4AY5A

Human o-glcnac transferase (ogt) in complex with udp and glycopeptide
Total Genus 272
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
272
sequence length
717
structure length
698
Chain Sequence
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title O-Glcnac Transferase Invokes Nucleotide Sugar Pyrophosphate Participation in Catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
molecule keywords UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYL TRANSF
total genus 272
structure length 698
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ay5A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ay5A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4ay5A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4ay5A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ay5A03
3Q49B 2HY7A 2QN3A 5FT9A 2VSNA 3OY2A 4HORA 1FCHA 3ZPJA 2GPNA 4KQMA 4GA0A 3BCSA 3GUHA 4YVOA 2C4MA 4RIIA 3T3GA 3MV3B 4MI6A 2C0LA 3TAXA 4I17A 2PQRA 1VGVA 1Z62A 1JIVA 3CV3A 4L22A 4O6FA 3SYMA 1IIRA 4MI3A 4WUYA 2QLNA 3HBNA 3MTBA 3OTHA 4UI9J 4BT9A 3ZCQA 2IFUA 5IKOA 1QZ2A 3S2UA 1FU4A 1PN3A 2QRQA 4LDPA 5EX0A 3ASGA 3RHZA 3KD7A 2IUYA 1L5SA 5CCMA 3GZ1A 2XGMA 3S28A 4BFCA 5BT1A 4EL0A 3GW4A 3RJVA 1UZUA 5M72A 4KXKB 1KTIA 2LNIA 1TJCA 3CEMA 3MT9A 2OFFA 4PQGA 1RRVA 1KT1A 3MQFA 3L01A 2BISA 1A17A 4G23A 4GCNA 3CVQA 2KS6A 1C50A 2IYFA 3S27A 4GPKA 5DLDA 4CTMA 2MHKA 2H1HA 3PE3A 3CEHA 3IA7A 4RG6A 4QLBA 3L7DA 3OKPA 3LKUA 3MRTA 1HZ4A 3FP3A 1L5QA 3MV2B 3OTIA 2I6HA 3LY8A 2GEJA 2F3UA 2PRIA 1UQTA 2P58C 2FF5A 2C2LA 4GPBA 4EKYA 5HXAA 1HXIA 4GYWA 3EBOA 3LY9A 4YVQC 4H7XA 3S7FA 1AHPA 3D0RA 1Z6QA 1FC0A 2F9FA 1ZBPA 2LSVA 2QN8A 2ECPA 2QN2A 1FS4A 2QRGA 2KCLA 1WV0A 3CUWA 3QDNA 1YA0A 3BDAA 3NPAA 1K08A 2QN7A 4BTAA 2HO1A 2KATA 3OT5A 4WNDA 3E3NA 4KBQA 3WC4A 4WADA 4GA2A 2R60A 2F3QA 4KQ2A 4KYOB 4G2VA 1GZ5A 3FROA 4BTBA 4M60A 4NC9A 3MT7A 1L6IA 3MS7A 1FTYA 1ABBA 3QOUA 4N3AA 4B94A 5KJLA 3CUYA 4XIFA 4G2TA 3BEOA 1B4DA 1O6CA 3S0JA 4ME2A 1L7XA 4I2ZA 3TG5A 4CGVA 2FEZA 2F3SA 2E2EA 3S7DA 5G05C 2VQ2A 1PYGA 2FBNA 4F3VA 3D1JA 2SKCA 3TSAA 4RELA 4RENA 3RO3A 5DIZA 4JL0A 3LCAA 2R4UA 4IN3B 4EJ2A 1WW2A 3MRVA 3T3HA 4U07A 1YGPA 3IEGA 3T7DA 1Y8ZA 3JYSA 3NCHA 2IEIA 