4AY5A

Human o-glcnac transferase (ogt) in complex with udp and glycopeptide
Total Genus 272
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
272
sequence length
717
structure length
698
Chain Sequence
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title O-Glcnac Transferase Invokes Nucleotide Sugar Pyrophosphate Participation in Catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
molecule keywords UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYL TRANSF
total genus 272
structure length 698
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ay5A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ay5A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4ay5A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4ay5A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ay5A03
2P6PA 2FBNA 3OY7A 3UPVA 4N39A 4J8FA 7GPBA 1FTQA 3IEGA 2XGMA 2XCBA 4YNDA 3ASFA 1Y6GA 3CUYA 3EDTB 4M60A 1B89A 1RRVA 1GPYA 2GEKA 1XL1A 2ACVA 3NC4A 4G2VA 2C9ZA 1GPAA 1A17A 2AMVA 1KTIA 4WACA 3S2UA 3AS8A 4CTNA 4UI9K 2PYDA 1NOKA 3TG4A 2ZB2A 4YUAA 3Q47B 4I9CA 2QN2A 2PQRA 1FTYA 3CK8A 1Z8DA 4GA2A 2IV7A 1Y8MA 4GZ5A 4M83A 3QDNA 1XKXA 1YGPA 2GPAA 2IEIA 3C4QA 2OFFA 1ZU2A 1O6CA 4J0UA 2AVPA 4XI0A 3G2JA 3QKWA 1P29A 3E3OA 3T3DA 4EQFA 5A7DB 4WNDA 5A6CA 2BGUA 2YJNA 4CTOA 4EL0A 4O6FA 3S28A 4G25A 1YA0A 2BGTA 4EL5A 3GYZA 5TMBA 1C3JA 4UI9C 2IF4A 1JIXA 2X0FA 2UWJG 3ZN3A 5ARGA 2R60A 2KATA 2IYAA 5JTTA 1Z6PA 4CGWA 1C50A 3D0QA 5M72A 2BISA 3CVNA 3L7AA 5DXFA 3CUVA 3MA5A 3ASDA 3JYSA 4AN4A 3ZCUA 2KC7A 3ASHA 2HR2A 4M7PA 4RG6A 4KQ1A 3GZ2A 1RZVA 2ECPA 2IYFA 3CK9A 3MKRA 4IN3B 4I9EA 1IYGA 4F3VA 3ZCPA 4L22A 4GPBA 3MBOA 1GG8A 4REMA 3LPZA 2VGXA 3SYMA 1HXIA 2VYIA 2QLMA 1A8IA 3MRVA 4Z5XA 4BTAA 2ATIA 4BWRA 1E4OA 1F6DA 3VTXA 4EKEA 1XV5A 3WC4A 3L7CA 3LYAA 3ZCVA 2XCCA 3QWPA 3MEKA 2X0EA 1FCHA 5EX3A 5HI7A 4N2QA 4F96A 4LDPA 5FT9A 1L7XA 1NZFA 2QRHA 3S7FA 3Q3IA 3CEQA 2F3SA 2HYZA 2JLBA 4BFCA 3PE4A 3ZFWA 4ME2A 2ACWA 4WADA 2R5SA 2VSYA 4H7YA 4NEQA 4BQFA 4RIEA 2FF5A 2PQNA 1Y8ZA 2C0LA 5LCWJ 5FZQA 3QHPA 3Q4AB 3CVPA 2X6QA 3RHZA 3VUEA 2QNBA 2XA9A 2QRQA 3KS2A 3MTDA 1XOIA 3S0JA 2Q7FA 1BX3A 2F3QA 5BW8C 4RIFA 5CCLA 4RIGA 4AMGA 4CDRA 2G9QA 1IXYA 2XPIA 5TVGA 3ZCQA 3GUHA 2JZCA 1W3BA 2GJ4A 5TMDA 2VCEA 3DDWA 4KQMA 5D0OD 3S27A 3MV3B 3QOUA 5FZSA 1P2GA 2GW1A 4CTMA 3BEEA 3TG5A 3BCSA 6GPBA 1XNFA 1RZUA 4I1AA 4N3CA 4WNEA 4YVQC 2C1ZA 3WAGA 1QZ2A 3OTIA 3Q5MA 2LNIA 4HOQA 2FETA 4KYOB 3DZCA 3MV2B 3O3CA 1NLMA 4ABNA 3U3WA 3HBNA 3URZA 3S7BA 2Q6VA 2UY1A 3OXLA 2H1FA 4WNFA 1UQUA 4G1TA 3OT5A 1NA3A 4KQ2A 4X6LA 2L6JA 3Q15A 4U04A 2WTXA 2DBAA 2XGSA 1IIRA 4LEIA 1OUVA 4I17A 1L5RA 1QKJA 3AS5A 5HXAA 4GYYA 2F9FA 2OOEA 3NAZA 1V4VA 3OKAA 3T3EA 4UQYA 3RU0A 3ZGQA 1C8KA 2V5FA 4RG9A 3HBJA 4APOA 1KT1A 2WQHA 4WNGA 3ZPJA 4F97A 3ZCTA 2NC9A 3GPBA 2HY7A 4JL0A 1NOIA 2SKCA 1E96B 4FKZA 3ZCSA 5JTUA 2VG8A 2IEGA 2QRPA 2R66A 4F9FA 2XGOA 4J8DA 5G05C 1WM5A 2GPBA 3E3LA 1Y6FA 4RBNA 3UYLA 5G04C 3G2LA 2XCUA 2X6RA 3S7DA 2AW3A 4GYWA 2FF4A 2UY1B 2J9QA 3CVQA 4KXKB 3R9AB 4A1SA 2XCIA 4BT9A 3K9IA 1PSWA 2PYIA 2GM9A 2ASVA 1LWOA 5HQ8A 9GPBA 4MHOA 1FA9A 3DDSA 3OY2A 4I2ZA 4HORA 3CUUA 3OKCA 4MICA 2BUGA 4HOSA 4AIFA 5C1DA 3SYRA 3WXXA 3HBFA 2IW1A 2VCHA 4G23A 5BT1A 4HLNA 4BQIA 4FZRA 4AMBA 2C0MA 1JIUA 3T3HA 1ABBA 2FO7A 2HO1A 4GCNA 4MI9A 1C8LA 4GZ6A 8GPBA 2FI7A 3BD8A 4GZ3A 1QM5A 3MS2A 1AHPA 3ESKA 4QLBA 1WV0A 3WADA 1NA0A 2VGXB 4NRHB 2C1XA 2WPVA 1TJCA 1NOJA 2GPNA 1P4HA 4X7MA 3G2IA 3CVLA 4EKYA 4UQZA 3MS4A 4HOTA 3MT7A 5JJTA 1NZDA 5LCWC 4RIIA 1LWNA 4Y6WA 1P5QA 1AXRA 3MTAA 3OKPA 2C4MA 2O6LA 3ZHEA 2R4TA 3FP3A 3D1JA 4MHSA 3CX4A 5DU2A 1ELWA 2I6HA 4PQGA 3UUXA 3C48A 3TOVA 5TMEA 3CV0A 3L7DA 5FJYA 3TAXA 2IUYA 3BD6A 2VQ2A 3MT9A 3S29A 1VGVA 4X7RA 1HLFA 4W6QA 3CKBA 3LY9A 4RELA 3BEOA 1SXQA 4XI9A 1L6IA 1L5WA 1XC7A 3IAAA 3VDNB 3L79A 1JG7A 5D00A 3G2KA 3ZCRA 3T3IA 3PE3A 1NZNA 1FU8A 1PNVA 3RO2A 1P2BA 3LCAA 3H4IA 3LY7A 3QWWA 2AV6A 5ENZA 4EJ2A 2GT1A 4BTBA 4LEUA 4WUYA 3BDAA 4N9WA 1L5VA 4YI3A 1WW3A 4YVOA 3NF1A 1NVKA 1GZ5A 5KJNA 2YHCA 4UQXA 5FZRA 3OTGA 2FFRA 1SXPA 2PQ6A 4B94A 3G2HA 1GGNA 1HH8A 4U0ZA 1FS4A 4KBQA 5BNWA 1E1YA 4NC9A 1UQTA 1JEJA 5DBKA 4U07A 2YQ8A 3T7DA 3U4TA 4HWGA 2VSNA 5ARFA 3RJVA 2P58C 1KT0A 2BFWA 5I45A 3HYMB 1PN3A 1P4JA 3RKVA 2KS6A 4JHRA 3CEJA 3MQFA 3NCHA 1YA6A 2IFUA 3T5TA 4JA7A 3FFLA 1JG6A 4NQ0A 1WV1A 1J39A 3Q3EA 5AYWD 1FC0A 3G2NA 2KCLA 3QKYA 4GPKA 4AM9A 2QRGA 3FWVA 3UYKA 3CEHA 2XA2A 2FEZA 5JJ7A 2QZSA 3NPAA 3LKUA 3ASGA 1P4GA 3CKCA 1PYGA 2LSVA 2SKEA 4N5CA 5KJLA 3GW4A 5D01A 4W9RA 4N3BA 3CV3A 3D0RA 3AS4A 3OTHA 3MT8A 3KD7A 1EXVA 4MI6A 1FU4A 3COPA 4YI5A 2F3UA 1K08A 2XEVA 3EBOA 4G2TA 5KJKA 2X0DA 3KAEA 4Y6CA 3TGOA 3BD7A 1KLXA 4MRAA 3Q3HA 1Z62A 3IA7A 3NB0A 5IKOA 4RENA 5G04J 3S7JA 1UZUA 3ULQA 4MI3A 1IHGA 2PRJA 4AY6A 3LY8A 3CUWA 4GA1A 4GYOA 5CCMA 1XL0A 3RSZA 2KCVA 1L5QA 2Y4UA 2QN3A 4WHMA 4G26A 3EBPA 2E2EA 3SF4A 2QLNA 1WUYA 3H4TA 2R68A 2QN7A 4GCOA 2KCKA 1GPBA 3L7BA 3E4BA 1HZ4A 3VDMA 4H7XA 1M5RA 2IV3A 4J8EA 3OXFA 2AZDA 1PC2A 2PRIA 4I2WA 2JJMA 3BCUA 4G24A 3CUTA 3L01A 4CGVA 2QLLA 3O48A 5DLDA 1F0KA 3DD1A 3TSAA 2SKDA 3MS7A 2QN8A 4U0UA 4HOUA 1WUTA 2QN1A 2G9UA 3HBMA 3VUFA 3GZ1A 2LSUA 3CEMA 4U0SA 3T3GA 1QQEA 2QFCA 1B4DA 1Z6QA 2H1HA 4JA9A 3MSCA 5IKPA 4N2SA 2PZIA 2QN9A 4GA0A 2XMPA 5KJMA 1JIVA 3RT1A 5GPBA 4RIHA 2C2LA 5EX0A 3NP9A 4XIFA 2R4UA 3RSCA 5DIZA 3NP7A 2G9RA 4AY5A 3E3NA 3MRXA 3VTYA 1WAO1 3QWVA 4BQEA 4BT8A 2GEJA 5CHEE 3UQ3A 1ELRA 1ZBPA 4N3AA 1FU7A 3AMVA 5LQDA 1FTWA 5EKQD 2G9VA 3Q49B 2MHKA 3BCRA 3ZHEB 1GFZA 5JJ6A 3PDNA 4NESA 2XA1A 3SZ7A 1WW2A 3MTBA 3OXGA 3FROA 2F3PA 1H5UA 4X7PA 2PL2A 3RO3A 2ONDA 2VGYA 5FTPA 1P2DA 3RIBA 1K06A 3CK7A 3N71A 5D0QD 1L5SA 3C4VA 4UI9J 3MRTA 5G05J 1EM6A 2Y4TA 2QRMA
