4AY5A

Human o-glcnac transferase (ogt) in complex with udp and glycopeptide
Total Genus 272
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
272
sequence length
717
structure length
698
Chain Sequence
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/peptide
molecule keywords UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYL TRANSF
publication title O-Glcnac Transferase Invokes Nucleotide Sugar Pyrophosphate Participation in Catalysis
pubmed doi rcsb
source organism Homo sapiens
total genus 272
structure length 698
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ay5A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ay5A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4ay5A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4ay5A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ay5A03
4U07A 2FI7A 2QN3A 3MV2B 3S2UA 1GPYA 4KQ2A 2SKEA 3ZPJA 3CX4A 3L7CA 4L22A 1XNFA 4JL0A 3U3WA 5KJLA 2XCIA 3CEMA 3COPA 4G25A 4M83A 4HOUA 6GPBA 4HLNA 1WW3A 4KBQA 4O6FA 3TAXA 1P4JA 5KJNA 1C3JA 3S28A 3L7BA 1FU8A 5BNWA 1WUYA 4G2TA 1FU4A 1E4OA 5D0OD 5FZQA 3CUWA 4W9RA 3VTYA 3TG4A 4HOTA 1Y6GA 1GZ5A 4G23A 3NP7A 2YQ8A 1L7XA 2X6RA 3OXGA 4EKEA 3EBPA 1AXRA 4Y6WA 4KQMA 3ZCTA 4MI6A 2KCLA 4AN4A 4EL0A 1PN3A 1IHGA 4RIFA 4CGVA 4NEQA 4CTNA 1GG8A 4I2WA 4AMGA 2LSUA 3NCHA 3IA7A 3UYLA 2QRHA 5TMBA 5DLDA 3QOUA 4HORA 3MTDA 3CKCA 3MEKA 1F6DA 2HR2A 2KS6A 1PSWA 3LYAA 4YI3A 9GPBA 3MTAA 1HZ4A 4GPKA 1GPBA 4IN3B 5G05C 1Z62A 2AZDA 2PRIA 3URZA 3ZGQA 4RG6A 3NC4A 2X0DA 3E3OA 4HOQA 3UPVA 2UWJG 3WADA 3E4BA 3D0QA 4RBNA 3R9AB 2KATA 3MSCA 3CV0A 4G1TA 3CUUA 4F9FA 2FETA 5EX3A 1JIUA 4WNFA 3S7BA 3ZHEB 2R4UA 2ZB2A 4J8EA 4MHSA 4GZ3A 2P58C 2QFCA 2BFWA 3U4TA 1UZUA 4JA7A 4G2VA 5ARFA 1XOIA 2C2LA 2F3PA 4YUAA 3AS8A 1Z8DA 3ZCUA 3SF4A 1O6CA 1LWNA 2DBAA 4PQGA 4XIFA 1FCHA 1JIXA 2XCCA 3BD8A 4REMA 3ZCRA 4WNGA 1FS4A 3CV3A 2HY7A 1HXIA 3OXFA 1Z6QA 2AV6A 2J9QA 2XEVA 2QN7A 4MRAA 4F3VA 3T7DA 3T3EA 3RJVA 2PQRA 3ZCQA 3JYSA 2C0MA 1F0KA 1C8KA 1L5WA 3AMVA 5CCMA 2VGXA 1C50A 3NPAA 3SYRA 1XV5A 3IAAA 3S27A 5FJYA 4WADA 2I6HA 3VDNB 1WAO1 3ASGA 2PZIA 1P2BA 2SKCA 1P2GA 4F96A 3GUHA 2XCBA 2JZCA 2C9ZA 4KXKB 2PYIA 1ABBA 3RO2A 3BDAA 4FZRA 2KCKA 4I1AA 1IXYA 1E1YA 3OT5A 1UQTA 4J8DA 3WXXA 2F9FA 1H5UA 3KAEA 1A8IA 4JA9A 2ACWA 2OOEA 2FF5A 3Q49B 2BGTA 1OUVA 3ESKA 3MV3B 3ZCSA 2KC7A 2IV3A 2C1ZA 1VGVA 2F3SA 3CUTA 2VQ2A 3O3CA 2QRQA 3G2KA 2YJNA 4KQ1A 4EL5A 2XA1A 1JIVA 1IYGA 4M60A 3Q3IA 4J0UA 1WV1A 3VTXA 3GW4A 5JJ6A 3WAGA 1WV0A 2F3QA 2X0EA 4NRHB 3UQ3A 1L5QA 1B4DA 4GA2A 2AVPA 4X7MA 4AM9A 2IF4A 3MT8A 4BFCA 4LDPA 4YVOA 3MS7A 2V5FA 5AYWD 4UI9C 4M7PA 4RIGA 3QHPA 3N71A 5G04C 2H1FA 2IYAA 3MT7A 4WACA 2IEIA 1NOJA 5JTTA 2JJMA 4U0SA 3AS5A 2C4MA 2Q7FA 4BWRA 4NESA 5CCLA 1J39A 5DIZA 2QRPA 4CTMA 3CVPA 3Q3EA 4YNDA 2XPIA 2PL2A 3RO3A 4X6LA 2O6LA 3BCSA 3TOVA 2FO7A 3DZCA 3UUXA 3FP3A 5FZRA 3ZN3A 1EXVA 2VGYA 3OY7A 4WNEA 2BUGA 2GT1A 3BEOA 2ATIA 3MKRA 3MTBA 5IKPA 1P4HA 1KTIA 1A17A 2C0LA 3ASFA 1LWOA 1NZDA 4QLBA 5LCWJ 3VUEA 3CUVA 5HQ8A 3Q15A 3L01A 4LEIA 5TMEA 1PYGA 2VCHA 3Q47B 5DXFA 2QN9A 1Y8ZA 3G2LA 3OKPA 1NLMA 4BT9A 3RSCA 3FROA 1FC0A 2VCEA 1GGNA 1WUTA 2VSYA 4BTBA 2XA2A 3KD7A 1NA3A 2GPNA 2XCUA 4N5CA 2XMPA 2LNIA 4CDRA 3VUFA 2GM9A 2IV7A 1KLXA 5A6CA 4FKZA 1BX3A 2C1XA 2IFUA 5CHEE 1K06A 1L5RA 1NOKA 3LY8A 1AHPA 1RZVA 4W6QA 1WM5A 2KCVA 4N9WA 2PQNA 3MA5A 2QRMA 5DU2A 3CVNA 4N3CA 1M5RA 2IUYA 3MBOA 2ASVA 5FTPA 4BQEA 1XC7A 2MHKA 3BCUA 4H7XA 1WW2A 1XL1A 4CTOA 3OKAA 3GYZA 5C1DA 3HBMA 5LCWC 3Q4AB 4JHRA 3MRVA 2WTXA 3DDWA 3OKCA 3GPBA 4AMBA 5FT9A 4X7PA 4BT8A 3QDNA 3ZFWA 2QLMA 4EQFA 3RHZA 4UQYA 2R66A 4GA0A 4XI9A 5KJMA 3E3LA 1QQEA 1PC2A 3MT9A 3RU0A 4I9CA 1JG6A 3G2HA 3MQFA 3OXLA 4GYOA 1K08A 2R60A 1P4GA 3G2IA 2QLNA 3PE3A 3ZCPA 1SXQA 1QM5A 3T5TA 2ONDA 1Y8MA 2WPVA 4N3AA 3CEJA 1YGPA 3HBJA 2R4TA 2G9VA 2AW3A 3NAZA 4BQFA 1RRVA 2HO1A 3C4VA 5KJKA 5HXAA 3BD6A 5M72A 5FZSA 4WNDA 3S7FA 4U0ZA 1XL0A 3MS2A 3ASDA 3PE4A 2F3UA 4F97A 1ELWA 3QKWA 7GPBA 4MI3A 2IW1A 4MHOA 3L7AA 2YHCA 4U0UA 5ENZA 4Z5XA 2BGUA 1Y6FA 3CK8A 3EBOA 3CK9A 1YA0A 4KYOB 4X7RA 3IEGA 2G9UA 3T3DA 3LPZA 1ZBPA 5D0QD 2QZSA 2AMVA 3GZ2A 1ZU2A 4ME2A 1P29A 3EDTB 1EM6A 3Q3HA 4WHMA 1FTWA 4I17A 2PQ6A 4RENA 2ECPA 2PRJA 3S29A 5JJTA 5A7DB 4A1SA 4EKYA 1RZUA 3LCAA 3T3GA 1FA9A 3D1JA 5ARGA 3ZHEA 1FU7A 4N2SA 5GPBA 4WUYA 2VSNA 1V4VA 3E3NA 5TMDA 3T3HA 2H1HA 3MRXA 2LSVA 2ACVA 4GCNA 1YA6A 2GEKA 2XA9A 2NC9A 4YVQC 4I2ZA 3SYMA 2SKDA 2VGXB 5G05J 2PYDA 1JEJA 1FTYA 4APOA 3BD7A 3BEEA 4BQIA 4ABNA 1E96B 2L6JA 4B94A 2GEJA 3H4TA 3G2JA 4GZ6A 2X6QA 3OY2A 4RIHA 1PNVA 4HWGA 1KT1A 1JG7A 2JLBA 4GYYA 3QWWA 1XKXA 1GFZA 4G26A 4CGWA 3S7JA 2QNBA 3TG5A 4N2QA 3UYKA 3C48A 2UY1A 3OTHA 2G9RA 2GW1A 3CEQA 4GYWA 3FFLA 2FBNA 4AY5A 3RT1A 1UQUA 3D0RA 5HI7A 5LQDA 2G9QA 4G24A 3ULQA 3TGOA 5D01A 1SXPA 2X0FA 5EKQD 5D00A 2R5SA 2IYFA 2Y4UA 3SZ7A 3OTIA 1KT0A 5TVGA 3Q5MA 3MRTA 1W3BA 3S0JA 3LY9A 3NP9A 4H7YA 2Y4TA 2QN1A 1NOIA 4GZ5A 4GPBA 2HYZA 3L79A 3MS4A 2VG8A 4MI9A 3S7DA 2E2EA 4RELA 3CK7A 1GPAA 3K9IA 5BW8C 2GJ4A 1IIRA 4AY6A 1C8LA 2P6PA 3ASHA 5IKOA 3QKYA 4NC9A 1HH8A 5EX0A 2VYIA 8GPBA 2XGSA 4UQZA 2IEGA 5JJ7A 2GPBA 4BTAA 3H4IA 5I45A 2QRGA 4RIIA 2XGOA 2R68A 4N39A 2QN2A 4RG9A 4XI0A 4UQXA 4GA1A 3VDMA 3PDNA 3BCRA 4J8FA 4NQ0A 4UI9K 4U04A 3HYMB 3WC4A 4N3BA 1NVKA 2BISA 1B89A 2GPAA 3CKBA 3QWPA 3RIBA 4AIFA 3DD1A 3T3IA 2XGMA 1L6IA 1NZFA 3L7DA 3TSAA 1L5SA 4LEUA 1ELRA 3HBNA 2FEZA 4HOSA 4Y6CA 1P5QA 2UY1B 1NZNA 1FTQA 1L5VA 3ZCVA 3GZ1A 3KS2A 3NF1A 2Q6VA 3RSZA 2QN8A 4UI9J 1P2DA 3DDSA 1QKJA 3CVLA 3CUYA 3G2NA 4MICA 2OFFA 4I9EA 5G04J 4RIEA 1TJCA 2QLLA 3FWVA 5JTUA 3RKVA 1HLFA 3O48A 3OTGA 4EJ2A 4GCOA 4YI5A 1NA0A 2WQHA 3AS4A 3CVQA 3LY7A 5DBKA 1Z6PA 2FFRA 3NB0A 3CEHA 2FF4A 3HBFA 5BT1A 3LKUA 3C4QA 3QWVA 1QZ2A
