4AY5A

Human o-glcnac transferase (ogt) in complex with udp and glycopeptide
Total Genus 272
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
272
sequence length
717
structure length
698
Chain Sequence
b'SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYL TRANSF
publication title O-Glcnac Transferase Invokes Nucleotide Sugar Pyrophosphate Participation in Catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
total genus 272
structure length 698
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ay5A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ay5A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4ay5A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4ay5A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ay5A03
3NP9A 1AHPA 3RIBA 3BEOA 1ABBA 1Z62A 4PQGA 3Q5MA 3MA5A 1FTWA 4XI0A 5KJKA 3ZCTA 3NB0A 1YGPA 3ZHEA 2QN7A 3LCAA 2LSVA 3FFLA 3PE4A 1PSWA 2C9ZA 2JLBA 2QNBA 3CK8A 5JTTA 3OY7A 3MS4A 1L5VA 1B4DA 1PN3A 2G9UA 3KAEA 2BGTA 1A17A 1NA0A 1E96B 2IYFA 6GPBA 1E4OA 2ATIA 2PZIA 1KT0A 3ZCQA 5FZSA 3BD6A 1L5SA 4IN3B 3OTIA 2FBNA 5BW8C 3G2LA 2SKDA 1GFZA 4J8FA 3FROA 4BQEA 1P4HA 4GA1A 3RHZA 4G26A 3CEMA 3OTGA 4NRHB 3Q3EA 4MICA 1P5QA 2VGXA 1FS4A 3OKPA 3TAXA 1W3BA 2HO1A 2YJNA 1B89A 1K08A 2C0MA 4GZ5A 4RG9A 2KC7A 3MRTA 4L22A 5KJNA 4HWGA 3T5TA 2Y4UA 2X6QA 4HOUA 4AIFA 2F9FA 3OT5A 4CTNA 3G2JA 2QN1A 2IW1A 2ZB2A 3EBPA 1Y8ZA 5M72A 3ZCVA 5AYWD 1FA9A 7GPBA 5G04J 3TG4A 2Q7FA 3OTHA 2C1XA 2FEZA 5D01A 4JA7A 3SYMA 2ACWA 3VUFA 1HZ4A 2FI7A 2VYIA 3HBMA 1IIRA 4M83A 3IA7A 3LPZA 1YA6A 2GJ4A 3NAZA 1A8IA 1L5RA 2VGYA 3H4IA 3CV3A 3L7CA 4KXKB 4MHOA 5CCMA 3D0QA 4EJ2A 2LSUA 3AS4A 3ASDA 4Y6WA 1EXVA 4EL5A 2Q6VA 4BT9A 1P2GA 4KQ1A 2C1ZA 4W6QA 1Y8MA 3BDAA 3BD7A 4MI9A 1FC0A 2AMVA 4U0ZA 3VTXA 4RIFA 1JIUA 5FT9A 2R5SA 5DXFA 3RSZA 3LYAA 4KBQA 1P2DA 1WV0A 3DDSA 4WNGA 4GYOA 2FF5A 1C8KA 1FU4A 3CEQA 4BTBA 3CUYA 4MHSA 8GPBA 5IKOA 4XIFA 3TG5A 1YA0A 1NLMA 5D0OD 3ZHEB 4F9FA 1XC7A 5FJYA 4RG6A 4NEQA 3MSCA 3UQ3A 3RSCA 2XA9A 4HOSA 1E1YA 3BEEA 1L6IA 1O6CA 4GYWA 2VSYA 3G2HA 5TMEA 4X7PA 1HLFA 3CEHA 3EBOA 4RBNA 2BGUA 2PQRA 4REMA 1HXIA 2L6JA 3E3LA 3NC4A 3DD1A 2XCBA 3JYSA 3ZFWA 3GZ1A 3AMVA 1XL1A 2XA2A 2IV7A 5EX3A 4I17A 2BFWA 2R4UA 2AW3A 2BUGA 3S7DA 3L7AA 2PRIA 2VGXB 1TJCA 2WQHA 3QKYA 2I6HA 4BQIA 4UI9J 3ASFA 4A1SA 4YVOA 1C50A 2OOEA 3KS2A 3MQFA 4HORA 1F0KA 2P58C 3KD7A 4RENA 1L5WA 1QM5A 2JZCA 2R68A 2QRGA 4G24A 4MI3A 1SXQA 4GA2A 3ZGQA 4LEIA 5ENZA 2F3PA 5DIZA 3T3HA 4MRAA 1XOIA 1NA3A 3IEGA 4G2VA 2ASVA 1VGVA 2ACVA 1C3JA 3AS8A 3SF4A 3MTAA 3Q47B 3PE3A 1GPAA 3C4VA 4Z5XA 2XCIA 2X0EA 1NOKA 1F6DA 4QLBA 3QWWA 4RIIA 2WTXA 5TVGA 4RELA 4M7PA 4J8EA 3CK7A 5DLDA 3DDWA 1Z8DA 2AV6A 5TMDA 5ARGA 2ONDA 4GZ3A 2ECPA 3CUUA 3BD8A 4G23A 1XL0A 1XNFA 2KS6A 4BFCA 4NQ0A 3CUWA 4N5CA 4YVQC 3UYLA 4I9EA 3MT8A 2IEIA 4GCNA 3UYKA 1V4VA 4FKZA 4J0UA 3T3GA 5FZQA 1QQEA 1WM5A 2QRHA 2H1HA 2IEGA 1KLXA 1GGNA 1LWOA 3CUTA 1K06A 3Q3IA 2KATA 3CUVA 4N39A 5EKQD 3G2IA 4W9RA 2XEVA 3NP7A 3NF1A 3MKRA 3U3WA 2SKEA 2GEJA 3E3NA 5ARFA 3RKVA 3QOUA 3RO3A 5A6CA 4GZ6A 2SKCA 1Y6GA 2GM9A 4XI9A 2FF4A 1C8LA 4NESA 1GZ5A 3LY9A 4EKEA 2GPBA 3S27A 4AY6A 3WAGA 3EDTB 3WXXA 5JTUA 2IYAA 3OY2A 3BCSA 1WV1A 1GPBA 1H5UA 1FU8A 2O6LA 1KT1A 2X0DA 3ZCSA 4GCOA 3VUEA 1RZVA 3MT7A 4BT8A 2FETA 4AN4A 3UPVA 2BISA 3CVNA 3S2UA 2QN8A 2AVPA 2YQ8A 2UWJG 5KJMA 4JL0A 1XKXA 3NPAA 3URZA 4YI5A 1ZU2A 4CGVA 3L79A 3TSAA 1NZFA 2Y4TA 4CTOA 1IXYA 3HBFA 4LDPA 3ZN3A 3HYMB 3HBNA 3VDMA 1WUYA 3WADA 1NVKA 2IFUA 4HLNA 2PYIA 4UI9K 3QKWA 1PC2A 2E2EA 4U04A 4WNDA 3SYRA 5HI7A 3RO2A 3LY7A 2PRJA 4CDRA 2XGOA 3G2KA 2R4TA 4U0UA 1ELWA 5TMBA 1KTIA 3U4TA 2HYZA 1J39A 3GYZA 2IF4A 5A7DB 3MEKA 5I45A 2H1FA 2QN3A 4I2ZA 2IUYA 2UY1B 3MS2A 3RJVA 3VTYA 3AS5A 4ABNA 3MRVA 1P4GA 2JJMA 5HQ8A 4UQXA 3FP3A 3CEJA 2QRQA 3CKBA 5BT1A 1UQTA 1WW2A 2QRMA 4I2WA 5CHEE 4UQZA 4EQFA 4X7RA 3C48A 3COPA 5GPBA 3CVQA 4H7YA 3OKAA 3R9AB 4M60A 2F3QA 3LY8A 3L7DA 3Q49B 1AXRA 4U07A 3Q15A 3FWVA 3VDNB 2YHCA 4F96A 2G9VA 3CX4A 5FTPA 3CKCA 4GPKA 2GPAA 3ULQA 2VCEA 3CVLA 2C2LA 4NC9A 5G05C 3D1JA 1IHGA 2F3UA 3HBJA 3OXLA 4EL0A 4N3AA 1NZNA 3S0JA 4I9CA 2GPNA 4APOA 2WPVA 1NOIA 3S7BA 2P6PA 4LEUA 5FZRA 4GYYA 1JG7A 2UY1A 4WHMA 3T3EA 4BQFA 5EX0A 4N9WA 2R66A 2VSNA 3MS7A 4YNDA 4CGWA 3RU0A 3CK9A 3MV2B 4AY5A 3PDNA 2QRPA 3CVPA 2XA1A 2XGSA 2QLLA 3NCHA 2IV3A 4I1AA 2J9QA 5LCWC 2C0LA 2X0FA 2PYDA 2DBAA 2C4MA 3WC4A 3K9IA 3ZCUA 5JJ6A 3C4QA 4GA0A 4HOQA 4AMBA 4U0SA 4AM9A 1JIXA 3OXGA 4CTMA 3GUHA 1JG6A 2VG8A 3OKCA 3GZ2A 2QN2A 4F3VA 4J8DA 2QZSA 4ME2A 4G2TA 2HY7A 4EKYA 4FZRA 1WAO1 3BCRA 2GEKA 3T7DA 3G2NA 4RIHA 2V5FA 3O48A 2QLMA 1GG8A 3N71A 3GPBA 5KJLA 3S29A 4WUYA 3QDNA 4X6LA 1RZUA 1LWNA 1JEJA 3LKUA 4N2QA 2XGMA 4N3CA 3S7FA 3H4TA 2XCUA 1BX3A 2QLNA 4JA9A 1HH8A 3ASGA 5C1DA 2F3SA 3O3CA 3E4BA 1ZBPA 3ESKA 3MRXA 4YUAA 2X6RA 4GPBA 3ASHA 4UQYA 3E3OA 4G1TA 2R60A 2KCVA 4UI9C 1QKJA 2FO7A 4AMGA 2HR2A 2KCLA 4N2SA 4HOTA 3T3DA 3BCUA 3S7JA 1PNVA 3MBOA 1PYGA 5HXAA 3OXFA 3L7BA 1XV5A 3QWPA 3SZ7A 3S28A 5BNWA 4RIEA 5DU2A 3CV0A 1Z6PA 1JIVA 2PQ6A 3MTDA 4X7MA 4F97A 5G05J 3DZCA 4BWRA 1P4JA 4N3BA 5JJ7A 1SXPA 3UUXA 1FU7A 2PL2A 1FTQA 1NOJA 5JJTA 4WACA 4BTAA 1EM6A 5LQDA 3RT1A 1IYGA 5CCLA 2PQNA 1P2BA 1Y6FA 3Q3HA 2NC9A 1OUVA 1L7XA 3TGOA 1UZUA 5IKPA 4B94A 2XMPA 2OFFA 1ELRA 5D0QD 2G9QA 3D0RA 5LCWJ 2FFRA 2XCCA 2LNIA 4YI3A 3T3IA 4JHRA 3Q4AB 2XPIA 4O6FA 4KQMA 2GW1A 4H7XA 2GT1A 2QN9A 3MT9A 4KYOB 2VCHA 4WADA 1WW3A 1FCHA 5D00A 4MI6A 1UQUA 2AZDA 4WNFA 3QHPA 3TOVA 2KCKA 4WNEA 1P29A 1WUTA 3GW4A 1L5QA 4RIGA 5DBKA 5G04C 1NZDA 1M5RA 2G9RA 3QWVA 3ZCPA 4Y6CA 3MTBA 1GPYA 4KQ2A 1QZ2A 3IAAA 3L01A 3ZPJA 1RRVA 9GPBA 2MHKA 2QFCA 2VQ2A 3MV3B 4G25A 3ZCRA 1Z6QA 1FTYA