chains in the Genus database with same CATH superfamily
1WZCA 1QV7A 1KJIA 1NM5A 1YQ9A 2HF2A 3OOEA 3BQNB 3D3EA 4W7IA 5LQRA 2EZ4A 2XVXA 5C1PA 4GYKA 1SA0B 4ZQIA 1G66A 4EJSC 1ZVVA 1SBCA 4BP3A 2GLUA 4LJAA 2VRNA 4B3IA 3OU6A 1F4LA 2JCBA 1FSSA 4QGHA 4RACA 2XGMA 1JXAA 2XIJA 3FNRA 3EGWA 4BMZA 1QX3A 1VL0A 1OAAA 3GQBA 1Y6GA 3SHOA 1Q2UA 4X85A 2PBZA 5DXAA 1B89A 2JAUA 5C53B 1VJRA 2Z2XA 1RACA 5KTYA 3UHOA 2P3QA 3WLSA 3UJ6A 2IXEA 3NOVA 5CMWA 3WB0A 1L3CA 2UVQA 1D04A 3F8WA 3PR2B 3GQBB 1LRLA 4R7ZA 5B1EA 4L2LA 5GGXA 2EGUA 1TXGA 1J1IA 1NBIA 1O3YA 1XTJA 4JVOA 4A15A 1DX6A 1Z4PX 1TLTA 4CMKA 1X4RA 2F8LA 1RCUA 2QJOA 3ESLA 3R8FA 4JHXA 1G3QA 2M63A 4HN4B 4OXXA 3ZDDA 1QU3A 2J7KA 1NP3A 3QV1A 1FMCA 3I4RB 1DEXA 3O92A 3DDZX 2QE7A 2ZTLA 4D4LA 4IDGA 4CEHB 1T5HX 3TGLA 1BZYA 3F4KA 3GPDG 1XZHA 2F62A 2W37A 3S28A 1V11A 4CMGA 5JZSA 4I0WB 4G1MB 1IMOA 3THOA 4LVNA 4M1WA 3MHTA 3I64A 4LPSA 2JJ1D 2ZIGA 2UWJG 3OQIB 4MGZR 2GX6A 5DBOA 1R9NA 4TKVA 1Z4KA 2JGLA 2H8KA 4ESHA 2WK1A 4ENWA 2DY0A 2KI5A 3SJZA 3I0ZA 4D0SA 4S1WA 4GTOA 4O5OA 5DXFA 3MSXA 2YJZA 1JH8A 4PX5A 2A0KA 2OCXA 4CF4A 3FKSA 1KI6B 3GPCA 2FY8A 3EWSA 4MXDA 4Q4JA 5TX7A 4LJ9A 1TQ6A 1L7QA 4PV7A 1PJ2A 2XNSA 2P2CP 2OPHA 3VR6D 5LP6C 2PRKA 2XMZA 1ZRNA 1Z2DA 4R9RA 5A3JA 2G7MC 5JAZA 4IN3B 1IYGA 2RGGA 1IPEA 2H7XA 1K2WA 4I1OA 4I46A 1V1RB 4OHKA 1IYZA 3ZCPA 2PH5A 3PF8A 1R88A 3QTLA 3ACBA 1X7XA 1E7RA 1RXYA 2IGBA 1H5QA 3KZ1E 5D3KA 3WLOA 1WU8A 3EZ6A 1VZ2A 3ZBPA 1EFRD 1SBTA 5BW8A 2GNPA 2SHKA 4C9BB 1YRWA 3K6KA 3MGAA 3JYQA 3P5SA 4QUJA 3KJGA 3D0KA 4RH1A 2IXDA 2JBAA 3F96A 3QF4A 5LMCA 1P5ZB 1OLOA 3RRNA 2B7LA 1T35A 5IJAA 4B6PA 3SI7A 3L9WA 1NW8A 4G5GA 5LU8A 1QQTA 5ILGA 4N47A 2JIDA 4HDMA 4GRDA 3RNOA 3EXEB 1CZLA 1FCHA 5FCDA 2VDPB 1N0RA 2X23A 1OXVA 4MIEA 3FCAA 5AI0A 4TMYA 1UPXA 1E1KA 3EDMA 1R18A 4GI2A 1J0XO 2UYQA 4Z9AA 4EG4A 5IYZA 4M1YA 1SBHA 1XPUA 2HWWA 3IIMA 4G1FA 4NICA 3GPIA 5D5HA 1UOOA 4ME2A 2J0UB 2ACWA 4DLPA 3R7QA 2ICAA 1GGFA 3UNXA 1JHMA 4D43A 1XDGA 4WA8A 1WXDA 3L6AA 3HP7A 1ECPA 4IINA 5CLGA 1P7YA 1IXRC 4OI1A 3ZHOA 5LCWJ 1YVEI 4PZUA 1Q50A 3CVPA 1AO3A 2YC2C 5K0NA 5BSWA 3I5XA 3E37A 4RD2A 5KAMA 1O95C 2XDYA 1A0OA 4L4RA 2YVQA 2RKBA 4ZU3A 2HDNB 3GC6A 4HNUA 5MHTA 2X4DA 4BFVA 2V3VA 2CZQA 1Z07A 1XOIA 3GUZA 4Y2TA 4D4HA 4ZZ2A 4BFYA 5I51A 2R86A 1R16A 1SQSA 3K72B 1QH0A 2H8GA 4KPUA 4ETIA 2AN3A 4YUWA 4FLHA 1T2DA 3AZPA 3OIGA 5CIYA 3B60A 1T3TA 3CG4A 2VDRB 2ZJ3A 3YASA 1OT5A 3M4ZA 4MNTA 2J0SA 3GT4A 4MUAA 4IJUA 1BEZA 4F38A 1UMBA 1HDOA 1Y37A 3SC3A 1KZ7B 4M36A 2LXNA 4AS3A 4GICA 1CNFA 4HEQA 1ODFA 4CTMA 2BD0A 3DMDA 3KT0A 1IN8A 3IP1A 4O1PA 4WJZA 2AF4C 3TE6A 2RBGA 1WXEA 4L8GA 5EIEA 2ZE7A 5IKEA 2OUKA 5KSPA 3FW1A 4ZHBA 3GRUA 3WLFA 2YWRA 1DKQA 3UWOA 5BNZA 4NARA 1TQ4A 4HOQA 1X1QA 2B8TA 5B58C 1S2LA 1E6UA 2PKQO 4OBWA 4TLMB 5A4FS 2CMKA 1X8LA 4N5LA 4LXUA 3W9UA 4AO6A 3PVSA 1JEQA 3T6KA 2P4HX 4QWWA 1EHCA 4X8QA 4ABNA 2RMKA 5AKHA 4LPKA 5F2OA 4MUYA 4QYMA 3S7BA 1NPYA 4DSUA 2CCKA 4FMPA 5H3LA 2ZRJA 1FFGA 1EAMA 4H1UA 1IBSA 2DUUA 2GMWA 3OWXA 1KMHA 2H65A 4X6LA 3AHCA 3DV2A 3TQFA 1BKSB 3C1OA 3DTVD 1XTIA 3IVCA 3DEHA 4TN5A 4TQUS 4EEZA 3SFZA 1LB1B 1HT0A 3AR8A 1QKJA 4AIRA 2CXHA 4DFDA 4RTRA 4K28A 1K7YA 1TECE 1Z2NX 1Z26A 2GOYA 3AO0B 4XIGS 4Z6KA 5JQGF 4C48B 3RVJA 3O91A 4HRMB 1PJSA 4TQGA 4Q7EA 1Y48E 3KKZA 2GCPA 3FDXA 2IQ5A 3CNEA 2I6GA 3LBYA 1WDYA 1FY2A 4Q01A 2OGSA 4QYXA 4YJ2F 4OAPA 1DOHA 5T6BA 1BU8A 2Q1UA 2R62A 4B0OA 4J0FA 1ZH8A 2AJDA 1OYYA 3B85A 3G7UA 1WP4A 2VBCA 1D07A 4P22A 2VH5R 4F5WA 1T9GR 2QTAA 3AIIA 4XE5A 3BIXA 1HGXA 3SBEA 3TIXB 2YFHA 3RC1A 1MX3A 1NX6A 3ZWWA 4JL5A 1N5KA 1T5DX 3J5PA 3EDCA 3FTWA 4ZRNA 4YY3B 5JO0A 4DC1A 1W49A 4DR4B 1CETA 1I3NA 3IDZA 3LRXA 5B37A 1QLHA 1U2QA 4KMMA 4BQOA 4KPYA 1UBUS 3KU4A 1MT3A 4PGMA 2Q4RA 4NI5A 2RI6A 4I5EA 4Q9NA 2RBKA 1TPZA 3KUXA 5EIHA 4RD6A 4A0GA 2XADA 2I7DA 3KEAA 1GQSA 1X87A 2BCJQ 1UKBA 2V6BA 3G3EA 3GA0A 3PC7A 4KQGA 5GV8A 2GN1A 2B6CA 1SK8A 4JI6B 4MHOA 1BVUA 4MEAA 4CCSA 4NCBA 1AY0A 3I6IA 4MICA 2C88A 4DCTA 4GI5A 2YYYA 3CT6A 3FCEA 4MQEB 1VIYA 3AM1A 4U00A 3TTWA 3JAWB 5M3BA 3P4YA 1DZ3A 3DEPA 1R0KA 3H8SA 4C3UA 5FPYA 2QW8A 1AA6A 1I0LA 1KSGA 1BXGB 1KXJA 3AILA 1KEVA 3OWHA 2E6UX 3KSUA 4YJFB 5KYWA 4FDTA 3RAUA 2EF1A 4GIBA 2OENG 4JP2A 3SHTA 4QEDA 5JY6A 4IG9A 4LHSA 5FBLB 2OEPA 4WKNA 1G4AE 3ED5A 2Q8NA 1RWWA 3L5OA 3SEFA 2O54A 1XJ5A 4JIGA 4WK2B 2LBPA 2I6UA 1OD6A 2J5XA 3GVPA 4KVMA 5D51S 5JWRA 4GZ3A 1DT5A 4N0MA 5CVDA 1DX4A 4BNJA 1V54E 3LT4A 2Z2JA 3EGVA 4Q39A 4DT1B 2B0JA 1WV0A 4WA7A 5EKUA 3B7RL 3TZEA 4E08A 5BXOA 1C9MA 2XUPA 4OYHA 4WECA 