3IAAA 4JA7A 3TG4A 2QZSA 5TMDA 5TMBA 3OXGA 1SXPA 3S29A 2GW1A 4HOTA 5D0QD 5LCWJ 4G1TA 2C1ZA 1NZDA 1WAO1 2ONDA 4Z5XA 3LPZA 3CX4A 3K9IA 3C48A 3PDNA 4U04A 5JJ7A 5JTTA 4BQFA 4MICA 3ZCSA 1C8LA 4J8FA 4YI3A 2QRPA 3OXFA 3MBOA 3ZCVA 3MRXA 5DU2A 3CK8A 3MTDA 3Q15A 2PL2A 5KJKA 1GPYA 3AS4A 3AS8A 4GCOA 4UQZA 2KCKA 1WW3A 3CVLA 3NF1A 3O48A 4GYOA 2VG8A 4F96A 3CVNA 1KT0A 3RU0A 3NAZA 5D01A 3RKVA 2ACWA 1JIUA 3OKCA 1JG6A 4AN4A 4GYYA 4XI9A 4CDRA 1WM5A 3DZCA 5FZSA 1E4OA 1FTWA 4F9FA 4MRAA 1XL0A 1P4GA 3OY7A 3OKAA 3T3DA 2VCEA 3G2KA 2LSUA 4M7PA 1NZNA 1F0KA 4BWRA 1FU8A 2IF4A 2XA2A 5LCWC 2FFRA 3L7BA 2Y4UA 5HQ8A 4ABNA 2P6PA 3G2LA 4N5CA 2FO7A 3LYAA 4N3BA 3C4QA 4J8DA 4F97A 1L5RA 1OUVA 4X7RA 4JHRA 5D00A 4NESA 2VGYA 1A8IA 1Y6GA 4AY6A 2XA1A 3OXLA 3CEJA 3ULQA 1NLMA 5I45A 3T5TA 3ZN3A 3L7AA 3N71A 3BD6A 3NB0A 3HYMB 1ELRA 2XEVA 4Y6CA 5A6CA 2IEGA 1XNFA 1P2BA 2R4TA 1K06A 1QKJA 3BEEA 1NOIA 5JTUA 2WPVA 3CK7A 3E3OA 3T3IA 4W9RA 4MHOA 2JZCA 1NA0A 4HWGA 1NVKA 2XCBA 4HOSA 5G05J 1LWNA 3H4IA 5JJTA 1B89A 2R68A 4G25A 4XI0A 4X7MA 3L79A 1P29A 3CUVA 3DDSA 2QN9A 2QN1A 2ATIA 2YQ8A 4X6LA 2QRMA 3ZCRA 3GZ2A 5A7DB 1RZUA 1F6DA 4U0ZA 2XCIA 3Q3IA 4I2WA 1XC7A 3G2HA 2XPIA 1C3JA 3NC4A 3CKBA 2JLBA 3O3CA 1XOIA 2X6RA 4NRHB 3ZCTA 2WTXA 2OOEA 3ASHA 2HR2A 2IYAA 3TOVA 2QLMA 3G2IA 2FF4A 2QNBA 1YA6A 2BUGA 4N2SA 4AY5A 3U4TA 3MTAA 4AMGA 1IHGA 4RIGA 2GEKA 2PQ6A 3QKWA 4BQIA 4BT8A 2ACVA 4EQFA 4MI9A 1JEJA 2VGXB 1WUYA 2BFWA 2XGOA 3KS2A 4WNGA 4I1AA 4UQXA 4RG9A 1HH8A 1KLXA 2J9QA 1GG8A 3HBMA 1WV1A 2GPBA 3NP7A 4G24A 5EKQD 4X7PA 3CV0A 5D0OD 1FTQA 4I9CA 2F3PA 4Y6WA 1P5QA 2X0DA 2VCHA 3SZ7A 2BGUA 3ASFA 4AMBA 2VSYA 2Q6VA 3BCRA 3E3LA 3E4BA 1JG7A 1XKXA 2IV3A 2QLLA 2SKDA 3ZCPA 2WQHA 2C1XA 3CEQA 3U3WA 1UQUA 2SKEA 2G9UA 1NOJA 5DBKA 1L5VA 4WACA 1GPAA 5ENZA 1PNVA 4I9EA 3ESKA 3ZFWA 3T3EA 3MT8A 1E1YA 2IV7A 3UYKA 3URZA 4W6QA 3DD1A 2PYDA 4WNFA 2ASVA 2KCVA 3QWPA 5CHEE 5CCLA 5KJMA 3VDNB 3DDWA 4WHMA 1EXVA 1H5UA 3CKCA 4FKZA 8GPBA 2FI7A 2R66A 2AMVA 2PRJA 3FFLA 1XV5A 3Q47B 3MS4A 1IYGA 3CVPA 3LY7A 1W3BA 2X0EA 2X6QA 5FTPA 1AXRA 3AS5A 2QFCA 5EX3A 2KC7A 4N3CA 2G9VA 2UY1A 3RT1A 2XCUA 2H1FA 5DXFA 4GA1A 4YNDA 2AZDA 3HBJA 4BQEA 3FWVA 5KJNA 4GZ5A 2X0FA 2FETA 4UQYA 3UQ3A 3TGOA 4HOQA 1Y6FA 4NEQA 2XA9A 2QRHA 