXA 5I4IA 4DSAA 3HI4A 4W5JA 3S6JA 1EMDA 1IHUA 4JYCA 1YS7A 4DABA 1PQPA 3KEOA 4C06A 5CDSA 1MEEA 3HADA 1DG3A 3B36A 2VDMB 2A1UA 4QREA 1OYVA 2DY0A 2OGZA 3BL8A 4M6WA 1B8VA 2RK4A 2YYAA 4CQJA 2HNAA 3WWEA 5DISB 2QSUA 2Z2YA 5LKAA 5CRUA 3G49A 4FDLA 3HU3A 3CEPB 5SY9A 2QJWA 4YX9A 2AW5A 5J2UB 2V6JA 3H97A 3VHXB 4UBJA 3RAPR 1YBHA 3LZ6A 4AMUA 3A1FA 3TAHA 2VK4A 5K0BA 4CKZA 2OBNA 1RW2A 1RLOA 4FFNA 1GV1A 5CNIA 2J7PA 2O8CA 3WYNA 1WZEA 4FOLA 3ZHXA 2VZEA 1M2VB 5DK4A 1EJ6A 4OD0A 4DLOA 1N2HA 4X7BA 4NZPA 2QRLA 1DS6A 1GQYA 2VJQA 5CMYA 5J2UA 4QUKA 3D4OA 2G9NA 1YZYA 4EAQA 3VHXA 2AXZA 4WKGA 2XBMA 3OICA 4TMTA 3RUEA 1MC8A 4I2ZA 3QPDA 4EJ2A 2JGEA 2L82A 1D0SA 4KL8S 5L53A 3T5PA 3DOCA 2R47A 3DO6A 3IKVA 3ISMC 4CMIA 2H9YA 3DBOB 2Q45A 2XMDA 4O3MA 1M2VA 3E9RA 3D43A 3KAPA 2VR1A 4H17A 1KI4A 1K6XA 1KJQA 1GL6A 1JWLA 3QXXA 4RAOA 5BYKA 1R5NA 3SZUA 3MVEA 1ZLYA 1EWVA 5GJBA 4Q4DA 1CY2A 3ZZTA 3FH0A 2IYTA 3B6ZA 1RAIA 1FDWA 1QGZA 4NAUA 1ULAA 3HA3A 1JSLA 4N5MA 2XXAA 2PMFA 5DYTA 2ZIUB 2WD7B 2ZJYA 1P2BA 2IPAB 4W9RA 1K92A 3F46A 3D9HA 3K5HA 3UPDA 4LZWA 4REQA 1XTPA 3WGIA 4I8XA 4A15A 4PZUA 1DT5A 3AYXB 2CXNA 3E7PA 2A4ZA 1ND6A 5FQOA 3BXZA 4X1KB 3A37A 3F3SA 4JZKA 4ZO8A 4J0EA 4RE5A 2YWEA 1UBNA 3OZDA 3ZY5A 2R8EA 3MMNA 2IH5A 2HTFA 4N82A 4D0NA 3ZVKA 2NM0A 4JBIA 5A1TA 3B8EA 4TL8A 3BGVA 1UC5B 5JNRA 2WD7A 5JCZA 5HF6A 4FQ7A 2CJPA 3ZD9A 4ENSA 1CDDA 1SKYB 1YRAA 1F5SA 4X20B 3UB3A 2GILA 1JN0A 4CUKA 4AY3A 3Q47B 5AJHA 2GRQB 4OFBA 3MA0A 1VJ1A 3UW1A 1DJOA 5H7XA 5IJWA 2EEZA 3T7JA 4KPGA 5F9HA 5HIIA 1A27A 4JFRA 4X1KA 3Q6IA 1TIBA 1X1BA 2J07A 1XCLA 4F11A 1FC0A 3KDSE 3WMEA 4PQGA 1NUPA 2JG3A 1YZ3A 3K4HA 1KAGA 3QX9A 2AC4A 2UZAA 4Q4AB 2VA9A 1XK7A 2P2CA 3PDCA 5E1DA 1YFKA 4DUIA 2AF3C 4IHKA 4JYZA 4X20A 4PG7A 4LQ4A 3VH3A 2DKOA 4AUMA 2W5UA 4C43A 4ZT3A 3ZD6A 4MARA 4N39A 2XIQA 2Y4NA 3UUXA 4M8LA 1YIOA 3V3TA 2IOLA 1XKXA 4Z3DA 2O2IA 1EWTA 2FPXA 3PX7A 3GIWA 3HJTA 3TG4A 5IULC 2CKDA 2PUWA 2VA8A 2WFMA 1N9ZA 2VYND 3UJAA 4IGEA 2PVSA 3T9CA 2PGOA 1Q0TA 3ORSA 2BEKA 5KC9A 1LSSA 4FT2A 2C4KA 3G7SA 2ZQ5A 2FU5C 1YJCA 2OECA 3UT7A 2YWXA 1DNPA 3A4TA 1ZINA 4Q4AA 1GUZA 2OHJA 1KL7A 1J2UA 4KSBA 4EMBA 3T5GA 2P9YA 4HGRA 1U11A 4ISCA 3P0IA 2I33A 4C21A 4CI9A 4E2FA 3ASVA 3ANYB 1G3IA 4EUNA 3ASUA 4BB0A 2HMWA 3CH6A 5P8WA 5FFNA 4OB7A 3SM3A 5EJ5A 1A0OA 1FMCA 4YPVA 5AW4A 4YJ2B 1EFPB 1M6YA 4LCEA 4UOEA 1P5JA 1JG1A 1T0BA 3PL5A 2PQNA 2ZUUA 5E6RB 1THZA 4GLLA 4DMGA 3NVKI 2CMHA 3V48A 4DSOA 1NYTA 3WLRA 1QH0A 1WAMA 2GBPA 1ZAYA 1I3MA 4EVRA 3GZ2A 2UVPA 1K8KG 4JNKA 4XYGA 1POXA 2B25A 3WQBA 4K9PA 5CM2Z 2CHFA 5J58A 3LAWA 4WWPA 3IMGA 3L82A 4WMLA 3E0XA 5FA5A 4LE2A 4GTSA 2I62A 2A57A 1XMSA 3V1NA 3HABA 3SBXA 3QVGA 1EFPA 3VA7A 4LJYA 3Q11A 3O21A 3I6BA 5AQ9A 1E6WA 1L3CA 3GNQA 2ZBEA 4QODA 4N0DA 1TW3A 2C5LA 5EMKA 3A8TA 3VZDA 3IJRA 1Z08A 4JT9A 2Z0MA 3Q5DA 1SVIA 3LO5A 4IV5A 4Y6LA 3AVWA 4M8NE 4DCJA 3EF0A 