2C1XA 4EATA 4G97A 1D5CA 1LD8A 4MGHA 4WOBA 2ZTSA 1PR0A 1R8SA 2QM0A 3U9WA 1K9VF 4BASA 1KS2A 4G4SO 4B3CA 4MVCA 1IBRA 3OEEA 1NYTA 5AFSA 1KO7A 4TLCA 1XUOA 1YUNA 2FCAA 2MTBA 3VNAA 4NAUA 5BOSB 1GM5A 1NZDA 2WVHA 1V8ZA 3CR3C 4P93A 4RIIA 4XCXA 5E9WA 2GROB 5BPPA 1O57A 1EDBA 1E9VA 4K9LA 4DABA 5I48A 2CBGA 2HC9A 4GP9A 4FFBB 5H68A 5A9SB 1XA0A 3LPMA 3N2NA 4XD7A 4LMRA 3WQHA 2X14A 4YJGB 2VAPA 3PWZA 1H93A 3QE4A 5KYXB 2P2NA 1PGPA 4LXTA 5I4BA 4M7CA 2AVNA 4FULA 2FWJA 1VRVA 2Y6VA 3GGGA 4RWZA 5H70A 4OI4A 3U19A 4ZHQA 2QT1A 5J4KA 2VYFA 1EVKA 2XUAA 1DIBA 1VB3A 4X7RA 1A7UA 1U3UA 1XCJA 2K2WA 1II8B 2ATVA 2JEYA 5FR1A 5KI6A 2HWUA 2PUHA 5LDHA 1UMCA 3FU5A 4KR2A 3SX2A 1ZDMA 1XU9A 1SUEA 2WR8A 1T4DA 4WI1A 1BA2A 3H2ZA 3K2IA 4ZVPA 2FSGA 5I4IA 2ECQA 1L5WA 1NW7A 4EKNB 4JJ7A 4PC6A 4XPIB 4DMGA 4BNIA 2XVMA 2J3MA 2FUEA 3I2FA 3T4PA 3THRA 4MVJG 4DBZA 1SBIA 3EGXA 1U4NA 4KI0A 3RBXA 3ZCXA 4DM4A 1NTRA 1VJGA 5I7HA 3L1VA 3LUCA 2OGUA 1Q91A 3UH0A 1RXSA 2ROQA 2AFRA 5EJGA 3AERB 3G1TA 4OGFA 1WCXA 3DM5A 3DVAA 3F97A 4G36A 1MIHA 4YLEA 1Z74A 3AVOA 3BWCA 4RO0A 1JKFA 2HNBA 3OZDA 3R9WA 4EUKA 3RTEA 2ADFA 3ORYA 4J7WA 2O9JA 4NBVA 2G09A 4D8WA 4S04A 1ADYA 3JARB 5KJNA 4MB2A 4NG4A 5DPMA 3WHKA 4BFRA 5BMOA 5ED4A 1N4QA 1G6KA 1MCZA 4INOA 5LQSA 1KQFA 2YIDA 1DWUA 4X1KA 3MMSA 3WQRA 3PREA 4QSHA 2CSUA 2X1LA 3ITKA 4K9MA 1W87A 1V3UA 2BTQB 3ADDA 3PXCX 3TJPA 2HJRA 4D3ZA 1XHLA 5EEGA 1RVV1 2A2ZA 1QE0A 3DWIA 2PYZA 4WNAB 2O0MA 3GA5A 4O2AB 3PNTB 5ARFA 1XMXA 4HNAA 4MPTA 2RGNC 3GRAA 3ZWBA 4EGSA 3FUUA 3SBTB 2P77A 3ES9A 4X54A 1MJ0A 5KO2A 1UPFA 4AVYA 4ZTZB 1LV7A 4A8TA 1IN7A 1P4JA 1RXUA 3FA2A 3ROXA 4B80A 5BXQC 1QZTA 3MUEA 3NW9A 3UKOA 1MX5A 3M1IA 5EYPB 3CBQA 4GBED 4XX0B 1DELA 1XVLA 2BR4A 2QJWA 2ZRDA 3QELA 5LQUA 1Q5PA 2GWRA 4FFLA 1G3NB 4YMWA 1TJ4A 4CMJA 3AF4A 3T7EA 3NO4A 3IH5A 3LYHA 3AESB 3RI3A 1WPRA 1KNQA 5CFNA 2VPIA 1OCEA 1TCBA 3R1IA 4PZ0A 4MYUA 5LMNB 3A0RB 5BQXA 2ZT7A 5ADWA 4PGAA 3SWWA 3ZGVA 2P2DA 1IHXA 4WEOA 3DP9A 4W9RA 3DCNA 1K5PA 3FRHA 3JR3A 1AZLA 1OHHA 4TL6A 3FU6A 1V5IA 1UDXA 3F46A 1REQA 4Q9KA 2EX0A 2WIJA 1AB6A 4WVLA 3AETA 3TQTA 2WMOA 3WYFA 3ESCA 1BD8A 4MJ7A 4GT1A 3OQHA 3U4MA 4EVRA 4BVJA 3BD7A 4FT4A 1O97C 3L0IB 3PTZA 2ZJOA 5F76A 3OLWA 3ON5A 1XTVA 1ECJA 3R6TA 2AUTA 4BE9A 4PRLA 4JI4B 4V0NA 5ITSA 5LLDA 2GAOA 2O4UX 4RY0A 1QU2A 2ZVDA 4JWTA 1UMDA 2G70A 4KFTA 3HQ4O 2EBFX 2O1SA 3D59A 3IB3A 4QTZA 3C3OA 3ULKA 3CLTC 4L2IA 4LMAA 4GYOA 3LLVA 4CFYA 2FW6A 3H8VA 4BLVA 5EZYA 4G26A 3NIBA 5DVZA 4O2BF 4TGLA 3V1KA 1HOXA 4RZ3A 1BC5A 4LY0A 4YP0A 1NQWA 3H4TA 4RHUA 3W6PA 1VL1A 4ALIA 2IY0C 2QVLA 4B8AA 3Q78A 4F9TA 3AVUA 3CH5A 2Y1DA 4Y6GB 2HJ9A 3IDQA 3MELA 5LOVF 3GRRA 3KQMA 5C8VA 1T2CA 3S55A 1H0SA 3DOIA 4ZCSA 3HI6A 1UT5A 1U5BA 4WFQA 3NX4A 3SYTA 3U7JA 3ZQJA 3IEPA 3COYA 3RAFC 3H3FA 2J45A 3I01M 2C2YA 4CKZA 4CGVA 1ZCAA 2J33A 1YZHA 2ZSDA 3EZ2A 1VI5A 2J4DA 1A8HA 4Q9JA 4ZEXA 1DRKA 4N5MA 5AHOA 3JVUA 5EIFA 1W4RA 2I4NA 2B5VA 2Z8YM 2EKPA 3CCCA 3JYHA 1DDIA 1YMVA 3OX3A 3H1FA 3SXPA 5BVHA 5JXJA 4IS3A 1MW9X 2QUKA 5DNWA 2Y0BG 5HQ3A 3BZWA 5AXBA 5K3FB 4MMZB 4F6RD 1NDQA 1S2IA 3FTXA 2JIBA 3IR7A 3G79A 2VTVA 1RQ2A 3AR9A 5AVOA 1SD5A 3ZDYB 1XB2A 1PJ3A 2IDZA 3V6MA 4M76B 2H4XA 2F1OA 4J07A 4KE9A 5EHGA 5JS2A 2B4YA 2RHRA 3N76A 3NASA 1Z88A 3BXHA 2B1RA 3U7RA 2B61A 2QW1A 3BL6A 4LE2A 5CEFA 3IRVA 3NUZA 1MJGM 3WDMA 1H1DA 4FQ8A 3SF8A 1CF9A 5DIZA 1Z0SA 2OORC 1B14A 1TL7C 3I9KA 3ZHVA 4EGCB 1RZRA 3I1JA 3RRUA 5GV7A 1DXOA 1EJ2A 3FB1A 3OIFA 4WNCA 5JAOA 4EFNA 5JU6A 5G0WA 1JDUA 3AMVA 1E9BA 2R97A 3KZVA 4IV5A 4J7UA 3QVGA 1Z12A 5F73A 3Q49B 1NAHA 1MVLA 4JBLA 1C7EA 5EWJB 3TD9A 1XZLA 3U62A 1ZR2A 2AZMA 3JZMA 3RC9A 4GTSA 4C4PA 4YAOA 4D8YA 2FLVA 4NZZA 3T34A 4Z1OA 3OXGA 5HJ7A 4I1VA 5ALUA 3D9OA 4Q3AA 3NYIA 2VNJA 1RYHA 2GAIA 2WSYB 1X1AA 1W9MA 1JDBC 3N7TA 5AQEA 4DOMA 1K06A 1SEVA 3C4VA 1JFSA 4RVBA 5H81A 1FT1A 3DWGA 5G05J 4UYKB 1BNCA 1YBHA 4TTRA 1NW4A 3OM1A 3GRCA 1EFCA 5KTPA 1NJ1A 3WIUA 4KZCA 4KXMA 5FX2A 3K0AA 2GDJA 3ZLJA 2LV8A 5D85A 2CVPA 2GTPA 2CVZA 2NTVA 3PFBA 3U4IA 5IYZB 3RYIB 5LX8A 3FOBA 4J16C 4B3RB 3STWA 3X2EA 1DG1G 5FPKA 2DUWA 3EC7A 1U0EA 4KH0A 3N28A 3EXEA 1AKWA 3H2SA 2J9GA 3A7EA 3MJ4A 4IUDS 1XL1A 3GT3A 4LQCA 2VNAA 3NC4A 4J1TA 1TM3E 1W30A 4C0QC 5BUQA 5CM2Z 2C99A 2XDAA 2WSBA 3JXJA 3H2GA 2O3RA 3LF1A 2ZAYA 3PI7A 1UFRA 5IZCC 3NZSA 1ZW6A 2JLSA 3A4MA 4JUBA 4EVQA 2Q41A 5AM3A 4H7PA 4DR7B 2QMOA 5C32A 4Q5IA 3CK8A 1KY4A 2BMWA 2ZJZA 3KB2A 3NBXX 4R9NA 5CLFA 2Y8EA 3QVWA 5KKAA 4WXEA 1WAMA 3KV3O 3UO8B 1K75A 3PXDA 4UWLA 4WOPA 3ZI4A 4DG9A 3FSGD 2WVGA 1RRCA 4EL0A 4OGWA 4ZN6A 2H0RA 1KC3A 1QO0A 1AQYA 2BFFB 3OJLA 4ZRDA 4FVTA 5TPZD 4DCMA 4HLQB 2YC4C 2XBUA 3H6KA 3KU1A 1KJNA 3R23A 4QPDA 5JAIA 2A0XA 3JRNA 3R0ZA 3RO7A 2AC2A 1WBDA 3HVHA 4MGYR 3EY4A 3MUFA 4JCCA 3AKDA 2AOUA 2KATA 2O8NA 4K6CA 4L5YA 4MUJA 1B93A 4UUQA 3GRPA 3P19A 3VKUA 1I6MA 1OVMA 1VYTA 4RL4A 2BM8A 3GNQA 5JRZA 1SPXA 3FHCB 3RS0A 3OZ7A 4HTAA 4DBVO 2PMWB 3W9BA 3ZKWB 1EGHA 1T8PA 4JGIA 3E30A 2OBYA 3IHVA 4KQ1A 1RKBA 1DGQA 4WOKA 1V11B 3VKGA 821PA 3TMKA 3G9QA 1TRKA 3MWEA 3MKRA 5B4UA 2C5GA 3MCWA 4FR2A 4FZ3A 5EE0A 2VRWA 1P3JA 3C7CB 3WMFA 2Q6KA 5CG2A 1J0AA 2ODTX 1RNLA 4CKWA 4J75A 3IUPA 