chains in the Genus database with same CATH superfamily
3UM2A 5IHPA 5IZCA 1Z13A 3U6BA 3RSFA 4AC9A 2V7PA 1ZM2A 5EOVA 1Y8RA 2BL4A 1SU7A 4ZAGA 2HMAA 2A6PA 2O2YA 1L5VA 5H9VA 2AG1A 3T5DA 4Z7JA 3C3MA 4GPD1 3ZCQA 2UYGA 3NHMA 3ZY6A 1L9XA 2CB9A 1OR8A 5I48A 1JHAA 1ISGA 1YBFA 2FY8A 3WYNA 1Z5OA 2R44A 4K9KA 5FLYA 1AC5A 2JH3A 4XB6B 1Z4JA 4OUDB 1T3SA 2V4HC 3PGJA 4HOUA 3SE0A 1GUDA 4DT1A 3OE1A 4ZVKA 5G3ZA 2CFZA 1K0FA 2MMGA 5CLFA 5KTMA 2ZJ4A 4MVJI 1CUFA 3IEKA 5C35A 2R6ZA 3DHNA 3GW8A 4QJBA 2AQKA 1L5JA 2A4KA 3ANMA 1H2EA 3ZTYA 2TMDA 1R0WA 1I2DA 4CCYB 1CZUA 3OF3A 3MMXA 4Z68A 1A1SA 1ORVA 2XVXA 2JC3A 8GPBA 4N54A 3PT9A 2BI8A 3AF5A 4ACAA 3ZOKA 3WMEA 2MYUA 1GNVA 2QW0X 3RI3A 2Z4TA 2BHNA 5B1SA 2XCBA 1USUA 1AT1A 4JKOA 1Q2UA 4V24A 3FH0A 2CHZA 5AQBA 3AR8A 1GNLA 4J0QA 4BCBA 1ZCJA 4BC1A 1PBNA 4I0WB 4HC4A 3QEAZ 5LNK6 2AL7A 1Q3TA 4H7EA 4E70A 3BUAA 3MRSA 5HX7A 1VCOA 2YXEA 1U2GA 4JODA 3D9OA 3Q47B 4FDVA 3VI3B 3AHHA 4NECA 5WRFA 2OV2A 3C2QA 1CY2A 5JH7A 5DI9A 5ITZF 1LPBB 5AK5A 1RI5A 3S8MA 4D8WA 4YP5A 2ODEA 4AU1A 1NQWA 5DM60 5LQUA 4QQ8A 3P9SA 2EX4A 5B1BE 2KATA 1PRYA 2FFBA 2WWGA 4B74A 5IAGA 1VYUA 3EK2A 3ECAA 4KV7A 5IW8A 2JLQA 2QJWA 5JNWA 1E7MA 3ZHYA 4BVLA 2C88A 3EDTB 1AK9A 5AVTA 1Z88A 2BISA 2LKDA 4WVLA 4UXHA 5EI5A 3IERA 1XKXA 3HO6A 3SAJA 3HVIA 1BE0A 4G5OA 2FN7A 1OUMA 2AVDA 3AP1A 1LA2A 4OI0A 3F90A 2ZJFA 4KFSA 1MB2A 2X9GA 2X2FA 4JLOA 3A1VA 3FSEA 4TXRA 2Q46A 4B9AA 5JZOA 3O7WA 3PR1A 3ZE2B 4J43A 4DIBA 1IBLB 4EJMA 5EIFA 3Q9NC 5B1HA 3OLWA 1OH8A 1NAHA 5LDHA 4UXIA 5EGSA 3L92A 3FTQA 1XRJA 2IEDA 3EQ6A 1N92A 3UPUA 3CO5A 1PU2A 4C07A 3I4RB 2HF8A 2EJBA 1QIMA 3RS9A 1IBSA 1KC3A 4DSOA 1PKXA 3SD5A 3IVMA 4GR5A 1R0CA 2X76A 4CEJB 3WGYA 3K0AA 1BEUB 1A04A 4F86A 2QLLA 5HA5A 4HAXA 4L3WA 2Q1SA 1ZOPA 1NJ6A 3DAOA 1Z4MA 4F1JA 1VB3A 1QKKA 2BTQB 1H6CA 2QROA 2E4AA 3LO8A 4AZ3B 4FNMA 4IICA 4F4JA 1V5WA 1NX9A 3RS4A 2QD5A 4XKBA 2DYRE 1FUEA 1GVNB 1OFIA 2P35A 3ELYA 2F2TA 1PK8A 3AOGA 4DDUA 2H8GA 4UCFA 2X58A 4LERA 2I91A 5G1PA 2COUA 2C2MA 4QQIA 3D1VA 2H1WA 2VJMB 3RVJA 2YZ7A 2NX2A 2VDQB 4Q6BA 3KVOA 2GX6A 4TMZA 3AXSA 3K0HA 1ZNXA 4TUYA 3IR5A 2A9FA 1EH5A 4KDFA 2AYXA 3DQPA 3GRPA 1MZPA 1ZU4A 4FGLA 1PUJA 3PEFA 2ONCA 2NQTA 3Q4AB 2P2GA 2X7HA 2JGMA 3ORFA 4Z2YA 4Q03A 5FF9A 5HBGA 2OENG 1XAJA 4RVFA 4L5JA 5JNVA 4XM2A 2ZRKA 1NSTA 4XLTA 1N78A 4PGGA 2HQBA 1Q0UA 3DBLB 5LQJA 2IOYA 1PSWA 4MV1A 1IZ8A 1OCCE 4J6FA 4UWHA 2QLFA 2C07A 4LHYA 3HJBA 4OMUA 2JFQA 2WHYA 2ZATA 4UD6A 4ZCRA 1NE2A 2W2MA 4Q4HB 1W25A 4D02A 3N7UA 1II0A 3FHCB 5C80A 4BLRA 2WXNA 1BMDA 4EB6A 1S2OA 1C41A 2QPOA 3C15C 3WLPA 1XVTA 4OA8A 4X85A 1AURA 1OHHD 2DTDA 2ACWA 3AG2E 3HBMA 1SVOA 5HPYB 2A3NA 3GIDA 4QREA 1EXVA 5KVQA 1Z3IX 1VJ1A 3OBBA 3VR1A 4KPYA 3CJRA 2YJ6A 4V2UA 4QT4A 2IYEA 2CLDX 3OO0A 3EGDA 3AIKA 2DUJA 2J09A 5KAMA 2C57A 4BFVA 4KNWA 3C3CA 3ZTWA 1NE7A 2YIDA 4TL7A 4KXWA 1WDWB 1HLFA 4AN0A 3FTCA 3E3LA 5CAEB 3ETNA 3SOZA 2O8FB 1JT9A 2WKQA 2FEKA 4GMLA 3KSDO 4K81B 2YWJA 3BZBA 4GLOA 2BFWA 1BXKA 2BVNA 3U3OA 1EWRA 4I4LA 3KLOA 2J3HA 3GL9A 5KCZA 3QX8A 3GFRA 4L7QA 1KYIA 3LHSA 1F8GA 5FBWB 1W44A 1LI4A 1NOKA 3BK2A 1ADFA 4LF6B 1MW9X 4MGEA 5IVDA 1EI9A 4NONA 1Q57A 3O3NB 1ULHA 4UPVA 5EQTA 3VHXB 1HH4A 4YEDA 3PZRA 1JDJA 3P96A 4B2PA 1H3NA 4N5IX 1E7RA 1NDHA 4RPHA 1JUQA 5EJEA 2ENUA 5CMLA 2J0SA 4HDNA 2W42A 4R7LA 2PTGA 2YW2A 4A15A 1UPFA 2IOFK 3ZNPA 5FLEX 3BD9A 1ZJ4A 3MJTA 3W9UA 1LCIA 3IPRA 1KU6A 1RHMA 3L5OA 2AIRA 5F12A 3T8YA 5BOVA 4CM4A 2J3KA 3HVEB 1M6YA 4Z1MD 2B69A 4HGZA 1LDYA 4YMTA 1DX4A 5TPWB 3RO2A 1PW7A 1F8YA 4R3UC 5IKMA 5A7DB 4LVOA 1Z7YA 1J0DA 3CF2A 1ECPA 4JIGA 4DXDA 2YOHA 1YASA 5FADA 3WFZA 5LYJF 4BO6A 1I10A 1VKRA 4AJOA 4RD4A 1FRFS 2Y05A 1XP8A 5TX7A 3AETB 3OXLA 4HS4A 4B33A 3I1FA 2X0KA 4QE3A 1AGPA 3X1DA 4NEGA 4M7WA 1G5HA 1PJAA 2DBVO 1RZ4A 2R1VA 3GDGA 3RC8A 4CGWA 3OA2A 1QFJA 1H5NA 4KBGA 1JXQA 1AKWA 1H2FA 1U28A 4OL0A 4UARA 4QNMA 3B7SA 4V0MA 3H04A 5EHGA 5GMOA 4ZYWA 4D4MA 1ZW6A 4NE9A 3SHTA 3HYTA 1V9LA 5JWHA 4XCQA 521PA 1YUBA 3UKRG 1UM9B 5ARDA 4E6EA 2BMDA 5E1OA 4UAJA 2JGNA 4JLBA 4JI6B 3UNXA 2VBIA 3UGTA 2AZTA 1ISPA 2HXYA 4OMDA 2PANA 4PPYA 4N7JA 3KUDA 2B1JA 4RZ3A 3PQ3A 4O6FA 1RWVA 1X7XB 1ZMRA 3BHNA 5TJ9A 5JDCC 4O5OA 5H1YA 1EE1A 3QHPA 2Q0XA 4S05A 2INGX 3NYRA 5B30A 2G82A 5L7YA 2HJGA 3IAAA 2GI4A 2ID8A 3FB4A 3ZUPA 3GDWA 1FMFA 3CRNA 3FNQA 4ANXA 1N36B 1QPBA 2P5SA 2Z5FA 2P9EA 2ZZNA 4L95C 1EFVA 3DOEA 5C4IA 3DE1X 1B4DA 5JAZA 4K3UA 1WOYA 1U11A 2ROQA 2I4TA 4INPA 3WLLA 4IULA 3Q7EA 5ISMA 2VF2A 4HLUC 2RH5A 2VDPB 1ORRA 1MIHA 4A8JA 2WE7A 4W5QA 3OQPA 1EJ6A 4R2IA 1V5IA 3BG0B 2O3TA 2WYHA 3LDHA 1YK1A 4PNZA 3EGWA 