The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
22
|
sequence length |
94
|
structure length |
91
|
Chain Sequence |
ASLKEIIDELGKQAKEQNKIASRILKIKGIKRIVVQLNAVPKIRYSMTIHSQNNFRKQIGITPQDAEDLKLIAEFLEKYSDFLNEYVKFTP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Viral protein
|
| molecule keywords |
ORF 131
|
| publication title |
The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb |
| source organism |
Sulfolobus islandicus rudivirus 1
|
| total genus |
22
|
| structure length |
91
|
| sequence length |
94
|
| ec nomenclature | |
| pdb deposition date | 2010-02-08 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Signal recognition particle alu RNA binding heterodimer, srp9/1 | Signal recognition particle alu RNA binding heterodimer, srp9/1 |
#chains in the Genus database with same CATH superfamily 2X5G A; 2X5T A; 2X5H A; #chains in the Genus database with same CATH topology 3ITW A; 1X4R A; 2FJE B; 2X5G A; 3PE3 A; 2W9J A; 1JNZ B; 3SK1 A; 4GYW A; 5AOX B; 4XIF A; 3TAX A; 4UYJ A; 5BNW A; 1UJR A; 1QMO E; 2DK6 A; 2FFG A; 2K4N A; 2X5T A; 2X5H A; 4GYY A; 5C1D A; 1914 A; 1E8O B; 4CDR A; 2A90 A; 4XI9 A; 4UYK B; 4AKX B; 4GZ6 A; 4GZ5 A; 3BT3 A; 4N3C A; 4N3A A; 3OMS A; 3V3L A; 4N3B A; 2RSF A; 5AOX A; 4N39 A; 3TU3 B; 3VCX A; 4GZ3 A; 3GYX B; 4UYJ B; 1U7I A; 1JNR B; 2KJZ A; 4AY6 A; 2FJA B; 4AY5 A; 1E8O A; 2FJB B; 2FJD B; 4UYK A; 3PE4 A; #chains in the Genus database with same CATH homology 3ITW A; 1X4R A; 2FJE B; 2X5G A; 3PE3 A; 2W9J A; 1JNZ B; 3SK1 A; 4GYW A; 5AOX B; 4XIF A; 3TAX A; 4UYJ A; 5BNW A; 1UJR A; 1QMO E; 2DK6 A; 2FFG A; 2K4N A; 2X5T A; 2X5H A; 4GYY A; 5C1D A; 1914 A; 1E8O B; 4CDR A; 2A90 A; 4XI9 A; 4UYK B; 4AKX B; 4GZ6 A; 4GZ5 A; 3BT3 A; 4N3C A; 4N3A A; 3OMS A; 3V3L A; 4N3B A; 2RSF A; 5AOX A; 4N39 A; 3TU3 B; 3VCX A; 4GZ3 A; 3GYX B; 4UYJ B; 1U7I A; 1JNR B; 2KJZ A; 4AY6 A; 2FJA B; 4AY5 A; 1E8O A; 2FJB B; 2FJD B; 4UYK A; 3PE4 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