3LY8A 3MD0A 5LM3A 3ZWWA 1E2HA 3RC8A 2ZIGA 4PTYA 5H59A 4AX8A 1Y9DA 2ATXA 1I4WA 2ESRA 1TUBB 1A4IA 3TD6A 4FHCA 1RM3A 3CF2A 2W2OA 1NMSA 1ONOA 5A6VA 3DG9A 3RKVA 4JA7A 2GO7A 4UTOA 2YJ3A 4UMEA 2QLJA 2Z08A 3OOSA 5LD2C 2B4TO 3NKFA 3I9V1 5EOVA 4UU8A 1JHQA 3TXAA 5KOIA 4EATA 3BTOA 1Y8AA 3EFBA 1T9GR 3DQPA 2QYJA 3IQHX 4ZCLA 5K5EA 4ZVKA 5GPBA 4P7FA 4EG8A 1TQ4A 4JLUA 2CK3D 4OOFA 1EXVA 1D03A 4DILA 2DCPA 3UJCA 1U2RA 3MWJA 5DTMA 3UV6A 4YDRA 1A8HA 5K6TA 1SBNE 4B46A 1OZHA 2Y0PA 3O48A 3ENZA 1QZ2A 3IV9A 3LDGA 2Q8PA 3ND7A 1U2VG 3QVXA 2G67A 3WNBA 5D2CA 4FNMA 2M6RA 4F1SA 3PNQA 3RDPA 3I8XA 1UC9A 2ZROA 2BBSA 4XQ0A 4UAGA 3VO8A 2H11A 3LUKA 2YZNA 5DGXA 3KSQA 1K0UA 2P2LA 2V7XA 3IHLA 2OLKA 3P1UA 2P2YA 3KEZA 4OB8A 1VCMA 3FMPB 5MN6A 3QNUA 3V1TC 2HSEA 1YA0A 1QAMA 3FGOA 1IJFA 4KQXA 5GVSA 3OEWA 3OZWA 5JJLA 1JT2A 4A03A 4NRDA 1Y89A 1K06A 3KUXA 2VPPA 3EH2A 5TF4A 4JCCA 4DA6A 3WHIA 5LX8A 1BCRB 1FYVA 3GMTA 1HEUA 1CIPA 3FDZA 4C4XA 3B51X 3EC7A 5LP0A 2R85A 3VJLA 1NQVA 2V1UA 3ZYQA 1HG2A 2CY0A 5KJKA 3T5TA 4YCLA 3TLKA 1JA9A 4LBYA 4QWWA 4GMHA 3C45A 3P9NA 4Q66C 5KYUB 2IHYA 4WECA 2OMKA 3RVQA 2IS2A 2BFDA 2JGKA 3BCSA 4GGPA 3D8TA 1E18A 3B95A 3BFXA 4RJIA 1N94A 1NUTA 3IB6A 1ZD5A 3P4XA 3U66A 4XARA 1NX9A 3C8ZA 2NV2B 2WXMA 4AJ1A 3AM3A 1D4ZA 2L0IA 2GEJA 1V6CA 2MJLA 2A3RA 2GZ3A 2Q28A 3UBMA 4PC3A 4TTQA 3N8GA 2FW7A 2JLBA 1EGAA 1EXWA 2WWXA 2HO1A 5KYUA 5BSWA 1GKUB 3HUUA 4EG0A 2VN8A 4I50B 5EHIA 3W04A 1L7PA 3WLTA 1XU7A 1WF6A 4Q3NA 3VMFA 3MTGA 5JZBA 4H7XA 3K5PA 3WHPA 4ZEOA 1ZOIA 4AMYA 5EUCA 1TQ6A 1LEHA 4XVQA 1A50B 2E87A 3E8XA 5AOBA 4NDAA 3OOEA 2VPIA 4YJ2F 1OTYA 5JNSA 1II8B 2YL2A 1V41E 2K87A 5KNHD 1JIKA 1UAAA 5TQJA 2OV3A 2R1VB 3JQ6A 1IZZA 3UHPA 4GWLA 4OY3A 3RYHB 4TYWA 1OTXA 4MS4A 4XD7A 5HQTA 1U8YA 4QJBA 4X93A 2DC1A 1H6PA 4MVJA 5JMPA 4RK6A 3SJAA 3TL2A 2FV8A 5JIBA 1ZGGA 3FDHA 1SC1A 4DLUA 2PCJA 4WN9B 1OCZE 2BPOA 4MMXB 1MXFA 3ISTA 1CETA 3SZ7A 2GK3A 3OOJA 4XI9A 4AWXA 3ACDA 2YWHA 2AFIA 2R1UA 1UP7A 2BM9A 4ZAZA 2R1VA 3FU0A 1WPQA 2AQIA 1GITA 5AKJA 5ALKA 1UQUA 4JVLA 1RCUA 3N2LA 3UVEA 3HLKA 3RYHA 5CLIA 5CB4B 2G70A 3NBMA 4DS3A 4D9IA 3GR6A 4UHJA 4RY0A 3G2TA 2QUAA 1E96A 2GETA 1RYNA 4DG5A 1J9ZA 1YE5A 4DR7B 1SEVA 3GQVA 3R6DA 1CS0B 1JEEA 2PQMA 1XU9A 4ZT6A 3FCYA 1H8HD 2Z9CA 2ZAMA 1O95D 4F4DA 3QI7A 1Z0FA 5ALLA 4LC1A 2AMJA 1SB9A 2WT9A 2CHWA 1R16A 3AO0B 4MCAA 4Y6WA 2XUHA 1BS2A 4EKGA 1QO0D 2FKAA 1QQAA 1L7QA 2F48A 3MWEA 1K5HA 4Y6GB 3ICPA 4ZFNA 1FQOA 2O6HA 3FUDA 1XRSB 5CB4A 2X5GA 4UYJA 4KR9A 2J41A 3VJMA 4BBAA 1WLSA 4G3XA 3C1AA 1AQYA 5ALTA 4ZCTA 3DB2A 1YL5A 1CS0A 1KIMA 1GDDA 2Q6OA 2P35A 4KMMA 1MTZA 1E64A 4Q15A 4QULA 3HDJA 1FXWA 1CWUA 1IHBA 3LBYA 1EKXA 1LNZA 1G64A 2X0NA 2PANA 4ERNA 4ANVA 2WQZA 2OCKA 3OIVA 5B30A 5JD3A 5L9AA 1Y3AA 2FZWA 3HGQA 3LA8A 3ZJUA 2FZ5A 4XAQA 2I34A 3REQB 3CHMA 1NFQA 2Q62A 4EMTA 4CFSA 2Y1DA 2A7QA 2H07A 4IF4A 4MEJA 2C7PA 