3RIBA 1M5RA 2YHCA 2YJNA 3RO2A 1L5WA 3RSZA 3RSCA 1FU7A 2PYIA 5G04J 3VUEA 3G2NA 3S7BA 3ZCUA 3ZHEA 3WXXA 1E96B 3NP9A 3QHPA 1P4HA 4RBNA 3COPA 2PQNA 1FA9A 2V5FA 2C0MA 3VDMA 3WADA 3MKRA 3SF4A 3HBFA 4RIHA 1C8KA 2UY1B 1Z6PA 7GPBA 4AIFA 3MSCA 4H7YA 4U0UA 3CK9A 4APOA 4AM9A 2BGTA 3CUTA 3UYLA 4N39A 3BD7A 3UPVA 2ZB2A 5HI7A 2XCCA 2XGSA 3GYZA 1Z8DA 1ZU2A 2PZIA 4NQ0A 3MS2A 2VYIA 3ASDA 2O6LA 4CTOA 3Q5MA 3Q3HA 1P4JA 2VGXA 4HLNA 5TVGA 3OTGA 5JJ6A 1IXYA 4RIEA 4M83A 4GZ6A 2AW3A 4UI9C 4YI5A 1PSWA 4CTNA 3PE4A 5G04C 1WUTA 2AV6A 5GPBA 1ELWA 2GPAA 2G9QA 3C4VA 4WNEA 1XL1A 4GZ3A 2C9ZA 2GT1A 1LWOA 1RZVA 3WAGA 2R5SA 5BW8C 3ZGQA 1V4VA 2IW1A 4LEUA 3GPBA 5FZRA 5BNWA 1GFZA 4YUAA 2G9RA 3R9AB 3Q3EA 3S7JA 2HYZA 3L7CA 3D0QA 4CGWA 1GGNA 2XMPA 1BX3A 1NOKA 5AYWD 4LEIA 3QWVA 3BCUA 1QM5A 4U0SA 3UUXA 1HLFA 1J39A 5IKPA 1Y8MA 4J0UA 1JIXA 4EKEA 3H4TA 3VTXA 3MA5A 3VUFA 2L6JA 1PC2A 4KQ1A 4UI9K 6GPBA 3Q4AB 3G2JA 1NA3A 2Q7FA 1SXQA 1GPBA 4G26A 2GM9A 5TMEA 2DBAA 1P2DA 4RIFA 2GJ4A 2JJMA 4EL5A 3BD8A 5ARFA 5LQDA 5C1DA 1EM6A 4N2QA 4MHSA 4A1SA 3EDTB 3ZHEB 5ARGA 1P2GA 9GPBA 4J8EA 5FJYA 3KAEA 2UWJG 5FZQA 3VTYA 3EBPA 4REMA 3SYRA 3QKYA 4HOUA 3QWWA 4JA9A 1NZFA 3AMVA 4N9WA 1QQEA 3CUUA 3MEKA 2NC9A 4FZRA 2AVPA 2Y4TA
chains in the Genus database with same CATH superfamily
4QJ3A 2VSNA 5A02A 1OYYA 1JH8A 1DLJA 1K68A 1Y6RA 3HXLA 4PSUA 4ARVA 5CB4A 1R0WA 2GN1A 4JJ7A 4MAMA 2HJ9A 4KQMA 5ICMA 1TZBA 5IS2A 4Q01A 1SK8A 2VNKA 2A3NA 3N6XA 1IC6A 3PLAE 3TIFA 5EVJA 4YQZA 2VDOB 2XB8A 1YK0A 4KDFA 4ANUA 1WQ3A 2PQRA 4TN1A 1Z62A 2GD0A 3GN2A 2XAUA 3E5NA 4EHHA 4OGLA 1NX6A 1SOUA 1C1XA 2HTFA 4Q7MB 3ZE8A 4C4OA 3K2IA 1RHJA 3W7BA 2VZ9A 1YS9A 3OTHA 4WLVA 2GBGA 4OUKX 1YO6A 3CLRD 3DULA 3S2UA 4BBPA 5JANA 3VLEA 2OCIA 4IKOA 4PAMA 5KNGA 1ENPA 1TMYA 1ZB1A 5TRTA 1DJPA 1ZWKA 3DHNA 3L1IA 4C0AC 5KVQA 4CR8A 3REFA 4E5YA 1N1MA 3ZE1B 2E2WA 3MGCA 3QKUA 1V25A 3MUNA 4GL4A 1SKYE 2XMSA 3M3HA 4K5QA 2WHRA 4BYMA 3DE2X 1M6YA 2RI6A 5H9VA 4CN9A 1SHLA 2C9MA 3M6FA 4G0VA 3JQ1A 4OHXA 3JQ7B 3U9SA 4E07A 1KTIA 5CDFE 1WDKA 3EDYA 4LV5B 3AW9A 1V16B 3CZ4A 4BQSA 4XWOA 3ZJ5A 5BWMA 4LXXA 4WXRA 3ZGOA 4II2A 3V2IA 9LDBA 4YWHA 3IV6A 3ZNGA 4HRAA 4MROA 3FBWA 621PA 3PEVA 1C50A 2CL0X 1TZ2A 1MEJA 1USWA 3ENEA 2FZGA 3FJ1A 3X2QE 