1XP8A 5G0VA 5K05A 3BUAA 5M5BA 1QIEA 4XR4A 3RU3A 4ARVA 3HCCA 1G5PA 2RB4A 1O87A 5E4FA 4EVIA 2QRVA 3KEMA 5C7YA 4BWRA 1F6DA 4P35A 5AI4A 2DZOA 4J0QA 1OLSA 4L27A 1MNAA 4Z9YA 3AW8A 3V4SA 4J94A 1XCMA 4JP1A 4F3NA 1BJTA 2BJVA 4P0PB 4HZIA 3EXHC 2PV7A 1OXBB 2IW3A 2YWDA 1D4OA 1NXTA 3BMOA 3OETA 1UZAA 5EPUA 3WGLA 4MO9A 4UUMA 2BTEA 1BA3A 2JIPA 3G9TA 1GPH1 1T26A 1G5RA 4KBGA 3VNSA 1JBQA 3FCXA 4C3OB 4L3VA 2P5YA 5CPFA 4IKEA 2CK3D 3DVRX 3WB2A 1ZITA 4BFCA 1CCWA 3KRTA 4Y1RB 5B7NA 2IYEA 3GU3A 2R5SA 4WE3A 3JPYA 4U9UA 2RFMA 1EQAA 1MO2A 1Y7HA 2NXPA 4S2UA 1YJCA 2RCYA 1RXIA 1ZJYA 2EILE 3NUGA 2ZVQX 4RZUA 3QPDA 4Y2PA 3T8KA 3P4UA 2R00C 2V5UA 3CVUA 1NW9B 4U7JA 4TXRA 3ER8A 1RJEA 4GL2A 2UYOA 2V9ZA 4DUGA 4HQDA 1LX7A 2IU6A 2B2NA 2JFUA 3FMPB 4KTVE 5B1DA 4NENA 1NLYA 1RP7A 1I32A 3AK4A 3B8HA 5EP3A 5KWDA 3IQXA 2F3QA 2R5NA 3NEPX 4JJIA 3Q9UA 4Y2VA 1TO6A 3A27A 5FNVA 1SUSA 2GFQA 4CXMA 5C8YB 3SIPA 1AKEA 3FLEA 2NVUB 3LYLA 2VJMA 5AHWA 2UUBB 3FTFA 2G9QA 3AEXA 3A04A 1LZKA 3VR4H 1OX4B 1T4CA 4ZC1A 1H3EA 3ZQ6A 1QBQA 1W3BA 1UPBA 3GLGE 3H0KA 5SYNA 3ZVMA 4UQPA 4TMFA 1I30A 2W0MA 3IBFA 4BMVA 3M6MD 4LXHA 4RD0A 4EHNA 3EXG2 3L4KA 3UUWA 1T6BY 1P1BA 4AYWA 4FFVA 1P2GA 2W6OA 1J2RA 1U5BB 2R1UA 2I03A 3AM4A 2JD1A 5ESWA 3SIWA 4E5DA 5FUQA 5BW6B 4FNGA 1TO2E 4LX8A 4MKTA 1EYHA 1S2GA 1O8BA 2NU7B 2PHZA 3I2HA 3OPNA 4TXMA 4A8PA 1T1GA 1W1WA 1O9BA 2XQVA 3A11A 3D9QX 4LYGA 5J5AA 1MYOA 3VTKA 3GPLA 3CZ9A 3OFNA 3KB8A 3CPEA 2JLWA 4TUYF 3TSCA 2J6HA 4DMKA 4BAZA 2C7PA 3ZZ0A 1J25A 2HHCA 3RU9A 3Q7AA 1ZLXA 2HJVA 2QYHA 1CRQA 1NNI1 3K53A 3L6EA 4ZT3A 4BNDB 3BFKA 2P9SG 1E5DA 3FKJA 1NA3A 3DPYA 3PGLA 1WXHA 2DLNA 1KF0A 3R5JA 3DAHA 2OHHA 3NV7A 3SC2B 2F9FA 1VGRA 3G2OA 3Q40A 3WLNA 4RUKA 5B4VA 3RU0A 3E53A 1GRCA 1C8KA 3WBJA 4GW3A 3U1BA 1VIDA 3P4XA 1XZQA 2XMCA 3HE3A 3O3NB 2MJLA 1E2UA 3OJEA 2F8YA 3CHRA 2GXSA 4RVFA 3REFA 2QZ4A 3OX1A 4K6HA 4ZVQA 1KYTA 2QVBA 1B76A 1Q7CA 3OP1A 4GLOA 4TMZA 2HY7A 1V3VA 3DOHA 3DP7A 4MYRA 5E3JA 2PNJA 5JNWA 2IP4A 2NSYA 1LNZA 1UFQA 3GCGA 2QRPA 2Y76A 3WNZA 4UAJA 3GLUA 4BNUA 4C4AA 2GTHA 1J9ZA 2O1EA 1YR3A 3AESA 1MX6A 3TL5A 1VBKA 1OCRE 1A2KC 1NQUA 3AF1A 3G2LA 3O8NA 4RBNA 2AFIE 2X6RA 3EFBA 4Q3BA 3S7DA 4KYUA 2C97A 3WQSB 3PUZA 1RI2A 1RAFA 1L4LA 4J0HA 4QG3A 1V7QA 4BT9A 1NSYA 4MIYA 3WLEA 4G01B 1E3QA 1TADA 2GM9A 4DA7A 1JTVA 3KSLA 2PR2A 3UGKA 3JWEA 2IIQA 1IHDA 3HB4X 5HJ2A 2C7VA 2D4HA 5JALA 3K70D 1FX0B 4LUNU 1WZUA 2ZJ5A 4I2ZA 4HORA 1ZSVA 3NIDB 3PR3A 3ZJVA 1CEYA 3RC8A 4MTCA 1QIKA 2X5NA 4B45A 4NYJR 2A1TS 1Y1RA 5EY5B 3K94A 1LK7A 4GLJA 3ZK8A 2JBAB 3QF4B 2XYVA 2DJIA 3GNTA 4ZQFA 1FJ2A 3PT9A 4FB4A 1Q0TA 2CN1A 1FBTA 3AZQA 4FWIB 4JI8B 2JJ8A 2A3RA 2CGEA 3EUFA 3S2YA 3EJNA 2BFAA 4ZT5A 3A2NA 1ISPA 3FD8A 4MI9A 2JIRA 1V7PC 2G3YA 4JFAA 5D8DA 5F35A 1C9DB 4F1KA 5J40A 2LP4Y 1ZXLA 4JYMA 3W5AA 1JXOA 3UH1A 3GI1A 2G06A 1GPNA 4JHKA 1ZJ5A 1KTVA 2KSQA 3COVA 3TWOA 4C4OA 3ESKA 2Q5HA 4EYGA 3O4GA 5IFLA 1EXNA 1R0CA 1HZZA 4Q19A 5GADl 1E20A 1W0CA 4HNHA 4XTRA 1FUEA 1YOBA 5CIWA 5CX1B 2WPVA 3R5SA 1VJDA 5KWEA 1HM5A 1R0ZA 2FCRA 3A9RA 1PO7A 3IIIA 2YJTD 4PCAA 5D7NA 4F2DA 2H1LA 4BVBA 5AK5A 1KHHA 5DW3A 4BQRA 5ENPD 1P44A 3GLFA 4XB2A 2WIFA 3N2GB 3MS4A 5C4IA 2JK1A 5EVJA 1JJFA 1KAEA 4Q7MB 1PUIA 4UTOA 1KEPA 1DCTA 3AUKA 3MWKA 3W7BA 2Y3AA 4EUNA 3CZRA 2VXYA 4K26A 4L7QA 4R2WA 4B7XA 4A2QA 4JC0A 1FLVA 3AB7A 2O2XA 2I1VB 2P9GA 2REQB 2A59A 3HXCA 3TNJA 5FPSA 2VIIA 3CVOA 3GLKA 1N33B 5AVVA 3IBYA 3E2IA 3BFVA 1DIOB 1SXJC 3RKRA 3CZPA 1ONPA 5DP2A 4D6YA 4E2WA 2EQ5A 1UG3A 2SBTA 1SCQA 2C8LA 3GJ3A 4KPFC 1HLFA 1D9ZA 4LJ7A 3OAAA 4QQ8A 4MRPA 3WB1A 2DQ4A 4JJ4A 1H0HA 4WFIA 2NVOA 3D3KA 4OIFA 4TL9A 3LTEA 3WXBA 1ODLA 2O2JA 4M1KA 4BU1A 4CM4B 3WLHA 1Q1QA 2XXBA 4UC0A 2C9BA 5NULA 1T36A 4R0NA 1K8KG 2FMTA 1TU4A 3QX9A 4OYRA 4C7XA 4MVJH 2B1GA 3A26A 3G2KA 1ZM3A 4QQKA 4H4DA 1X14A 3PENA 3PEYA 3TXMA 2OZLA 2CHZA 3ICWA 4NURA 2C0PA 4FUQA 4JNCA 4LZAA 3U44B 1RJ9A 3ZU6A 1WMFA 1W34A 3O8BA 3RRYA 4KXFB 3LY7A 1R0SA 1LI7A 1PE0A 3E9RA 3QYPA 1HSOA 4NABA 4GD3Q 4H59A 4L2YA 4H6VA 3FSEA 4I8DA 5CGQB 4BO5A 3IEMA 3L13A 1Z0JA 1AE1A 1KZGB 1P1JA 1Z4LA 4P81A 5AK6A 1OLUB 3W1WA 2VWPA 4HUQA 5AHRA 3IVMA 3TQRA 1ZL0A 2ZIUB 1Y4AE 4EMTA 4J7AA 5FZRA 1QO0D 2HMWA 5DHPA 1CY1A 1DRWA 4J0DA 3ZVVA 2FKNA 4KVAA 3WICA 1NTOA 1P0QA 4R1QA 1HH8A 4S12A 5DK6A 4ZDIA 4PINA 5IP5A 1B0UA 2I4IA 2GXUA 3B3AA 1E1YA 3WA6A 4B3GA 4KIFA 1VCHA 2OB1A 1KQOA 2ZPTX 1BS9A 4RSHA 3OHPA 4WSOA 2ZAMA 2Q3MA 2QTTA 5I9SA 4RLHA 2Q4BA 3KSRA 2HF9A 2YQ8A 2IV2X 3DTVA 4W5OA 1H85A 1BHQ1 5AI8A 1MC5A 2BR3A 2PU5A 1GEEA 3VPHA 4DJFC 3T1VA 1N2HA 3BSWA 4BLRA 4PZEA 1CNMA 4K6OA 3HEMA 2C4UA 4YIHA 3L6OO 4EMSA 3CSFA 4FE3A 1T6YA 1UK9A 1GSHA 4H77A 3UMBA 2ZRAA 2JC3A 4JA7A 1RYDA 5EUCA 4C3ZA 1Z16A 3GX1A 1LF8A 3S8YA 3P9ZA 4FU3A 1E69A 3WO1A 2HU2A 4DMRA 1N0HA 3MCTA 3TBFA 3C3EA 1UOQA 2ZWVA 3ZC3A 4H2DA 1FRFS 2QZSA 4B09A 3MLAA 2PGJA 2DVWA 2QY9A 4NS1A 1JU3A 5HF6A 2HMSA 3TWVA 5B1AE 3CKKA 5F9FA 4UKDA 3MX3A 4KVFA 5FLKA 4B79A 2P0EA 3GW4A 3K92A 3KVNA 4A92A 1P8AA 3C14C 4L16A 4G84A 3OM8A 2HNKA 4R9SA 3RSHA 1MA3A 1ARZA 1D09A 1U4OA 2V6FA 1PQ4A 1Q21A 3JQFC 3MPOA 2YRWA 4MI6A 2AXUA 4YJKA 3U64A 5T64A 2F3UA 3WYDA 4RTNA 2Q3JA 3VISA 3EBOA 2Q5CA 