3WV4A 4DX1A 3N6VA 2WXJA 4XQ9A 1N3LA 4JVLA 3A9WA 2ZRQA 1KJNA 1KWGA 2HRBA 1PJ8A 2WXIA 1LSOA 3FWHA 5LQKA 4GKBA 4MS3B 3OWHA 3GPCA 5C5IA 2CL6X 3BMCB 2XW6A 2XA9A 2V3WA 5A04A 4CMHA 1EFKA 5BRAA 1QXSA 2ZYRA 5FTWA 1RIIA 2XNKA 4ZXPA 1KYXA 3NZEA 1TJCA 3QKYA 2QTWB 1QIFA 3ABLE 5EHZA 1C1YA 2LXMA 3FI0A 4AYXA 2QRZA 5J43A 4C0QC 2YWGA 2MU1A 1RNLA 4JASB 1TMGE 4M22A 3SC6A 3NQ41 3WLRA 1SXIA 1K7FB 2FSGA 3J5QB 3NBNB 3OH8A 3BF8A 4GI5A 3DDUA 3DZIA 5C3UA 2HJSA 1XPJA 3NF1A 3JZMA 4M0EA 3CTPA 3AF2A 3GEEA 4FSHA 4BEJA 1DOZA 5DNUA 2OWEA 4DTIA 4EQ6B 3R44A 3RIXA 2VC2B 3D4NA 5DOZA 1K68A 5DNVA 4L6IA 4ZTZB 4JJGA 2LO6A 4KH1A 1L5KA 3ICOA 4KO8A 1JDSA 1OXJA 2DFDA 1UBUS 2BI4A 3HVRA 3PGLA 4OYYA 1ICIA 4PX9A 3WNCA 2DY1A 3A2LA 1EMDA 4TV8F 3MJVA 3DGFC 3JQ9A 1IVYA 1TD1A 2R6FA 3JPWA 2WJPA 1T0UA 4C87A 1XMIA 3CX3A 4I1IA 1HKHA 4F9EA 1X2BA 1TTPB 1B16A 4W1RA 5E0OA 5K0EA 1UJ5A 3NDIA 5LKRA 1T29A 4P98A 3ZWKA 1HC7A 5LDGA 3TG2A 4WQMA 1A1VA 3H99A 5KNCD 1N2XA 1HA3A 4NCNA 1ZLYA 1W85B 1SNYA 2P2CA 4QECA 3AW8A 3I58A 2GXAA 1KH1A 2FVXA 2QLMA 2QSZA 4OGFA 1IUNA 3NOCD 4M55A 2EBFX 4ZYYA 3O3CA 2BKLA 3P20A 1LC0A 4X8QA 1R9GA 1IZ7A 5LOZA 1GZDA 2FGJA 4JJZA 1S3GA 4TMWA 4K6FA 3I8XA 4U7FA 1P7CA 2JA1A 4DZTA 4XVHA 4BAUA 1JFFA 1H2ZA 3BIFA 3ZHUA 4ZARA 3LQ1A 1A88A 1A71A 1PWYE 4B2IA 2X5NA 4RJKA 3B3GA 1ONNA 4FTWA 1YIDA 1BOFA 4BNKA 4JBIA 5KNDA 3JR3A 3QTLA 4EBAA 2W2LD 3BCHA 5TS2A 3DV0B 3P2OA 1P77A 4Y7CA 4DB4A 2WWRA 3H7AA 4Y6QA 3QPDA 5ALSA 1K97A 1NR5A 5BVGA 4PC2A 3KD2A 4M8SA 2VQ2A 1KDPA 5ALEA 1ISSA 1S0PA 1R12A 4WY8A 5DSZA 3MA5A 3U7QB 3VR5H 3B82A 4K9PA 2Q27A 3VSDA 3AONB 3INYA 5BSRA 4IV5A 3E7DA 4PCLA 2OQVA 3VPBA 1EBUA 1O6BA 3CQ9A 1N4DA 1XCGB 4EYQA 4GXTA 4PLHA 2UYCA 2X3YA 1NR7A 2FSPA 1SUDA 2V7VA 1HFEL 4GX5A 4H6PA 4CVNA 2HA6A 3U62A 1SHKA 4BQOA 3RSQA 1QHSA 3O4GA 5CPBA 4EWLA 1K08A 3EGEA 4UTVA 3TB4A 2X0IA 1EB9A 2DBQA 1QH0A 4LE2A 3IURA 4INOA 4Q4CA 3RASA 2GAFA 1L1EA 2HT6A 5HRAA 2AMVA 4F71A 1AIPA 1OLXA 4LSGA 4GWKA 4YBZA 1NTRA 3IDFA 3DW3X 1FVHA 2A67A 1NJ5A 4GMFA 2GVNA 3TVTA 1IMJA 1YIAA 1FP4B 3PGKA 1VE5A 4BO2A 3NC4A 1Z6AA 4RGQA 4AYTA 3RT7A 4A5OA 3PZBA 4F0JA 1AQUA 1TC2A 3EIQC 4WCFC 3LQRA 5HNKA 3NBZC 1XALA 2A9RA 3WHKA 3DSUA 4UHHA 1QS0B 1GRRA 4I4TF 2VP4A 3KSQA 2FJPA 3B89A 2Z1DA 3BWYA 1ML3A 4DLVA 1U7HA 1JKFA 3DZDA 4JL6A 1QG4A 2CHQA 1SFRA 3SE7A 3G8YA 3DVQX 2Y1EA 3FA2A 3PQFA 2PS9A 3LQKA 4N0QA 4XE0A 4YWHA 3DSXA 4QOJA 4PLVA 2BI7A 4JL5A 1IFXA 3STHA 2P0EA 3DEOA 2AOUA 3WYCA 4B3MB 1FU8A 5GM2A 4JYZA 3H5TA 3C3EA 3RAPR 4DJ5X 3BPSA 3HP7A 5HKOA 4JCCA 4FNGA 4F3YA 5JJCA 2NUTB 3WGVA 5K09A 3DEPA 3P4UA 3WKBA 3PC8A 1PC2A 3ZE7A 5AOXB 1RP7A 3O3OB 2LGJA 4OHWA 1HE2A 2CYAA 1P62B 2VHVA 1YJ8A 3QG5A 5BR4A 1NW5A 2HJ9A 4BNLA 2H1FA 1N6LA 3QU9A 4Y2GA 1YJ5A 3RYCA 2IYRA 1RM0A 2NAPA 1EE9A 3H5OA 1WMDA 1EXDA 4GZMA 4JC4A 4PO3X 2A57A 1SXJA 4HGQA 3EXG2 4GPKA 3ONWA 5TIIA 4B6FA 3U5ZB 4B5KA 3UA4A 4YCAA 4RGBA 3DULA 4FB4A 1TCVA 3TI9A 2CLHB 1NXQA 4E5MA 5DWVA 1PT5A 2XCTB 3EGXA 3L8DA 5LKAA 3S1SA 4QVKA 2XB2A 1BPOA 4K87A 1YZHA 5GV8A 3B38A 3BRCA 1VOTA 4HX2A 2XYQA 4IFIA 2JPDA 2VSFA 4C6TA 4XEUA 2HY7A 3WIDA 2IDMA 5JALA 4ZEOA 3N8HA 1CUJA 3BCRA 5KKCA 3QNWA 5IANA 4WZBA 4O2BB 3S7FA 2Q1UA 3GLRA 1BDMA 2F3SA 4ARVA 1MQ9A 4W4TA 2UYYA 5F1YA 1J4AA 3NNNA 5A5FA 3BGIA 1JPVA 2EX0A 3Q5DA 2J33A 2YR0A 2FQWA 3S28A 4C9BB 3SQXA 4CM1A 3C7AA 4M36A 3HXEA 5K45A 1R0LA 4LXQA 1UFVA 5IY5E 1G59A 3HSKA 1GFIA 4ZHSA 4XVRA 1Y3BE 3GFFA 2B99A 3ENKA 3ED5A 1AQIA 2NC9A 3VYSB 3B51X 2CBZA 2G9QA 1VSVA 1KMMA 3HIZA 3IV9A 1R0BA 2BUBA 3OZGA 2R05A 2I29A 4RHUA 4YCBA 2HLPA 2ZR9A 4M76B 2ICAA 3DD5A 5K6TA 3Q2KA 4Y2JA 4HVBA 4GRDA 1CSEE 4F1SA 3R8FA 3OU2A 2XNDA 3HACA 4UBMA 1JJAA 3FRIA 3RFFA 4US2R 5TGTA 4UEJA 4KL8S 4RTSA 5DV9A 1M6VB 4EFKA 2WQZA 5EFOA 1OH7A 4IP0A 5ENDA 5FAXA 5IEBA 1DADA 3LTEA 1LI7A 1G5PA 4HVAA 4L9WA 6PFKA 1A8PA 1Y9AA 3UZUA 1K7EB 3OJEA 2GPSA 1V11B 4J0JA 2QTVA 1NBMD 4U7DA 2XADA 4GYJA 2VJBA 3BMNA 5TQ0B 1X74A 2QV7A 4RNCA 3LJNA 4IFBA 1OZGA 4D0RA 1OV4A 4N48A 3P9XA 4X8LA 3B1JA 3FCUB 3BGWA 3B1YA 4E32A 4HNAD 4FHDA 3T38A 4MPRA 2XXAB 4HEQA 4LMAA 1GCAA 4G97A 3FD8A 5CVVA 5HK8A 4IHJB 1U8ZA 2RGRA 5ALWA 4WCFB 3N5KA 1OBFO 2R6R1 2X7XA 1FNBA 3H65A 4F7WA 4JBXA 5LZ9A 2RD0A 4OYRA 4MVJP 3QUQA 4G11A 5IM5A 1RTKA 1SKYE 1XJCA 2VJLA 4U6NA 3GLFE 3OECA 5HK9A 3HXLA 1L5ZA 3QJ5A 1Z7GA 3PDCA 1RWPA 4ND2A 3K1YA 1XCMA 4YK7A 5TE9A 2DIWA 2H7CA 3BE4A 2QYSA 1ISRA 2FX5A 2IW3A 3MTAA 1ST3A 3S8EA 1CQJB 4HGRA 2ILTA 4O2AB 5I9NA 4LF8B 1NQXA 5BXUA 1BHJA 1L7VC 1CDEA 3R0QA 2QRVB 4LRTB 2R8OA 2D2XA 4D4HA 1N7JA 1GGNA 3GV0A 4BX0A 1EX7A 2HLDA 1A96A 4CIAA 2C4WA 4TTPA 5CB8A 3NP7A 4RUKA 4BNDA 2JFNA 4HDRB 2FPSA 5GIOE 4M0UA 5HE9A 1WTCA 4Q4AB 4RVGA 4OI1A 1N1DA 4M9RA 1GYQA 5ENOD 1WP4A 1EESA 5FWXB 4INZA 3ZI0A 1CVRA 4PG5A 5I6DA 1PGQA 2W6NA 5BXOA 5LUAA 1DCTA 1J07A 2GN8A 3GQBA 3KCQA 3B9BA 4Z51A 2NZWA 3ICPA 1E0DA 1JAHA 3O91A 2PSJA 3D9IA 4FC7A 5KAPA 4YCCA 5C7YA 3RU2A 4X61A 2P9IG 1N8TA 3SGLA 2BGWA 2FKAA 4S1WA 4C2AA 5A3VA 5FYDA 4TPKA 4M60A 1N4QA 4ALIA 4I1MA 1QYDA 4TXJA 1A7KA 2OFWA 3HUTA 2IZ7A 1IATA 1N0QA 3QE0A 5J59A 1QIHA 1C0PA 1MD9A 1O4WA 3E81A 3P7MA 5JEEA 1U7UA 1ULTA 1ENYA 4DBLC 2N1MA 3QVUA 2XDQA 