2RFAA 2PZ8A 1J4AA 2P90A 2NSLA 2IKQA 3DAHA 4KUHA 2BHSA 2C2WA 4KXNA 4AQDA 3WBBA 1A7KA 1L4MA 2JCXA 3PQ3A 2Q21A 3MC1A 4TUUA 5A05A 3SM3A 1H69A 4EJ0A 5BSHA 2YRXA 3MJVA 3B36A 2P58C 4N6NA 5EEHA 1VYHA 5F52A 1LPMA 3KJFA 3T7TA 3RU3A 1QFSA 5FH9A 3EBOA 4J6FA 5E4FA 4NDNE 5CB4F 3MJFA 3JYLA 3MHPA 4GXQA 4D81A 1F7UA 2O48X 2YJ6A 3GA0A 4Y2VA 5ILOA 3CN9A 2ECPA 2QN2A 3NO4A 4ENWA 2XKJE 4TPKA 5SYNA 2C5AA 2AN4A 3CUWA 3MJCA 5F77A 5EP4A 4V1CA 3BN3A 3BDAA 5HF8A 3BC1A 2XQJA 2O8DB 3GLTA 1MB2A 3OT5A 3EVFA 4IXMA 3NWOA 4KB5A 4ZOCA 2HKIA 4MNTA 3ZV6A 1R6VA 6NULA 1L7QA 1RAAA 4XW2A 3SFXA 4E5VA 4WMLA 2IS6A 3CC8A 5IAJA 1CNMA 1QG0A 5AI9A 1KPHA 1LTXA 4CL3A 3NQ41 4F2PA 1IN1A 2NO0A 4G2VA 1GZ5A 4G89A 4YNBA 3TZQA 1N1DA 1TW3A 3HMQA 3MT7A 4JLOA 4PGHA 1L6IA 2WVGA 5CJJA 1O5IA 5HE9A 4XJTA 2HHHB 3ZKWA 4GR5A 4ZQBA 1KIMA 3P9SA 3SICE 1TYQG 2JJ1D 2PX3A 4R1UA 1YZFA 3S2IA 1GILA 2XUIA 1XQVA 5EE5B 3JAKA 4E4RA 2LO6A 1UBHS 1KRXA 4PSAA 4TLCA 1W85B 3FTCA 4XIYA 2R1UA 5K8LA 5K0GA 2IW3A 2YW2A 3AEKB 2ILRA 1JH9A 1IKND 3CLTD 3MD0A 3NBYC 2QDXA 2C42A 3DM9B 4QYIA 2WU4A 2CDRA 2GKGA 3IO3A 3H19A 4DSNA 5I4IA 2MSNA 1KERA 2BTEA 3WYCA 5LQUA 4EPTA 1UBOS 2PK3A 2SKCA 4M1KA 4W7HA 3HJAA 1W30A 5BVHA 5EIEA 3KSAC 5J5VA 3MMXA 1Z6ZA 3KU4A 4DPKA 2I4MA 4AFNA 5K20A 1EGHA 4F1PA 1RAIA 1DQRA 1P81A 2J7KA 3PQ2A 4XLZA 3VR3D 1RKBA 3DOOA 1EB9A 4DIEA 1S7CA 3D31A 1YGPA 2NT4A 4BO0A 1EFTA 3DFZA 3ELDA 1WM1A 5ALHA 5JH7B 5E1OA 3WDLA 4E6EA 5G40A 3V8VA 1B6GA 1CRQA 3FPHA 3IELA 4UASA 3S29A 5H7PA 5LX8A 3NASA 5ISMA 1FLAA 4HKTA 4F3CA 1Q0RA 1B8VA 2VWPA 2GM4A 1BWRA 2QBYB 3E9EA 2IPXA 3WLJA 1W6UA 1DXYA 1P2UA 3K1JA 4R0VA 3RH0A 2XB2A 2DLDA 4DABA 1R0LA 2CL5A 3JZAA 2R8EA 1JLMA 3PJEA 4KC0A 1B3RA 1NXTA 1TLFA 3LXMA 2IHJA 3RNOA 4A8JB 4NK4A 3P5SA 1YMQA 2UUCB 1G20E 3B7SA 1FP4B 2EZ4A 4RVNA 2ADOA 1ODJA 3U1BA 1KIAA 1GUFA 2F48A 5DU2A 4ZKDA 4DMHA 1SWVA 1T5TA 2VH1A 5C7LO 3ICPA 1W9HA 2E48A 3QYAA 4F84A 1C30B 4J90A 3O2QB 2EIKE 4YUWA 3TAUA 2Q9UA 4LGYA 4EYGA 1E2KA 4RPCA 5IC6A 3X1WA 4L1BA 5EWMB 4QNMA 1E7QA 3E2MA 2FOLA 3JZFA 5SY6A 2AE1A 1E4OA 3KSZO 2XUOA 4C3OB 2VRBA 2M6SA 2O1SA 2J9FA 4TYQA 2PPLA 1LBQA 4LOAA 4QTUB 3PI6A 4OMUA 2FGJA 5LYJA 1QIIA 1UOHA 2BM9A 3FW1A 1QMPA 3GBVA 2W2PA 2QA5A 3G2KA 1OU4A 2JI8A 4YAFA 4CUJA 3PHJA 3R7RA 