chains in the Genus database with same CATH superfamily
5KYXA 2GHTA 5J23A 1IXZA 2A14A 3T3NA 2O2CA 3V32A 1X9HA 3HM9A 2EGGA 3M0EA 3IBFA 2FV8A 4O1PA 5FZQA 5CFNA 3IAM6 1R7RA 3BC1A 3QPBA 1G21B 1JV2B 3U66A 3D8BA 3K2BA 3EY4A 3WS7A 2FEKA 1VHJA 2G77B 2BTDA 5KQLA 1ZD8A 1RRKA 4H7DA 2JLRA 5IHPA 1Y81A 1CR2A 4FK8A 4B3SB 3U4DA 2XRYA 4Z51A 1QU2A 1E9CA 4YUXA 1WMSA 1UXGA 2IOHA 4IF6A 2B3TA 4G8KA 2VRNA 3WQSB 1V16B 1H6OA 1P5ZB 1A77A 5TS2A 1EPUA 4DCVA 4YO8A 4KKXB 1JF8A 4PYMA 2R79A 3BD8A 4NBNA 1N0VC 1SQ0A 4TS4A 2HMYB 4G11A 3TFQA 3MWKA 4JQCA 4Q00A 1PCXA 3R7WB 2JZCA 4P5PA 5DTRA 3D8SA 5LU9A 3OT5A 1ZQ1A 2OCGA 2UZIR 4MYCA 3UOWA 5HKPA 2AN5A 1YRQA 4AJPA 2JFBA 5AKZA 1ISIA 4DC0A 3B6JA 1NPTO 1TKAA 1WV0A 5LM3A 5LMZA 3QUQA 3EQ7A 3DWFA 4O6VA 4RIGA 3STHA 3EVNA 3LQFA 1JLKA 1QZZA 1JQ3A 4DNXA 4NESA 2QRPA 1SA4A 2YNMC 5GVRA 1WIWA 2ZBGA 3G2OA 2IUFA 3KQTA 1U4OA 2X0KA 3DVAB 4GOMD 4LNUD 5ANRB 1ECFA 1KHHA 5KX5F 1P39A 3IIKA 1UJRA 4I8DA 3WRVA 2JI7A 2UZ0A 1HX7A 1DDGA 2XA2A 3OPNA 4D3YA 1QRAA 3KO8A 2XQIA 1AGXA 2C2MA 3A1VA 1IWOA 1V47A 4C6SA 4BXOA 4FINA 5CK4A 2FLKA 2B69A 4BQEA 1P1HA 3GUVA 4HNAA 2PXAA 2J0QA 4B93B 1G2IA 1VLJA 5GOZA 4NBKA 4MUEA 1GTG1 2ONDA 2V7BA 3PGKA 4HATA 2WEKA 4MYHA 4DM4A 1I4TD 5HRYA 2BFOA 2W58A 1C0EA 3IDOA 1EWKA 3CPEA 1QBQA 1I9CA 2OLKA 4EGAA 3GEEA 4EVQA 3RUHA 3R0VA 2G9UA 5AW9A 4DSTA 3LZDA 3VYWA 1NF2A 4RENA 2W2TA 3ZKWB 4A1SA 1JA9A 5K20A 1V5GA 3AXTA 3T41A 4FYMA 5HGJA 1JU3A 4Z4GA 3GW8A 3HDGA 4NPHA 3LT2A 3F1LA 2XH8A 5IDYA 3OY2A 3AG2E 4YQEA 2E3JA 4INPA 1YTUA 1T5OA 2B21A 2HIAA 2VNJA 1K2VN 2O19A 2YMPA 1JAYA 3IEMA 5DX0A 4FHCA 1O95D 5CLFA 4Q93A 1U3WA 4X5OA 4BX3A 5ENTD 3QLTA 5JZVA 4LJKA 5JAHA 5AT1A 5D85A 1NFFA 3B3AA 4DQLA 4Y6LA 5BWMA 4AF7A 2LRHA 1RIIA 3WGUA 3TLKA 5EWJA 5JNUA 3WL8A 3B20A 4C29A 1SIOA 3ND5A 2W0MA 3EIFA 2ZYIA 3FDXA 3FU3A 3ZH9B 3RIGA 2XZDA 1Q7GA 3ZDQA 3WLTA 3AK4A 2O0MA 1U94A 2FEZA 3ZWMA 2VHJA 3WK4A 2BFCA 2OC9A 1U5CA 1FBTA 2N1BA 2W7TA 2QN8A 2H65A 3EC2A 3O26A 3ZYMA 3I2GA 2IU4A 4EKNB 1Q5PA 2DEUA 4COKA 2NQ8A 2PX3A 1L5YA 3HWWA 3Q8LA 3HJBA 2C5EA 1VCIA 3RHTA 3BB1A 3ZPJA 1YONA 1DOHA 4CI9A 3H17A 3RFUA 4F71A 3QI7A 1PDWA 5A23A 1XZDA 5FAXA 1OZHA 5ILQA 3Q8KA 2JGNA 2IXFA 1HSZA 2EBUA 4QDZA 3NAMA 2ASEA 5IMSA 4PXSA 2JZOA 5FA6A 3U40A 2GBLC 1BE1A 5FFNA 2N42A 4KX3A 4UOEA 3BGIA 4BLPA 2VHQA 3UH1A 1ZVKA 4FE7A 5BPPA 2PT5A 3CH7A 1J5XA 3EZGA 3AF4A 3GMTA 2JFOA 2A0FA 1FPMA 3GLFE 1GW6A 3K0EA 4UYKA 1PDVA 5AI8A 1GGFA 3I76A 3ST7A 3DYIA 1NJ8A 2EKLA 4TLCA 1T34A 3SIRA 4PGMA 2IYQA 1GZ3A 1V1MA 1NL3A 5LXTF 1PWYE 1XKTA 2O2YA 3PJEA 3IHVA 2GBCA 3D8TA 2G9NA 1YCFA 5CA1F 4WADA 4ZCQA 5B4VA 3SSAA 4FYIA 1UOHA 1TJPB 2XCBA 3AKDA 3LI2A 4LNHA 5K0GA 4R7ZA 1U6JA 3ZHQA 3FTVA 4TYYA 2OV8A 4O1MA 5KOYA 2PAFA 2O8DB 3ETCA 5LYJA 2BFFB 2D13A 2ZYSA 4DHWA 5HW0A 1GM5A 3QEMA 4O4HF 2F3QA 1N2SA 1KXJA 4L76A 4N5LA 3VHRA 2O0KA 3G6KA 5AW8A 4PYKA 5JEDA 3F73A 4JLSA 1XEXA 5HR5A 3FNGA 3DTYA 4KQWA 1JLSA 3MJHA 1GILA 2FPLA 1UBJS 3M2PA 3FDJA 4HQLA 2ZWIA 2X5TA 3L1KA 1RRGA 2XEXA 4F6LA 3B3QA 1T29A 1A97A 2NSDA 3INNA 4HX5A 2YS7A 4JJZA 4TQUS 4PRLA 5FTNA 3AUFA 3L77A 1R9JA 3EZFA 2O2ZA 4KNWA 2HMAA 5TDHA 5C32A 4Q9AA 4FR2A 5JCZA 3I2YX 4A16A 1E7QA 4GZCA 2WYWA 1QK3A 3WYCA 3DWGA 1CDDA 1I7LA 2B83A 3PE3A 1KYQA 3B1XA 2VH2A 3TWUA 1ULTA 1G21A 3MPOA 2XCLA 1GRRA 1MNAA 5AJVB 3PE4A 1ECLA 1WAMA 5YASA 3HDJA 3EW9A 4YS6A 3CK9A 5C18A 1W25A 3BT7A 1PJCA 1ZJWA 2FPKA 2C2GA 3F9CA 3PXBA 2PQ6A 2M6RA 3NALA 1KZ4A 1J70A 5K0CA 1CNEA 4QBHA 4XVQA 3T3GA 2MDTA 2POQX 1TM1E 1V5IA 2A3NA 3HHMA 3O03A 3GDWA 4UMDA 4O2BF 4FOPA 2Z9BA 1WF6A 2OFPA 4L2LA 2J7PD 4LF7B 4DLLA 1ESZA 4N5IX 1FOEB 1ZVMA 1D2MA 4XPZA 1GNSA 1ZNQO 2H4YA 4MPPA 3REGA 1ZI9A 2RGCA 5KVQA 4L8FA 2KZTB 5EKQD 3Q7PA 1G8PA 1QYMA 4TZ0A 3NP9A 3WLJA 3TQSA 5KYWB 1IDN1 1OJLA 2PUWA 3W8DA 1T5BA 3TBKA 5AM2A 1GT91 1QP7A 2DTDA 1CRQA 1E8MA 2WMOA 2ZWOA 3KEOA 5EL0A 1E59A 4RIIA 3WDSA 4K86A 5EQDA 4D8YA 4S2EA 5CT4A 4KQ6A 5HYVA 4F21A 4ENQA 1YNOA 2B4QA 3L82A 2IIQA 3PRKE 2B4RO 1OBVA 3JQDA 2VRCD 1NDHA 5ANRA 4ANUA 1RP7A 3BE4A 1SHTX 4IINA 2Z4RA 1ZAYA 4MR7B 4LYDA 2AUTA 2Q28A 1MVOA 1K5GA 2B2XA 3N86A 4HI8A 1Z0SA 3DZDA 1JHVA 5H3LA 1HO8A 5ES4B 1MH1A 1G5IA 1NM5A 4I66A 4W9RA 2QR2A 2BKEA 3H2YA 4DWJA 2V7UA 1RQRA 3KJHA 3LU1A 2V5UA 2HWKA 4E21A 3RRUA 4M55A 2H2AA 1KDPA 2BJWA 3LHSA 1F4LA 1PSWA 3HJNA 1H2ZA 2IPLA 2UWJG 4F0JA 3A4YA 4KFCA 5A2QA 4MPRA 1YZKA 2YNMD 3DTTA 4EY7A 1QR2A 2OMKA 4YP7A 3NTLA 3E84A 2C31A 3KB2A 2P62A 2A30A 3SF4A 3KHSA 4J1TC 3DJYA 2H08A 2R86A 3DKPA 4B7CA 3HXDA 4N6GA 2NTYC 2P78A 2QN7A 