2VHTA 4ILEA 4GR9A 5K4AA 1AKUA 5GWXA 2VHCA 2HRDA 1RAHA 1U2RA 1ZIPA 1FVFA 3FUFA 3BQ9A 4A9AA 3F3KA 1AUPA 1MN6A 1JXMA 3K2EA 4S1OA 2WT8A 4X65B 2C9YA 4INAA 2J3QA 1MAHA 4Q4JB 3ISMC 2DHRA 5L3VA 1BJTA 1AUXA 5LA6F 4CMCA 3DTNA 5JO9A 3RS3A 3BJEA 1Y89A 1I1OA 3LY5A 4UJ3A 1SR8A 1UXIA 2PX0A 3R5KA 3WYFA 4WOPA 1PGJA 3MCXA 2JD1A 2FDCA 2P5TB 3AFGA 4JLJA 2GRMA 2P9LG 2BPOA 3ZXPA 2HH9A 3DYVA 3GGPA 1W5BA 2VH1A 2Q5JA 1A76A 1UXGA 4BN4A 2J6IA 1J5XA 3I05A 3IT0A 1ZK4A 4TS9A 3FKQA 1J8DA 4D46A 4NARA 4FX5A 4MQLA 4YGXB 3J5PA 1KI3A 3FHTA 4HV4A 3BGOS 1E18A 3B6MA 5CBPB 5I51A 2W2TA 1DWUA 2D1SA 2XWQA 1MOSA 4CBVA 1NATA 4F93B 2QMYA 1C4WA 3DXFA 4RTQA 3ABSB 2AN4A 1TQDA 4D9FA 2YHAA 3OIDA 3BAZA 2JAXA 1D1SA 1V7PC 3LM8A 3M9LA 2WC1A 2Q7FA 3DL7A 3NVAA 1B76A 2GCGA 3NYIA 3M4XA 3P9RA 4GVXA 3CZ5A 5IFKA 4GD3Q 4KLZA 4MHOA 1Y63A 1GKUB 1OC4A 2AQ8A 3DM5A 1YK0A 3E15A 1IY1A 3TR6A 1TYAE 4BJHB 3D3KA 3MOSA 2UZ3A 4AMYA 1R4MA 2ZIWB 3PS6A 2BUCA 2OGWA 3EY4A 4ZQBA 3CEQA 4MV0A 4ZAFA 2DZOA 2F37A 1KH3A 5JAPA 4ZO6A 1BS2A 1DHTA 4H7JA 4C5BA 4P4UA 5COAA 4ANFA 1NC1A 3WDSA 5A4JA 3C85A 2GN1A 1D6MA 1GTRA 3UWOA 4LBYA 3G2UA 3HKEA 1KAHA 4R7ZA 4AEZC 3KQPA 1LVGA 1EBBA 1KY2A 5K0CA 3DVAA 2A7QA 2XEHA 4F8YA 4PZ0A 3HZOA 4MW2A 5A4IS 4L6CA 4QBIA 5DHPA 4CLRA 2R03A 4XCVA 4C0LA 3K5PA 4B6GA 4ATNA 3EVNA 1NQUA 4KK3A 3DDWA 1T3HA 2VK2A 3ZWNA 4UD2A 5TEVA 2QG9A 2B8TA 1OXXK 3SKXA 4M0DA 4WD3A 3VBEA 2GZ2A 3BGSA 3LQYA 4Z3DA 5ALOA 3CLUD 5CFQA 1Q1QA 4C03A 3ZQUA 3NOOA 4GECA 5CLGA 2P6OA 5LQCA 1FX1A 1QLWA 2FZWA 3ZEFA 2YDYA 2IU3A 3GWGA 3R6DA 1J1ZA 4ALJA 2GZAA 2C92A 2PH7A 4XLZA 2JH9A 4LI3X 2KJZA 4U2GA 4TLCA 1ZH2A 2UZ1B 3O95A 3UWMA 1BCRB 4RKWA 1M7GA 1NVKA 2POCA 3FYTA 4G1EB 1K63A 2JGFA 3JQPA 3ZD6A 4P8RA 4QRHA 5DBGA 3NKFA 3DH0A 3RVSA 1ELWA 3NPMA 1LB1B 4YDEA 2YV4A 3JD2A 2VNHA 2V7UA 2ZTSA 3FP3A 3I9LA 2FHSA 3APDA 4OXQA 2QY6A 5ILGA 4A3TA 1JCRA 2XYVA 4FN4A 3RTAA 4NBNA 2GGFA 4J1TC 4BAZA 4C4YA 2V1XA 4NCBA 2HIGA 4MV7A 3AJEA 4M1ZA 5IN4A 1W0JD 3IJPA 4N0DA 5C5DA 1N9KA 2DKNA 1KY3A 4IDEA 2DCMA 1P1RA 2FDRA 4CM9A 3GJXC 4E88A 3UK6A 5ITZB 3E27A 2RB4A 2Y76A 1TDJA 4WXPA 4XKJA 2IVZA 3GN1A 2VYVD 1BI8B 3AXTA 1SPXA 1JIVA 4YRIA 1U9IA 3ZKWB 1N8NA 2YYYA 5K2OA 5HMLA 5F9HA 3TE7A 1A9TA 3U4AA 1Y6FA 2DHEA 5KU1A 2P6NA 2XB8A 4ZMSA 1EPUA 1EUCB 1O0SA 2ZXWE 4LYYA 4PFJA 1U6JA 1FEZA 5E7JA 3I9V6 3OVMA 2PUCA 4IYPA 4N7RA 4F8EA 1UKCA 2WHPA 4QODA 3RWMB 4C4XA 3RTBA 1T9AA 2V5QC 1XF9A 1VBMA 2XNSA 3QNMA 5EKSA 1TVEA 4XYMA 4ZANA 1DV1A 2DBZA 3LNTA 4FZJA 2QTTA 1EBFA 1IL0A 4KFCA 3L0CA 3RKUA 1JHRA 4QU9A 1MAUA 1ZSYA 3RODA 1W2GA 2OQRA 2IWHA 3NFYA 4H31A 2H2HA 1YHYA 1EHCA 3TECE 2HHHB 3TIIA 1TAGA 5HKPA 5I7RA 4ESOA 3H84A 2A5DA 3DOCA 1S70B 2DE0X 1LQTA 1TQHA 2F8YA 2BEVB 1FNMA 2VQSA 2PPVA 5EPOA 1N6IA 1D9ZA 4FYIA 1YOVB 3WRXA 4KVAA 1ZFNA 1OH6A 3ZDZB 5FWYA 3SNHA 1F48A 4ENUA 5KYKA 3GMTA 3EVAA 4FMCF 1G8MA 5T4EA 2VNAA 1WV0A 1KSHA 4UE6A 1IOVA 1NVFA 2R59A 4RETA 2ZAYA 3UW3A 3JQAA 3RAJA 2BGUA 3ILXA 4YLEA 1U5BB 1VHQA 2H1VA 1HBJA 1VMAA 1E3LA 3L82A 4MDYA 3DE2X 1E94E 2HKIA 3EPKA 2CNLA 2YWCA 4A0HA 1OX4A 1NRJB 5G4KB 4KQCA 1P2FA 4QNNA 5JRDS 4AECA 1RS0A 3E4CA 1A7UA 3WQSB 3PGVA 4DLLA 2X0NA 4YQZA 3U60B 4G23A 3ZVKA 4O4JF 1DC5A 3X44A 3DBVO 4H6VA 3CF4G 2C3OA 4I6JA 3A1EA 1KTVA 2H1HA 1P0QA 2YXPX 2W6ZA 1QHHA 3TYXA 4X9XA 4AX4A 1XTUA 1JR3A 2FN3A 4V0NA 4P22A 1E66A 3IUPA 2JLYA 5C31A 4K05A 1NNI1 4RA6A 2VAVA 3NBKA 2DG2A 4FGKA 3RKSA 4OK5A 1ZH4A 4FFOA 1NRIA 2PSHA 2D1YA 1TEZA 4LHSA 4P4TA 1RPNA 1S2GA 1ZD5A 3GVXA 4EDFA 3RBZA 4HKTA 3TSYA 4IGEA 4GB9A 1ZVMA 2F55A 4J4TA 1T0PA 2A0YA 1M8PA 3D31A 1UAGA 2H4ZA 3A6FA 1MKYA 2JGRA 5C8ZA 2E48A 4MW1A 3FOFC 3X1KA 3PHBE 1UMCA 1E5XA 1M6NA 4GPMA 3OLYA 3TPZA 4CODB 1OYVA 1BVYF 3FFXA 3ULQA 2DU8A 1GIAA 3EXFA 5CG1A 4UE3S 3IXQA 3PXAA 2FXVA 3O1HB 4F72A 2AEEA 2WIBA 2CDCA 2DBRA 3A11A 3DVRX 1WM1A 3QU7A 3PRJA 3P9ZA 2XRYA 3RVQA 3AEKB 4E5SA 5EKDA 2GS9A 3SFXA 5G0WA 4RIHA 2A8YA 4YYZA 3HZHA 3FUHA 5CMWA 1YH3A 4R1SA 3LKUA 5M04A 3IR7A 2EZTA 5C1DA 3ESKA 5EEGA 4JCOA 2X6RA 1DKQA 1P5ZB 3OQ1A 4DG9A 5LU8A 2YJZA 1HMYA 2ZANA 1INZA 1GPLA 3A06A 5UKDA 1NDUA 2QORA 2P79A 2DWZA 3O73A 1XVUA 1LTKA 4L9RA 4EPZA 2I65A 1RKQA 2DJIA 3AWDA 2GW1A 1YJXA 3GZJA 3QW2A 4MUXA 2A5EA 4LV8B 1H2RS 1M83A 2G71A 3DWEX 4DR2B 2CMDA 2ZKIA 3WIOA 3D64A 2O4UX 4BFTA 4UATA 2OM6A 1UBHS 3X1XA 4YC7A 1LBHA 3OE4A 5H16A 1FTYA 1RYYA 2WXLA 4G84A 1UT5A 3R5FA 1NUQA 4RHXA 5LYJB 4P0QB 2JLBA 5FBVB 1EP2B 4DA6A 2QNBA 1RMYA 1A17A 2AEJA 2PCJA 3K71B 3JWGA 4IINA 3U4DA 4FGSA 5JI2E 3FVVA 4AN1A 3CNHA 4XAQA 5DPMA 1IBMB 2OHFA 3LT5A 4L08A 2H63A 3K1JA 2QKYA 4M0MA 4JHJA 4F4HA 4EJ6A 5A6SB 5EHXA 5KYTA 5J08A 2GM5A 1X38A 1ZUWA 1F1BA 2X2EA 2QTBA 1HG1A 5ENVA 1D07A 1OFUA 5FNZA 1SB8A 2DETA 4FM9A 3FCXA 1PJLA 4EL5A 2Q6VA 1HG5A 5JT1A 1WABA 2XD4A 1U9JA 2R5SA 1N2IA 3WAJA 5BT8A 1JZSA 1FP7A 4PLPA 5KSZA 1W4RA 3RVBA 1ZP6A 1C0EA 1S89A 3DPDA 4P0PB 2QY9A 5TGDA 5C18A 1GAJA 1D4ZA 4COOA 1ADGA 4MW5A 4HJXA 1XEWY 1M2JA 2HA7A 2WABA 1U5AA 4NQRA 1QZZA 5DW3A 1Y33E 1HORA 1ZB1A 3QW4B 1JKMA 4UTRA 4HY3A 4D4LA 4XPIA 4ZCLA 1DRUA 2P77A 2HF9A 4D81A 3FNHA 4PXSA 4G0WA 1XOIA 4EJFA 3HJFA 3JYQA 2VLIA 2IS6A 4LY9A 4DLBA 3VAAA 2Q5EA 3V1LA 5EXDA 4E3ZA 