3ET5A 4CEHA 5FWDA 2UZAA 3DE6X 5ETJA 1BMTA 1ORIA 3KQQA 5JHHB 4XD7D 2QAGC 3SC2A 5JJCA 3ND5A 3I5AA 1UANA 5JYCA 4TZ0A 3MJCA 4W5QA 1KAMA 4ZO8A 3BH6A 5EYPA 5JECA 4KV9A 1MT0A 3GH1A 1EMDA 4XB6B 4BMOB 1ECBA 2Q4TA 5FOTA 5CB8A 1P60A 1L5ZA 2ZPUA 1E1NA 2FULA 1VKNA 4AY6A 5EXTA 3AOGA 1XL0A 4RVOA 3SFXA 5CFRA 3KX2A 1UKZA 2ZYRA 3OPYI 4UEQA 3E9YA 1RYFA 3HZRA 2VPTA 5BYJA 2QLTA 5I9BA 3SAJA 3PSAA 4RY8A 3IVGA 4B3XA 2AJAA 5IKXA 2IZ1A 1WX1A 2CVFA 4G5QA 4FWBA 4DLTA 1HZ4A 2AWIA 4H7FA 3ABRB 3WWEA 5KJ6A 2ZZMA 3KE9A 1L1FA 4J8EA 2F8XK 3VV3A 1QS0A 5BP7A 3OU7A 1XEWY 3RV4A 3IJ5A 3NGMA 4W5WA 1Q7TA 1HDIA 1IWBB 1A9TA 4QUKA 4EUEA 1IULA 4TTTS 1MTZA 1H2TC 2EIJE 5JSYA 4MR8B 5LXTB 3ND8A 3ITWA 1G42A 2O3QA 2SKDA 5LQAA 4QELA 4N01A 2ZUVA 1RJDA 2PUWA 2HK7A 4HT3B 3F98A 4OK6A 4RPHA 5BV7A 1GCGA 3MHPA 2PSDA 1QPBA 4D57A 1CZRA 3CCFA 2OKCA 5DYTA 1AD2A 4FGLA 1E9FA 1VLVA 4MB0A 5EIWA 3T3GA 4P98A 3E4DA 4KSBA 1STOA 4J16A 2Y93A 4WGGA 3TQSA 5A5EA 5JQWA 4RCVA 5EQJB 3NWEA 2XMPA 3EGEA 3C8HA 1CR6A 1ZY2A 3HCWA 5KJMA 5G1PA 3OMSA 4ZD6A 3A9TA 2A0WA 3TF5A 2UUCB 1TMGE 1E7VA 3EMDA 4UCQA 5DCUA 2OVBA 3Q8LA 3NP9A 2NUBA 1CDZA 3ZGXA 1PFWA 1YBMA 4QXRA 3NQPA 5D5QA 3JD3A 4OVKA 2OUIA 1ZIDA 1F6BA 2Q27A 3LS2A 4D79A 3KOYA 4B4WA 4BT8A 4OL9A 4EA6A 5CXQA 2OXIA 2X8AA 4DLBA 1LJUA 2WKSA 1VZ3A 3CGWA 3FUIA 3AKEA 5AIBA 3EUEA 3UBTA 2JAPA 3FH0A 3DB2A 4EP1A 2EDCA 2OILA 3DYBA 4DIUA 1A9QA 3IOEA 4G89A 1NC3A 3SZ7A 1SQ0A 4FR5A 1ZSYA 1G4UR 2FPMA 1EJ0A 3F3YA 3RQIA 4WJKB 2NYUA 4PWZA 3ZHSA 2B35A 3U80A 4L5BA 2ONDA 4JLVA 2TMDA 4Y2QA 3K20A 4AAYA 5EHZA 1QTQA 4AU1A 3GWGA 1L5SA 4TT8A 4NBLA 3THXB 2OHFA 3L0DA 3EEQA 4HSGA 2OGTA 3IEKA 4HYQA 3QLJA 1UN8A 4E22A 2GAJA 1CUSA 2OFWA 2VL7A 5CXXA 3ZU5A 4PLWA 1QYIA 1QORA 2QY6A 4O4HB 1W96A 3E35A 4ROSA 1V4NA 3GRZA 3UAVA 2WEKA 4DSZA 1IY1A 2EX4A 1AG9A 1D6JA 3NTQA 3ROGA 2HV8A 4BX8A 4ASUA 3LP5A 7GPBA 1U9CA 2F8TA 1X1CA 5ENTD 3ZWDA 4GLFA 1EVJA 2EJBA 3EDTB 2W2PA 2ZAOA 4ZC8A 1PLKA 1EP3B 4QHTA 4DGQA 4Y6OA 1UFVA 2C9ZA 3IPRA 1EB9A 3K2BA 4KI7A 5IAJA 4E5UA 1ORRA 4TTSA 4PC7A 4BFTA 2GA8A 4GAEA 2CLHB 4UI9K 2OZLB 2ARKA 3AG5A 2QU7A 1DJQA 1RQGA 3A31A 2PGLA 3HCPA 1C0IA 5A23A 3VO2A 5BWMA 3UM9A 2FUG6 4I9CA 3PNSA 3ZD9A 4UM5A 4ND5A 4A2WA 1C30A 1A2BA 1UZNA 3EZ9A 4QBFA 4QICA 4BLUA 3JASA 4JC8A 1U8CB 2A5JA 2DULA 2F1HA 2RGWA 4TS3A 4EPTA 5LMZA 1IIBA 4AX4A 4KZKA 1M2WA 5A7DB 1T1EA 3NCTA 3Q87B 5CH5A 4A6EA 5HYVA 2Q3EA 2X3YA 3H42B 1VCOA 5FV4A 1V0JA 5C46F 1XNRB 1MHTA 2BEDA 2YHIA 5F2EA 5DBIA 1UJKA 3P1JA 4GX1A 4MWCA 1ZK0A 3E3AA 3LZCA 5FQ6A 1BI7B 1NM5C 1ZMOA 1KBOA 4IYJA 3GJ7A 2AS0A 5FPTA 4YEDA 5CBNA 1YS6A 2C7GA 2RKWA 3IOMA 2KC7A 3ZY5A 4HDQB 1XTSA 5BWLA 4FEAA 3IDOA 3R3UA 1FP4B 2ZKLA 3LC7O 3EVNA 3ONFA 5ESDA 1J00A 2IYFA 1A5BB 2PRZA 4W5RA 5AN8A 2PQMA 3RBAA 1XQWA 5AW9A 1E62A 3BAZA 4F7AA 5CD1A 5AXCA 4F3VA 3ODPA 4L22A 4N40A 2LIVA 4Z0NA 2PNFA 4Y1GA 1BKYA 4BGIA 5AI9A 4EDFA 2J5RA 2BFCB 4U2FA 3EGOA 3I73A 3OZUA 1XO1A 2QPAA 2A1UB 4GMHA 3UTDA 1KDPA 3D64A 1ELKA 4ZO9A 1E5LA 1JPUA 2GR9A 3KHUA 5FTKA 4BO3A 2HO4A 1M2JA 1VXRA 3FJYA 2NM0A 3GEPA 1ZN8A 1I3MA 2QTHA 3HCBA 3TTTA 4Y2YA 1D2AA 1P2VA 4F8JA 3C24A 2DUJA 3V3KA 2P62A 4B6SA 2W70A 4FOSA 2EKZA 2G40A 3GEHA 2WE7A 2X42A 4TOIA 3VAYA 1HE8B 1BVYF 3B3GA 2IUUA 1YJ5A 5EZYF 3DC2A 5HIKA 1Y3IA 3L7LA 1T9GS 1NBAA 3DD5A 1FEZA 2I3DA 3OA2A 3ZIUA 2PIDA 4AMVA 5F5XA 2O5VA 3VR6A 4CL8A 3ZDEA 4L0QA 5C8ZA 1U2ZA 1SEPA 3KELA 2R8XA 1U31A 2OZVA 4ZVVA 3UJCA 2ZI3A 2OHIA 1JEEA 2Q6IA 3ORSA 3A1EA 1U5CA 5C7IO 3WP1B 4G1UC 4HJRA 2A86A 4JLDA 4ZQGA 5DW0A 1SZ9A 2A14A 1LLUA 4CV0A 2EZTA 1D2NA 1YRBA 4B82A 4NZ9A 2J3EA 3HCAA 4HQKA 5CUQA 3FWKA 3K3PA 3K5HA 3VU1A 3UAGA 4G37A 3F5DA 4WKGA 5HFNA 3ZHTA 2NTJA 1Z0AA 1SCNE 2WXLA 4OF4A 3RF6A 4KVOA 3UWSA 4C7OB 1RCFA 2P9CA 3QU7A 4L5CA 2EP7A 3FMGA 2B1QA 1MAUA 2VSQA 4GQIA 2PD3A 3AU5A 4DV6B 1YDMA 2YNMA 2HXGA 3N6RA 4CDRA 3I04M 3BKWA 5TVGA 3A3KA 4OPMA 1XHFA 1O95D 2XENA 1AGNA 3BULA 1L8LA 3NALA 3V6LA 3F71A 5TGDA 1IAVA 1XAJA 1QKIA 4MAAA 3U61B 1UP7A 4A03A 4NBNA 2R5FA 4MWDA 1A7JA 3F78A 3W3AA 1NXQA 2X3UA 3ZHZA 4GQBA 2PZJA 8OHMA 1X70A 3V55A 4LYAA 3D0OA 1RZUA 2D7CA 1P75A 3NYQA 3OUUA 4TV9F 3V3TA 3NBYC 3JTMA 4DHEA 1OFUA 3ZKAA 3I9LA 4PC3A 4D45A 5KB3A 2G83A 3WL4A 5CLJA 1BQ4A 2VHYA 1ZMXA 3K31A 2P4EA 4HX9A 1BLXB 4Q21A 4ALMA 4G1BA 2D2IA 3COJA 1YHNA 1NL3A 2EQAA 4HLUA 4UAVA 3REOA 2TYSB 3IT3A 1UIRA 1VLJA 1Z82A 3IRUA 3KE8A 1S89A 3QXXA 4MRSA 3ZGNA 3VJRA 1IHYA 2J6BA 3E70C 1VIAA 3CVXA 2B78A 4MVJA 2OM2A 2QP4A 1LRJA 4OFXA 4WKBA 3OEHA 4YAIA 1XQ1A 2XUJA 2F90A 1UAYA 2FK7A 4ND8A 4R05A 4PGGA 4QOHA 4RGBA 3L0YA 1VDYA 1Q6YA 1HL7A 2AQIA 3ITEA 3MQ2A 3NTVA 4HF7A 5FP0A 4JI3B 3WLKX 2WB4A 4C22A 1ZNWA 2VDNB 3E81A 4B34A 4EA8A 5CDYA 4F4JA 4FNAA 5A71A 2MINA 5KBYA 1N11A 1XQ9A 1CIJA 1G8PA 4MDYA 1CYEA 3GRFA 4D3YA 4P5EA 4BECA 5ALFA 3R7AA 1QOPB 5K8LA 3AHJA 3RADC 5SY6A 3USCS 1KT1A 3NI2A 3SK0A 3SNHA 1A1VA 4XDYA 2OV2A 1QR2A 2YL2A 3D4OA 1S63A 2B92A 3KTDA 4OSEA 4OUDB 5DRYA 4CG1A 4EPRA 4ZVMA 5KVCA 2RAPA 2I3GA 4YRTA 1N1DA 3SQWA 1RRKA 1Y0BA 1Z39A 6PFKA 4ABTA 4D9EA 4X94A 2AZXA 2W2QA 1TJYA 3QIVA 3KV1A 2WD7A 3AQIA 1J09A 1OUMA 3UMMA 3HABA 3KOXA 5K3DA 1A82A 3OQ6A 1SCJA 2OAQ1 3CVQA 2X22A 3FSJX 1JKMA 