3ISVA 3U3ZA 1OCRE 2IZ5A 1T8SA 1XV5A 3M8KA 1C30B 3C74A 1GEEA 2AXEA 4DV4B 1B8PA 2FYTA 1DRUA 3F7TA 3ETEA 3U4IA 1A8IA 2IYEA 4PSDA 5HKKA 4AJ4A 3L4BC 3O2SB 1OXVA 4M1ZA 3HHEA 2DGDA 1LV8A 5KTTA 4CDMA 1D0VA 1L7OA 2V5FA 3IKLA 1SO8A 2IEIA 1NOJA 3U1VA 2JJMA 4F4UA 3PBKA 5JLAA 1BJRE 3KAJA 3IJPA 3MTQA 4BEVA 3UBMA 3FTQA 2VK2A 4Z53A 3F97A 2VK4A 1LDMA 1CRWG 2P4SA 3O5AA 2ZK7A 3TKLA 2Y0PA 1TW3A 2VF5X 4AG5A 1XWFA 3GMDA 1T3GA 4L4ZA 2LNIA 4PYLA 1L4EA 3G5MA 5FI1B 5FO1A 2AI2A 2PUEA 1PD0A 5T3YA 2PEZA 1UOPA 2P0EA 3A6GA 3BCUA 3JRWA 3SBTB 2GO1A 5DGHA 1N3YA 3RVLA 1FLDA 5TARA 4AFNA 5LCWC 4M1KA 4WKBA 1XZFA 2V5QC 2BVNA 4NNOA 4LTNA 2WU1A 3FYCA 2RGNC 1LA2A 4JXKA 1PG5A 2CEKA 2O2JA 3TPFA 3NFYA 3ZKJA 4H77A 4CIYA 2PNFA 4L0CA 1UANA 3RLIA 1VOTA 3ANXA 4I3FA 4NCJA 1XVVA 2V65A 1C1XB 2ZPUA 1QOZA 2VPWA 1TXGA 3FUFA 3ZE7A 1ZU4A 3OEED 4X3CA 1ZNXA 3PXGA 4IZOA 1TYZA 2EF0A 4DANA 3GJYA 1ZWKA 3HZOA 4ACKA 4MW9A 4URKA 3UAZA 4FI3C 2J3EA 3WBFA 1UJ6A 3WB9A 3A4MA 3HLKA 1ZK1A 2PBLA 3VOSA 4G5OA 2XUFA 1A71A 3MUNA 5AUNB 4BLSA 4X00A 1CS4C 2BDUA 2I54A 1G5TA 4YLEA 3F5FA 5IYZB 5IAJA 4KVAA 1FMJA 4U2GA 2E2WA 3TS1A 2QMOA 2O5CA 4GQBA 2BFFA 2HM7A 5B3KA 4TLLB 1RYMA 2ZYAA 3IJ5A 2C7BA 4HKTA 1SC9A 1RHQA 1TO1E 2VSXA 4COOA 5JD4A 4QBIA 3TZLA 2ZIAA 2WWRA 4W5RA 4EA6A 4QQRA 3TM4A 2B6NA 3BFJA 2HB6A 2DPGA 4Z8XA 4L3WA 1Z82A 2EQ5A 2I2WA 4IGFA 2IK8A 2H4FA 2IV2X 5EIWA 2PVPA 1QTNA 1CUAA 2N9UA 4DLZA 5HS6A 5HIAA 1RMTA 3NCTA 1G8MA 1UKVY 1ZONA 1Z0KA 1QE5A 2H52A 3HVJA 1SUSA 3NM4A 4BMCA 1P0MA 4QXAA 4F1JA 3C3PA 3DEFA 3BGOS 1L7XA 3FI9A 3H7IA 2YIDA 2CBXA 4BC0A 3JVEA 3QE0A 3FCYA 3DL2A 2VAWA 3BICA 3URZA 2CMGA 5CDTA 3KYCB 4RXTA 3DQQA 1AKVA 2C5SA 1GHTA 3KSLA 1EFCA 1WJGA 1ZSYA 4Z0HO 4J8PA 3HRAA 2AXNA 2X1HA 2P91A 4HTFB 2YBDA 3ZPXA 3JD3A 2C9BA 5I7RA 2O3RA 2RHHA 2EKZA 4PICA 2RKWA 4F45A 1ORIA 3SXPA 3RROA 1FTGA 3MAJA 3QFSA 2WU4A 5G4KB 2KBFA 5SZKB 3QPWA 3LIIA 3HFRA 2AC2A 3K94A 4C08A 2GA9A 2RJNA 4EYSA 3LEWA 4LVCA 1MU0A 3WAGA 3ZBQA 4IJMA 5BWCA 3HP1A 3M7IA 3RU7A 2LW7A 4GA2A 4KR3A 3A2KA 4DREA 5TE9A 2HO4A 4TT8A 3AU5A 2IE8A 3O73A 2FUKA 2PUVA 1G64A 3GT0A 1FVFA 4NSNA 5TQJA 3BGSA 1XNGA 1G9XA 2W2VA 1OREA 4EA9A 2NXJA 5AXCA 1IM5A 4D0RA 4ZODA 3V34A 4J1NA 2IOLA 1JG2A 2C98A 4F5EA 4GTQA 2X6KA 3TWSA 2PS0A 1OIVA 2VSYA 4AY2A 3ESLA 5K2OA 3EE6A 3ZD6A 5CX1A 4MITA 1PEDA 2P1RA 2YC2C 3CLUD 5AXDA 2WJGA 5E38A 3KZCA 4AZWA 2XF2A 4ZVOA 3MBOA 1PJRA 1UBLS 3BB4A 3ZWBA 3OPVA 1T1RA 4X7PA 2P9IG 2QDXA 1SR8A 1SBNE 3PC7A 4C05A 1QHXA 3LUAA 3IMFA 2ZEJA 2YJ5A 3P5SA 4E12A 2R8XA 1NVAA 4AMZA 2EQAA 4QDUA 3F49S 4WI1A 1JMVA 1GUYA 2A58A 5CA0B 2NLOA 5FYDA 4Q7EA 4OYRA 2VSOE 3EGDB 3ZDBA 5I9LA 2XEEA 1EG2A 1P3DA 1Z5WA 2HCFA 2C42A 5B37A 1FU7A 2YYAA 2Q4BA 5CFRA 4X6XA 4ZI7A 3D5EA 3DBIA 2ACVA 3U4GA 2OXCA 4MS6A 1M8KA 4S1TA 3B38A 2FFBA 1QLHA 4P32A 5HF5A 3TIGA 2Q5FA 2GVZC 1ZRMA 1Q0UA 4JI4B 2EFDB 5I3CA 2J9ZB 4I1VA 4TXMA 1C30A 5C1OA 3E9MA 4J2TA 1OH7A 4G24A 2Q3DA 3BUSA 5EE0A 4RV5A 5JDCA 3AVTA 1JQKA 4E4TA 3TEMA 3NH9A 1Y5NA 3S0JA 3K7EA 2XENA 5IP5A 5LZ2A 3LPDA 2HQRA 2UXBB 1XRNA 1XF9A 4L9PA 5HOQA 2P6PA 2NO0A 1H0AA 1YYHA 1V1RB 5KAPA 1NN3A 4HYEA 5CW2A 5JJ7A 4Q39A 2BGRA 3M9XA 2J5BA 1LBIA 2O50A 3C1OA 3UJDA 1DQRA 1KSGA 1BX0A 2J3IA 1VJGA 3D54D 2Y1FA 3PJDA 4L57A 4YJ2F 1NRWA 4B46A 2B92A 2J0VA 3CUSA 1DIAA 2R6ZA 4GLOA 2DOKA 1BWRA 1G9SA 5LCXA 4BOYA 3INRA 2V0PA 5TVKA 4E5UA 5KVCA 3U48A 5KWSA 3A32A 2AOTB 2QRUA 3NGXA 5FPQA 3TAHA 5I9TA 4H3VA 2EIXA 5AJLA 1ZZGA 5BNWA 3V42A 4FSDA 4ILEA 1VP3A 1JB1A 3PQ6A 1E4VA 2CZGA 5JZOA 1Q0QA 2YW2A 4IYPA 1S8AA 2II6A 3THXB 2Q62A 2HQ1A 3TLYA 2XTMA 1R00A 3V48A 2WKSA 4GF5A 4M0CA 4Z99A 3MCUA 3T54A 1N0IA 4RGVA 5AHRA 1SVMA 3GDHA 4MI1A 4R41A 1ZJYA 4NBSA 3C7CB 5M2QA 1PJ4A 3DHVA 5CRUA 2H17A 5K6AA 1X70A 3ENZA 3GF4A 4X24A 3FUIA 2AG0A 3FIJA 2FUCA 4P31A 4AECA 2ZR9A 2WA1A 4K5CA 2OENG 5H83A 4HVLA 4ZOEA 3W2EA 1Q22A 3DMFA 2I1WA 1KO4A 2YIMA 1V45E 3LXUX 4ME6A 1GJRA 2CF6A 2QAGB 4KH0A 1EP2B 1FFXA 4EENA 3FCCA 3OU6A 2F9LA 1CUXA 2EW2A 4BKUA 3VZSA 5E4JA 2G3YA 4HB2A 1OXTA 2PTGA 3OURA 2NZVG 3QU5A 1PZEA 5BVHB 3LDHA 2OBYA 3MB8A 2FU5C 2AJLI 2DY0A 4ZZ0A 4IHJA 3PSAA 5CT5A 5DNEA 1E8DA 1JCSA 3W7VA 1M2WA 1J2TA 3UB4A 1A9RA 3ZN3A 2PGNA 1QUFA 3X2EA 3ZQJA 1WXHA 4ASUA 1QH1A 3HSSA 4DDUA 1QE3A 3EEQA 3GCWA 3S40A 5EMHA 5I5EA 4WBXC 2DP4E 1ECBA 3NEAA 2OCKA 5C2JB 5AOCA 2RHCA 4JXXA 3KT8A 3TWWA 3O6VA 4HP8A 5TPZA 3BXGA 5IJXA 1HT1E 4KXUA 4JQZA 1VCMA 5LQMA 3KYDB 5BSWA 5BORA 3FFWA 1KAOA 2ZRBA 3A8TA 4YGXB 2AXZA 3ITEA 5IJZA 2O0LA 1KE2A 1C0KA 5BQPA 1U81A 2KXPC 3PF9A 4D5EA 3IH5A 4M36A 5ALNA 1UBRS 3KDPA 3ZRHA 1F4PA 4GXTA 5BQ5A 4NOMA 4Z4IA 2XD9A 3ETNA 4Z7NB 2AMVA 1ZU2A 2VXOA 4LSMA 2I3ZA 2WZCA 1KTVA 4DKXA 5JAMA 3JSAA 1WVIA 1UBGA 1S3IA 3PWTA 3TLCA 2QRNA 3MT0A 1A7KA 4BQIA 1T1IA 3CRVA 4A92A 2A90A 4YASA 3F4LA 2XVZA 4ZVNA 2AJDA 3E32A 4LKRA 4RA9B 4RA6A 3B9BA 1FXWA 1U2ZA 3RT1A 2MSKA 1OFHA 3PR1A 3O2JA 3F90A 3OQHA 2PKYX 2JNWA 1Z5SC 5LQUA 2DXIA 3EHRA 2W8BB 1M75A 3G9TA 1A7JA 3K1JA 2QB5A 2R6CA 4RTMA 1XB2A 5EJFA 1JSLA 3PZ1A 4WGGA 3LJ3A 3OP4A 4LXHA 1MCZA 3PXXA 5AVQA 4PYOA 1E1RA 4F4DA 1SA5A 3H6GA 4OGFA 3X1WA 2FP3A 2FPIA 4EVRA 3PP8A 3VU0A 2GKOA 2HYDA 1DC7A 3GV0A 2EFGA 2NZYA 1ZCBA 