1IPHA 1RQPA 5J2TB 4J9VA 421PA 2WSBA 4EI9A 1HY3A 5E1BA 3GYBA 2F4NA 4HB5A 3NJRA 1L4BA 3TIVA 3T7KA 4I19A 3ZQKA 2YQ5A 2LCQA 3TSWA 2JLWA 4B94A 3N8NA 2XQJA 3IUJA 1J0XO 4EAAA 2O3TA 4V0NA 2WA1A 1V16B 1DBWA 1F8GA 3REQA 3WRYC 1FMJA 2P0YA 2Y0BA 3L7IA 1BDBA 4JDPA 5EWMB 1YZKA 1E6CA 1OU0A 5AJUA 3S44A 1ZJZA 2PKWA 4FFDA 3ZHOA 5J2TA 5L7WA 1G0NA 3H2ZA 4D9MA 3THYB 3FNHA 1QRUA 5I9NA 2WK1A 4UQZA 1Y3BE 5FTJA 1AGNA 4O4HB 5JI3E 2FP3A 4EO7A 3EJ6A 3QUCA 3NTUA 1GG8A 1V7ZA 4H08A 3A26A 4CT4A 4D74A 3FNIA 3PRYA 5I6DA 1NVWQ 3TS1A 1UODA 2JI6A 4HNAB 2X6RA 1ZESA 5DM60 3ZC3A 4MZXA 3TE6A 2ZG6A 5MN5A 4BX9A 3MRSA 1CW2B 3VKHA 3S7ZA 4GICA 5BNFA 4K0RA 5DGCA 3W9YA 3OPQA 2ODBA 2DERA 4C0EA 1KEUA 1T5SA 1SNYA 5EWMA 5GM2A 4I2WA 4I50F 4J94A 2M6LA 1G0OA 3THYA 5CDUA 2A9OA 2BIFA 4MVJF 3WYDA 5FQ6A 5CVCA 3BD7A 1SB8A 4RPKA 3LS2A 1E8XA 2X1MA 3HP4A 5C37A 2C0PA 3KTOA 4RXTA 2Z5FA 4BX3A 5HX7A 2FYTA 3OJWA 3OTIA 3QG5A 4JA0A 2FPWA 2IIPA 2XZTG 4XGIA 3KXDA 3GA5A 2B30A 4WXHA 4E30A 4GLBA 5DN6A 5DM0A 4NOLA 5F1PA 2IUTA 3IXEA 3VPXA 3NALA 1UOPA 2RHDA 4HFRA 4LXIA 5J4VA 3SICE 1RI1A 3QBVA 1ZMOA 2FLKA 3NHWA 5DTIA 2JIBA 3UPUA 1VYTA 2Z83A 1SG9A 5DXFA 2ORED 3V8PA 5AQ7A 2Z43A 4JUFA 3K4PA 3I23A 4LYEA 1O5OA 2D7JA 1IYGA 3SHTA 2O5RA 4OI0A 1CP2A 4UKDA 2J6HA 1OBFO 2B7BA 2Z98A 1XB2A 4Q39A 3CA8A 4L95C 5EZYA 3HA5A 2CXOA 4UAUA 1Y98A 5KQPA 1E9DA 3EFOB 5L3QB 1R6XA 3OM0A 1N6KA 3FUHA 5EEHA 3UI2A 5TRTA 2JLSA 2MSLA 3KKMA 4DLXA 3MNFA 3UF0A 7MDHA 2B78A 1DX4A 1WMFA 1ZEMA 2MYOA 4JBGA 3P2OA 4WOCA 1S3SA 1U1IA 3R76A 2R1TA 3WQSB 4QTYA 1XD2A 4I1UA 2IITA 4ZV7A 2VRCD 2F9LA 4P4NA 2VSYA 1SUFA 4JGIA 5IEJA 2C4TA 2PIAA 1UDCA 4JUBA 3EFOA 4TVSA 5K3AA 4OHWA 4IIFA 1OT5A 5FQNA 5A3JA 2XPYA 5KTMA 4D8XA 4G2NA 2X2OA 4J8DA 5EL0A 3GFQA 3K6JA 3L0CA 5FR1A 4DZTA 2Q1WA 5HFAA 4NCHA 3OIWA 2JANA 4KIWA 5FTPA 3VZRA 2XZPA 1KRHA 4IUDS 2H6EA 3OWHA 4BP3A 3LM8A 4B09A 3FR8A 3HNOA 4H3SA 3LKZA 3WRWA 1E1MA 4Q12A 1ONNA 5H83A 1USKA 1FW6A 3K92A 2XNHA 1BD4A 3TVTA 1ZOOA 3EX7C 3OF2A 4ZALA 4KH0A 1JWGA 3ADOA 4FINA 2JFNA 3ZQ4A 4BN0A 1X4RA 2QMQA 4AKEA 2PGNA 3LLMA 4GZ3A 2ZJAA 4JL6A 3GUHA 4X7RA 1IN8A 1ZQ1A 2G1JA 4Q7JB 1UPAA 2BV3A 3FF4A 3U80A 1C9YA 2RHMA 3IAM1 4EY4A 4F3YA 4N3NA 3ESXA 1PTJC 2J3EA 3S1SA 3W9SA 1OROA 2AR9A 2OL4A 1NVMB 2JH3A 4TM7A 2RFMA 4I6EA 5CUQA 2YJZA 3WV5A 1DMSA 3KD3A 2J0VA 3FCSB 4D96A 4IJVA 2NUAA 1ENOA 1YK0A 3M6AA 1G8MA 5CNMA 2ZQZA 4S05A 1PFQA 3FNEA 4HDQB 1N5IA 1U0GA 4F4IA 3GOHA 4O4LA 3HV0A 4HWSA 1J5XA 4LOJA 1QONA 4O4HF 1XALA 4ESVA 2JLYA 4J0FA 4HEQA 3NAWA 1H0SA 1XMJA 4XWOA 3FFLA 3JUEA 2QU7A 2DK6A 1L8AA 3ID6C 4H4CA 1HFEL 2CLSA 1Z8DA 4MV0A 3GAAA 3WAJA 2G08A 3TIFA 1QTRA 1X3SA 1MMFB 3DAOA 1LJLA 3DPSA 2AQHA 4O4IF 3JQ0A 4XEUA 3IE0A 3U7GA 3SKXA 3VJKA 3KUCA 3AU4A 4OFZA 2G9QA 4RZUA 1U3TA 4C78A 5D87A 1SCIA 4XD2A 1EGMB 3FZNA 1K7XB 2EZ9A 3RW9A 1F3LA 1TNZA 1E3EA 1HT1E 4BLRA 5A4JA 5J47A 1GRVA 