2H54A 5FINA 3F6YA 3R23A 2LVBA 2KQUA 2R8RA 1XR3A 4CJXA 1TZMA 2CXRA 2C61A 2OVBA 2ZWIA 3I5AA 4DLNA 3ND7A 4IAOA 3N58A 2HU2A 1OZ0A 1K2WA 2HWUA 2WVIA 4LUCA 1A3CA 2W93A 1ETHA 5JSHA 1NNUA 3U3KA 1N77A 2ZXUA 2WAYA 3NAGA 3K0CA 2ZRFA 3SXUB 2C9MA 3OCZA 2GK3A 4JI5B 4ZKDA 4PAGA 3S1AA 2H7VA 2W6QA 4O5AA 4DJTA 4MP8A 4FFMA 3H1FA 2PWPA 2CV2A 2R85A 1FMTA 2H06A 2JGAA 1EJBA 5J2TA 2CGEA 1QQ6A 2IXDA 4QFVA 3ASUA 3ZHXA 1WG0A 4DQKA 3NBMA 4JPSA 5FX2A 2V4MA 2D5IA 4BFUA 4OXIA 2ZS7A 3LY8A 1MTZA 5EWJB 4DEYA 2OBMA 5E2IA 1J56A 2VCYA 3VH1A 3UK1A 3LPAA 1Q7EA 1SUIA 5A5VA 1G2IA 5MDHA 3E61A 3AFHA 4C7JA 1JAIA 1S02A 3ZCUA 5DP2A 3UCXA 4W8HA 1YL6A 5H4GA 3U56A 4KRXA 3Q7AA 2D59A 3HKBB 1AO3A 5DMHA 1V71A 3BFVA 5ITWA 1VYTA 4FFPA 3QVSA 4FGUA 1HQKA 4ENTA 3BSWA 5JSZA 4C3ZA 1XNHA 5I8WA 1QV9A 3CE9A 2CJWB 4MJXA 1JEAA 1GZ3A 3RSHA 3OF2A 3L0SA 1UG3A 4YJGA 1R37A 3MMZA 1F2VA 1XCLA 3TE6A 3L4JA 3L6BA 1BHO1 2ZFUA 3TD2A 3LQFA 1A9XB 5FA8A 4JC8A 2VNKA 4BRZA 3HCNA 3O9VA 4MK4A 3F7TA 3FMVA 2EFYA 2H9IA 1W29A 3FI9A 5D0QD 3PG5A 1QMOE 4MVJG 2XBLA 3ACCA 1QR2A 4ZFHA 1VJTA 1IONA 2P9TA 2YYZA 4DDKA 3KJIA 2QUJA 2WUDA 2PMWB 4MS4B 5DYNA 4GEKA 5E1MA 5KWSA 3OQMA 1V9CA 2C77A 4TV8B 2XE6A 1UXJA 1ZISA 1KOFA 5DH9A 9GPBA 5KWDA 3LW7A 4TKVA 1YKFA 1Z7EA 1KMQA 4K1XA 5E0KB 4ILGA 4J8PA 5LQMA 5KOJA 3LDZA 4WX2B 3HP4A 1YBMA 1Z5PA 5LCXA 3R3WA 3SYLA 2VLBA 1MHPA 4K6OA 3AV3A 4GSKA 1E96B 1XCJA 3D3NA 4WDQA 4N65A 5BW8C 2QD4A 4BQEA 4C7OB 5IWCA 2EIKE 1M1YB 4MKRA 2NM0A 3A4MA 1AF7A 4AOFA 2W98A 4Y6OA 3ZK7A 4QO8A 3A1CA 2PNJA 2WXKA 4RV9A 4DNOA 4TWIA 4FBLA 2FQYA 1SWWA 1N2CA 5T64A 2VXYA 1OOEA 3NNSA 5JHAA 2IKQA 5H81A 2V8BA 1L1FA 1K8YB 5H5JA 3N5CA 2ZB7A 3VDXA 421PA 2JJ1D 1XZEA 3DLBA 4DR5B 3SC2B 3AY0A 2NO1A 3TRFA 3ZHEB 1OLSA 5FP0A 4GG1A 2FFHA 2AOTA 2Z08A 4XX0A 4RCZA 3EN0A 3MB5A 4G07A 4B87A 4XWTA 3C45A 3BT3A 1PWHA 4GH5A 3A3OA 2ZRIA 3TX2A 2PM8A 3C8DA 5CT8A 2PMCA 4K40A 1JDVA 4KMSA 3STXA 1VE1A 5BSMA 2X0EA 2X22A 2H3HA 2IO2C 3K5HA 5T67A 2KS6A 3D6MA 3CINA 4G0YA 4EHBA 1N6RA 4CKCA 5F78A 3BREA 2Y1LA 4FU0A 4WZAE 3KT0A 1L7RA 5CXQA 3C5RA 2OV6A 4GM0A 5E6SA 1YYHA 3EHNA 1DC7A 1ULAA 2AR7A 4EGCB 3CN9A 3PD7A 3OJ0A 3BCSA 1RLUA 3FN4A 3HVKA 1AV6A 2ZJ3A 3IHKA 4KRFA 3GQVA 3H11B 2RHLA 1SEPA 5BR8B 4P3OA 2G3YA 3QKSB 3GVPA 4KTTE 3C3OA 4QDOA 4DHEA 3T3NA 2AJCA 3Q79A 3HLYA 3DG9A 2QGZA 2J9YB 3HJCA 5ADUS 1UDRA 2ZYUX 3MEKA 3C6YA 4RNDB 4CKEB 1F4PA 4RF3A 1AQ6A 2QXYA 3ILSA 3LLMA 3PSHA 1MO5A 4HNSA 3T0FA 2ZRCA 1JLLA 1V7QA 4I6GA 3EXAA 3L8GA 3N2KB 3GJ4A 2ZVPX 1HR0B 4RY8A 4D9HA 1E61A 4IUDS 3VR2A 5IG2A 3L0IB 1W52X 2A7XA 1AKEA 1Y8QA 3SMQA 2F3UA 2GESA 4K5CA 2PMFA 3NH9A 2IIPA 4WJZA 2HJRA 1RWWA 4Z49A 3TDNA 4RTRA 4G86A 2AFHE 5KX5A 4I4TB 3UV7A 5EE3A 3PDUA 4WNAA 2IONA 4HYYA 2J0VA 3EWNA 3R7WA 4UQLA 4G5XA 1B2LA 3SJAA 2V5AA 4UASA 4Y2HA 3K32A 3M5CA 3CVVA 1IKND 3CHPA 1L4EA 4UZEA 2C7GA 1JU9A 5FUXA 4TXNA 1DIGA 2G09A 4XD7A 4D3SA 3O26A 4KPFC 2C84A 1O4VA 1KHHA 3V48A 4DPRA 4L6AA 2W4QA 4O4LF 3QWBA 1FU7A 3K9HA 2PKXA 1XD2A 5B3JC 2Q3BA 1IB0A 4JVOA 3QRWA 3ZQJA 2PM7A 2D3TA 3DCIA 5JROA 1UPXA 2XCCA 1SZDA 2H11A 1CRQA 5CCDA 4FHCA 2I3DA 3GCGA 4X7BA 4YJKA 2ZK7A 2EARA 3LBIA 1OFTA 3UFXB 2OBYA 4OQMA 3MTBA 2R5WA 1D7OA 1GG5A 3CH6A 1OXKB 3LG2A 1WMSA 3HN7A 2HV9A 2YV2A 1QFZA 1RDFA 2AR0A 5K03A 3NP9A 3OLXA 2ZJYA 1C7EA 4B44A 1W36D 1YULA 3H8WA 1FQJA 3BK1A 2DCUA 4GGPA 1L4UA 4ZCTA 1Y1SA 5L95A 3AF0A 1ONBA 2GM4A 4YECA 3CVJA 3BT7A 1QZ3A 1KYVA 2PLWA 4FFDA 4EATA 1ACJA 1CC1S 4FNOA 4MS1B 3ULKA 5ENNA 4KEAA 2FV8A 3E2PA 3HXTA 3JUEA 1XZAA 4Q12A 3ER9A 5A7FA 3JPYA 4G5GA 1B2RA 3G9XA 1N5JA 1P2UA 1H6AA 4UM9B 3C7KA 2AUTA 3D0QA 4OYSA 2ZIEA 3K70D 2P3SA 4XSVA 3SLRA 1CZNA 5C1IA 4X3PA 1KBZA 4J4BA 5KYYB 5K4HA 1OKKA 3QI2A 4QG7A 2X8WA 3GFQA 1A2OA 1VE3A 1U1DA 2G25A 2TMYA 3HTXA 4BEBA 3OQIB 1FVXA 1SC6A 2FOLA 2IXTA 3S2FA 4RORA 1YRYE 2XMGA 2I3ZA 1QQ7A 5JFOA 2IEZA 4NICA 1QHXA 2DY0A 1O57A 4YP6A 4OU5A 1LNZA 1JP7A 2JVIA 3K7EA 2AC2A 5CH5A 1YCFA 3PP8A 4QLOA 3WK5A 3RPEA 4KSYA 2FN9A 3PHHA 1XVLA 1L5WA 1QM5A 1V54E 5KO2A 1I0LA 2HTFA 4LEIA 4TLEA 1FDOA 2PX6A 2OFOA 2B1GA 3IEGA 2HSJA 1XN1A 4G0XA 3PFGA 5AQ9A 2BEUA 3ZWOA 3ID6C 2A5GA 3N2LA 2QAIA 1NF3A 4RF5A 1UN9A 1S2DA 1W5EA 3BE8A 5IJ9A 4JQZA 4MKHA 3RVNA 1QQAA 2E4YA 1JIJA 3DE6X 4EG0A 1KP9A 2JAWA 3HJNA 4HLDA 3L08A 4MVJE 4CI0B 5BQ5A 1YQTA 1DBSA 2ZKLA 5LOVF 1QC5A 4PZAA 1H5UA 4MR7A 2PT5A 5BR7A 4JP1A 1QV6A 5E6UA 2IPLA 1V3UA 3G5AA 1R6BX 1ECBA 3HMKA 3W7VA 4UUCA 2Y4TA 5BMOA 1TGYA 2H29A 3EXEA 4KIWA 4BVEA 1JWLA 5E4YA 5IC4A 3TIGA 5KYWA 1XEWX 2M1ZA 4HGYA 5AQ1A 4LE0A 4IG4A 2IZ1A 4A2PA 3JAKB 1MUUA 2IYLD 3L77A 3HZZA 1GLVA 4LJ7A 3X3HA 1EGVB 3ABME 5IRCD 4Q82A 4PLFA 1R66A 1QRSA 3V8QA 5TXGA 4CT5A 3CNNA 1QGYA 5FPPA 4ICIA 1T1IA 4AO6A 4YMHA 1ZH8A 3I12A 5CR9A 3MJDA 2PUWA 3I3NA 3HE3A 2X1LA 3CSSA 3PITA 1VMKA 3R6LA 2VTBA 1SUWA 3ZQ4A 5LWHA 4J29A 4DLOA 2Q1WA 1NUSA 1CIPA 4AP6A 4RXMA 2Z30A 3G2NA 1YA4A 2EKLA 2JI7A 3IRUA 3D2BA 4DG8A 3PCTA 3OLZA 4Y2QA 2A92A 4MYUA 2BMVA 4Q47A 1G9TA 5DI3B 1ESNA 1SCQA 1WCIA 1DKPA 1DO8A 1T9BA 3C3PA 3BZWA 1M8KA 1D2RA 5FHQA 1FRZA 1B14A 2VBCA 1A9PA 4PYMA 3KQOA 5CU7A 1DT3A 2A9VA 5REQB 4DSUA 1GSAA 4KN5A 1ZWLA 2C82A 4RPJA 3FLAA 1TIKA 4ZOAA 5B7QA 