2J4BA 4N3BA 2Z09A 5LOVA 2P9ZA 3I9OA 3GRFA 4HQDA 3TMKA 1AV6A 4OHWA 1ELRA 4MQMA 2WF7A 1SU8A 3D9JA 5DWQA 4RF5A 1KPHA 1CJCA 2YHSA 3WKCA 4DAEA 4FKMA 1ZHHA 2DMRA 4A10A 3HMQA 2CG2A 4UUAA 1QRUA 4XR4A 3ONEA 4Y9RA 3GLFA 2EU8A 3ETGA 2DH5A 5CR9A 2C59A 3T1OA 4QNMA 4KTVE 4HOUA 1E98A 1I2MA 4NOJA 1H9BA 4WN9B 8ADHA 1FU8A 1YB1A 2QSJA 1FU4A 2QVXX 4MIKA 1TTPB 1W2HA 1OBHA 3DMHA 4FSXA 4Y6WA 3BTVA 1VBMA 4RXMA 3ZY2A 4JCOA 4Z7JA 4CTNA 3K0BA 3CJTA 1VJDA 2F4VB 2GD2A 4PZ0A 4EMBA 1ADYA 4H3HB 2CUNA 3PRHA 2DT8A 3AONB 4ZI5A 4UATA 4X97A 4AX8A 1VLQA 2CZQA 2J30A 3Q72A 3AFGA 3MTJA 4R9NA 2X6HA 3FTPA 3EGDA 2PA0A 2OQ2A 4LMAA 4YUAA 4FKBA 4NHEA 3D9PA 1E7MA 3W9BA 3HWSA 3HBLA 3RVSA 2VWPA 1CU1A 1NA5A 4TTAA 2H4WA 1UKAA 1G4UR 3VX4A 3LDFA 2XIQA 3NPAA 1LPBB 1LF0A 1Z6AA 3DH0A 1T0JB 3IEPA 3EFOB 4OTZA 4KMRA 2EVWX 4CKWB 3QUSA 3KR0A 2Q2OA 4M8KA 4D56A 1IYGA 1GPKA 3DLHA 2ERXA 1E2FA 4GMDA 1SBHA 3T8YA 5EXSA 3OMXA 3A6JA 4E13A 4V2UA 3KUCA 4KYIB 3ODPA 1JDBB 2NSLA 1WTCA 1QMPA 3TKYA 2YJZA 2OFOA 4WCFC 4B6FA 2OEPA 5FR2A 1YT5A 4DPLA 3CZAA 2Q0QA 1UN8A 4JL8A 3H1EA 4C0BA 3QTLA 5BOSB 4JLNA 4DOMA 4CIXA 2ST1A 1X0XA 5EIOA 4QU5A 1OXJA 4L74A 2MHKA 2E1RA 4YXFA 1WVGA 3IIJA 3LIPA 4ZO9A 2WFZA 4IXTA 1Y34E 1EXMA 1RADA 1IPFA 4B7XA 3ZS9A 1NV9A 3MT9A 5THQA 4GU5A 4LXYA 3WP1B 4ZXPA 4PBSA 3G2IA 5JHGB 1C3EA 1LD7A 4UM5A 1SZ9A 4HS4A 3SSOA 2AJBA 1LBEA 4MW7A 3EXAA 4YFYA 3M4XA 2NNLD 5FYQA 3N58A 5ECYA 3T61A 3KJIA 1NJ6A 3ZQ4A 4ATZD 2UVQA 2IBMA 2ZETA 1RTKA 3O8QA 1L1QA 2ZVDA 2B5OA 3BWMA 2Y92A 5A9SA 4HH1A 1VIVA 4R1NA 2IOSA 5M7EA 4IJ5A 4AKHA 5IRCD 2KLBA 3TRIA 3D7LA 4E6PA 3AU4A 1ZCJA 1TM5E 3NWEA 3EULA 2DG2A 1MBZA 2P6RA 4WLFA 4U7HA 1G55A 1GNVA 3M6WA 2UZAA 1Z39A 2Y1WA 1KT1A 4JYZA 1UP4A 1H23A 1XKXA 3I9V6 2GWHA 1ZL2A 3SHOA 2XUOA 4DLWA 7MDHA 1N2JA 4B4VA 3MW8A 3UICA 1RZRD 2HHHB 1U5BA 2OZPA 2GDZA 5ARBA 5E6RB 1QIFA 3C5CA 1KDZA 1BQ3A 1KEEB 4UE6A 1POXA 3RBZA 4DNOA 2Y93A 5BVHA 1S2NA 4B8CB 1IY8A 3N8GA 4ICIA 3TNJA 2G6TA 5EP1A 3ZHVA 3UENA 2V45A 3DXYA 1BJKA 4OMDA 4UI9K 2D74A 1H65A 2X8LA 5KYNA 5LNK1 4CDGA 2F37A 4CQNA 2D5AA 4N5DA 1S96A 2JLAA 1P74A 1GUAA 3RGWS 2XB4A 3PVLA 1SC3A 1ODFA 1OI2A 4UWLA 3LQ1A 4L72A 1A4IA 4KBFA 2QVCA 2D2VA 4D6XA 5AFSA 3CX4A 1Y9JA 2CNWD 3COPA 3AP3A 5EWJB 2YUIA 4I1OA 5T4YA 4X1OA 3I4LA 2YXBA 1PJQA 3M2TA 1S7CA 1TJ3A 5IC6A 7ABPA 2WDPA 1QIIA 4XRRA 2MYUA 2ZJBA 3UPUA 3PZBA 4HLEA 2AOUB 2BFCB 4URZR 5L3QB 4E3ZA 1ZKMA 2HRRA 3JX9A 2BKUA 4U96D 1X7GA 2PH7A 4PX2A 2AZDA 4PAMA 4DA7A 3NO4A 4O08A 2J9RA 3HVHA 2AQHA 1U0EA 1FDRA 3HKBB 1ZLYA 4J8YA 1YOVB 3EZ7A 4QTZA 1NF8A 1SD2A 4P93A 3S2AA 1O6CA 3B8EA 5EFZA 4ED9A 2QZZA 2X4IA 5A3VA 3J81k 4A7PA 1Y3CE 3EF1A 5TMPA 4H7KA 4P4GA 5KJCA 2WKPA 3GHYA 3IDFA 3AVYA 3LZCA 1J2UA 2QL5A 2XR1A 3L9TA 4CKCA 4ERXA 1ZQ9A 3O93A 5LUAA 5AKEA 1UQTA 1KVSA 3GMIA 2PZBA 3B89A 4RA9A 1UPBA 3LJKA 2YZMA 2R02A 5C4MA 2M32A 2ZYDA 1NQUA 2I71A 1G6OA 1JKIA 3SE0A 3K3PA 2W8BA 3S81A 3BTSA 1AHHA 2IF4A 1XMXA 3ZLUA 4NQZA 1NRJB 2VYND 3QMPA 2JW5A 5ILOA 5DNCA 1TNUA 1ECGA 8ABPA 4LGYA 4LSWA 1O5OA 2C29D 4R83A 3PUVA 3RUCA 5D5QA 3IQGX 1DKPA 4KE9A 1Q2XA 3RD5A 2WE8A 1A8SA 4XQ0A 5LYJB 2V6BA 4PCLA 3BKXA 2PM7A 3MA5A 1ONBA 1PUXA 2O2GA 4MKHA 3BYZA 3OKAA 2RH5A 4P08A 3HBMA 3Q4AB 3R75A 2GF2A 1XEXB 5D6NA 2XEDA 1HQYE 2DLDA 4Z0PA 3ASOE 7YASA 1RQNA 2R3SA 2VRBA 5E8RA 3FUCA 2R60A 1C7RA 1JIIA 2EFYA 1H5QA 1WDWB 4RZSA 5DE3A 3B7GA 2AZMA 4DR7B 3JQ0A 5AW4A 3W06A 2IO3C 1RFLA 1WB9A 4W1SA 1TQDA 1DIHA 4AEZC 4BZQA 2KI5A 4B5LA 4CCWA 3HDXA 5B30A 5IASA 4L3OA 4ZAGA 2GVNA 5ECDA 2Q4DA 3DVQX 5BMOA 1YDGA 2C78A 1LQ2A 1S9DA 3VZDA 4TZTA 4ON9A 4TZ6A 3L0DA 4HRMB 2RGRA 1RLOA 2DQKA 3S2GA 5AHKA 1T9CA 3T4XA 1OLUA 1PL0A 5TF0A 3UYKA 4DQVA 2XE4A 3BL6A 2AX3A 1YH3A 3QBJA 4QIHA 3EFOA 4KE7A 4CKWA 3UJBA 4US0R 2BFAA 1HE5A 1BS2A 3FPLA 4KQEA 2VDNB 4TL9A 4OHXA 3UV6A 3A26A 3QX8A 2PM8A 1E3WB 4Z2AA 4R8VA 3U6BA 1TQHA 3C15C 3GEGA 3ONDA 5B3JA 1M83A 2M6LA 4DPRA 4KAXA 5FBWB 2TS1A 1D5CA 2PGAA 1Q50A 2QG6A 3SM3A 2ODNA 4JB3A 1E61A 2NTNA 1HG2A 1TNBA 1ULHA 4LNAA 5IZ4A 4FT4A 4HJXA 1ONOA 4BZZA 5BOSA 3D4IA 1BMTA 1Z5UA 1D2HA 3PU6A 4DN6A 2CMHA 4B31A 1TOAA 4AJWA 1YQEA 2NZXA 1I7QB 1G9TA 2WMOB 3DM5A 4WOKA 3CU5A 3N8KA 2W6JD 3E1KA 2H85A 3RYIB 2R6DA 4LZZA 1Q91A 3K1AB 4BYMA 3L82B 4MUMA 4FUQA 1XD2B 5H4GA 5JUWA 4IQGA 3E3AA 3FWNA 4Y67A 2Z1MA 3DAFA 2W83A 3CHQA 2QRHA 5DSZA 1RC0A 3MTDA 1U6IA 3G0CA 4IY1A 1QRDA 3LHFA 3QTBA 5C5IA 2BGIA 4WXHA 4OB8A 2GUGA 3EDQA 2VP5A 2R8ZA 1ZC4A 1IUKA 2F3PA 3B1JA 2PK3A 1GLVA 5FUWA 4AS2A 2GBGA 1WQ3A 4JEIA 4FEYA 2VP2A 3ML8A 4QUBA 4C4YA 4LZOA 3VSEA 3D9NA 3Q41A 2R05A 1BFDA 3TU3B 1I1HA 3F6YA 4C3OB 4Z54A 1E9EA 1V2HE 5CIQA 1APBA 4I1AA 1I7DA 3ZDYB 4S0ZA 1F4VA 5ISMA 2ZIVB 1ZEJA 4NBWA 2GM5A 4HQOA 1KO8A 1CJSA 1M2GA 4RHUA 3IBGA 1E9AA 3X2QE 3K71B 1PZNA 3LRPA 3TQQA 2ERYA 5E6RA 3KYBA 4LDPA 4PLVA 5BSHA 1KEEA 2R6HA 1C2TA 1HLGA 4N7BA 3I2KA 2FEWB 3UXEA 4K5BA 1NF9A 3LFUA 4DCJA 1YKFA 5J58A 1T9GR 3B52X 3OSZA 3C6KA 4KYVA 3BHIA 2AF3C 2OAP1 1DXHA 3GFOA 3HJGA 4DQDA 3P2MA 2UZ4A 2G0AA 1ZIXA 3GNSA 3PX2A 1L7RA 2LVBA 2VSOA 1MA0A 1OXXK 3GDGA 1XMPA 2B4AA 1L9XA 3WDKA 3V00A 4W82A 3ZYKA 1RI1A 3GP3A 5EOVA 1F5NA 4M1TA 4NS4A 1N34B 1JJAA 3E15A 3FMGA 4WESA 4FZ3A 3V2XA 