1U2RA 2X40A 3NHSA 4LN1A 4LQ4A 3UWMA 3HJTA 3KDPA 5IW8A 1C9EA 1CZKA 1T5SA 3NJRA 3P96A 3ULEG 4E07A 1KEWA 3SP1A 3BBLA 2RSFA 3CUUA 4F2PA 5FL3A 3FHTA 5TS2A 4AJOA 2A4KA 4HPXB 4U2GA 4EJ0A 4F21A 3LKZA 2TECE 1L9KA 4ONEA 2VLIA 4EYSA 3KSMA 3W4JA 3H5WA 3B12A 3HTXA 4YWJA 3PYLA 3DEZA 3S1SA 2JI4A 3ROFA 1XROA 3H04A 1OFUX 5BT1A 3MWLA 3WTBA 3ZIAA 3QITA 4FZRA 4E2XA 2C0MA 1DQZA 1RPJA 3UIPC 1S8FA 1VFNA 4MCJA 4WL0A 1O94A 4IHKA 2ONYA 3U7QB 4U96D 3URKA 4BB0A 1JIIA 3IP3A 4RA6A 2HJSA 3C8UA 4XJTA 1CB0A 4TWBA 3ZDQA 3FRIA 1WF3A 4IR7A 4MWOA 2YICA 3EHEA 2JGIA 3MS2A 3QPVA 4N6OA 4BWGA 4K9NA 2ISCA 4N03A 1FFYA 1YTLA 2I4RA 2ZU0C 3A2LA 4PAGA 5AKKA 2L19A 3K09A 3QLUC 3HSKA 5EFOA 3D9IA 3TL6A 2QWXA 3U5ZB 3LPLA 3H65A 2HJWA 1E6MA 1BXZA 3K6JA 3DL7A 4WOJA 4XXHA 5EUBA 2DB3A 2LVBA 2E3JA 1X42A 3NWOA 2PMDA 1BS2A 4R81A 3B6MA 4WN9B 4F7DA 1PTKA 3PFKA 2PUDA 1CUHA 2CXPA 1E9DA 2F1JA 4XGNA 3IOYA 4KWTA 4HAVA 2ZDGA 4ZQCB 1Z5GA 4ZO6A 5GONB 2HM7A 2VPXA 5HVNA 1MBZA 1BX1A 4ZVUA 4UMFA 2BR5A 2I7TA 2XE7A 3D6UA 1JFTA 4PQGA 4EJFA 1LS1A 4ZIRB 2RHBA 3FCUB 2HK9A 4MKGA 3DE5X 1A9OA 4KQJA 3A3NA 4X41A 4YQYA 3T1TA 2FX5A 3VZSA 5JCXA 4QXPA 2LUHA 3KYIB 1SCUA 1E61A 1X1EA 3LLCA 3AJ9A 4G5YA 3X1XA 4L76A 1A7AA 1DWOA 1T4MA 2AX4A 4FS8A 4AS2A 2VP4A 1V9CA 2HBRA 3FYTA 4OD0A 4RELA 4PN3A 2LKDA 4L23A 4MH0R 1XD9A 1GYQA 4LRQA 4LRUA 4AW9A 1J0BA 2D5LA 3F6QA 2RGUA 5ENVA 1GGMA 3IQHX 4TKZA 1F14A 3VI3B 5IH3A 1Y3CE 1AURA 4RQTA 2ZYSA 1D03A 1DE0A 3FGZA 3NHUA 3ZCRA 1M7HA 1K1BA 3FMOB 2XT6A 2B1JA 2P3LA 3N86A 4FM9A 1OYVA 3E61A 4YCDA 1QYMA 5ALWA 3E9EA 2BTOA 1XRRA 1PNQA 2D0DA 3B38A 4FDLA 5DK4A 2HEIA 3RGWS 4KR6A 2VNHA 2XZOA 1QPGA 3ER9A 2EARA 4GMLA 1H1LA 1EIZA 3HEBA 2Q46A 3HGTA 4XX1A 3HK2A 3WGJA 4UVHA 2WYOA 1PT8A 3DLIA 3EQ9A 3FYDA 2AFVA 4RKWA 4DILA 5KKNB 1OLXB 1VKJA 3EVFA 4YI3A 3LECA 5FL7A 4XGKA 3PNOA 4NV1A 1HE4A 1O89A 1X0XA 3O2JA 4D3DA 1G7SA 2AG0A 1YQEA 2JW5A 2ZRBA 3DFFA 3KP1A 5JADA 3GXOA 1E6EA 2NAPA 4FADA 1V26A 5JCJA 2CFTA 2E9SA 2VYQA 2YWJA 5H1YA 3TFOA 1AKMA 3MGKA 5CEEA 3X1WA 3OMLA 3LKVA 4DJTA 1X80A 2CL5A 1KETA 1I4TD 3WWOA 2R84A 4C78A 3BRQA 2F2TA 1UJJA 1TMKA 2FMHA 3MA0A 4JLJA 1RYBA 4P0TA 3SHFA 5DSTA 2V7PA 3NMUF 1R4AA 1U7UA 4JI0B 4FMCB 3FUXA 3AJ8A 3LPAA 5ECYA 4TKUA 4TWIA 3WIDA 3LXMA 4AKEA 4DWWA 1VMIA 4OKIA 3UZUA 5ILQA 1JR2A 4QM6A 4WH0A 1J39A 4E15A 2J3JA 2C0CA 3CRW1 3LUAA 1UWCA 3PTLA 2GHRA 5JI2E 1ESNA 4O4LB 5CFQA 3HXMA 1F2UA 1T24A 4M1QA 4DV4B 1G1MA 2YKGA 2YXPX 2J5KA 5JCPA 2IYOA 3C4JA 3ASGA 3DMHA 2HIGA 4YPOA 1P5JA 3MJRA 5D84A 4YCJA 1QH9A 4Z7NB 2LO6A 4OO3A 5KNDA 4RKFA 4EY7A 3RFUA 2PZLA 3OOYA 4CMIB 4P33A 4Z53A 1G17A 3GYBA 4BX2A 4F5DA 1YKSA 3BXXA 4QG7A 4YGXB 1JS1X 1NSFA 4ECAA 1HR0B 2C5SA 4EEKA 5ANRA 3ZJ4A 2X4LA 2LDBA 4F84A 1ZBQA 3UFBA 3DBVO 3K9WA 3H9UA 4FMBB 4QQIA 2X6HA 2OQVA 3GJ5A 5E3HA 5AHKA 2WJHA 3CLHA 3PVLA 5AJXA 4Z86A 3HDQA 3OI7A 1TQ2A 1ZNZA 1NRJB 4J7XA 3LLSA 4LMBA 3VPDA 2Z98A 3CMMA 2X3MA 1PTJA 3QG1A 3ZQKA 2OCAA 4MI3A 5HS0A 1PRYA 4BO4A 4O4IA 1JN0A 3DFUA 3QPBA 4CMBA 1L5YA 3L49A 4JBYA 3HV2A 1LBHA 1YZ3A 5JQGA 3SF4A 2PMKA 1F8XA 4GPIB 1MQ9A 3F5SA 3R76A 1QBKC 2I9PA 2W2LD 2CJFA 2Z2IA 3L06A 2X5TA 3DGEC 3MXTA 1T4GA 2P7HA 3FNEA 2B83A 4D7AA 1U04A 3WNDA 1RDFA 1VE6A 1P7WA 3L07A 3VDMA 4ZYWA 1RMQA 5MN5A 2BZ1A 3BG5A 1WUKS 3E5NA 3QU9A 3ZS9A 3ZDXB 1YQQA 4YCAA 3ZY4A 2IOSA 4JUAA 4CF7A 2PPLA 2F55A 1R7RA 3CEPB 4Y7DA 4AZ0B 4CQMB 1PKXA 3S1AA 5K0JA 1QHHA 1YJXA 2J07A 3B89A 1WPGA 3WIOA 1Y8RA 3SQVA 1OTYA 2Y1OA 5BUSA 3VPXA 1MX2A 2BEUA 2OBLA 4LC9A 1FQWA 1Z34A 3DMYA 3ESXA 3L0BA 3MS7A 2X4GA 3SEZA 3D4LA 4GC9A 3WNVA 2JHAA 2WWFA 3AWIA 2BY4A 3KR0A 4FOPA 3F5FA 4M89A 1M66A 2Y1XA 1BE1A 2ZREA 3FZQA 3NWJA 3HZHA 3I6BA 4NJEB 2WWVD 4EY8A 2XTZA 3K6SB 4L28A 2ZZNA 4O60A 1FXWA 2YTZA 3G8AA 4IWNA 3T5CA 4DCNA 3IEVA 4ZAWA 2FPGB 2QPLA 4NZMA 3RFFA 3UK6A 4HO1X 4CM9A 1KJQA 2V1XA 4GA0A 3PA6A 1E58A 4R7TA 4TLAA 3GGCA 3QEMA 4A82A 1JR4A 2M1XA 3FTQA 5K8TA 8LDHA 5EOVA 3ICEA 2C2LA 5EX0A 3I30X 1DC3A 2E2WA 1EVQA 1GTZA 4PGHA 2V7BA 4X93A 2WF9A 3PDIA 2G17A 3R5HA 1I4WA 3L6DA 4GWKA 4M53A 1YNSA 3UQ3A 3K5WA 4Y6QA 5C5EA 6LDHA 5K09A 4LBVA 3W8EA 1YQWA 1DKUA 4ANWA 1ORVA 4PWYA 3HM2A 5ERGB 3S81A 2IEYA 3TTVA 2NUTA 2WTNA 3DFMA 1N77A 4JFRA 1JMKC 2IYXA 4J03A 1FNSA 1RPAA 4R1OA 1IY2A 3VC7A 4UVDA 2I1QA 1MV5A 3L40A 4XGRA 2G1PA 4KB5A 4A23A 1RBYA 3UT8A 4PNEA 2WXKA 1A1SA 4D9BA 1GLVA 3IAHA 3N71A 2ZT6A 1W5TA 2C8JA 4ZMRA 3BG1B 2QJFA 3S99A 2DWPA 1XVVA 4L2IB 1VSUA 3U81A 3V4OA 4U0KA 2IHNA 3GV0A 4A7PA 3LQKA 4I55F 4OXRA 5AWFC 2M32A 2F7SA 3FYHA 3LIIA 4D10C 3QE3A 4NYIR 4JSRA 4XCQA 4X1KB 4ZVRA 1EGQA 3B13B 3PUKA 3QGMA 3MYYA 4QOJA 1ZP6A 2IXBA 1FDVA 3HY3A 1RABA 1F1JA 1C3EA 4DMUB 3R7NA 4INJA 1F0YA 3TQCA 2EWMA 2XSZD 2H11A 2OY0A 1Q57A 4UQOA 1PDWA 3RRFA 3SGLA 1TD1A 5C8XA 1NKSA 3USZA 3K8OE 3KNZA 4S2EA 3M6IA 4A0HA 2PKQP 3HL4A 4IZIA 4O1HA 2IU0A 4GTQA 3KQWA 1FDIA 1GZHB 1YR6A 2I4LA 2MYUA 2I7XA 2Q1TA 3NNNA 5CFZA 2EFEB 4FGKA 4IUBS 4DUIA 2C57A 4HFMA 4PSDA 3RKUA 4KE8A 4UNQA 2PQRA 1FTYA 3JQRA 4DIMA 1JHQA 4HWSA 1YDGA 3ONNA 3ZHRA 1GZ7A 4OLAA 2V3WA 1GY8A 3DE7X 4I36A 4OREX 4C08A 3G59A 3PRZA 4FX2A 4LJ4A 2YXEA 1LX6A 1ZU2A 1UMCB 3RTGA 2AVPA 4IL5A 4E2YA 5KYVA 5G41A 1V43A 3AR7A 