5ESWA 1LRLA 5HS0A 1I7SB 4J8EA 1PO7A 3JXEA 2C99A 3CRMA 4R7GA 2DPGA 3AV3A 1UIRA 2HPVA 6LDHA 3OAAD 3H2BA 1EUYA 2F1RA 3RBAA 2G0NA 1JHYA 3EOZA 4HLNA 4NIMA 3CYFA 3K9GA 2PMKA 2RH9B 4HDOB 1M2NA 2G40A 1CVRA 4INAA 2WF6A 2XNDD 1IBKB 1DEXA 5BVHB 3U9WA 4KQMA 3WMXA 4FB5A 3G9QA 2BKGA 5MDHA 4B3BA 1KAHA 3VR4A 2VZ8A 5DK6A 3BGIA 2LZ0A 1G4AE 3HV2A 4LNBA 4B8WA 2O8DB 4MGIR 2P9HA 2ZSKA 2DPMA 2YMMA 1TCCA 1SY7A 4IMIB 3QITA 3DXYA 4X0EA 2P91A 3DPUA 1N5JA 2Q49A 2PIDA 5F5XA 4RVCA 2BTDA 5IYZB 3PXXA 1EDUA 2LAHA 1ZXLA 3KETA 1ZXBA 1BDMA 5BVHA 3CO0S 2HGSA 3ELDA 1Z7GA 3UMGA 2V8SE 2WIKA 1XV5A 1YS4A 5MGBA 1B6GA 4ENTA 2IP1A 2QRVB 5F7OA 4LY3A 2QYSA 5AOAA 5A7DB 1F1JA 2HA5A 1UAYA 2O8DA 2HEGA 2O7SA 5JSUA 3GH1A 4QFBA 5EJ8A 5JS1A 1NV8A 2PSFA 3LPMA 2CD9A 3V4FA 4LQLA 5MF6A 5U4QA 1N2CA 3WL7A 4BNWA 4BP1A 4RHTA 3FMIA 4KU4A 3AC0A 3FTWA 3SK1A 4FR0A 1R9NA 2WUWE 4Z7NB 5IYZA 1FDTA 1NTOA 3WMFA 1NC3A 4W9MC 2IY9A 5FOUA 2ZTVA 2XBUA 1DKPA 3AUTA 1YAJA 1XUOA 2BUGA 5K3OA 2G9VA 1N5KA 5JROA 3B5EA 5LUBA 4WZBE 1WNTA 1KY4A 4C4OA 1EWQA 3MHTA 3LYAA 1UOOA 2PAFA 2AL7A 2Q4EA 5EJ4A 2HIGA 4HI9A 3VJRA 3RSOA 4OG2A 4R0MA 2NU7B 3ESCA 3APFA 2EFEB 4C7BA 1CG6A 2B3DA 1P91A 2VXYA 1TI7A 3WLOA 4PCUA 1U8EA 1Y5LA 4Q00A 4ZZ1A 3DF9A 1GU0A 4TS4A 1BMQA 3U60B 5TSDA 3IP5A 3AL3A 1ZK2A 1BVYF 3V7FA 2PWPA 1JZQA 2Q5JA 2GDJA 4KPYA 4QDZA 1N6HA 4FMBB 2HK9A 1L7AA 4OGFA 3Q7SA 2R0QC 2MINA 4YUVA 3WNCA 3BILA 1H94A 4HT3B 2NU7A 3JQ8B 2DPLA 1Z2AA 1MH9A 3RI3A 1CY4A 2P6OA 1UC8A 5C9ZA 5AXAA 1N8SA 4QVIA 3V6LA 1IN7A 1Q0PA 3OWOA 4RHUA 4M9RA 1K88A 5JXJA 5EIOA 3B85A 5AHWA 1THGA 2YDXA 3NAGA 3M33A 2ZYHA 4ZTBA 4M37A 1L1FA 5CDFE 3U49A 3OUUA 4CL3A 1ZD1A 3ONKA 4DG8A 5D84A 3CQ9A 4BEJA 3DE0X 3T9BA 1TJ3A 4L4RA 2MOKA 3LF1A 2IU3A 1SIOA 5A7GA 4BUCA 4TRJA 4JLWA 3PC8A 3I0NA 1E8WA 4N0EA 4IHAA 4Q3OA 4EK9A 1RXIA 1N54A 5KX5B 5FBRB 1KI3A 1JHZA 3U4QB 2P58C 2AIRA 3C85A 3R8CA 3G89A 1KWGA 1XA3A 2ZSEA 4ZVRA 1Z2OX 2YVKA 4ZTZB 4J0GA 1SU6A 3JVIA 5HMMA 4ND1A 2ZE5A 2HC9A 1CJVC 3LCUA 1CK4A 5EIDA 4X6LA 3I5MA 2ILRA 1EDOA 2W6NA 2GYVA 1B89A 3NFYA 4DPRA 3J81A 1UBLS 1ISFA 3FZQA 3L02A 4J2HA 5KX5A 2QMHA 1ECLA 4R69A 3IS3A 4DMKA 2FQ1A 1EXNA 1W7AA 4Q1FA 1LDGA 1JZTA 5JECA 1ZZGA 2ZCUA 1QVZA 4QDOA 5E38A 2W6IA 2YUIA 2GO1A 4Q16A 5HM6A 3R0IA 5FWAA 4AKHA 2V6BA 3EUAA 1NJ5A 2YNMC 3VR5D 3SFTA 1ZVMA 4ZYXA 8GPBA 1CUGA 2FRDC 2VDPB 1KPHA 4ODIA 3UUGA 3IQWA 5CNKA 2EERA 2GD0A 2QX9A 2FFAA 1EBUA 1XCJA 4BLVA 1BVUA 1Q7BA 4CLXA 4BZWA 3WGHA 4CHGA 3EH1A 1I3OA 2ZAGA 1PJ8A 1XDGA 2HLDA 1TPZA 3IQDB 4Q1VA 3PIRA 1J00A 3DDNA 1XZ8A 4J0QA 3SIPA 4FB4A 1TN7A 3LLVA 3U19A 1RRCA 4DYHA 1OBOA 4I1YA 4XKJA 1KZ1A 1IRXA 3KQVA 1LVGA 2R02A 1JKJB 4MI6A 3AJ8A 4QYSA 3DEFA 4B4OA 1ZBPA 3OJCA 2OC9A 3CLKA 1O3YA 1DAMA 2HT6A 3T9AA 3FIUA 4LRYA 1JDPA 5EIHA 3U64A 3JQBA 4U39A 2EJWA 5ICGA 1GVHA 3ICOA 3N2KB 3EGXB 2R5NA 2V9CA 4TMZA 4TS3A 3VHRA 3PUKA 4CKEB 4D9JA 