4FXPA 4FYYA 4QARA 3ZWOA 1G38A 3MILA 4B2IA 3ZWCA 4QFBA 3E9NA 4FEAA 4MWDA 4DVGA 4YRJA 1E1QA 4JFAA 2W6NA 4BE9A 2C8VA 1B0ZA 2A9QA 2BFMA 2P6PA 3A6EA 3F47A 5DX8A 5EXPA 2JI6A 2FX5A 3U3OA 3UHAA 1QIFA 1KY3A 3ISMC 1UDRA 1WPQA 1BJKA 3ANYB 2IPOA 1F06A 4GM0A 4MJLA 3ZHTA 4BGEA 3GZSA 4XEHA 1Y6GA 1QZTA 2X8JB 2QD5A 3CVWA 4LSGA 1KPGA 4LN1A 2GA9A 3NBZC 2Q3LA 3PRHA 3SIPA 1Z73A 2WSLA 4W63A 1S2IA 4L4YA 2QX6A 3DZ8A 4D99A 2D2IA 5JNRA 4RJIA 4L51A 2ET6A 3IYLW 1FVOA 4Z7QB 1FT2A 1QGUB 2CB9A 2ZW9A 3F78A 1X8XA 4OTZA 1XYYA 3BMQA 4HLUA 1AGYA 3ZVLA 2G8NA 4E30A 1O77A 2CLDX 2WM8A 5G05J 1DMSA 1PL8A 1PYOA 2B1IA 3OM9A 3KWMA 3HUDA 3RJ9A 5JJTA 5TSDA 2D1TA 1FOEB 3H8WA 1AK1A 3IIIA 4XVHA 1T36B 1CY2A 1PL0A 1NLYA 4NIMA 3RAFC 2AWIA 2YWXA 4AW9A 1JG4A 4WXEA 4YY3B 4DXAA 2PYZA 1TUEA 5FLXA 4BVFA 3D6AA 1BCSB 1LDBA 4C2TA 1F14A 1WULS 3C3PA 4I50A 4RMNA 5GVRA 1RZUA 3E82A 1QLJA 1H8ED 1NF8A 5EWLB 5EZ6B 3ZD8A 421PA 1W73A 2ZJBA 4I2WA 2YHEA 3JXJA 1CY0A 1Y37A 2HB6A 3KB6A 4LNHA 3EVTA 5FB3A 3TL5A 1KHHA 1A1SA 4KJXA 4TWAA 1AK2A 2EKBA 2A90A 1Z06A 1ZGCA 2YZ2A 4I4IA 4Y6LA 3WBFA 1FTGA 1OROA 3OIUA 2BZ0A 2XF8A 4EKGA 5AH0A 4DZTA 3THYB 1M6VB 2YASA 2A9KA 3EA4A 2F43B 3IFSA 1RWKA 1XEWX 1N7HA 3ZJYA 2OTCA 2GB4A 1C2YA 1GNRA 1Q15A 2IDKA 1WXIA 4ZEMA 2ACVA 1U8CB 3PV0A 1E1NA 2IS4A 4BCDA 2XGOA 1G20A 2DFTA 2W2LD 2WHYA 5I8PA 2KZTA 2D13A 4EMTA 3OLXA 4V2UA 2I3DA 4HWRA 2Q99A 4L9PA 1G41A 1BQ3A 1JT2A 2WA1A 3CV0A 1VPVA 3M5PA 5D0OD 2AB0A 3KKKA 2O2YA 4YDSA 1N2CA 4C0LA 3HO6A 5DXAA 4EHJA 4JB0A 1SCQA 3E70C 2Z1NA 3A04A 5ALFA 5L7YA 3CF2A 2HMYB 4GMHA 4QLOA 2TMYA 1XG5A 4RCYA 4IRUA 3P4XA 4QXRA 2JKVA 4PGFA 4OQLA 1LSSA 1T8YA 4U6SA 3EISA 2SKDA 5DASA 2HJWA 1GR0A 2X8WA 4CKEB 4R5MA 5ARDA 4OM8A 2FWBA 1GV0A 3S40A 1IJBA 5F9FA 3P20A 2Q1XA 2QTFA 2I1KA 4R16A 1ZIDA 4KPFC 1JA0A 1PNVA 3NPMA 1E3LA 3BE4A 5BSEA 1WCWA 3AEUA 5BMVB 1Y8CA 1UIMA 1ZGAA 3ANLA 1HT0A 1ZOOA 2HWUA 2JFQA 5CW1A 3SHOA 3UUFA 1X5BA 2D8AA 4F3TA 2OLEA 1GAXA 1OW3B 3UYKA 4U8VD 1FXWF 1MVOA 4LX8A 4P6VF 2BF7A 4YJGA 2AKAB 5GMOA 1U9IC 1ZICA 2PH7A 4YJ2F 3QA9A 3VPAA 1SKQA 3IRUA 5CM2Z 3OZCA 4D1YA 3DGEC 4KYUA 4WNFA 3IKMB 4GKJB 4LOIA 2QYTA 4M8KA 2CT8A 2PSJA 3K20A 3RFXA 5BWBA 3THOA 1KAGA 1XZPA 1X7HA 2AIRA 3VDRA 3T5VA 2EX0A 5M04A 3CZAA 3QVSA 3W3ZB 3LYLA 