4Z4IA 3B60A 4BNTA 2WU4A 4C6HA 1KYZA 4YRDA 1JV2B 3S2EA 2W90A 3CNLA 4H7XA 3RYHA 2XMZA 1YQEA 3SHQA 1Y3DE 3L6EA 3GW4A 3H9GA 1N5LA 1YR3A 3DFFA 4KWCA 2YFKA 4LTNA 1QH8A 5EJ9A 1O6GA 5I5EA 5EHIA 3L01A 3AHIA 5I4BA 4PG7A 3LT2A 3SEFA 3FUMA 1Z62A 4V2IA 1FTWA 4CF3A 1JU4A 3RS5A 2EW8A 1N6OA 5FBLB 3DKVA 4DLTA 1E58A 1FLDA 3CYFA 1D0IA 4LNUB 4LQDA 1LV7A 4IMIB 2WILA 2ZG6A 2YBDA 3OPQA 4XW2A 1NWHA 1N4RA 2Q4BA 1GQRA 1MC8A 2CBXA 1YQDA 2AWNA 4HVCA 5L6LB 2RFMA 3RM3A 1D6JA 1RLOA 4QOHA 3TAHA 1KQOA 4QFDA 5AT1A 1E1KA 1TM7E 2C3YA 3HDQA 4HYEA 3R9XA 3C6QA 2FX3A 4CLDA 4G5RA 3WGHA 1TCCA 4IG9A 4JSYA 1R88A 3IQXA 2A4MA 2B3TA 2VPYA 1P4RA 5FBQB 3ZWYA 2XLBA 1Y1PA 1UP6A 1SKQA 4FJ0A 5LA6B 3W8RA 5CTAA 3OZDA 4D6XA 4NMHA 1Q91A 2BFEB 1Z29A 1E6UA 1RMQA 3B1FA 3KQHA 3O4IA 1ZUIA 4ISBA 3M82A 1R5NA 1S2LA 1N1EA 4L50A 1XCOA 2WQ6A 3U3RA 4RFLA 3KE9A 4AY3A 3WL5A 4H7FA 4KH0A 1XLWA 2G07A 3ASFA 2V59A 4U02A 1Z0DA 3MD9A 1UC4B 1T4CA 4CQMB 2VXOA 5FBRB 3MA0A 4B40A 2W7TA 4X97A 3GDOA 3IO3A 3IAUA 2QX6A 1S3FA 1TF2A 2C94A 2Z8ZA 3GCXA 2WTXA 1JA0A 2WV9A 1RI4A 2R7LA 3PVSA 1QVAA 4H3SA 2GD6A 5JD3A 5ARGA 3IJEB 1XLVA 4JBNA 1U5CA 3K1TA 4PFQA 1X3LA 1T43A 5BN5A 4ANVA 2WTUA 4CIYA 2BFAA 1KVUA 3I42A 1K6EA 4MEBA 1ZCFA 4YUYA 4URYR 3GXOA 1UPCA 3IGFA 1OTYA 3FB1A 2V7WA 5DM1A 1HLDA 2KJQA 3I0ZA 1MO3A 3M4JA 5DWDA 1FPQA 2V3CC 3OCVA 3O38A 5LM3A 3UPTA 3T5XA 1TO6A 4MRRA 1VIAA 5G3YA 1XXHB 2D2EA 3W5AA 3U7JA 1G42A 1LS1A 2QPLA 1ZK3A 4PZEA 3RV3A 3IPXA 3FCAA 1QP8A 5LIRA 3QF4A 3PWSA 2ZT7A 4S04A 3GAFA 4NG5A 3TNYA 4G5SA 2Z9CA 2UV8A 1G19A 2HMSA 4DPKA 4ARBA 3H5IA 5GVSA 2QVGA 3A2MA 4MWTA 4IXWA 4I9NA 1SELA 2WTAA 4TQ9A 3GJ6A 3AM4A 1Y6JA 4GKVA 1RCUA 2GPNA 4NYIQ 4P5DA 1LJ8A 2VATA 2XHEA 4CT4A 5K8UA 4WBXC 4D9KA 1XROA 5TEWA 2QRPA 3JQFA 3C5HA 4BFXA 3WY9A 2D2VA 4FJ1A 4JXJA 1ENOA 3C6XA 3R7QA 3NTOA 1ZJJA 4GTVA 2E85A 3VC3A 3T7DA 2V5FA 4XARA 2Q9UA 2AKEA 4X93A 5IUNC 3OMSA 3TWTA 1RZUA 2RGNA 4LN1A 4JA2A 1OX6A 4Z9YA 3LH5A 3A04A 1E59A 5EJFA 5A2GA 2R60A 3I73A 1KPHA 3DB1A 4DMKA 3OQNA 1GCGA 2XMSA 1DG9A 1MIOA 4GGOA 1XV5A 4XVQA 1OVGA 2DFTA 1E20A 1X7ZA 2O0MA 2BH9A 5B36A 1FE8A 3JAWB 4WCVA 2SCUB 1RIFA 3VYWA 2IH2A 4R9RA 1H93A 4EYSA 1FTQA 3AZOA 4K9QA 4LQLA 3FPEA 2VF7A 5CVUA 3OETA 2PNNA 1X1AA 1CUWA 1ELRA 2CNKA 1P60A 4R40A 4AS3A 4E5NA 1I6KA 1OKKD 3ZZ1A 1PZHA 3GFOA 4XX5A 5FWQA 3LL7A 1M6WA 2BGLA 1L3IA 1MH9A 5FTKA 3DBIA 4L4UA 3GJYA 3KKOA 2ISSD 5IASA 5E8RA 5FLXA 4YROA 4MR8A 1AU9A 2IP1A 2P2NA 3GXBA 2XWBF 3JVUA 1PT9A 3PR2B 2FZCA 1GPKA 1WSBA 3TOCA 2J8ZA 1NQVA 1JI0A 1TQ2A 3KHTA 3EQ9A 1N7GA 3AHEA 4UCQA 5DHQA 1U8TA 2G5PA 2GZDA 1UK9A 3WGQA 2YXNA 5JANA 2C4KA 1TM5E 5DLPA 1V16B 1QYIA 2RG7A 4AZVA 2QX7A 2ZU0C 4PWYA 3JTMA 3R24A 3WTCA 1P8JA 2FEZA 3F9CA 4DUGA 3OCJA 3TTSA 2W70A 3AS4A 1P2GA 1AG9A 1JYFA 4KPUB 1BSVA 3U7RA 2XB9A 3K35A 2MINB 2CVZA 5ITSA 3TG5A 3INGA 3B1ZA 3SIWA 4J0IA 1A2KC 3ZYCA 4IEFB 4RBNA 3FUCA 2PUBA 2OY0A 1H23A 4MMYB 1JKIA 5LXTA 1CG6A 5KNDD 4BMZA 5FPKA 3HCAA 2AW3A 2GBGA 1YCHA 2PZEA 1AQJA 4JUFA 4OAVB 4MH0R 3KQWA 4W1SA 3R74A 2F9LA 2Q50A 1TCAA 3KQVA 1Z6GA 3R76A 1T3ZA 4RS4A 3GZ4A 4F5ZA 5MFZA 4G4SP 3I4CA 1HLGA 1H1LB 1S64A 4CM7A 4R2LA 5KYUB 2NUPB 3HU1A 2JFFA 2VYNA 1YFKA 3QOXA 1ZA2A 3RKVA 1RQ2A 5JXIA 3MWGA 4MCIA 1WLYA 2NU7A 3RNLA 16PKA 5B2EA 2YV3A 3C3QA 1XEXB 4PR3A 3G0DA 3ZU2A 2ZUEA 2ZT6A 1EVIA 1U2TA 3IDQA 3UCEA 4KP7A 1RZVA 1CUHA 4RZUA 2Y27A 1U3VA 2W2VA 1RPJA 3GGOA 3PUZA 3AVOA 4HPJB 4ZV7A 4ND8B 2Y1KA 3KR0A 2Z04A 2F1JA 2VI5A 4G0PA 2PZJA 3SYRA 3BWXA 1GM5A 4NFYA 4QDKA 1GZ4A 4OP2A 1OU4A 1N6PA 3IIEA 4A8TA 4FMCB 5LMNB 3KTAA 5BN4B 3ROZA 4ZVRA 4UNSA 2GMWA 1ZOIA 5B4UA 3T9BA 3M3PA 3ADOA 1MX2A 2IHBA 3KL2A 3ME5A 1L9KA 5FTMA 2BLLA 3WYDA 2D1QA 5F35A 5AYVA 2QMHA 4KZKA 5FL3A 1SQSA 3ZJ5A 2WXFA 3CRMA 5C53B 1VJCA 2C29D 2H31A 4G36A 3I3SR 4G8JA 3FUEA 2VSNA 1TMOA 4JR2A 1YS9A 1BCSA 4HX9A 3P71T 1NJSA 4K1LA 5DNYB 1JSLA 5JJ6A 1JW9B 5JO0A 3QXSA 1W76A 3WDLA 2R8YA 2OBBA 1XG5A 2RIPA 2DWCA 3W8EA 4ZYXA 4LHZA 2X41A 5FA5A 3ASHA 1E2GA 4O4JB 2YFYA 1QG2A 3OAAA 3EQZA 2M6LA 4PHCA 1V8ZA 2Y99A 3NUGA 2I4RA 4BY6A 3TKLA 3R9WA 4DI3A 1U2QA 2BP7A 2V6BA 2QUZA 4JXTA 4PO8A 1E90A 1X92A 3HYRA 3PF9A 3RC7A 3NALA 3TWWA 1IXRC 1NYTA 4CDNA 5KHAA 3Q7SA 1XXLA 4BB5A 2W0SA 4U2FA 2RC5A 4AFNA 5ALKA 2EILE 2AN3A 3U4QA 5DM0A 1YU9A 4D80A 2V6JA 3IPLA 3VR4A 1NNLA 4RWZA 2K5UA 2I33A 1ABBA 4RMIA 2C97A 3QUBA 3H7IA 4MLZA 2W6JA 3QVJA 4JOCA 5DZSA 1SXJD 1IB6A 1P1BA 1UDXA 3EOBI 3G0IA 3ZE0B 1SXHA 1H2BA 3IBFA 2PA3A 1XPRA 4EQZA 4JHKA 2G1UA 4WEOA 3RUPA 1JPUA 4ECAA 4I8DA 2P9YA 2I2XB 4MP6A 2J67A 3ZIDA 4F4UA 2C0MA 2GNPA 8LDHA 2G4VA 4BO1A 1NURA 3G2JA 5JMND 3BH6A 4XGKA 5DEIA 4OB6A 5KTKA 4OJNA 2GEUA 4PHGA 1E98A 2BJVA 5GOTA 5ADHA 3B7BA 3IALA 2P9NG 5LP6A 4CM6A 2N3ZA 4EVRA 1K8XB 1MAAA 1UOOA 1V95A 3VVBA 1E7QA 4JB8P 4X1YA 3NHAA 4AYWA 4L8GA 1RQRA 4C0SA 2IDJA 2R79A 4M2LA 3HN6A 2OVFA 4TV9F 1QANA 4CV1A 5KYVA 1KEEB 3RNOA 1Z4LA 4FYHA 3OURA 5TV2A 5FFFA 3ZZNA 3MFYA 3REGA 3KQLA 1EX9A 3JRXA 3ACBA 1QYCA 2XT0A 1IM2A 1O6ZA 4UQPA 2EZ8A 1US8A 1TAHA 3ND6A 3MWEA 1GZUA 5A4AA 3LBHA 2P9ZA 4RMHA 4QHYA 4ZEWA 4EYEA 2AI2A 1XNRB 1F2TA 1SOAA 1H65A 1V1RA 1ZMOA 4KUHA 3OTWA 1KDVA 1E2BA 2XNDD 2PUTA 1HNNA 