1WMBA 2W2NA 3G0DA 4PN3A 4YVFA 5IVIA 3I3NA 4H7KA 1YQTA 9GPBA 4DNQA 3IIJA 3T94A 1MG0A 1TYEB 1XLWA 3Q10A 4BWRA 3Q3HA 3R1IA 2AWIA 1JKJA 3FOAA 4GXRA 3OOHA 2HLPA 4HJXA 4JP5A 3PX3A 4AVYA 2FMFA 1CZKA 3GLRA 4YUYA 3QF7A 1GPBA 3TQTA 1F0PA 1NVXQ 3WS7A 3NHKA 1Q3HA 3RWBA 1AV7A 3D4LA 1M34A 1U8ZA 3N2KA 2H4HA 4R4JA 4CKEA 2H7YA 3IELA 4HV4A 3U3WA 1AZTA 3L4EA 4KLZA 3F0TA 2P6PA 3CNLA 1K9SA 2JD0A 1T35A 4IM7A 2IXGA 4HRNA 1VBNA 1AKNA 1D9ZA 4MS3B 3B52X 1UMCA 2WHXA 3V3KA 2GN2A 3ZCVA 4EA8A 2PH3A 4NE9A 1A4UA 4KODA 2FCRA 1ORVA 2BKVA 2C2KA 4B5KA 2H0RA 5F4ZA 1NJ6A 4LG1A 4PNEA 3VTAA 2UUOA 3FTQA 3ABLE 1SVUA 3PCXA 3ZHVA 1WY6A 3AR8A 4TLDA 4ZT2A 3CZ5A 3P5SA 1W2HA 1YZHA 3HNPA 1GNLA 3L6BA 3RSQA 1XROA 2C5BA 5KAMA 3DSSA 2JFFA 4CV1A 4MS3A 1AJEA 4X8HA 4FOOA 3SX4A 3FHEA 3KTAB 5DHRA 4RH1A 1J42A 4D9EA 1MW8X 1KBZA 1CQXA 5AYWD 3ZWKA 4QUIA 5JZOA 1I7QB 2R44A 3O6VA 1V6SA 1HT0A 2Y1LA 5DTQA 1KPIA 1X7ZB 4G0QA 2VAVA 2OO5C 5EIEA 5JXIA 3PDWA 1XEXA 2JGRA 2XQVA 2I3BA 1G98A 1TRHA 3OZTA 3AI7A 3ET5A 2YCBA 3DGFC 4MUEA 4B2PA 4J1TC 2KLBA 5DHSA 2A3NA 3VBCA 2I2AA 4E31A 3FU5A 2I4IA 2Q50A 5DIFA 3FSEA 4WOBA 5HDQA 3VOTA 5G1NA 4LF7B 2M98A 2FPLA 3FOCA 3K0FB 2FXIA 2QTWB 4N9QA 1M1XB 3JWJA 2A84A 1MQ9A 4P5EA 4OJKA 3NUQA 3Q72A 2EW2A 5DNEA 4DXHA 5U9CA 3MJDA 4QKQA 2V9PA 1X7ZA 1PEDA 4K05A 5ALIA 2FJAB 2FRVA 2PM6A 3O38A 4CF6A 1JGTA 1EE9A 3P9QA 2TMDA 3CKCA 4R1QA 1JYEA 2ISSD 4DLBA 4M0KA 3IVRA 2ZTHA 1FLNA 3OLCX 3RQIA 2VUSA 2ZPTX 5ISMA 4TMKA 4ZPXA 1IVSA 1IOVA 4UUNA 1NMXA 2FK8A 3TX6A 3JYNA 2I6FA 3H0KA 3ZY2A 4D42A 1TDJA 2FWJA 1FDRA 4FN4A 4W1SA 3CVYA 3QWAA 3ITWA 4TQGA 2GSDA 3SF4A 2BR4A 4NQ0A 5AKXA 3K1ZA 3TM4A 4QWMA 3DL2A 2AGVA 1Q1AA 3BEDA 3CX7A 1SW6A 3GDFA 3A6DA 5CJJA 2OR3A 3BRCA 1CRZA 3PPYA 1GNSA 2RCYA 1NQXA 5EQFA 1FNNA 4J49A 4G1VA 5HP4A 2JBHA 3OM9A 2HPHA 3AUKA 1N1EA 2C2XA 3ZWDA 1LQTA 2FMUA 4A8JB 5DWVA 1XL0A 2H8KA 4N0QA 1TM7E 3HCAA 4CL2A 3D0QA 4INPA 1HDXA 2VQ6A 5I7EA 4PZ9A 4AG3A 4FQ5A 1QTNA 4L5JA 5ADUS 1STOA 3ZQJA 4QO7A 1PEAA 4HEHA 3RIXA 1HO8A 1M7HA 3IQEA 3USCS 3DOJA 1SUWA 2ZLBA 3CKBA 2O8CB 4UTPA 4NE2A 3QSGA 3TR0A 4G6ZA 4UU7A 1NR5A 3TDNA 3TNLA 3VVCA 4D41A 2WWHA 4GVLA 3SR4A 1AWCB 5JRDS 2ZJ6A 4JVSB 3VU8A 1PR3A 3HMKA 4U2GA 4FYVA 1VHQA 2SICE 2XDYA 3IODA 4A8JA 3ET4A 1P5ZB 3HYLA 2H16A 4KX3A 4OA8A 4MNTA 2X40A 1QP0A 4BFTA 3TSCA 4HWKA 4DRXB 2I1KA 4RULA 2ZXUA 3WYGA 1S1CA 4DLNA 1HFWA 5A6CA 1OREA 1Q57A 3EDOA 4CLHA 2DYKA 5ANRB 2CJFA 4CMIB 3PQ2A 5FA6A 3VVMA 4GOJA 4Y1EA 5J59A 1QBQA 4PLCA 3C7KA 3EFHA 5HZKA 2GM9A 4HQLA 3H9JA 5BNIA 4JVSA 4F3RA 4Z86A 3FIJA 4CTKA 1N57A 2RH4A 3CX8A 4R41A 3RQSA 1ORRA 2CFSA 1RJFA 3FZGA 4G5YA 2EL9A 3ZI7A 4EJSB 5IKPA 4DRXA 3SCZA 3FTXA 1E5XA 3RC3A 1TKCA 3MCXA 2FMXA 2XXAB 1EX7A 3TWSA 3MYRA 4YCBA 5BN1A 4Q9AA 2EJBA 5FBVB 5ANRA 3KWLA 4MUNA 3OT1B 4EB3A 2P30A 5BMVB 4DNXA 2Q4BA 1EHYA 2A8YA 3TUZC 4REQB 4PINA 3SZMA 4Q4CA 4X66B 1M0EA 