5CH3A 1XDWA 3UPTA 5D86A 3AWDA 4V24A 4YDOA 1XNQB 2AMVA 3NFRA 3E9YA 3V42A 2G5TA 1KI3A 4JKYA 3S2YA 4F1JA 5DT2A 4RFSB 1T1EA 1GCAA 5TXGA 3A7DA 5A6VA 4WK2B 3MJ4A 1CJBA 5HILA 1P8AA 2XB9A 2PZLA 4Q3DA 3I53A 3OX3A 4QPPA 4ITVA 2ZYWX 3F8TA 3OI7A 4R1PA 1HH4A 4ZOBA 1A82A 2GRUA 4G5HA 2P9IG 1FYXA 3LCJA 3BM5A 3LOQA 3NT5A 3V7NA 2VDRB 4JGBA 4BNYA 2ZT6A 1QDUA 3R5XA 5T8KC 4C4ZA 2X0NA 2V3CC 3O1JC 3TAHA 1T13A 2P6UA 1IWOA 1X70A 2OCAA 2YUTA 1HMYA 5CX1A 3W8EA 2H1FA 4PN7A 4MCAA 3ZH9B 2A5FA 3WGGA 1ZN8A 1EEHA 2XDQA 5EUMA 2DY1A 3OO1A 1YRQA 3WRWA 2VSFA 1N6LA 1U8ZA 1Z3IX 4WN9A 5CDSA 3N1UA 3H1EA 1RW2A 2YJ4A 3HI6A 5DKFA 4NCBA 1QR6A 3K9QO 3T9EA 2DEUA 2DWPA 3VH2A 2Z6UA 4E22A 2P3OA 2OV4A 4GTMA 1ODTC 3FUDA 3C5WP 1WD7A 3RVMA 3G7NA 4OLBA 5EEGA 1XNRB 4WN9B 5AD1A 3B85A 1XZHA 1XJWA 3OZBA 4YCBA 3HB9A 4IUYA 5FTKA 3AUUA 3PVSA 2QXYA 1D1SA 2IEAA 1EFPA 4EBAA 2Q6LA 4A15A 4QXQA 1ONBA 3BXZA 4BNDA 4QD3A 13PKA 1S7GA 2F1RA 4DVJA 1N0QA 1E7UA 1C8KA 1Z6PA 2DT5A 2L82A 3JVDA 3VO8A 2W2MA 4H7YA 1TM5E 4X20A 1DC8A 1ZI6A 3SKYA 1KU0A 1ZK0A 4N39A 3DC7A 5LZ4A 4LX0A 3UPVA 4JHJA 2VTBA 3I3OA 5FIUA 4AO8A 4FQ7A 1Z8DA 3QVKA 3IP3A 3GJSA 4HS4A 4LF9B 1K66A 1P31A 3VSAA 4BGUA 1PKEA 1XZFA 1ILEA 2FPIA 5DNVA 4PCVA 4EHLA 5FWYB 4OBXA 1Z22A 1W0KA 1U65A 1DKPA 2XS1A 5H0IA 2BEKA 3FN4A 4HFJA 4GMLA 4KO3S 1VBNA 3IUMA 5GPBA 4MRUA 4Z0PA 1PD0A 4M1TA 2EARA 3L0DA 1BC5A 1JG2A 1EJ2A 3MUEA 4LCJA 4BFTA 5KTMA 3WSTA 4JK3A 5FI1B 4Z68A 2D4AA 3L1JA 3B3QA 3S8MA 3C1TA 3CXUA 4LTNA 2XHEA 9LDTA 1KXZA 4B44A 3W5DA 2YJZA 4OOEA 2ZSDA 2F2TA 4HNGA 3EC2A 3GRAA 2V7VA 5J2UA 1JFSA 4NU6A 5BR8B 1BX3A 1U04A 4DR6B 1H9AA 3CWQA 4YRIA 5AYWD 3ZVVA 2Z8YA 3PU6A 1KYYA 1E2HA 2H08A 2LRHA 3ONVA 5IH3A 1W581 3TUZC 1BS2A 3LDUA 4RU1A 5MN4A 1JHUA 4FGKA 4LHVA 2VHXA 1KWKA 4WI1A 2P40A 3AV0B 1CUFA 2CGEA 3ZY4A 3PS9A 3RC3A 4IGAA 3KCNA 4IINA 4J1SA 3I2HA 1S2MA 5A71A 5T8KA 2AOTB 2C88A 4J1QA 1O0BA 2WXIA 5EIBE 3ES9A 1KI1A 2ODEA 3M6LA 4MW0A 3U4MA 4MVJG 1U3UA 2I6UA 1YL7A 4K6GA 1SXQA 2VBCA 2GM9A 4QICA 5FQ4A 4PLGA 2DBAA 1P2DA 4BZPA 1RQLA 3E7XA 4X3PA 1UC5B 1RYMA 3GUZA 2G07A 3ACDA 2H5JA 2P68A 1PG2A 4DLXA 3IEMA 1QVVA 1Z4JA 2ZIEA 3KD3A 1HNXB 2QR5A 3NBFA 3E9DA 1JFFB 3SLKA 5J1SB 1V26A 3UQYS 1ESEA 4DW8A 4QM6A 1P2GA 4FKMA 2D7CA 5HS0A 1ZP6A 2GEVA 