4OY3A 4YMWA 1TKCA 5MGNA 3A14A 1EXNA 1MC5A 3L0ZA 1Z36A 3SXUB 4L50A 2AOUA 5L3QA 2WDZA 5HKOA 1TIKA 3AESB 3WE7A 1XCPA 3TX2A 4MUHA 4FHDA 3NPMA 2YWCA 3U7QA 5HA5A 1Z0ZA 2EZ8A 4P3OA 3PXEA 2JAPA 3W5JA 4XYBA 3DFZA 3HKBA 3I42A 3W3AD 1YOVA 1KBZA 1QGYA 2KSQA 3KSMA 3MRXA 1M6WA 2Q1TA 1K7EB 2H6GA 2GJ9A 1GZUA 5BUSA 4OQ4A 1XZLA 2PFSA 5DV9A 5I4KA 2HT1A 2BKKB 1ID1A 4B74A 3MKQB 4PPFA 2W2NA 3LBAA 1AE1A 3BILA 2PMFA 1ZBDA 2J5XA 4R9UC 2BCEA 5EERA 1U8EA 3SZ7A 1SWWA 2QF7A 1Z6GA 2X5HA 4KGVA 5SZHB 4LA4A 2OP1A 1W0CA 1OCZE 4EQ6A 2LZ0A 3KU4A 4QSMA 3AUSA 4QELA 2IRWA 1WY6A 2ISSD 2O5VA 3K70B 4LQLA 1QHGA 2CL5A 1HH8A 4RTLA 1QOPB 3FYTA 1WXXA 1JFTA 5AK3A 3M4ZA 3P0IA 4XSHA 1SZAA 3RTDA 3IT1A 1W35A 3LWBA 1K4MA 2BFDB 4FDLA 4PSVA 2A1TS 4HOSA 5KNHD 3VPSA 1T2UA 3L8MA 4XVCA 1MZPA 3NXKA 3UMRA 1GU0A 5CEEA 1DIGA 3DE2X 2NP6A 4WZZA 3E58A 2NO5A 1K2WA 2FF4A 3HZZA 3LO8A 4XB1A 2QL7A 2A5FA 3GG2A 3OEHD 3FI0A 4HLNA 4KGXA 5LZ5A 5IEJA 2GASA 1QWOA 3TR6A 4IOLA 3CW2A 2ZLBA 2DHCA 2PX4A 5D0OD 2H18A 4JKOA 1V4NA 2K6GA 2YN4A 3RTEA 2H57A 5G0SA 4MI6A 4JXZA 2C4WA 1IJFA 5ENPD 1RHJA 5EHZA 3SMVA 1LVGA 1GO2A 5LKRA 2F9MA 2RONA 2NOAA 4F5YA 5ECWA 1JQJC 4LOJA 3WMXA 3NW9A 3I4FA 4XZ3A 1JHRA 1X38A 4O0LA 2VT7A 3QOFA 3K2QA 3TQTA 1T4DA 1ST3A 3HJAA 3C45A 1ULBA 4BKMA 3QC1A 2JHFA 2W2OA 4H7IA 1T13A 3KLOA 2QP3A 5FBVB 4E14A 2IZ0A 4O1IA 1KFCB 4YR9A 4RVHA 3KR9A 1SBYA 2C7QA 3KQVA 1HWYA 3V8EA 4Y2TA 3A1FA 2YBEA 4YPOA 4BN5A 3FWYA 1E63A 4BO5A 4BJ6A 1MDFA 5B1YA 3OG9A 4OHKA 5T3RA 2PUBA 4JKYA 5A3SA 2AQIA 3QRWA 1EQAA 1OVGA 2UUCB 3OA0A 4AYTA 3R7SA 2CFIA 3I3NA 4QPNA 3TZQA 4Z3DA 3PHHA 1B0AA 5K0LA 3K15A 1GFWA 1NY6A 1E3WA 5CAEB 2O2EA 5K2MA 3QVTA 3CLUC 3UUXA 1EI9A 1UPCA 2CXOA 2Y1EA 5JRDS 2ZWVA 1J00A 4RKYA 1Z3XA 2ZRGA 5H59A 2O2XA 3DHYA 2AWNA 2V7EA 2GCPA 4PLZA 3AYZB 2AL7A 2QMEA 4UEWA 1EUCB 1KLXA 1IXKA 3IB3A 2Q49A 3WJ7A 3FLBA 3BCHA 3GRZA 1ODLA 3TN7A 4QWMA 5B7QA 2VJBA 4CIDA 5HUHA 5E9WA 4X85A 3WAJA 3F5MA 1LC3A 2ZRLA 1IHXA 3GCZA 2Y0EA 4WK2B 1D8TA 1NE2A 2BHRA 2OHJA 2ZBDA 3RYIA 2ZREA 1E8ZA 3K1AA 1T4GA 4XPIB 3WSVA 2UZ3A 2QTZA 1XD2A 2IW1A 3OCCA 3HJTA 2IDJA 5CX1B 3SHQA 3JD4A 5FWDA 1D8EA 1DWPA 4F85A 3RFCA 2EKBA 5IANA 3H9UA 1NYTA 1NN1A 5I8PA 1N9GB 2RGAA 2DJIA 3O91A 3FRJA 3PCRB 4ZZIA 4I1RA 2XT6A 1LLFA 4APFA 2BM9A 2XKKA 4BV3A 3PXAA 4G1VA 4PXAA 3X1JA 1TEZA 3AJEA 2BUCA 4N0EA 4BAZA 2F43A 2OXEA 3VNAA 3O38A 1N6RA 2W6QA 2R85A 3FUJA 3OU7A 4I9NA 3R8XA 5JXGA 4DY6A 4JZYA 4FFWA 1ITZA 2YZNA 4ZT2A 2AN4A 2A57A 1TNZA 1QZ3A 2WFMA 3QFCA 2WQZA 3F47A 3GXBA 1Z4KA 3DBVO 1NBHA 3LY9A 1GDHA 1RKVA 5BN4B 2QBYB 4FHJA 3OO0A 1GEGA 5A4AA 4DA0A 3WX0A 5DM2A 1K75A 2ZRPA 4ZI7B 5KYUA 1YE3A 2YFYA 5FV4A 4CLRB 5CNMA 1HXHA 4UMEA 5GV8A 1PD1A 5JCOA 4M0LA 3FYHA 4K5AB 4S3MA 3HGQA 3HV0A 1FRQA 4BUCA 4A2PA 3TMAA 1CR1A 2HA7A 3RSZA 4KI7A 4LUCA 1JPLA 1TCAA 2I67A 3EWNA 2J5KA 1N75A 3OPXA 2FN9A 4YMTA 1TZJA 2OO7A 4TL7A 1U99A 1QZ2A 1VIYA 1MA3A 3O1LA 4YBZA 1XK7A 4C0AC 5C0OE 2X86A 3C6QA 3HUDA 3X1MA 5HCIA 2A5EA 2WICA 2KB0A 4AMVA 1ZUHA 1WDLA 2ZSJA 1M33A 5JBIA 2PL1A 3CUEF 3D6VA 1NP6A 3DOHA 3ILXA 2EERA 1FP4B 4IXNA 3N2KA 4JV5B 2ZDGA 1TEHA 1E62A 4NC9A 2Z6AA 3SXUA 3CA8A 2HLDD 3FW1A 2FSSA 3VC3A 2GNAA 3AESA 2I03A 4XTRA 3MUOA 1NVUQ 2DYKA 3QEKA 3Q0IA 1C9YA 2C5LA 1JKFA 4A0HA 1V9CA 5KKNB 4R01A 1RYBA 3WGOA 2EP8A 3KALA 3UT6A 1EKXA 4L7TA 3LS2A 3N6XA 5HFJA 2XSZD 3GFFA 3IHWA 1W5SA 2I33A 2O07A 1DKUA 3ZBTA 5KWVA 1UBKS 3LXMA 1RWNA 2PZIA 1GFIA 5B1AE 2DULA 4JGIA 3TINA 3MKQA 4KI0A 4OHVA 2CFTA 2RAFA 1NN0A 3KAEA 2ZRKA 2PH3A 4NMHA 4LZLA 4B3GA 3HTXA 3AZOA 1DUVG 5B6JA 1O9GA 4FVTA 2Q1UA 4ZQHA 2B34A 1IPHA 4M54A 2XQVA 1RFGE 4DG8A 4M7PA 4JVOA 4W5HA 1C0LA 1SOUA 2B20A 4TTIA 3II6X 4Q0MA 4AVYA 2FPOA 2JKZA 1X5BA 1CP3A 3NGLA 2Q9BA 1RI4A 3G89A 3OBBA 2PM6A 3PV0A 2QM0A 5EUMA 1NZDA 2VA9A 3TWRA 3O4ZA 2BFDA 4LRXA 2QW0X 4HR7A 1CQJA 4OXIA 4CHTA 1RAGA 1FFXB 1GSHA 4MKTA 1ZIOA 1SQMA 2ONCA 4PM4A 3K73O 4FKZA 1YE5A 2IS6A 2IFUA 1FX0A 4DV5B 1ZHOA 2PH1A 3ADBA 1ZB1A 3B1FA 1TMOA 1N2OA 1II8A 2QYJA 3JPWA 4YPVA 4IHJB 3OT1A 4YCSA 1FYEA 5KYYB 1A5EA 1I30A 2J3LA 1XMOB 5JOQA 2DLNA 3KTFA 3SVTA 4YJ3A 5I51A 5E4YA 3FWZA 4HXGA 2FPWA 2E89A 5C8YB 2OYSA 4U7EB 1J97A 1QH1B 1SXJE 3N70A 4IX9A 3V4PB 5IAAA 5FZSA 1N5DA 1TE2A 3C5EA 2CBZA 1QCDA 4GMGA 4BL5A 3CW8X 4NCXA 3L7AA 1SURA 1E7RA 3OZXA 1U9IC 2ONJA 3WNQA 4MA0A 2AG1A 1WEKA 3PI6A 5IUJC 1RCTE 2CXHA 3Q3HA 1XU7A 5LP6C 4II2A 2ECPA 3NHKA 3KB8A 3LPNA 1RHKA 1XTPA 2VIIA 5B6PA 2Z30A 3K0FB 4ZYVA 1U7XA 5E8JA 4RDHA 2IYRA 2J49A 3LGAA 1Q0RA 4ND5A 3I92A 1EDEA 4JI3B 3WA6A 1SCKA 1IJEA 1ONNA 4DR4B 5LQDA 4O60A 1HDYA 1E92A 2AXVA 3OFNA 1LW6E 1VSQA 1V1JA 2I1LA 3I72A 5AOBA 4CG1A 2GM3A 4R2JA 1EFKA 3TRFA 1DKOA 1Z8FA 1YJ5A 2Q6OA 3CF4G 3UJPA 1PSZA 5CVTA 3CXUA 4I3GA 3KCNA 2HCBA 1EB8A 5HIKA 4QREA 5IKOA 4PGHA 2F1KA 4A0RA 3FUWA 4CFZA 3HYSA 2ZSAA 3W04A 2F7SA 3S2ZA 1C7QA 4KPFC 3UTDA 3JYLA 5CAEA 1B89A 4KR6A 3VHQA 3H16A 1QCCA 2EYQA 3JZDA 4PAGA 3HY3A 1Y5RA 2GETA 4RA6B 4C0LA 1H2FA 4KXXA 4H9GA 1WEHA 3O4JA 1Y82A 4I50F 1LEHA 4XYMA 4WLOA 1E3QA 1NA0A 3AS4A 1SKQA 4HYTA 2D1TA 1EUCA 3W5DA 5B7GA 2Y6VA 3ROXA 3UIEA 5FBKA 4Q4CA 3K2IA 1DBIA 2AOWA 2FPIB 3EPKA 1Z63A 4LF9B 2QIOA 4FP9A 5E9QA 4OIMA 3KV3O 