1HSZA 5TMDA 3AVPA 4AZ3B 3HVKA 3ZHRA 1CUZA 1JDUA 5T41A 1N5LA 4KQCA 4R1SA 4MUKA 3NTVA 3JQGB 4EJSA 4CKXA 1JKMA 1GZSA 2J8SD 3QX8A 1WXHA 2PK3A 3IEVA 3KQNA 3E23A 2V7QA 5F9MA 3AGPA 3OLVA 4XX5A 5CLGA 4DWOA 2D0IA 3OT1A 4RFVA 3I72A 5BMVA 2QTMA 4LFCB 4ANXA 4U6QA 1Q5PA 2ECKA 2IU6A 3BIXA 4OXQA 3LL4A 1E6EA 1RWQA 3KLBA 2PZ8A 3HCWA 1XVIA 3IA7A 3VOBA 3EG5A 4FOTA 4AZ3A 3HRKA 3TJPA 5BUSA 1K0FA 4I9HA 5JH7A 3DWIA 1UDWA 3JQGA 2QY6A 3UANA 1NBMD 1N5OX 3GB9A 3QPBA 1AHPA 2WUVA 2O57A 4HUJA 4UBIA 4LK2A 2YIVX 4HDMA 1W46A 3RVNA 1PZEA 4C88A 5EIBE 1Y1KE 2W58A 3QBTA 3OQHA 2FO7A 4HVBA 1RTKA 2C2GA 3O9MA 4NRHB 3OFSA 1FYFA 4D81A 3CPSA 4YAWA 3V55A 2BMVA 3RUPA 2CFTA 4S1TA 5C8YB 4QGBA 5DX8A 2O5CA 5IBRA 1A71A 1PT6A 4UTVA 5KNGA 4GCOA 2IF0A 2DX7A 5EJIA 3RLIA 3PP8A 4HAUA 4CR7A 1JR3D 2V6MA 4BQOA 2NO5A 3ZGLA 3NUZA 5JAUA 1LLUA 4WCVA 5CT8A 5TLSA 1GG2A 3G5AA 5BXOA 1E8DA 4JHJA 2HSGA 4P82A 2YIMA 4Q7MB 1VQ1A 3PNMA 3EA0A 1TTQB 1U8AA 3WGOA 1N0IA 5B1AE 1Q91A 1KETA 2IE0A 4LRTB 3RJ9A 3ESAA 4Y2XA 4G5GA 3C0KA 4KR6A 5TGTA 1F48A 1NNEA 3TQRA 4G4IA 2VKTA 1E9EA 3T4UA 5C8YA 1WB9A 1RKBA 1KFBB 1MX5A 3IAS1 4GBGA 4FM9A 1UOQA 4D46A 2BEUB 5AM1A 4MRVA 5HBRA 3ZWPA 2QNBA 4AKXB 1KK1A 3W5SA 1M2HA 2I1QA 2V7BA 2YDYA 3VSCA 5IC6A 3B3GA 3LX6A 1L4NA 4ZDKA 1SM4A 3MCAA 3CX6A 3CINA 4MQBA 1PT9A 2VP6A 4WWNA 2O7NA 3O8BA 2UVPB 3K09A 5LKRA 5J4KA 2OM6A 1DXYA 3VTFA 1KI9A 3L82B 1SKYE 4EG6A 3LYHA 1DRVA 1W0KD 4EG7A 1ZD9A 3R6GA 4QPNA 4JHKA 3QVGB 2IBSA 3BF7A 1IM8A 1R0CA 3O1IC 2QYOA 1RXYA 3K73O 3D8BA 2R2LA 3D9MA 2BEUA 2AD1A 1SUPA 1B26A 4NK4A 5J2UF 3PGVA 4TTTS 3F6BX 4RU1A 1AZLA 2JRCA 1WG0A 1RJ9B 4YMHA 4FEAA 1UXHA 2ZRPA 1WDMA 3MGBA 4UATA 1JKIA 4XFJA 1IHOA 3GC6A 1X1DA 4GXTA 4NZ9A 2ZUTA 2HREA 5KNBD 1Y3FE 4OLFA 1E0KA 3BJEA 1V9LA 1KC3A 3DMFA 4OM8A 4L9RA 4PH4B 2HXSA 2NZWA 3TIIA 3TWXA 3JRXA 2FG6C 1OI3A 5JYBA 1GA6A 1M33A 5AW8A 3BULA 1DC3A 5GADl 3N28A 1T43A 3KQSA 2GBLA 4F7DA 4PPNA 3EBLA 2Y27A 4N01A 2WWVD 3FCXA 1U9IC 3B6MA 1RJ9A 2ZB7A 1UDAA 4ARBA 2HRCA 5SYAA 1OWOA 1GPH1 1NUAA 3ROFA 2XCLA 1RACA 3MUOA 2HCRA 2O14A 4AN4A 1WE2A 1JWAB 2V4LA 4KAAA 3GJ7A 4BCBA 1ELKA 3NNSA 3E7XA 5F21A 4MVXA 1WIWA 4R7ZA 2Y76A 3O4JA 4AIIA 1Z22A 2OA0A 1H8HA 1FFYA 5KNDA 4IIYA 1SD1A 1O95A 1E7UA 4H77A 1NUQA 3DZCA 3AI2A 3Q7FA 3NHMA 4GRDA 1P9NA 5EHXA 4OKNA 2Y0DA 1Q7CA 3BMQA 5CIQA 4JBHA 4GSKA 5THXA 3IQFA 4E03A 5BQXA 1FSZA 1ZNXA 3S70A 3CW9A 5AKHA 3HL4A 3FUWA 2CLEB 3DV9A 5EGSA 2XGGA 5AW0A 2AA3A 3GZJA 4M0DA 2QAGA 3U81A 3ZNQA 2HWWA 2GHTA 3ENVA 1XWFA 1U02A 3NHPA 1WCWA 5ICCA 4G5QA 3FUMA 3C39A 5JZVA 3MYVA 1NW5A 2P4HX 4EFLA 2CLCX 2QMYA 3VVBA 1U8UA 4A2QA 1TRKA 3UKRG 5IX8A 3I5UA 3AP1A 1NQ5A 3KSDO 3NKLA 3EHEA 3FDZB 3H83A 3OM1A 2XWPA 1M2EA 2XIJA 2E3JA 4CETA 3TD2A 5KNCH 2HJWA 4QUBA 2CLIB 4RM2A 3PRZA 4FN5A 4EJ0A 2UKDA 5FWQA 1ZJWA 1JHRA 1SH7A 2GJKA 3CONA 3L0ZA 2F8YA 2BFDB 4MVJI 1TJCA 2XUJA 3HKEB 4YNBA 