2BKEA 3N7UA 3O1HB 1QK5A 3B6EA 4FOSA 4O25A 3WK7A 4IQFA 3VO2A 2EILE 1QFMA 2XEHA 1JHRA 2DSNA 1HGXA 3QKYA 2QHXA 3LHDA 4TRQA 2VZ0A 3JY6A 4I5FA 2XVZA 4JA9A 4C2AA 521PA 3X0DA 4QA9A 3KHKA 3QVOA 2A9FA 1X74A 3NHMA 2R8OA 4LQ4A 2SHKA 1O95D 3KXIA 2NVWA 2NC9A 3BXXA 5JVDB 3N9IA 1SCBA 1Z5WA 5IW8A 1K7FB 3PUZA 1RAEA 4L78A 5C8XA 2XHZA 4GTRA 2YC2C 3PREA 2XDWA 3KKPA 4PX2A 4F12A 1UJRA 2R6R1 1KEVA 4GMKA 4LMPA 3VYSB 2WP8J 2ZSIA 1DIBA 4FUTA 2E4XA 1DAIA 2WTUA 1E9RA 3OLZA 4FDTA 4WECA 4I17A 1NVDA 4LRUA 3G9XA 4AKSA 3GOQA 2OHGA 3KQQA 4BZWA 5LIRA 3DJYA 1UXOA 3IXQA 4WX2B 4CF3A 2AOTA 2XTZA 1V45E 4BT9A 1GRRA 3N2GA 3VNSA 2OYSA 2WXGA 3HKBA 4OQ4A 3ZUGA 4BP8A 4C4AA 5KNBD 3C5CA 1VM6A 1J8MF 2WJHA 4RTNA 1HYGA 4LYYA 3KLPX 3HKEA 2XJ4A 2ACEA 1DKUA 1JHPA 3QEOA 1YDMA 2WJWA 1O1RA 4HOYA 1U3GA 2VYVD 3HDQA 2CNLA 3VU8A 3WNVA 1TN7A 2XGMA 2W2QA 3KQWA 4Q96A 4PSCA 2C61A 4F8YA 1KH1A 3PNOA 3G0BA 4JX8A 4BFCA 2W2KA 2GHTA 4EL0A 3SS9X 5IWCA 2Q1TA 2WT9A 4OYLA 8LDHA 1C7FA 1Z2PX 1TCVA 1ZEJA 2V1XA 3GVIA 4GOMD 3REQA 4CMIA 2JG3A 3HVRA 1Q2ZA 4BNWA 1T4CA 3AR4A 3R5JA 2JCGA 3FA2A 1Y7HA 3C3BA 4ON9A 3TX6A 1KT1A 3E37A 1GLGA 2W0SA 3TSZA 4ILIA 3EARA 4WOKA 5KOHB 3IJRA 4LNGA 2GPYA 3IX7A 1NTOA 4Z3DA 3ZWNA 1RAGA 2XUDA 3U6BA 3V1YA 1DCFA 1HS6A 4YDQA 4H7KA 1UC8A 5BRNA 3TWUA 3QOYA 4RD0A 5AKYA 3PRZA 2G7MC 4H18A 5EIHA 1YKFA 3DL7A 3VJMA 1NSYA 5CW2A 3AAAC 1O3YA 2E87A 3L7DA 5CYFA 1XO1A 1U9IA 4GGMX 1YZ3A 4IP0A 1Z4NA 2X4DA 2JJ2D 3MN1A 2FMKA 3LY8A 2FEAA 3BJZA 3K5WA 3NALA 4GQIA 1OH7A 1MZCA 2V9ZA 4N03A 3AJIA 2O3UA 4RDXA 5KHLB 3N2NA 2DYKA 3KJGA 5HM8A 1T4BA 4R69A 1JA1A 1GRVA 3ONLA 1KH3A 3QVVA 4C0JA 4E7OA 3LTNC 2XPYA 4WQMA 2AFHB 4EQ6A 4CRWB 5EJ8A 3U09A 1CBUA 2P9LG 1JZTA 1J06A 1D1TA 1ZOLA 3DGFC 4M53A 4PLYA 3RGWS 5KTPA 3GFRA 5DLQC 3DCNA 2ZBRA 3A8TA 2E21A 2RGGA 2QW1A 4QRDA 4Y2RA 1K3UB 3SC4A 3LD9A 3KFVA 1KJIA 2BRUA 1HO8A 2J85A 1KP9A 2Q5CA 2HO1A 2P7IA 3UB2A 4NECA 4QGFA 2JBAA 3MJDA 2AN1A 3UHJA 4ENVA 2FN4A 1R3DA 4J7UA 4TYNA 2B7LA 3PUXA 2WWTA 3W79A 1F17A 3K4HA 4JH0A 3UC9A 4RAQA 5HKOA 2Q0SA 4UDXX 2C7OA 2G4VA 3BMNB 3JR7A 2VL7A 1XTRA 3LF1A 4BC1A 4BN0A 4B7AA 2FSFA 3Q2OA 1R0ZA 1YTUA 3ODPA 4PZPA 4JLWA 1DUSA 2H48A 2Q4RA 4H7DA 4QWWA 1KMNA 4ZI3A 5HHTA 2C4WA 2VJOA 4EUEA 3DEJA 2I2WA 4HLDA 4L27A 3WK5A 