3G2UA 4KDCA 5LOVB 4B43A 1WETA 1MP0A 4IGEA 4O3MA 3BBPA 4XPIA 4JP2A 1JHXA 2E4XA 1G3NB 2AG6A 1FSPA 2VNSA 2GYVA 2QJFA 3CUUA 2FJUA 3GLFB 3HJUA 5E95A 1SZDA 2C3MA 2AF4C 4YYZA 2RD2A 4K46A 3RU9A 3I4RB 2JI4A 4FHEA 3I5YA 1PQWA 2X0RA 3U2QA 4I08A 2ZUDA 2QVYX 1ETUA 1N9GA 1DO0A 3W6NA 4FYPA 3NAWA 5H7XA 3L08A 1PJ3A 1JYEA 2ADOA 1HM5A 1P1IA 1I94B 3VJRA 1PYDA 4ZT3A 3BE8A 4XUEA 3L0BA 1ZH4A 5ERGB 4ZYLA 4H0NA 1U3VA 4QU9A 1H93A 4LY0A 4BCCA 1DG1G 2CLFB 3BGWA 3SBOA 1OUVA 3ESKA 2EW8A 4K0KB 4D1YA 3QHQA 4CG3A 3CUTA 4JJKA 2I1VB 1RQ7A 3EGOA 4A9AA 1HORA 6ADHA 2BKXA 2NO7A 1AXEA 4CL2A 5KPDA 1JE1A 5BN4A 2QBYA 1XXHE 1P7VA 1YZLA 1KIAA 2HNKA 3BB3A 1R4MA 3B7TA 1K3TA 1NX6A 1GP2A 1NXXA 3IQXA 4L5CA 3QX3A 3EH2A 2WXPA 4CLRA 4C4ZA 2GF0A 3EC7A 1YRWA 2SBTA 5IM4A 1JLMA 1FYFA 3WOHA 3GVPA 3RUEA 4RGQA 2XKBA 4XVRA 1ULAA 2H7CA 3BU8A 2IONA 2HWYA 3ENWA 1NA3A 3APDA 5FI5A 4EHJA 2QT9A 1NWHA 4GPEA 3IEUA 5BW4A 2IYUA 4RTNA 3ICWA 3OWHA 4QLOA 3OPYB 1D1QA 1Z56C 1U0NA 4UHCA 1PS9A 2LXMA 2RHBA 4NH0A 4BP1A 1YCHA 5EE5B 2JBWA 5JYDA 3EPHA 1HYEA 5B5SA 1CE8A 3KEGA 2XCRB 4WNAB 4U2BA 4Q1CA 4M1EA 2HO1A 1GQ2A 5E6UB 5AIAA 4BV8A 2PA3A 3BXPA 2F8XK 5FOSA 1Y3HA 1FP4A 5FA8A 4Z5XA 4LFAB 5CRIA 1JFFA 4UYJB 3MLBA 3OJLA 4IWYA 2LD4A 3STUA 5J4HA 4N5MA 1P29A 2X1LA 1E2GA 1NJFA 1FTWA 2QVGA 5KI6A 5JJTA 5D7BA 1VG0B 2X0NA 4YONB 3FKJA 2L0IA 1Z6ZA 3RM3A 1ZM3A 1GUFA 4GCNA 2VF4X 2VP0A 1ISPA 3B2EA 3NOQA 4K0RA 1P3Y1 2IDKA 2X6IA 2RIRA 1YIDA 2ID8A 3UY4A 4B94A 3DZGA 1GL7A 3U3OA 3B6ZA 2HYIC 3VNUA 1TU3A 3BAZA 2ZG6A 2ZUWA 4B1FA 4HI0E 2PSHA 4B3RB 5A9TA 5HI7A 3NVDA 2I8LA 3T3PB 2NAPA 3ULQA 1AOXA 2AR7A 1YIOA 4WXEA 5G0VA 3O8QB 2EGHA 3O94A 3AUYA 1T8WA 1SVWA 5A9SB 3LCRA 5AJXA 4E5MA 3GWGA 1GQOA 1YD7A 1HX8A 1HR0B 3UM2A 2FLWA 4BO8A 3L0IB 3I05A 3DPYA 1SVXA 2ZIUB 4FZVA 4AM8A 2I6SA 1B73A 4S1OA 4TGLA 4IQ8A 4DLNA 3C6ZA 3PUIA 1HMPA 1W93A 1QCZA 3I52A 2DK6A 2I78A 4AKGA 3KG2A 4KGDA 3NVMB 4P9NA 2OLJA 1N4SA 4RVOA 4O3FA 2ETVA 5CCEA 1INZA 4GT1A 4W63A 2L69A 2ZJ7A 2E4VA 2ZFUA 1J0DA 4L8WB 4RKQA 3AILA 2C5FA 3D3JA 1R6VA 2HBRA 1GTRA 1U5BB 3NB0A 3QXCA 2PXCA 3SI5A 1WUJS 5H5JA 1CZOA 5JI2E 4CQLB 2PKEA 1OX5A 4OMUA 3CGGA 3TWTA 4JJGA 2OILA 3ZTYA 3IAEA 4G2TA 1LJ8A 4UBJA 5BYBA 1BVUA 5KYYA 2GN0A 2K2QB 5IY5E 2IHUA 2R7MA 1T2NA 1PS0A 1UJ5A 1TLLA 5F7JA 2XUGA 4XD2A 2QJTA 1QU3A 3FWHA 4HMPA 5F1YA 1VLHA 3GVCA 4TLEA 4C04A 2QQFA 2FOIA 3PHLA 1NC3A 3BRWA 4PC3A 1RWPA 5C8YA 2G67A 5IDQA 4J9VA 1UBOS 3SFXA 2BTEA 4BVEA 2K2WA 1GPBA 3DFKA 2NO4A 1V3TA 3BHNA 3NC4A 4E33A 4Q7KA 5I4CA 2QXYA 1O96B 5DVZA 5CG2A 3ZHSA 3S8YA 3SGHA 1P91A 3K96A 2FTKE 3C87A 3KVOA 5IXSA 1TK2A 5DN6D 4I1OB 2ERCA 1SULA 3RV4A 3UOAB 2JJ2D 5CB4F 4DV1B 2G04A 2NVOA 2H00A 4HDMA 4WBNF 4BO0A 3K0FA 1JZQA 4ZIRA 2EBHX 5TIIA 2WJZB 2HGSA 1CIVA 1ZN9A 1Q7TA 4RD3A 4R1SA 2AZXA 1O0SA 4OAUC 4FLEA 1G66A 1V11A 3HCRA 4HO1X 4CXMA 2W22A 1O2DA 2GF9A 5KYTA 5HE9A 3RC3A 2DTXA 5JIBA 3M4JA 4RLYA 4BO2A 1TQ6A 4BTEA 2EL7A 3AO0B 4HDRA 3MS7A 1B15A 4EHLA 3P2IA 5AW7A 1IC6A 4P7BA 4JHJA 4IDFA 3HPRA 2Z08A 4D8TA 3HU5A 1N6IA 3NC1C 1W4AA 4I5DA 4YAGA 3LUKA 2Q50A 1EFVA 4KPUA 4CKCB 1A9SA 3IPAA 1LWOA 3I1JA 1MAWA 2FAXA 2AEMA 3TX6A 3ZDCA 3T9KA 4BKOA 1EP1B 4K87A 3TEJA 4IRMA 4H4DA 1F38A 1XT6A 4B32A 3NBUA 3ROGA 3G8DA 4EGJA 2JC3A 3H5VA 1XMQB 2NPIA 4WQMA 5T7BA 2WIJA 4ARCA 4QJIA 1EK0A 1RCFA 2AHOA 3SZUA 4M87A 5IVIA 4B6PA 4FR5A 4FSHA 5T41A 4EG7A 1UDWA 2X6JA 2FI1A 4CFYA 4RL6A 1ELOA 4EO7A 4HMOA 4LJAA 2IKQA 2BF0X 4DC9A 3ROFA 2IGTA 2O7QA 2P9LG 3T38A 5FTJA 2H29A 2B3DA 3G1TA 2W9JA 2CD9A 3F67A 3AEQB 4PLTA 4L3VA 1GARA 1K27A 3P0JA 3MELA 2WXQA 2FG5A 4HDQB 3QITA 2GCEA 1YBMA 5JANA 4INJA 2UYHA 2WM9B 4MQLA 2EZUA 1WOMA 3V80A 5B3AA 5D3KA 1ODJA 3E7DA 3LUBA 1ZOPA 5KCMA 5JMND 2W2KA 1LI5A 3PGVA 1D1TA 4FLBA 4OJNA 3PHBE 4E1BA 3H4TA 4KSCA 4OQLA 2V4UA 1ACMA 3OLVA 2CYAA 3AIIA 4MV9A 3WJ1A 1R10A 1KH2A 3DLIA 4UVIA 1JUDA 2Y4UA 1FYWA 4OQYA 4FCVA 2HI0A 4OHCA 4MVJD 2JIBA 3FHEA 2W93A 1KNQA 2KYRA 2C9DA 4JI6B 5AQ1A 3MEQA 2QROA 1UPTA 3PRJA 4JBNA 3EQ8A 4DC1A 3GGPA 4NVRA 3BVPA 1G5FA 3K32A 2JJ1A 1NKVA 2X4DA 1W5EA 3L4EA 1VGRA 3ABZA 2D7CA 1UAGA 1Q15A 1C7ZA 1PR6A 5FPYA 5GQSA 2QZ9A 2NXCA 5TQ0B 1SG9A 2FSPA 3CBQA 4EA8A 1QNLA 3PQDA 4KFTA 5AOAA 3DD1A 3R3XA 4TSFD 1SXJB 4R2HA 4BFTA 1OLUB 3L7DA 1UEJA 2PGJA 1JHAA 3V8QA 1Q3HA 3U37A 3TDNA 3HP7A 1P6XA 3QVGB 4R4JA 2MSWA 4G1MB 3I1IA 3VKFA 1CUWA 1PWXA 4BCDA 1Z16A 3SQXA 2XQGA 4UDNA 4HNQA 1B74A 3HA5A 4C6TB 1U8YA 1VA5A 4E2XA 3OPYA 4B4WA 2P68A 3Q6IA 1T6NA 1SW6A 3HUTA 1LGYA 4OKSA 4EGSA 2IOFA 3TLJA 3IO5A 1RU3A 5EA2A 3IQDB 5A9RA 4K3VA 4IZ6A 2VHUA 3AEXA 1CUGA 4TWIA 2Y76A 5FOQA 4QGGA 4WNAA 2WTUA 1UDCA 4JELA 4OB7A 4JMPA 5E6UA 2HW8A 3E0QA 5EVCA 3H9QA 5T67A 3TFOA 1Y9ZA 3AI3A 2DETA 4UYJA 2XRZA 2QD2A 4QXQA 3VKVA 2NZUG 1DKLA 4BIIA 4MVJH 1BGXT 2Q3JA 4GX0A 4B3TB 3QPUA 2BTQA 4IMRA 2JFFA 3MIIA 3PEUB 3KFLA 1D6SA 4UJ5A 3JQAB 3T7DA 2V9CA 1DWOA 4BQQA 1XCLA 1FUKA 3N28A 1G0NA 3JWIA 4UWFA 4XW2A 2MRIA 4HFNA 3WVNA 1BWPA 4NU6A 3ASUA 3PQ3A 1GG2A 4QVIA 1G19A 3PQ5A 3OAAA 3CNEA 3DBHB 4DDHA 4Y1EA 2OO5C 3N6RA 3Q2KA 4TTJA 3ON5A 2CLOB 2XT0A 1DEXA 1BEZA 2J4DA 5DFAA 5K8VA 4XZ4A 1Q0HA 1BDBA 1KYXA 1ODTC 5HFNA 3LYUA 5JROA 3DWLG 5D5HA 1WXIA 2C7GA 