2F6RA 3EVZA 1BMFA 1PG5A 1E7UA 1BMQA 4JU9A 2GLXA 3T4UA 2JVKA 3OFNA 4PAMA 2IX3A 5TT1A 4CF4A 3TG8A 3GLUA 1M8FA 1KIMA 2H3EA 3ACDA 2P9GA 2GAOA 3UKDA 5EMHA 3NM6B 3LX4A 2EV9A 4V0KA 3A3PA 4XI9A 4EG3A 5KNBA 1TTTA 5HJ7A 4ZT6A 2NACA 3QU4A 3TIVA 3RRYA 1BROA 3WLSA 1VA5A 4YAKA 1GN9A 2GRLA 2IYWA 2FMXA 2FMUA 1EYHA 1FNSA 4HDKA 2IZZA 2CHVA 1ELOA 3Q8MA 3NAMA 2IZ6A 1SZ9A 2E6UX 1VDMA 3P0IA 4X8OA 2QJOA 1KTIA 5FBKA 4OM7A 4H0CA 1R15A 1DZ3A 1F4LA 4TKUB 4QC2A 2XTNA 3BFPA 3GF4A 1RABA 1VLMA 1RMTA 4ZWNA 1Z06A 3L6AA 5IBRA 4TL9A 3C43A 3DMNA 3DXYA 1X6VA 3HDTA 2B4TO 3NI2A 3ROQA 1VHLA 3OSZA 3T0IA 1DO2A 1QIEA 2R17C 1NBIA 4R7GA 2R7AA 3EX7C 2PYDA 2YINA 1DGQA 4MB6A 3FNEA 3C4QA 2UKDA 3RANA 3TPCA 1IZ0A 5G2NA 4TWZA 1ZGCA 4JUAA 1CRZA 2PWBA 3DT8A 3HA3A 2C03A 1UADA 2JFUA 3LX8A 2NZXA 2YVUA 2HK7A 4N49A 4IFTA 1E64A 5BYAA 5F64A 1VXRA 2GBIA 4A8PA 3PHLA 2HLDD 3F5FA 4EIWA 2EFHB 1KMNA 3L6CA 1IQPA 5G0VA 4JXXA 1CU1A 1R8JA 1Z6XA 2VHYA 4A6EA 3ZIMA 3HJHA 2DQYA 3NBXX 4AF7A 4EDHA 2XCLA 5F4ZA 4RTJA 3SO8A 1PBTA 2N46A 5D3ZA 3B7GA 3JUIA 1EGQA 2GWHA 3UQZA 3AUKA 4ENQA 2NU8A 4M8LA 4UCWA 1AGXA 4C06A 4F04A 5C37A 1JEQA 3RLIA 3K72B 1BWPA 2R9VA 4TRJA 2DPYA 5K01A 2AGVA 5DBOA 2QUAA 4YJ3A 4XVUA 2FW6A 4HTFB 4RS3A 4P84A 1Z0KA 4Y18A 1GW6A 2DSTA 2NSJA 4BLWA 5FBZA 3U66A 5GADl 1A5ZA 2FULA 3TPFA 4L2IA 3OY7A 4NP6A 3LZDA 4K5AB 3KRTA 4TWAA 2YVQA 3O8OB 1GKKA 5DNDA 1A7JA 4QQRA 2X5HA 1P72A 4KQ6A 3RFXA 5DBFA 4DF3A 2MSLA 2VGXA 1K4YA 3KWLA 3NGMA 4ROTA 5CVCA 4YX9A 3IXMA 5B7GA 2B0JA 1A8SA 4OHBA 4ZZ0A 5A3QA 1NBHA 5EQFA 4GLFA 1XQ6A 1MFZA 3EDMA 4BE7B 4QUEA 3F96A 4R2XA 5CBNA 1KIAA 5H02A 2RAFA 4ZEVA 1HG0A 4FFBB 5KUTA 4G8CA 2C5FA 4LXYA 3EEYA 4WEQA 1FOEB 1BEEA 3OUZA 4Y6LA 3HR7A 3D8TA 5KI6A 1YA0A 1GRVA 5U4XA 5JIBA 4C5AA 3ELBA 4MUIA 4G8LA 3A0UA 5DYWA 5HZMA 4FUTA 4QEKA 5CJ2A 1HXIA 2X19A 3EPPA 2C5LA 2DR3A 5E9QA 3PVLA 5BMVF 1APBA 1JJVA 3TJMA 3PXBA 1EWTA 3N6XA 4MGIR 5J4YA 4OVVA 3BJMA 1Z3XA 4JXZA 3VZQA 3TRDA 1VLLA 4HNTA 1TOAA 1PQYA 4O02B 4ZAYA 3WL7A 2QD2A 4I1PA 1X3SA 2EEZA 2QXUA 4BXOA 4NE2A 1E4EA 4QGGA 1PFVA 1SOVA 3G1TA 3AM1A 1CERA 4OQDA 4AJJA 4OQEA 2IGTA 1ZSVA 2R5NA 3R6WA 3UT5B 1UW4B 1QJ4A 2AUMA 3BX1A 4N39A 4NZ9A 1YI0A 3M8KA 3MCZA 3IH5A 4BY9E 1QVZA 3N39C 3LY9A 1JMVA 2OCCE 1A95A 1ZDMA 1P0MA 5B2ZA 2IYAA 4AKXB 4JMLA 1QCZA 3OEHA 1QJCA 2KLBA 3NXSA 1G4AE 1KVTA 3WADA 3EJNA 4P1ZA 3FMOB 2ZTVA 3W2IA 5HKLA 5ALYA 4CCAA 1NBOA 4N6OA 3ZD9A 5THXA 2QL9A 3IA2A 2QN3A 3GNLA 1JFVA 2P7HA 4BVAA 1CEXA 5E1BA 3I9FA 1T1RA 5KVVA 2YMMA 1DRVA 4QKQA 3COPA 3HVUA 3IKMB 3L07A 4JR0A 4FSDA 4OXNA 3T52A 2DK6A 2WJ6A 3QK7A 3C7TA 3SHVA 3MBIA 2DQ4A 1IXSB 2ZQ5A 4LRSB 5A9SA 4XH9B 1TKRA 1GOTA 1MOQA 1YE5A 5ALGA 5JADA 2FEMA 4HK4A 1VL1A 1SVWA 2ZYSA 1KFJB 3GD7A 3G6KA 3RWBA 3PWZA 3KDAA 4J94A 3SR3A 3B36A 1ZHOA 2CMKA 4JEMA 3PD1A 1N8SA 2Z2ZA 2GARA 3PXUA 3ZV4A 2HDWA 5IPFA 1BTOA 2Z4SA 1ZAYA 3ZGOA 2QS9A 3FCEA 4ZO8A 1Q84A 5I9MA 4C6SA 5FBHA 3ZE1B 3MB8A 5JMOA 1PX0A 4HOTA 3LF2A 2Q9CA 1HFWA 4OMFG 4DGQA 4UAUA 2XUKA 3NTXA 1WPGA 1HETA 3TVDA 2NZUG 3DDZX 3ECSA 2E9SA 1V43A 2CFTA 3M3HA 3M6XA 3OFJA 3T41A 5JV5A 3H9UA 3W2GA 1YT5A 3OQVA 1CY6A 3NT4A 3DE5X 3ZNQA 3R7AA 2MYOA 2CVHA 2RHCA 4KYOB 1VSQA 2QM8A 3ETJA 1ETUA 5JATA 5FQ8A 4ETNA 1XYYA 4DS3A 1IAQA 3UG6A 1J9GA 4X62B 1TUGA 5JYDA 1LDEA 3ET5A 1Q15A 4ND4A 4QFMA 2RARA 4BBPA 3GGSA 4E4RA 5HHTA 2UAGA 3SNXA 2R48A 4CR8A 2MHCA 1ABEA 4J0HA 1KBOA 4CQJA 1SHJA 4DQXA 3SBTB 2Y1WA 1NTOA 5KYNA 2BGTA 3R0IA 1UKVY 3A6HA 5ES3A 1K27A 3UB2A 1L5SA 1Z6YA 3LGSA 2Q41A 1TEXA 4ZHQB 4FW8A 1P5QA 2EJWA 1P0PA 2ON6A 5EXEA 1Y37A 3AJIA 4Q9KA 3GCZA 4ZCIA 2HPAA 4LOIA 3OZWA 1MZCA 3NDRA 3T5AA 4JITA 1K0UA 2WJYA 4OX9B 4RJLA 3DHWC 5B55A 1FZQA 1PYOA 4KUGA 4CM9D 5I4CA 1HSZA 4K6HA 1HDGO 2R8PA 4UBJA 1P2DA 1U2DC 5JH7F 5AVRA 2B34A 4M1EA 1TT5B 1L8LA 4YJHB 3KX2A 2WW8A 3WYBA 2Z5VA 3CKMA 2WJ3A 3AC0A 3HV2A 2XZDA 3ZC3A 3E5HA 4O4LB 3GLKA 1S4QA 2LR0A 2OCGA 2DM6A 2W2NA 1M0TA 3ZU3A 2PRIA 1YC5A 2SECE 2XB4A 1SXQA 3DMTA 4PF1A 1S9DA 2IODA 3ZZMA 2MR6A 4YQYA 2P0AA 3GZSA 3C4VA 5BXQC 4KE6A 2LAHA 5DMXA 4M7PA 1AS3A 1GSIA 3DQQA 1UDWA 4O8ZA 4DRXA 4QQFA 3PIIA 4NV1A 5L3SA 2PRZA 2VH5R 5LB4A 5A4MS 1K86A 5F21A 4CZ2A 2B6CA 1QZTA 4BECA 2O5EA 5IC5A 5GZ3A 4IXTA 1RKXA 1W88A 1W2WB 2C2KA 3B1VA 3E9RA 2FLKA 3KHKA 2ZDGA 5E4JA 4AKTA 3FUJA 3EQ2A 4RF4A 3NHRA 5JC1A 3LZ6A 2XPZA 2WM2A 3R77A 3O4HA 3V7NA 2HWXA 4EHNA 1OA0A 5HZHA 1E62A 4LRXA 2WXMA 3T1VA 3VGJA 5L3ZA 3I8SA 4BTVA 2I9CA 1TLLA 1VHTA 3MGKA 3U44A 4BERA 4C3VA 1KZOA 3KYJB 2P68A 3ICEA 1N4AA 3BJRA 4IVQA 1OH5A 4J2OA 3ROTA 5EWMA 2BCGY 1PL0A 1UBKS 4RE6A 4NZNA 1F9EA 2DZDA 1JHUA 3NWPA 3N2GB 4N8EA 1FNCA 1GZ6A 4MQ6A 1Z74A 3RS2A 1NF8A 1EWQA 4DV5B 4DWJA 4I4NA 1IG0A 4Q9JA 2VGEA 3JQAD 1OQAA 1ORHA 1BW9A 4W1QA 3ANXA 1U8AA 3ENQA 1PAQA 4RKEA 4WI1A 4LGMA 1QCCA 4E3WA 3B7WA 3DF9A 4D0LB 4GYYA 3E0QA 4M8KA 1GLNA 5KEIA 2FVYA 3PENA 3EQ7A 2XQFA 3I92A 3WQBA 1JKXA 2FSIA 3WR5A 4LJYA 4KPGA 3MINA 4C04A 3V4VB 2Z3WA 3U64A 4EKYA 4JKYA 2JD2A 4FMPA 3ECCA 4XPZA 4IGFA 1N2ZA 3ZY3A 5JMTA 3ADCA 1OYOA 4MQMA 3PUHA 1NULA 3UTCA 3V30A 1YS2X 3D59A 3PEWA 2WXQA 5JAHA 1BE6A 2P30A 3F9RA 1Q1ZA 2N1BA 1WZ2A 1JR3D 4D92A 4TVBA 4WT7A 4DV3B 1M2OB 1VSBA 1OB2A 