4BLUA 1X0XA 3GZ1A 1J1ZA 5EJGA 3FSGD 4JP8A 2XRMA 3TTYA 4MPPA 2E37A 3DBVO 4A1OA 1A4XA 3OIFA 4JOSA 2X9NA 4Y9RA 4WGGA 1LRKA 3BZUA 4O3FA 4GE3A 2IGTA 4XSVA 1GRNA 4P0QB 3VSDA 1X19A 4TUYA 2XYGA 4IMRA 1E6UA 1ZIXA 1UFRA 1VRVA 3C3JA 3BDVA 3EW7A 1X2BA 1GAEO 4EHBA 1GY8A 1T5LA 2XGMA 4O2BB 1Y9JA 1U7UA 3HKEA 3NBNB 4JX9A 3PLNA 1QGAA 3FLEA 1BQ4A 1O97C 1C7QA 1K7SN 3E9DA 5ADWA 3BXFA 5JCJD 3QB2A 2PR2A 1V11B 2QTRA 4X84A 2X5TA 4K6KA 3ZYZA 3K35A 3TFWA 2JJ2D 4YR7A 1TT7A 1C3OB 1USVA 4EHIA 4RE6A 4H31A 4QRHA 1EP2B 3SC6A 3V2HA 4AJ9A 4MRNA 4KOAA 1QYCA 3WLJA 4M2LA 1UPUA 4IDQA 1PZFA 5IN4A 4MS4B 2F6RA 4O2BA 2JH8A 5K4HA 2WVGA 1A8PA 4N8SA 4Q9HA 5JY6A 3OKAA 3U3RA 4APFA 4B8CB 4DA8A 2I03A 3WLIA 1WZUA 5AHOA 2J5BA 1U7WA 3CTPA 1UJNA 5JSHA 3KAJA 3LUBA 1V11A 2PJDA 5DWDA 5C4MA 4FYYA 3EGIA 5B36A 2W6CX 3GX1A 1MB9A 1NV9A 3VTZA 4B6RA 2AFIB 3IPAA 1C3OA 2AXNA 2O6LA 4Q3AA 2UZ4A 3PDJA 5F33A 4YRBA 1QVAA 1JCQA 1AP7A 4TTIA 2EFYA 1SMKA 2J9RA 4G65A 5SZIA 3GYXB 1IUNA 3WP1B 1GT91 3K20A 1ZI6A 1TUGA 3EXHB 4ND5A 3VDQA 3HC7A 1E96B 4NHEA 3DDHA 1ZH8A 2GKSA 1EP9A 2C4WA 4PZZA 4Q18A 3GP3A 3QLVA 1FCJA 4ZXFA 4GR4A 3G8YA 2O23A 3ECAA 2PD4A 3EC2A 4AKTA 2EV9A 2J9ZB 3PQ7A 1PD0A 2GPAA 2VUTA 1INLA 3RS0A 3DLPX 3MWEB 4BKRA 4B8ZA 5LZ2A 1LK5A 1R74A 3NHJA 5JHAA 1AIPA 1PL0A 1V2GA 5AJVB 2REOA 2O20A 4UYJB 3EXHA 1T25A 1BH2A 3TQQA 3O4IA 3N0VA 3MIZA 3KL4A 1XYYA 3CLHA 2YKGA 1U8FO 3A1CA 4MUBA 3BGSA 1A3CA 4HHEA 3MWKA 5T67A 1DRWA 4JYPA 3EMKA 2OHHA 4MVJE 3WQQA 4XCQA 1KMMA 2WB2A 1V5EA 1XJ0A 3OLYA 2BM8A 3IUYA 2YICA 1H05A 4PS3A 3TRKA 2PMDA 3OUTA 3ZJ4A 1M10A 4C7JA 5KVSA 3UGQA 1T1JA 3WYEA 3TRJA 2QF7A 1NRJB 3CLSC 3D6JA 1WDTA 5GTDA 5A9TA 1A7AA 1LDBA 1B6TA 1N36B 4J8SA 5L4SA 2IEGA 5D6OA 1S0PA 1K7CA 5HJ7A 4PPFA 5DNWA 2WC1A 2DHCA 4P31A 3ABRB 4IUYA 3PEFA 2HT1A 1PK7A 1QZ3A 2CCGA 1G7CA 3P2KA 3T7EA 1KZGB 2VOJA 4OXNA 1ZRNA 1VFPA 4RPJA 1NY6A 1GR1A 2G9RA 3LUGA 2RC6A 4CG3A 3U26A 1Z6TA 4BVJA 3EJNA 1E60A 2W2QA 1KI6B 3X1KA 3A3KA 5DWQA 3CKKA 1JYSA 4MR7B 4K40A 4LGCA 3CNNA 1M0WA 3H4TA 4JP2A 3WDSA 2OCPA 4C0MA 1S8NA 1BHJA 3IR7A 3QXSA 2D3TA 4MIYA 5D3MB 5BV0A 1YFJA 4RVHA 1TN8A 2H52A 1JHUA 1KOJA 3WGJA 1ZK4A 3URMA 4CT4B 1XAIA 4KP7A 3RREA 1XYGA 3ZTTA 4EHMA 4XTRA 2WAMA 3SXPA 2QN9A 4UVIA 4XTCS 2Z95A 1CB7A 4E08A 5AW3A 3K6KA 4PVCA 1KI6A 3IBSA 1TYCA 2Z8ZA 4RTMA 2FEAA 4MR7A 4NYIR 9ABPA 3QBDA 4GSLA 1HDGO 2CHXA 4B6OA 1KSGA 2WSLA 2NMVA 3DV0A 1UWLA 2FVYA 4FE4A 4JVNA 2DFKB 4L57A 5ILQA 5D3MA 2V5UA 3LEWA 1WF3A 4E5KA 3I4FA 3CHRA 3LQ2A 2WB4A 1GG9A 4X54A 1G5IA 3Q9UC 3WVNA 1U6KA 3E0QA 4M88A 2EX1A 4AMGA 2W7TA 2ZYUX 4R2XA 3WXMA 3TWWA 1QB8A 4B3TB 6ABPA 2ACVA 2UAGA 4RMGA 1T34A 5H0IA 4EIWA 1O0BA 3SP1A 2WIFA 4D9GA 2QLMA 1YV9A 1O1SA 2Z9DA 2VUHB 5J3JA 4ENWA 1YA6A 1MRNA 1U0JA 2HYDA 3GZTB 3CEJA 1G8YA 5K01A 3N74A 2XOXA 4AS3A 3EVGA 2DZOA 1BXGB 3SJCA 3P32A 5KMGB 1XVTA 2QTVB 3NUGA 4AVXA 3W4IA 4FHJA 