5DTQA 1V9LA 1Y8AA 3A3KA 2CWWA 2O6LA 2WU8A 4WNEA 2XZTA 4M7CA 1LDYA 3IGFA 1P7YA 5K0EA 3GELA 2L2QA 5EKXA 3IXMA 3OZWA 3OZSA 1KJQA 1I01A 3DZJA 4KHPB 1K8RA 1W6UA 4TLAA 1E6EA 2D8AA 2DR3A 2IZOA 4R3WA 1CLEA 2NYJA 3D3WB 3LCCA 2B2CA 2IBSA 2E4WA 2XMQA 3OE7D 2AR9A 3AR2A 1QVRA 4TMFA 4CQLA 3L7OA 4LXTA 3DWEX 1P9RA 1L9KA 4QHSA 1SVNA 3CC8A 3T5BA 2MYNA 4R2WA 3DYVA 4J0FA 1N95A 1HQCA 3UAWA 3WLIA 1DJLA 1HUQA 3VO2A 4WA7A 2HA3A 4LJLA 2R2AA 3KUKA 4RQBA 4J0DA 5JO9A 4LXUA 2REQA 4TOIA 2MR6A 3R0JA 3RSLA 2WSSD 4H15A 1XP8A 2F90A 3NWBA 3P26A 5AM1A 3WGJA 3ZY3A 3A2MA 2CLMB 1E79A 3H3JA 1O96A 2ID9A 1XXHB 4DJ5X 1JDNA 3S55A 4BB6A 2V6JA 1SHZA 4S05A 1U2DC 3WMFA 1G5HA 3VBEA 1JH8A 3DOEA 2QPOA 1H4SA 4DI3A 4WESB 3W9YA 6REQA 3G2JA 2BE9A 3GPDG 3PC2A 4WJKB 1F0NA 3U16A 1Z26A 3P8ZA 1VHDA 4KLAA 4EW2A 3C2QA 4C48B 1G3MA 4LKOA 3TZHA 3NDBB 3S8MA 2MWMA 3GJSA 1QOQB 2R5SA 3UM0A 4W8HA 2Q27A 4DX2A 4HUQA 1J33A 4P83A 2PNJA 1EFPB 3W8NA 3U7QB 4R98A 3JD0A 4WMLA 4ER0A 3N2LA 1RAHA 1U7ZA 1JHUA 2I76A 2UUOA 3ASHA 1T1GA 3RI3A 4D0NA 2I9KA 1JSZA 3CX3A 2IYWA 3RRJA 3OIWA 1AUQA 4FDUA 2JEKA 4GECA 4QD3A 1UUFA 2Q21A 3VTKA 3CVYA 1W4ZA 3I5PA 4AMYA 1BFUA 3ZE1B 1RBMA 2G63A 3INYA 4GM0A 3VGJA 1E6MA 1G8GA 1OPXA 3BN3A 1JYSA 2HSDA 2ZTMA 1N1GA 3PL5A 4O4IB 3BHMA 4MQEB 3TNFA 3BGDA 4YR7A 1G20E 1N2GA 3OOYA 2A92A 3FWKA 4GZDA 4KT6B 2CLEB 2ZU0C 4E70A 4EQ6B 1DC8A 1KDYA 3M1YA 4AJLA 4UU8A 4MWBA 3T1VA 1S9HA 4HXYA 4QOFA 1DHRA 3EASA 4JX9A 1U1IA 1WKCA 5FLYA 3SOZA 1DL5A 1GADO 3NXSA 5G1OA 2HQBA 4V0QA 4JKIA 3J7AC 3OECA 1WX1A 3ZWVA 5AQ9A 4D4JA 5E9JA 1A9TA 4UHJA 2Z58A 2O1WA 2R47A 1Q12A 1TO2E 1I14A 5EE1A 1MT0A 1OAAA 2R1TB 1OH8A 4HFMA 3DT9A 9GPBA 1F6DA 4RK6A 1BO6A 4NFLA 3AEQA 1WQ4A 3A11A 4H4CA 4MRUA 4ODIA 3HCAA 1VFNA 1NYRA 2FETA 3K9LA 4HFJA 2P9NG 4GP7A 3A58B 3DDUA 4JIGA 3N75A 1RACA 4CNBA 2V3CC 5ARFA 2WM9A 1PTKA 3JS5A 1Z8DA 3LKDA 3EAQA 5FRDA 4OK5A 1VYVA 2V58A 2QRZA 1CYEA 2Y27A 1IQ0A 2PQRA 4ENUA 2JAWA 4ZPJA 4RH3A 1RYDA 3ICVA 4IS3A 4DIDA 4XFKA 1FRNA 1Y3AA 4DJDC 3QKSA 3EYAA 5FO0A 3L4JA 2VBGA 4CEJA 1TPYA 1P72A 1OWPA 3WHPA 5A4DA 1Y5IA 4TS9A 1OY1A 5JVDB 1H8HD 3A70A 3HDYA 2QU7A 1FJXA 1Q1QA 4EGQA 4X65B 1MJ5A 4MWOA 4MZXA 4QQ8A 2HL6A 5FORA 3DZIA 1II0A 4L4UA 2R4QA 3WY9A 4Z6KA 4QEKA 3WKDA 3R40A 5KTRA 3GFPA 1QE0A 4YDEA 4PC1A 2HTEA 5E6SB 3WFZA 3IHLA 5BV0A 1B6SA 3W6ZA 1BHQ1 4TWBA 4KC0A 3Q2OA 2XHEA 1O94A 5GAJA 5CH5A 5TQ0A 4HWPA 4PDXA 3NHUA 2F6RA 3PNQA 3M5WA 1SXJA 3L8HA 2FR8A 3GD5A 4NDZA 3MWLA 3H5OA 4JEMA 3TGLA 3LT5A 4PG5A 1QGED 3IPLA 3QVGA 4RJLA 1SQ6A 4TQ9A 1XG5A 5M34A 2IS2A 3UWMA 4UVGA 4MB0A 4C6TA 4YWHA 3CCCA 1X87A 3BXFA 3IIMA 4UWKA 4HXEB 2IYSA 3ENQA 3KEQA 5GONB 4FFSA 3S44A 3OIUA 2HPVA 4DLBA 2K87A 3BA6A 4QC2A 1K3FA 4OQMA 3FVRA 1WY7A 3FOEC 2F3UA 1SUCA 3C24A 2XYQA 1HU3A 3JQBA 4G3XA 5AQEA 1U63A 3TB6A 1XTVA 2QV0A 2BGJA 1I7NA 1M0EA 3PQEA 1R6XA 3B6EA 1G4HA 2OCIA 3BDVA 5C1IA 1HT3A 3FSGA 2L42A 1Y89A 1PJAA 4KIUA 1SKUA 4QATA 1XJ5A 5G53C 3OPYI 3LBNA 2PZ8A 3PEUA 5EJ2A 4ND3A 2XDAA 4M8NE 1P77A 3JQAA 1ZN7A 2DKFA 1D09A 4PLHA 1PUIA 4C0XA 2VWQA 1TAGA 3QLVC 4P4TA 4DTIA 3QJ5A 3Q5EA 2P4HX 4CM7A 1MJGM 1VB5A 1Z2NX 2P41A 3DBHA 5EMLA 1E5XA 3AG3E 1LXCA 4ZO8A 3H5NA 2E2EA 1ZN8A 3MCXA 4EAAA 1IWPB 3LX4A 1C8LA 3ZZTA 3FOZA 1IHBA 4ILGA 1D4ZA 2Z1DA 1GGEA 1H3EA 2O7NA 1OBCA 4U5QA 3LG2A 3PIIA 3ZEFA 1JG1A 5K3CA 2GN2A 3DHEA 2F43B 3KKLA 1B6RA 3DXZA 5KTSA 1S7GA 1NZNA 4DLKA 1L5VA 3FPGA 1UEIA 2C2BA 4ZV4A 2ZB7A 5JWOA 4X1IB 3TD6A 2OCAA 3UTCA 3GFTA 3S7TA 1XF1A 1KXZA 3E7PA 3MYRA 5EUBA 2WQ6A 3D3WA 2P2ZA 4IW3B 4M1MA 1UJMA 3I3OA 1UXKA 5KYUB 2FEXA 1E5LA 3T7CA 1RJDA 1P7ZA 4RYLA 3WWYA 3EXEB 3MUFA 1PJ2A 4XGQA 3IP5A 4G23A 4ZCIA 2ZDQA 1KOFA 4NV0A 4IDBA 1WMAA 4AYWA 4EX6A 4RSMA 4UTVA 1OE0A 5CYGA 3TTXA 3TLGB 5LC1A 3EXG2 3BFVA 2VTEA 1OLSB 2P67A 3O9ZA 1LPPA 4FLHA 2WVAA 4JHLA 3C6XA 1AX9A 1K4KA 4FB5A 2X19A 1TO6A 2A4MA 4A3VA 4RTRA 4XH9B 3ICCA 4QA9A 4G4IA 1UIMA 1XXHA 3W4IA 3DTVD 2XCCA 3MQ4A 3ANLA 5JD3A 4LNUA 3QY9A 2ZRJA 2ZATA 2IXDA 1D7AA 2C96A 3I04M 4RPGA 5AW0A 4XB6B 4LI3X 2AMLA 4ZYZA 4U7FA 3ASGA 1X15A 3JWPA 5FUYA 3N2KB 5BOVA 1YO6A 1UAAA 4B8YA 1KETA 1K8ZB 1NJ5A 4RMIA 2PUFA 1QONA 2NO6A 4XDGA 1R0KA 1WXGA 1NC1A 1CFZA 1TU4A 5FUXA 4HEHA 1EFPA 4FFRA 2AFHE 4BS9A 3TLXA 3H5RA 2FUG6 5IABA 3CSDA 3UMCA 2D5IA 4BO1A 3DV0A 1LFAA 2IY0C 3W6PA 4JVNA 4RTOA 1MAVA 2ZBRA 4QYSA 1A0OA 5LDHA 3CR3C 1U28C 2AC7A 2WUEA 3ONWA 1EE1A 2C3YA 4Q47A 4ND7A 4FNOA 3EHNA 1W5TA 1WPRA 1VG8A 3IR5A 3P2EA 3OLZA 3GROA 1WABA 5K45A 3EY9A 2F1RA 4N3GA 1RQGA 4O4IA 1Z0DA 1WP9A 4W8GA 4MQEA 5BSFA 3IHYA 5JC1A 4E03A 2FMFA 3NH6A 3W2HA 1T4BA 4YUWA 4F38A 1EXDA 1WY5A 1HE4A 4UVDA 3AM5A 1RE1A 3E3LA 4W5OA 1GWNA 4RSYA 1O95A 4HC4A 4WLNA 4TRQA 1Z15A 4D9EA 4YRKA 3EDRA 1LY1A 3FNBA 3WLPA 1CQJB 4O1OA 3WNZA 2ICAA 4OJKA 1GQSA 1O6FA 2R1TA 7ADHA 3RRYA 1FX0B 3X43A 5LQKA 3ZW3A 2DFKB 3RS0A 1AIPA 3VR0A 2J9YB 3K0CC 3ROMA 4C2UA 1II8B 2NXEA 1ZY2A 3JUIA 1BU8A 1T43A 4N65A 3GUCA 1E3LA 3OT1B 5P21A 4O0MA 2QJOA 4GBED 5DHQA 1ISMA 3U39A 5AVRA 4PS0A 1Z68A 3OLWA 4PLGA 4YJ3B 1RJGA 2XGGA 4Q94A 1OH6A 4WWNA 3QK0A 1V2GA 3ORSA 2IHJA 3JCZA 1OHHA 1GAQA 1EVYA 2ZBFA 2GEJA 1E58A 3MGBA 4U00A 3W3AH 5KDDA 4NI5A 4FYWA 2IPXA 4BKPA 5JD5A 2F3RA 