3WFZA 1RE0A 4NFLA 4G25A 1GAQA 4LXYA 3CKMA 3I58A 4I4CA 1H8HA 4UNRA 3GUYA 3TWXA 2O23A 1PBNA 3GXBA 1O5MA 1RTKA 4FE7A 1QG4A 4QSMA 3ZPXA 5CCEA 2R8YA 2NIPA 3AHEA 4RK0A 5LD2C 2G82A 1Z6PA 1G8MA 2C9MA 3VQTA 3ZGOA 1PSZA 1ADBA 3ZYCA 1Y8QA 4E3WA 4G0WA 4JUCA 1B00A 4IDOA 2EX1A 4PFJA 4W8OA 2EDAA 1J90A 3UJNA 3AIOA 3I72A 1RLOA 5U9CA 1G5TA 3AEZA 3ZWYA 3EHNA 2AHOA 4Q3NA 3WISA 1F06A 1OLSB 4NMWA 4BO8A 3WA7A 1FIUA 2PLAA 2JFGA 4KXVA 3J80A 3OPMA 4LS3A 1QDEA 3AJIA 1YVDA 1DVPA 4QOSA 2Q2NA 5CJ2A 3C15C 1NNEA 1Z6XA 5DNYB 2H63A 4GPBA 4AS1A 4RQIA 2E4WA 2Z3ZA 1GO2A 2BI4A 3E22B 2Q5IA 3QWBA 4QXMA 3ZZTA 5JNUA 1G2OA 4CDNA 5JWOA 4UMDA 3QC1A 4TSFA 2Z2KA 4PAOA 1J6UA 2C20A 2AZTA 3LQRA 4AC9A 1ZK3A 4DQVA 1N34B 4O0LA 1RRMA 3KOWA 1S1CA 3HWX1 4D0RA 2GM4A 3JRWA 1UEJA 3B7TA 2XH8A 2MYOA 4GPAA 3L7CA 4P80A 2JB9A 3UY4A 2V4UA 3M6VA 3HJFA 2MR6A 3OAWA 3EARA 1AS3A 4DGSA 4ZO4A 4EB6B 3OQ1A 1E3SA 3O8QA 1FNNA 3H11A 3FVWA 5IVHA 3CLSD 4YJFA 3U3RA 5KYWB 4N3GA 5CVUA 3E5HA 3Q3IA 2G76A 5JYBA 2GB4A 4TTIA 1JUDA 4UM8B 4L02A 5SYAA 1NQXA 4U7TB 4C0KA 4HLUC 2AE1A 3FNQA 4FD2A 4EBAG 4LFCB 1P4RA 1DL5A 1GT6A 4MW1A 2ZB7A 2JGFA 4BQFA 1OXJA 3T7TA 4F1PA 2CXXA 3NTOA 4CR7A 3AEKB 2C9CA 2VOJA 2W6NA 4F53A 1W8DA 4E32A 5DWDA 3FPFA 4BCDA 4ZREA 1H42A 2P5UA 1G1AA 1R10A 2RJ3A 1EDUA 1GTRA 2GKGA 1KR5A 1Z33A 3E9ZA 2YFYA 3SIXA 4C2UA 3Q7SA 1X1BA 3PQ2A 2YS7A 3W1VA 1A98A 1X7WA 3KS2A 4UWHA 4JVSB 1XRLA 4D41A 4OLBA 4FC7A 3O82A 1QV9A 4DQDA 1BN6A 1SQMA 2QQFA 1EDZA 3IBTA 3KLOA 3ZJUA 1JVNA 1EU1A 3QHAA 4IEFB 1ZM4A 2DH5A 1KQ3A 4N8DA 4QGBA 1TDJA 2ZIVB 2EIKE 4L7TA 5JVDB 5LIPA 3V8EA 5K0EA 1TF5A 4L9AA 3ZLBA 4KRFA 3ENQA 1OI4A 2EHDA 3TIIA 3U4CA 4CV3A 2WUFA 3H2HA 4CKBB 3MQ4A 3EGCA 5G4KB 1CY7A 2XMRA 4JOCA 2PLNA 1GKUB 3CSTA 1CIPA 1DO2A 1ST3A 5ECWA 3FLMA 4HS4A 2FN8A 5FZSA 4C0JA 5CTAA 2VZLA 3C3XA 3NWPA 2EJWA 4CYMD 1XIVA 1S9HA 3PK0A 2HQOA 4GOXA 4ZALA 2V4LA 3VHQA 1EINA 4LVOA 3TXNA 2NTEA 2F8MA 1QZ2A 4BGEA 3VR5D 2AUNA 2WI8A 3CLVA 1OFTA 3TQOA 3N8DA 4XQGA 1LC0A 3NHJA 1HEYA 3RR2A 5AW8A 1I2AA 4O59O 4GI3A 1ILWA 4U4AA 521PA 5HMLA 4E70A 3GAZA 5L3VA 2ISSD 3OXLA 1N2CA 1TT7A 2DRIA 2H1FA 3UGQA 3WWPA 4QIHA 4UXJA 4Z1MA 5INTA 3IP5A 2BL4A 1L6RA 5H5JA 5CA0A 4MB6A 5ARBA 3Q15A 1ZSNA 1R0YA 1WULS 4KRYA 1EK1A 4MYHA 2EJVA 3O21A 4F0JA 3T5AA 1C7JA 1BD3A 4YT4A 1D0IA 2HIAA 2YH2A 10MHA 4IDEA 2H5JA 5DLQC 3KUKA 5AYVA 1V4VA 3OFJA 1QO7A 2A9FA 2HCRA 2BMVA 1YB2A 3A8TA 3KPJA 3PFCA 8AT1A 5KWVA 1V9LA 4ATNA 5FTLA 4B3JA 1UJCA 4APOA 3LM8A 2X9NA 5DTMA 1YU6A 1V6CA 4Y1RA 3OZVA 2YVKA 4BVEA 2ZAIA 2VPQA 5IZCA 1F3LA 2BHSA 3BJMA 4EQZA 2OZKA 4OQZA 2OLJA 1XTZA 2FSSA 2VNSA 4R2IA 3WLRA 5JTUA 2WJJA 3QPUA 3W5BA 2GNOA 2OQ2A 2QMYA 1Z3CA 3MYRA 2AVDA 3DM9B 4YJ3B 2DCPA 4MMXB 4UDNA 1E0DA 4GUDA 1DAHA 3QBEA 3NBUA 1BCRA 4LXQA 2VDQB 5HTKA 1XK6A 3NFRA 5A3RA 4CIYA 3B6KA 4PHTA 5ER9A 1E8YA 2B4QA 3P9PA 3R09A 1CY2A 2AR9A 3NHRA 4L07A 2IXFA 3CYFA 1K0FA 4MS3B 4FHJA 3WMWA 3INGA 3NM5A 4CHGA 2XCQA 1W36C 3DDSA 3EIFA 1ECGA 3H75A 4KAAA 1EM8B 2FGKA 3O4RA 2NO7A 4FD3A 2ZBRA 3ROTA 3UJ7A 4WCFA 1MZCA 1KH3A 1U4SA 5TJHA 3WVNA 4JU9A 3QE2A 5JMND 1U7XA 3BGIA 4HK4A 3W79A 4YAUA 1U99A 2HA3A 3LT2A 4M7OA 4K5QA 4L9RA 1OF1A 4ZRMA 2DEUA 1E8NA 5CBKA 4ZV4A 2JBWA 2H57A 4MKXA 4ETMA 3LD9A 3ZEAA 2TS1A 1NMZA 5H16A 3MJHA 5EZSA 3TVTA 4HBGA 4U7DA 4C6TA 1FOEB 1XRMA 2HR1A 4NATA 2P4QA 1JIUA 1OXTA 1RYMA 4QUIA 4UEWA 2XQJA 5DFAA 4OFWA 1XDZA 2VDJA 2PFSA 3AKZA 1V1MA 4MA0A 3EE6A 3LBNA 4PSUA 5FBHA 3TG2A 3T3OA 4OMUA 2BHTA 4ENSA 4NRHB 1EF1C 4KYTA 1NG9A 2NT3A 5F7JA 4NOLA 3FDFA 1GUZA 5AKEA 1KKLA 1UFOA 3O8DA 5TB5A 2J87A 1QVAA 2NXCA 4Z7JA 2YQ5A 3FTVA 2ZBQA 4YQZA 1GGKA 4D02A 3IAUA 1ZUHA 4DV5B 4NPCA 2OCYC 3BTVA 2X0RA 3OOSA 5ITZF 2OC4A 3A9SA 4H16A 4A2CA 3C43A 1JHZA 5F23A 4OFZA 4KQCA 3WL8A 4C6SA 3L8MA 3DOFA 2CDAA 3AUJB 2XQIA 3MTAA 5AUOB 2OOSA 3CEAA 4JP3A 1WQ1R 2JPDA 2OD2A 4R5MA 2W8ZA 4MR7B 4OAOA 4Q12A 4BMDA 4E03A 4W5JA 1UBLS 2I6HA 3LCRA 2CJWA 5MGBA 2JI7A 3CQGB 2I91A 2VHJA 1APBA 4LSZE 1Y7TA 3T1HB 2WUWE 4JR1A 3CURA 5F51A 2IU1A 4EZLA 1NE7A 2JGAA 3R5XA 1BROA 3BWYA 1KARA 2FG6C 1VHJA 2AKYA 2GBIA 3EOAI 3H5IA 3ANLA 5D3MB 2FZWA 4DM7A 3OBIA 1JMVA 1IC6A 2FG7C 4EMBA 3GLIE 4DUYB 3V2IA 1SXQA 3O3MB 3AVXA 1T8TA 2ZYTX 1RLJA 4B4DA 4RM2A 1OI3A 2R9VA 5F1PA 4JOSA 4FFDA 4QNRA 4N5DA 2YINC 2ZAGA 1EB8A 4L72A 3I6QA 1N54A 1EM8A 2X13A 5LA6F 3K8ZA 4ZAFA 3EQ8A 4PLGA 1SN7A 2YY5A 5D00A 4YYEA 4EPYA 5CVTA 2NSZA 3J5QB 4D0NA 1KOGA 1NZNA 5FQNA 3DKIA 2PKEA 2I2XB 2VZEA 1IL0A 2AI1A 1SAYA 3QKUA 1JPJA 2HX1A 3QWWA 4YT8A 4GSLA 4TLEA 4CM6A 2XNHA 1GNTA 4FJZA 2OSBA 4WUYA 2GJ9A 3NWBA 1R4ZA 2B82A 1M6NA 5BNTA 4C4TA 1E2EA 2QW0X 4OMCA 5BN5A 3HO8A 4XASA 1I1QB 4HDNB 5FUXA 5LLSA 5T8KA 3ZWAA 5CA0F 3V4RA 5DH9A 4EHHA 3DVQX 3UT0A 4F06A 3HYCA 1P9LA 1EP9A 3SU8A 2FPIA 1AUXA 3LHIA 1GRNA 2EU8A 1P7PA 3VCXA 1LLCA 2A3NA 2QV7A 4QDKA 3WRVA 5K99A 3IVXA 5DBHX 2ZSUA 2GRMA 1JG2A 2PUTA 4R2KA 4DJ5X 3B9BA 2WT8A 5KJ1A 3DPSA 2X8LA 4BEVA 2CL7X 1SKMA 2BFWA 3OQIA 3T15A 3HXEA 1GG5A 3V9PA 2DHQA 3D9LA 2JI9A 1L4YA 4HATA 3EF1A 4OHYA 2PZAA 3BRSA 3O7MA 1HF8A 4BCCA 3VYRB 2Q5FA 4DUGD 1EUYA 4ABYA 3UAWA 3T5TA 1H6DA 4P36A 3BMXA 4BJ5A 4BNTA 4BTEA 2ZYUX 3PFIA 2GF2A 4BKMA 1LPAB 2ETVA 