1E2PA 3O84A 4AEZC 2PHZA 4MAFA 2FPOA 3RT1A 1OFHA 3HBFA 3WRXA 4DNFA 4GMKA 2F3PA 2Y69E 5HDBB 3DYBA 5EGNA 1TF5A 1RVV1 4KQFA 3CLTC 1QRTA 4Z54A 4U02A 1E2FA 1KY2A 1QYRA 2OV1A 3F9RA 4BC0A 1Q1EA 5EZYB 3BSFA 2VG8A 4JYBA 3ZU6A 1QIKA 3WADA 3GD7A 3T6KA 1XZLA 4XJSA 1XF1A 1NKTA 2A9PA 1QZUA 1ZC4A 3PIIA 1QO9A 4GVXA 2Q5FA 3OAAA 2VDKB 5K45A 1BXGA 3BL6A 1KZHA 5KMGA 2QTVA 3DULA 1GGJA 3P4UA 1J90A 3L3BA 4PE5B 1GGKA 3VLEA 1ML3A 3H7AA 1WM5A 3MKRA 3RTAA 2GXSA 3OC6A 4PLWA 5SYMA 1XQ9A 2QE7D 2WG2A 6AT1A 2NC9A 2IYSA 1NJSA 2R1TB 1BW9B 3KB6A 4PFSA 4DN6A 1XD2B 4OFWA 1I6LA 4JUCA 1ORIA 2PRKA 3GGCA 1CUIA 5ESRA 2XCOA 1E7YA 2C20A 4GYOA 3T1QA 3IP3A 5BYJA 4TLAA 3SOZA 2ZYWX 4ZIRA 3QW2A 2GVDC 5A7HA 1FY2A 3M5PA 4CG0A 2I4TA 2WXFA 3SBSA 1S8FA 1KYVA 3JVUA 2V7UA 5ADHA 4KXXA 1QZXA 4E3WA 1C0PA 3FD8A 4FADA 4N54A 3UENA 5CB4F 1Y80A 1XNFA 3O0TA 2P9EA 3ZE7A 2Z4SA 1P18A 3L4BC 3LBIA 3N53A 1EUZA 1Z4PX 3N5KA 1EVKA 3LCVB 3E30A 2IHVA 2W2KA 5HF8A 1BW9A 3LDZA 3PZDA 1YWGO 4KNWA 2W90A 2YINA 1GZ7A 3LRXA 3KR1A 1FXWF 3MMPA 3PFKA 3KX2A 1G41A 2AW6A 4ARIA 4CF7A 4C0XA 2QYTA 4ND6A 1JXAA 3EMVA 2GEVA 3TL6A 5FOXA 2F43A 1AK1A 2M1XA 2R7AA 4NYMQ 4PG4A 3E61A 2VYQA 5DHUA 4C5CA 2OSBA 4QDJA 4ZVTA 3G68A 4IH9A 3QHQA 2XYQA 2PS3A 2XLCA 3ZWQA 4XYBA 1BD8A 1HZZC 4NEQA 1KU0A 2ZATA 4IUCS 2B0CA 2IHTA 3HCCA 4GTOA 2P68A 1CUYA 2JLAA 4NV3A 2HE0A 2GM5A 4KO1S 1CUEA 1PJTA 2ZEJA 3TRDA 1NOJA 1A5BB 3HKDA 5FHQA 4JI3B 5JC1A 5EP2A 3RS5A 1YFLA 3OE7D 2I6TA 2QNIA 4B32A 3A32A 2OV4A 3DDZX 1F2UA 3CJTA 2NUAB 5DGHA 1FNBA 3TQSA 4J0CA 4JR2A 1E3DA 4ASUD 5KJEA 3K9IA 2VCYA 5J2TF 4N6OA 3E3MA 4O4LB 3OJ0A 4QAQA 4C30A 1O4WA 5JNUA 3PXUA 2D5BA 1T15A 4H15A 2KM1A 4D2IA 2PXCA 3Q7TA 1HU3A 3QEAZ 3AH8A 1Q11A 1RWKA 4DRZA 1ZSNA 3H6GA 3ZKAA 2FDRA 1EI9A 2WTNA 3WFIA 3TDMA 3OKPA 2OOKA 5E8JA 4JA2A 3VVLA 2PA0A 3CNOA 2X5OA 2BM0A 3P9KA 1KKLA 3WLNA 1V3QE 1I32A 2JHAA 2OLEA 3ZDZB 3K71B 1FOEB 4BVEA 2UYYA 3IMKA 2F3RA 4HD8A 2QMZA 2EIME 3JCZA 4BQSA 3SFYA 1VG1A 2F59A 3N7TA 5DSZA 3BEOA 2XLBA 2XWBF 3DOEA 1F7UA 3MRVA 4R3NA 4YT4A 1B4DA 5B7PA 3DZJA 1HX8A 3P9SA 4XSGA 2AOUA 1BIFA 4QDUA 1KJ9A 3S2ZA 5DZSA 4H1VA 4DJEC 3HBJA 4HWTA 4F9GA 3RNOA 4KZCA 4FFPA 2PYDA 4TWAA 1LPMA 2WWFA 2ZETA 1IM2A 4FCWA 2OEWA 3R0QA 3WP0A 2DLNA 3PDHA 3OESA 2QTTA 1DEAA 4Y0VA 4Q94A 3ZN2A 1U28C 3GA7A 1S2IA 5EZYF 3AM4A 3SX0A 4IDBA 4MO2A 1NXWA 2VJKA 2WVHA 4DMFA 3B1KA 2H7VA 4LJ4A 1CRWG 4N47A 1FJHA 3ZN3A 4HAOA 5FL7A 1ACLA 4HVAA 1GTSA 5F7XA 1US8B 2OQRA 4BLWA 1D2NA 3ELUA 1NLFA 1ESNA 3T7IA 2FSGA 4KC0A 3DAGA 3E3NA 1YMVA 1EE2A 1ZH6A 1CFZA 3T7RA 221PA 5KJMA 3UJBA 1OGJA 2ZM6B 3QTLA 2EL7A 4R2KA 4TSFD 3M8KA 2PZIA 3M6MD 2Z8XA 4ARZB 1MT0A 4OVKA 1F8YA 1GM5A 1MOZA 2RAVA 4GI1A 3GGPA 1DU4A 1US8A 4JXKA 4F1JA 4WD3A 4PLHA 2XJ4A 4S1WA 1JHPA 1TGVA 4PLVA 3QNMA 1PW7A 1OB2A 3OQMA 1FZTA 3WLPA 1N2CB 3HBLA 4RSMA 4NP6A 1GJRA 3U7JA 2ZIZA 4TXMA 5LZ7A 5KYTA 1DEOA