4PXYA 4XIJA 3RKSA 3M6UA 4I4NA 3CPSA 2Q0XA 3RWBA 1XZIA 2FPXA 5BURA 2QR3A 1U5AA 2O2IA 1GR0A 2AFVA 4Y2HA 1I3NA 3H87A 5JVDA 2CLHB 5F23A 1CEXA 2P9JA 2VWHA 2RKBA 4P3KA 1LQUA 3L54A 1ZD2P 3DONA 1SY7A 3WBKA 2NACA 1CSEE 5EJ7A 5E6SA 2A1UA 4TT3A 3DF7A 4DIFA 1U8AA 5JU6A 4DUZB 2P6NA 1ECJA 3I73A 1GNTA 4QPDA 4AMUA 3SJAA 4XVUA 4PX9A 4K9PA 3APFA 4R9SA 2O5RA 4EJ0A 2JBHA 2ZJAA 5KVAA 4Q4LA 1G60A 1HI9A 1G7RA 3TLEA 4WW0A 1R0SA 2G40A 2IEBA 4ZAFA 4UOZA 2OYCA 4BJHB 3AYXB 3FZNA 4ARBA 5JSUA 1XAJA 3BQMB 2P9YA 3EF3A 1MO4A 7MHTA 1PR5A 3TL3A 1V48A 2CHXA 4ETNA 1LS6A 3EBPA 5GONA 1Z4OA 2HD4A 3PKIA 1TUIA 3SQLA 2OP0A 2ANBA 1DXQA 4Q4AB 3EIUA 2V6FA 3H84A 1URPA 5AENA 3W7BA 2QD5A 3T1TA 3VVMA 2H5IA 1UJ2A 3JR7A 2OCPA 5FJJA 3ZGQA 4MDHA 4RESA 4Q34A 3D0QA 3KL4A 5FPTA 4F9FA 1WRBA 1U9JA 3JAWB 3HA3A 2OBMA 3KC2A 4RQAA 1BXRA 1CJVC 2NV0A 3RR2A 4AZVA 4Z4QA 4C2BA 4G63A 3RF7A 2ETBA 3K16A 5K09A 2PN1A 4CU5A 4JOSA 3T5DA 5DTIA 3TVDA 1M5TA 1PW7A 1QS0B 4DG9A 3F1KA 1C5KA 2ZXFA 5FPKA 1KJIA 3G8BA 2XNJA 5DM60 1G18A 4ZYTA 1NTOA 2PQMA 3Q40A 5F9FA 3IB6A 2HEIA 1YHNA 2QG4A 3VRHA 4O2LA 4LY6A 1U8XX 4IIBA 1T0BA 1Z4JA 1X1RA 1ISFA 3JQ9A 5DIFA 3RTAA 3QEOA 1VG9B 3U4MA 1N6LA 3TNLA 2FQ1A 5K4HA 4O29A 2B78A 3LCMA 1G98A 1AGNA 1Z2OX 3H8WA 1MF7A 2AN1A 4NYMQ 3SJUA 3AJDA 3W90A 5EZQA 5LPNA 3MMPA 3GN2A 2W4IA 1NLMA 2OEVA 2QD4A 1GGNA 3H75A 3KD7A 1ZVQA 1PHPA 3AVPA 3R5JA 4X1IA 3AGPA 1GKLA 1QH9A 2PS3A 4DLVA 3G2VA 1US8A 2B7LA 1NPYA 3EFEA 3ANYB 3P2YA 2IP4A 1R4MB 1EDUA 3UC9A 1T10A 5H3HA 2NQ2C 2IU0A 3ROEA 3L22A 4XRGA 1FIUA 2H51A 1K08A 1E5TA 4IJ6A 1OXSC 5CM2Z 5C5CA 5JAPA 3EXEA 3JRXA 4Z0NA 1KJWA 3NAZA 4AKXB 5HP4A 2BGGA 3ENEA 2W71A 521PA 4C0KA 4PX5A 4B2PA 1T9ZA 1D07A 4B80A 3HXPA 3M6FA 1PFVA 5E1MA 3LSTA 4N7RA 3V46A 4E11A 1Z0AA 3CB4A 3TLGA 5J5CA 1OLSA 1YRBA 1BXZA 5LIRA 3NX4A 3E5NA 4QRHA 5AI5A 4EKYA 3NQPA 1NIJA 1Y4UA 3HGMA 4HGPA 1YQQA 2PFGA 2OZLB 3T5MA 3MXOA 5EPEA 1A2OA 1CERA 1E2NA 3GGCA 2XADA 2VRCA 3VNSA 3KZXA 1CE8B 3LVBA 4RIHA 1X1DA 2FSFA 4F6RB 4KQIA 1N11A 2X41A 5AVYA 2E87A 2J5RA 2P9EA 4MQ6A 3QM1A 4NCIA 4G4SO 1CJMA 4EECA 1SKMA 1JFFB 1GT6A 3FSEA 3S2IA 4JROA 4FADA 4EHNA 1IG3A 1TIBA 1VLMA 4YAOA 3QV2A 3PF8A 4REQA 3V4OA 1T9HA 3PI7A 5ICFA 3ORYA 4R1PA 2OV6A 5B2FA 4TRJA 3F3SA 3PFBA 1IU9A 4N39A 3PC8C 4B71A 5C37A 1O6BA 4FDAA 4AIFA 5K3AA 4K9SA 5DGTA 3RVBA 2CXUA 5JECA 2PZJA 1FTNA 3TK1A 1C4OA 1FTQA 2YNMA 3D2LA 3NTRA 4TV8B 2QD1A 5J5AA 3TE7A 3G2PA 4UAJA 3H9EO 2IS4A 4DILA 3CLVA 4CLHA 5F21A 3PQ4A 4BFWA 3O82A 2Q5CA 4E46A 4GAEA 1TYQG 3ESCA 2DHEA 1COWD 2ONKA 2O3JA 1Z3YA 1YJQA 4R8RA 3C39A 5KJNA 3M70A 4J90A 1KMIY 4B3BA 4ACBA 1C3OB 4J1QA 2YFKA 4UBIA 3VO9A 4L5YA 2JA2A 2UUPA 2W5UA 4FC8A 1UQRA 3FUUA 4HX9A 3VKUA 2KS6A 2W6PA 1LNSA 4DADA 3GFRA 2W4MA 1OKKD 5AKXA 4UEJA 4YPFA 3E33A 3R9MA 3HYRA 3E0XA 2P2DA 2BT4A 2V4LA 2I7CA 2RHJA 2IPOA 2VP6A 4S1NA 3Q7IA 1F1BA 2NZJA 1AGPA 2YZ7A 4KQFA 3Q3CA 4OXYA 3KR2A 3A7EA 2XUKA 1FYVA 2G5GX 2JARA 4JOQA 2ZB4A 4YRJA 4D96A 1Z2CA 2ZYGA 2AV6A 3S7ZA 5LVAA 2Q1WA 3DEPA 4MW0A 3WA7A 4YV7A 1L5WA 1JHYA 3HO1A 3SR4A 4QOGA 5B3LA 2ZIEA 2V0GA 2HJWA 2O2SA 2FK8A 1PS8A 2YHAA 1HMYA 1RPNA 4ZZ3A 3VNQA 4BJ3A 4I55A 5DTJA 3ZWDA 2VBIA 1XKQA 3TRKA 2IU6A 4JQYA 4ND1A 4HLQB 3JD2A 4EFNA 2Q0HA 1QAOA 1ZUWA 2YN2A 1MW9X 3OIVA 1ZGBA 1V39A 1DV1A 3N71A 4RLQA 4INZA 5UKDA 1I5OA 2CHQA 4HDMB 4HEA6 4JSRA 4ZIRB 4Y6QA 1BI7B 1NXOA 4IKPA 2ATIA 1FDOA 4AS3A 3IKOB 3R6DA 2VP9A 1R5JA 2V5VA 4OLHA 3WOVA 2F1JA 1ZVJA 3KDSE 1V11B 4QQFA 1TYEB 1DAFA 3OEEA 2VUUA 4PO1A 4OX9B 5ELMA 3JWHA 4QTXA 4AXHA 3U13A 4MWCA 1E94E 4HDRB 4JHRA 4CDNA 4ZD6A 4GM1A 1T26A 3TSZA 3TG2A 4FMDF 3T8MA 4EPXA 3ZX5A 3G8YA 1Y8MA 4PG8A 5KQGA 4BERA 1EFVB 1IAQA 4KPUB 3OZGA 1HEYA 2Y0CA 4C20A 5LIPA 2EZ9A 5CLGA 4Q4AA 4FJZA 2I6GA 4QHTA 2FXIA 2GBLA 2G1AA 2AFHB 5B57C 4DT1B 5LMUB 3JAWA 5ARGA 1J49A 4F2PA 1QLJA 3P0EA 4Z1OA 2WJAA 4JLVA 1IY2A 1GPH1 5JBQA 1OIWA 4KYTA 4FU0A 1O1TA 1XJWA 5KBYA 1AUOA 2GTPA 4II7A 3D6FA 3LLVA 3ITNA 2Z0MA 5KU7A 5BR1A 1T1EA 1Q0ZA 1SVSA 1JDJA 3CSTA 1QS0A 3MAAC 1V54E 4UZFA 3GA5A 4IV0A 3DKKA 2UDPA 3VGPA 4YT4A 1Y48E 2GRAA 3EODA 1A69A 5CJ2A 4TMVA 4UEKA 2GD6A 3GLSA 3NAQA 4TKLA 1G20A 1K0UA 4MUKA 3ZGZA 4EYQA 1RS0A 5F2NA 1O57A 4TMWA 4DI4A 1WUIS 2YASA 2PR2A 5KVSA 3O8BA 3TMYA 2ODWA 2W2KB 1JIKA 1IE3A 3SC3A 4L4YA 1JSXA 4W5NA 3W2FA 1UINA 1X1BA 2XPZA 4XA8A 4KQKA 2ET6A 5TB5A 4BHTA 1MX9A 2ACKA 2CHEA 2ZT6A 2E7ZA 2GD0A 4HWOA 1UXHA 5I6DA 3MTIA 4KMOA 3COZA 4G5XA 1MDBA 4KE8A 3WSTA 2ZIGA 4ZVRA 3PE6A 2MMCA 1MB2A 2YJ4A 2W37A 5DM1A 3C7KA 3I4GA 1E0JA 2DWQA 4V0ME 1P62B 3AKEA 3F0TA 4EZLA 2JPDA 1QV9A 4QFBA 5AW2A 2ZBQA 3V4ZA 1KIFA 3M6IA 3NUZA 3KEZA 4NOLA 5F64A 4Q37A 4LJ5A 3PEVA 3BIOA 2TMYA 3Q3GE 4IS2A 2GROB 1U8CB 1UT6A 3JVVA 3HXLA 2A88A 3LO5A 4TYWA 1IHGA 4YP9A 4X60A 4WXMA 2ZAOA 1P0IA 4IIYA 3NDPA 1JZSA 3DR5A 2RE8A 3GJ0A 3FVQA 1Y37A 2CHUA 1RNLA 4RHFA 2PZMA 1KYTA 2YRXA 3RVRA 3S7BA 1B14A 2O14A 2XGJA 4WOPA 2GEDA 3TW4A 1FNCA 4HNHA 4XIFA 3L8FA 1RWXA 3JZAA 2FUNB 1RTTA 4G84A 2OZLA 3JYSA 1OC4A 3SYRA 4ATGA 2E5WA 4PSCA 1GD1O 4F6RA 3JD1A 3HA2A 3N3AC 2PMCA 4DLYA 3Q49B 2IWRA 1QP0A 2R5WA 5DM4A 2F3SA 3O3CA 4PHHA 2XA1A 3HCBA 5BXUA 1PF7E 3ZYLA 2C94A 5IC5A 1MPTA 2F00A 1O08A