4WTOA 2H1CA 3I4GA 1SZCA 1Q3KA 3EFOB 1BU9A 4LG6A 1B6GA 3W9BA 2Q5CA 5LOVB 3UXGA 3QXGA 4ZHBA 1KAMA 1T8SA 4HH1A 1E1QA 2IEAA 3MAJA 5D1HA 2G1JA 3AR9A 4JDUA 2HWWA 4EGJA 4X1IA 4E09A 3DYIA 3TSOA 5ELXA 3L0BA 1HTTA 2OYRA 3D4IA 1Q1GA 5MN4A 5CNJA 4I1OA 2WA2A 4A27A 2ZTMA 4HD8A 3G0HA 3D6JA 1PS8A 3NIGB 3NV9A 5DB4A 1G64A 2OAP1 4G1MB 1AGNA 3E1SA 1N57A 3S99A 3KXPA 3JYNA 721PA 2A9PA 2C1EA 2JF0A 5KYXB 1KFKB 3QMPA 4BGIA 3T5VA 1RXCA 4G26A 2NV2B 3G02A 3DAFA 5HF5A 4LDQA 1J7KA 4MV3A 3VC7A 2WJAA 4X92A 4BP3A 3CCBA 4QGFA 3UMCA 2MTBA 4ETMA 3SQNA 5DP1A 4XM0A 4EAAA 2W37A 2J9GA 4DZZA 3E8MA 3UENA 4ZAZA 4HSGA 8ATCA 5I7UA 4NH4A 4DLPA 5CCMA 2EJVA 4OCZA 4QVIA 2DT8A 1FJXA 2O8EB 3E7WA 2YW9A 2WVGA 1W8IA 3CRVA 1Z0IA 4B0ZA 1ODFA 3M4ZA 3A0RB 3IQDB 3X2EA 2I6FA 4RK0A 3QTBA 2BR3A 5F33A 3I1YA 5GGXA 1JZQA 1GGMA 3OESA 1XRLA 1GTSA 4ID9A 3AR3A 4L75A 1ONPA 2J5RA 1T5OA 2YVLA 1GCIA 4DWVA 1AXGA 5EP1A 2VDRB 2V0CA 4DW8A 3H3XA 1CUUA 4UMVA 4AUMA 1H2VC 2B4AA 2OXTA 1UK7A 4ZHQF 1RXIA 5CDYA 4RELA 2LTAA 4EZJA 2ZT8A 1A77A 3HXPA 3I28A 1YVRA 2JEZA 3E82A 3PC7A 1XL0A 2OPHA 2UVPA 1MBZA 1VL5A 4DABA 5KSWB 3DNMA 2PBZA 3CC8A 2FJUA 4XYGA 2QTFA 4V0LA 3F0TA 2CJYA 2MIIA 5EIEA 3P5SA 5JEDA 1RWMA 4UZSA 4MV6A 1WP9A 2WFZA 3NBQA 4B3XA 5ADVA 3P45A 1JJ7A 1RADA 3FMGA 3DLCA 2Q1YA 2YZKA 2ZIVB 5K2MA 3E4DA 4L51A 4PU0A 1TZKA 5GJVC 1D5WA 5E95A 5FAKA 4KGZA 2XVZA 2NXEA 2VRCA 3GHHA 4RK4A 3GD5A 3REQB 4I2ZA 3H0KA 3WWOA 1WNFA 5CJPA 4PS0A 4JSTA 5BPHA 3OQ6A 3TTVA 4QELA 1N6KA 1J2RA 1CS0A 3QHAA 2Z98A 3AG3E 2CHXA 3CVLA 2OGTA 4Q9HA 1AN9A 3KPUA 1QBQA 4DKJA 2DKOA 1T5TA 1PTJA 1BD3A 4FDTA 5J1SB 2PAAA 3WC4A 3ETCA 3GRVA 3WJ7A 4O0LA 1JIXA 2Y4OA 4EO9A 2Q8NA 4A5SA 5CD9A 2RGUA 4JI8B 1THZA 2CVFA 1UFKA 1CE8B 3WZ2A 3GEHA 1PWEA 3G8AA 3VO8A 4F21A 1H2YA 4AMGA 2FFQA 4DSZA 3CHQA 1N5DA 3IUMA 3PA8A 4LX0A 3T9DA 3E58A 2ETAA 3KU1A 4AMZA 1D4AA 1VA4A 3DZCA 2LCFA 2W2QA 3NG1A 4H7PA 3JQCA 4D8UA 2ZPUA 3NASA 3R5HA 3E5RA 5T8IA 3N1UA 2H92A 3PEEA 3N2ZB 5IAJA 5IEJA 1XQYA 4PZZA 3K9BA 4BWGA 2P9JA 3B5EA 3BMQA 2R1TB 3GLGE 3IP6A 4HZUB 4D26A 1XZDA 1QP7A 5FEMA 2QFCA 1DKOA 5CHYA 3H3FA 2XXBA 5MGNA 4LGYA 4JBLA 3E0XA 3EMBA 4TXHA 3OD1A 1XQXA 4PRZA 2VVTA 4Q3CA 2QYOA 4HEHA 4I7EA 3CRQA 4ZMBA 4TYYA 2BGGA 3RUDA 3CT4A 3FPSA 4JZYA 1BX0A 2N47A 2PQ2A 3L3BA 3R20A 1IQ0A 4R8MA 2BFNA 1J20A 2FSVA 1N2EA 5CNKA 2DLNA 1WB5A 5KKNB 5G4LA 4RG9A 1G20B 3U7FB 1KDYA 3VR0A 1G21E 4ZCSA 2QAGA 1WHTA 2CFSA 5J2UA 4RDIA 4LMBA 1YTLA 3ZD7A 3TBKA 4IIJA 3M34A 2XMDA 2PBRA 4PFKA 4B6RA 5L4NA 1DG1G 4E1VA 1HDEA 3EVFA 1B6SA 2CHWA 2ZBFA 4GP9A 4NK5A 1XMSA 2OXFA 4JNKA 4WA8A 4CEHB 3QKIA 2BDTA 1N0UA 3MSCA 1QIKA 2M9MA 4EHKA 1RBYA 3QYFA 4FMDF 3ADDA 1AKTA 2ZROA 4HDSA 4J7UA 3G13A 4P80A 4HMOA 4DADA 3S7DA 1EVQA 2D1TA 3RBAA 2EW2A 3KS2A 3KLPX 3CWCA 5KTRA 3IILA 3GVCA 3WIBA 1JKJA 2A5YB 2JK0A 5KJFA 4QUHA 1NW6A 3NJ8A 4HLCA 3ZHBA 1AV7A 3HFJA 3G1WA 1N7HA 4LYDA 1I36A 3DFZA 3DCNA 2EQXA 1T5SA 3SQOA 1E5VA 2J4DA 4YJ2A 3WKDA 5HIIA 2NTEA 3PXDA 5TJHA 1WE2A 2LUHA 1DQZA 2PR2A 2JAUA 2A5JA 4CFYA 2X2OA 3AEUB 5IT9A 3R3XA 4OLAA 4GPTA 4C7MA 4AY6A 5SYNA 1RRKA 5J58A 1QWOA 1L8AA 4Q05A 4EY8A 2WI8A 4IF4A 4AN4A 4NWIA 4MRSA 1FP2A 3FXAA 5EIDA 1SH7A 1TVKB 4H4EA 2HA2A 3RRXA 4LMPA 1VFNA 1DUVG 1SO8A 5LMUB 4DX5D 2OCBA 1T9HA 1VI5A 4U04A 1YVDA 1R0YA 2AXUA 5IBCA 4F6RB 2JGLA 4ZZ1A 1O0CA 2YNMA 1LJUA 3Q73A 4RTKA 5L3QB 1NP3A 3MOIA 3AVYA 2Q3FA 3KQSA 4HVTA 3ESLA 3JVIA 1FW6A 3UAWA 4RABA 2O5CA 2QP9X 1OBHA 1U0JA 5DM4A 3QBVA 2XBUA 3I9KA 3RIHA 2QL5A 3TFWA 5C2YA 1G9SA 1RJGA 4EKIA 5C7OO 4DQVA 1LZLA 5K0FA 1Z3YA 1UBJS 2PD4A 2X2PA 1OFGA 1WW8A 3PDNA 4JWTA 3RRMA 8ADHA 1OAOC 4GHWA 4W7HA 2Z5GA 4JQCA 2GN4A 5H83A 4Q9DA 1S9HA 3FUUA 1GKIA 3O4VA 5FTNA 1U3TA 3P2YA 1Y7PA 5B6IA 2CKDA 4FQ8A 4WL0A 4EFLA 3MJWA 3KTOA 5JC8A 2OEVA 1LWNA 2HLNA 3W1WA 4GFDA 1ACMA 1WOMA 2Y0BA 4PN7A 3BIOA 4NTZA 1DCQA 4QYMA 3WMGA 1PFGA 1ZW1A 3V3TA 1914A 1I1HA 4OUKX 2C2GA 1XJ5A 3TX6A 5D6NA 4RIEA 4BMDA 3EF1A 4Q4DA 4B3FX 5K8VA 2E4UA 4ND6A 3E9QA 3QXCA 3V8BA 5CK5A 3L9WA 5E6RA 1UZUA 1Z36A 4AXBA 2CXNA 4TMFA 5GJCA 4CYMA 1CDOA 4I1UA 4CEIB 1Q44A 1OY1A 4H08A 4OU4A 3Q9UC 3AR4A 2K2WA 3IAHA 2QXTA 1QFMA 1IJKA 3ITDA 4JQYA 2VF4X 4C0JA 3ILHA 1GGKA 4EG5A 4MVXA 3VKUA 4TM8A 3E30A 4GI1A 2A1UB 3PYLA 4FX2A 4LGCA 2OOKA 4L8LA 3QXHA 5AKHA 1GZ7A 5CT6A 2VJDA 3D9NA 5SYAA 2AWOA 3QBDA 4ZOLA 4DNFA 4XFDA 3VR2D 3MS4A 2O48X 2IYFA 3W6UA 5EJ4A 1R4NB 4WLEA 2VOEA 3CLSD 4J1NA 3TL6A 3R6GA 1UOHA 1FFGA 1UBOS 3V7WA 4ANWA 4MICA 2JJQA 2IH4A 3R7LA 1KZ4A 3UKOA 3SD7A 5AYWD 2HO5A 1QB7A 4JJ6A 4K8OA 5I8PA 3FTDA 2WSSA 4Z1OA 4GL4A 3G5TA 3UJ7A 4XWAA 5DLQC 1QMPA 3Q3VA 3AKCA 4GC5A 2FG5A 4NJMB 3NHJA 3NRJA 4XD7D 1JIUA 3WGJA 4PINA 3BIJA 4NYJR 3TLKA 4DXHA 2FF5A 2W8BA 3QVLA 4O4HF 4R51A 1KPIA 5BOSB 1N0RA 1QGOA 3O31A 1CCWA 3RVPA 3HCEA 1SQ0A 2AXEA 4MUFA 1LD7A 3PTLA 2V7EA 2ZSHA 3T5MA 1O5TA 2R00C 4CCWA 2OBFA 5I7VA 1I2AA 2NUAA 3B6KA 1AY0A 1DVPA 1QWSA 2OP0A 1VGVA 3DC2A 2A59A 1IY8A 4MARA 2X9VA 1X42A 2IHVA 2RB5A 2H6FA 1NF9A 4WOJA 4EJ0A 4URWR 1U81A 3AIMA 4MP3A 4JJ8A 1JDBC 1N6NA 4C0WA 2J48A 2MSDB 2I54A 4DLQA 1QQEA 2JI9A 3ZYLA 3JQRA 4QXQA 2QL6A 3CW8X 4UYKB 1YWGO 4HN9A 3Q3IA 4EABA 3UGJA 1W59A 2XNJA 4F60A 5ARFA