2H07A 5AR1A 4RJ2A 4C06A 5DMXA 2P1RA 2Y6UA 3GFSA 4MWZA 4WIAA 3DSWA 1JDTA 2BWJA 1QFXA 5BSRA 3RVQA 3VZRA 1MA0A 3Q8XB 1OAKA 2ZRQA 5IDYA 2VO1A 2AOTB 5CDTA 1NW3A 1XEFA 4G0PA 4N12A 5AJTA 2W9XA 2IOHA 2SKEA 1CDEA 4F4UA 2NP7A 4N5CA 4NK5A 5KYUA 3KXLA 4RDHA 2O1XA 4XZ3A 1PX0A 1K86A 3A3PA 3VSDA 5CT9A 3TGPA 3EPLA 3CW8X 2AQKA 1NJGA 3DZDA 3FZYA 1V8FA 1K98A 3U49A 2P30A 3ZNPA 1S8AA 1H5NA 3CZ4A 2BMJA 5KJKA 2Q6LA 1R0BA 3DKKA 2X0DA 1MIOA 4Z3DA 2R1ZA 3U0BA 3ENEA 2DERA 1C9YA 4W8GA 4MRAA 1T2VA 1FK8A 1GRVA 4KPEC 2OMEA 4G1VA 4NCAA 1QHFA 2Q50A 1QFZA 2GJSA 2R1VA 3WE7A 4MW0A 5CGZA 2IFTA 2P68A 3NB0A 1QK3A 1GW6A 3RRMA 2AH5A 2UVPA 1DMSA 3WDKA 5E9QA 2PRJA 2HUNA 4FFOA 2FUCA 4HQFA 4DJAA 3BZBA 1FDUA 3FI9A 3W05A 4LYYA 3VVBA 5TQVA 3WSVA 4OP2A 2I3AA 1EWRA 1Z6YA 2DPMA 3CCBA 3EODA 2NQ2C 2W6QA 3L7BA 1C3OA 4BFXA 3PEVA 3V5NA 4LIPD 3DDOA 2PKYX 2V0GA 4LRXA 3MAGA 2ACKA 2ONCA 5L51A 3KD3A 5KQGA 4QU8A 1Q7RA 3BJRA 1KH2A 3ZKWA 2AZDA 3PG5A 2IH4A 3PQCA 3KHSA 2FW9A 2H6IA 2NO1A 2Y92A 3H13A 4H6XA 5KZMB 1UBFA 3BCUA 3GJSA 4ADSG 4QYIA 4E5YA 2ZBUA 3S70A 4E31A 3TKAA 3DD1A 3SXUB 3WDSA 1USIA 4YRBA 4RTLA 2BKVA 3MOSA 1U7HA 3QVSA 2JLQA 3L0PA 3OX4A 4IXNA 4JBXA 4KQWA 1U7OA 2EGHA 3FYUC 4G5RA 4HGYA 4QO7A 4IDPA 5TLSA 2ZXWE 3LTNC 2VJDA 1BVRA 4OGKA 2IELA 4V1CB 1SBNE 2VUSA 3CNLA 5FI3A 1FFEA 1R0WA 2HB6A 1AQJA 1F0PA 3QOFA 4QDTA 4YRIA 2Q3DA 1X3SA 3UMSA 3FVQA 1EE1A 3ZBTA 3LW8A 4YS6A 2J67A 2H16A 2X15A 4O4HF 4B74A 5A2GA 1WPXA 3B70A 2XF2A 4LCJA 2VUIB 4C43A 1RXVA 2M9MA 1AIPA 4UAGA 4RDCA 1G8HA 1S0PA 1OZAA 1QHHB 2N42A 4COKA 1SC9A 2ZJ6A 2P69A 2RH9B 2VXBA 2FFQA 2ZRMA 3SGHA 3ACDA 3VKFA 5LM3A 3DA8A 2NU8A 4C3VA 4I3GA 4U6SA 1H05A 4EFDA 1R00A 5L40A 2OLEA 4FCVA 2IE0A 4JH0A 3WLJA 4ETNA 1X7WB 1E2LA 1KR2A 2OL4A 4JI7B 3JX9A 1SZJG 4GAAA 4P58A 5ED0A 5CHEE 4EHDA 1R37A 2WXPA 2OP1A 5DYWA 3KQKA 4X62B 4HXEB 1F12A 3QK0A 3DKPA 1QGYA 4I19A 3U7FB 3FFBA 2CL0X 4F1JA 4ZTUB 4MPDA 2X9LA 2V96A 4H7JA 5JJ6A 4EIWA 4HNRA 3PDNA 3LGXA 3IP6A 4RA9A 2AMFA 3EA0A 2WILA 4HHEA 2J9FB 4PIMA 3NH6A 1G8GA 2QE7D 5D6OA 5I9IA 2O14A 1IDOA 3VNUA 3D2LA 3ZY6A 1BE0A 5DULA 5F12A 3TZQA 2F43B 4IHJF 3U44A 1E3MA 1O1YA 1GVHA 3GVCA 1EM6A 1NV8A 3ASZA 1TW2A 2O8EA 4ACBA 1RYYA 1ZM7A 5BYBA 1XP5A 3MUOA 4RS3A 3O2SB 3M9LA 2GAAA 4NOMA 3SFTA 4C0XA 4FKBA 3NKLA 3IODA 2IS1A 1ZD3A 4OHMA 3IBEA 1NN0A 4M0EA 3SO8A 1DDGA 1RZ4A 1ONSA 3E27A 1QGED 2C78A 1II8A 4HNGA 1FTNA 4WN9A 4YA6A 3WZMA 1RP1A 3OSZA 2IHYA 2A1IA 4U2EA 5AICA 5J08A 4PPQA 2EHJA 3MBKA 4AJLA 5JVDF 5J5CA 3KIPA 3NBZC 1CY4A 1ATZA 1D3AA 1JI0A 2HFJA 1QRAA 1GPYA 1Z2OX 1G8KA 1DP4A 2WNIA 4R16A 4YRMA 4BVLA 1ZZEA 1CBUA 4F2HA 4F93B 1MH9A 4IJWA 3IGFA 1P74A 4I9UA 4CI9A 4CPDA 3S2UA 1R15A 5F3WB 4H27A 4JVMA 2QAIA 4DMMA 5SICE 3KJQA 3NGXA 3ZDAA 4L0MA 2MSEB 1HE8A 1TNDA 2UZ4A 1JALA 3KB6A 3REQB 1LD3A 4FW8A 3L9TA 4DNPA 4LE1A 1Z8DA 2FSPA 3DNMA 2GK3A 3R5TA 1HEUA 4O2BA 1LJLA 2AW5A 2OZPA 4ARBA 2XS8A 1P1CA 3ZHUA 1P29A 1ZU5A 2KLBA 3E3OA 2BGUA 2JATA 2IXTA 7MHTA 4QTTB 5GOZA 2J5QA 4O6FA 4KWHA 1E8XA 3I2YX 5LQMA 2ZSEA 4GSKA 3GFPA 4DA4A 2ZB3A 1LKZA 1UBTS 1YAHA 2IEJA 1JAYA 2YJGA 4NYMQ 3CZMA 4FHDA 5SZHB 2X0FA 1Z38A 3QXHA 2WHEA 3RF7A 3K16A 3UHJA 5JS7A 1VL2A 3L1KA 1JP7A 2WDZA 5HFJA 5ENSD 4UVIA 2CE2X 2IPMA 2BISA 4G3XA 5LNK1 3L7AA 4ZQEA 1PDOA 4DADA 3EF3A 2XLBA 4Y2JA 1G7TA 2XRZA 1WDTA 3BQ9A 1N95A 4QWMA 2CUZA 1HU3A 2HREA 4IQFA 3V1UA 1PZMA 2DYRE 2PL9A 3ONEA 4E4YA 3B5IA 1RI5A 2PH3A 3L18A 1DJPA 3LDFA 4P7KA 4CKEA 2XB8A 1A04A 4KCGA 3JXEA 5CNKA 5AESA 4F6RB 4IIJA 5CB6A 1AQNA 1I1HA 4S24A 4ZHSA 5B36A 4EX6A 1XAHA 3RUEA 4JY7A 3T1OA 4X6UA 3Q9UC 3UJBA 1ZGGA 2O0HA 3G8DA 4YLGA 4HL6A 1LV8A 5CCDA 1N2JA 4LY9A 1OZHA 3JWHA 1S7CA 4RV4A 1XXHB 3B1VA 3CH6A 2RAUA 5E6RB 4FMDF 3SVLA 2DK6A 3GDWA 1I94B 1ESCA 4FILA 4IIFA 1AZTA 4XM0A 2WHRA 2J3KA 1ZH6A 2FP4B 5C9ZA 3SZGA 5IZ4A 3TUIC 5TGTA 2CF5A 1E2JA 4MYSA 2GRLA 5FLYA 5F3RA 3IJRA 2ZSAA 4PSKA 1R4MB 4A0QA 3E8MA 2H31A 4U5XA 1ZIYA 3ORHA 2P9EA 4LDRA 4F96A 1VL8A 1RC0A 3BAFA 3NLLA 2QRUA 3WFJA 1QG2A 1MP0A 1UP6A 3WZLA 3N1UA 4HRNA 1F2TB 3BXFA 4P5PA 3X43A 3D5EA 5IVDA 3RS7A 1KDYA 5JFGA 4JAVC 3PGXA 1ITZA 2VSYA 1IM8A 4Q18A 3NBAA 8ATCA 1DS6A 5EIDA 3TB4A 2AXQA 2PQNA 2VP2A 2GBFA 2R7MA 1U65A 2GVNA 2RGBA 1DIRA 3FFTA 4MR9B 5TJ9A 4L3OA 3TVDA 4BETA 3Q4AB 1EVYA 1VA5A 2AFIA 1HYQA 2HWKA 2WKQA 3R0IA 4NBWA 1B6RA 5EMHA 4FLEA 5L6MB 1LBTA 1T1SA 1UXHA 2X7JA 3EZFA 4O4LF 4W6ZA 5G2OA 2VATA 3QA3E 2B4AA 4AZVA 5JBQA 4K9OA 3CT4A 3DAGA 1YZLA 5G4LA 5C2JB 3W4IA 1Z5PA 1BX3A 1YL7A 2CLLB 3RK4A 1FRVA 3ZKJA 3RTCA 4DXHA 4G0VA 3CU5A 1BGXT 4DSAA 3DJFA 2ZQ5A 2ISQA 5JXIA 5KWJA 1HLPA 2C3OA 4PAWA 1M1XB 5H82A 4AJPA 1P1RA 5FR2A 3GUHA 1K4KA 1HETA 1TUEA 5ALKA 3HPRA 2BTQA 4TM7A 3M6LA 4YXWA 5AVZA 1UWKA 5ERXA 1XVUA 1K6JA 1Y33E 2ES4A 1ZOSA 3K1AB 4JLSA 4RS4A 5DBFA 5DGTA 2XNJA 2ZJ7A 1DU4A 2FWPA 5A3VA 2VT2A 2EFHB 3GFGA 1NXVA 2O8BB 5I4KA 4TYYA 4RMIA 4HWPA 1Y4ZA 1R6DA 2P2SA 4RZSA 4JP8A 4J8PA 3R7WA 2GFIA 1IZ7A 3Q5MA 1Q7BA 1IEWA 3WGHA 3KTOA 4KXLA 3FTYA 3TFQA 4MW6A 4TVBA 1X19A 1KJZA 1XTQA 2ZJBA 4JWKA 3E7DA 3C3BA 4BQSA 1YRLA 1V41E 1S7GA 1ONBA 3F6PA 3LS8A 2NO9A 3CLTD 4D3XA 5J2TF 4B2PA 3ONDA 1KA9H 1H8EA 3TG8A 1PGOA 3OT5A 2OHXA 2ZJAA 5LKAA 1TQHA