3PSAA 4EIWA 5LU9A 5I3ZA 2QUBA 4IF4A 1L7XA 2MINB 2RFMA 1A95A 1CD5A 1JNYA 2W6OA 2XKAA 3DBLA 1D8EA 4R8RA 1UPXA 1MMFB 1WP9A 1UP6A 5KNLA 2P9FA 4UM8B 3DMFA 2CHQA 1M75A 3QNMA 4K9LA 4C3UA 1U5BB 2EERA 2R1ZA 4F4DA 3F6PA 3I6QA 1T2FA 4P2GA 1HM5A 1RJFA 1G21A 1SKUA 2GWHA 4O4JA 4O4LA 3DQPA 3DF9A 3IR5A 3OTNA 2LW7A 4EB0A 3R0ZA 1FW8A 5D1HA 4YRPA 3ORQA 1WZ2A 4GNRA 4R9RA 4O4HB 2GH1A 4UQPA 4G1EB 4HUQB 4AYXA 2LGJA 4C01A 4QVIA 1JRLA 3EA5A 1TNOA 4RK6A 4RM3A 1RRFA 3BH6A 2Q46A 1J33A 3LU1A 2IEIA 2HU2A 4NFHA 1JPJA 2OQIA 3KBOA 1QFZA 3QW2A 4F3RA 3UAYA 3AVXA 1R8SA 5CD1A 5A0VA 3WNZA 1GL9B 5JD4A 2IOQA 3OMSA 3GJXC 4BNIA 1NKVA 1JFVA 2R9VA 1NNSA 4LSWA 2AC4A 4P5PA 2QT0A 4EJMA 1PK8A 6REQB 3I76A 4NI5A 1D6MA 2V45A 1C7QA 4LJAA 1TK3A 4URFA 5F1PA 2BHTA 4W7SA 3ZG6A 1SM4A 1XD9A 5CYGA 2I9PA 3TQHA 1TC1A 4CLHA 2RHBA 1BVHA 4CL8A 2D62A 4PZLA 1V7CA 4FC8A 3MBOA 3K6JA 2JH8A 3GEMA 3ZCVA 1N34B 1GLVA 1VL6A 5TPWA 1RQ7A 3MCWA 1JQ5A 2R1VB 4Q7JB 5K3FB 1MORA 4JJZA 3BB4A 4E6PA 3KELA 4MAAA 1IRIA 1MQ8B 2Z3WA 3ESYA 4QYWA 3TDNA 1U0BB 1OZ0A 3PJFA 4IZIA 4MV8A 4M2LA 1IXVA 4FD3A 3OKCA 2ZIGA 4MI1A 4AN4A 3VJRA 2ZBPA 3ZDBA 1W0CA 2RSLA 3TZHA 3ANNA 3F9RA 3VPFA 4RS3A 3X1DA 1AKNA 1JN0A 1LPSA 1ZN9A 3TJZA 1SD5A 2VDQB 5CG1A 4RPGA 3SIXA 1OA0A 3ABQB 4GECA 4JT8A 4Y7CA 3L1HA 4ZD6A 2L0IA 5KSYA 2VCEA 3RG8A 3LVRE 4WCFA 4ECEA 2JH9A 4X24A 5KS2A 2WI8A 3B8EA 1M1XB 4OGFA 3CRZA 4U5QA 1GG9A 1VMKA 2PWPA 2Z5LA 2XODA 2O8FB 1G8AA 4U2DA 1BN7A 4DF3A 2J46A 2H1OA 1BKYA 1X81A 4HI0E 1DEOA 1SULA 1O9HA 2C9CA 4K9SA 1L5RA 1UODA 2WWVD 4O0MA 5TEWA 4C0HA 1SCUB 2FE4A 3DO5A 3ETNA 4OXQA 2ZPAA 4QX6A 4ZYUA 1QTRA 4FNAA 4UTZA 1XNJA 2X8BA 1H66A 1V5GA 2QP9X 3ABOB 2C98A 4L5JA 3FZYA 4OHOA 1NW5A 1MHQA 4JDPA 3BG5A 4KPYA 4S24A 3T5TA 1VCOA 2BHLA 2BH9A 4MUFA 5FTNA 1TVKB 1U2EA 3ELUA 3MCUA 2HU7A 3OE1A 4Q1VA 1ND6A 1IU9A 3NWEA 4LMRA 4CGZA 5AN8A 1GL3A 5A6CA 1JT9A 2BD0A 4KYTA 1KBQA 1O4WA 4MTCA 5I7EA 5EINA 5JAUA 4XYMA 4IJ6A 2JEKA 1H85A 1NOIA 1Y1QA 4JKIA 2WPVA 2ZZNA 3CK7A 3THYA 1OBOA 3CRW1 1NA0A 1A9TA 2V6MA 1M0EA 1DFHA 3ZWBA 2VRCD 4EF5A 4UUQA 2OQVA 1V55E 5HUHA 4HPXB 1L3CA 3ULYA 1X7XB 3TWQA 4HSEA 1QWOA 3IUQA 3P32A 2HZBA 5ENNA 2WWXA 3A1WA 4OJMX 1G20B 4QUKA 1NI1A 2N1MA 5EVCA 3Q8KA 1TUBA 3L79A 4FI3C 4Y0VA 1D2GA 1ZY2A 2FZWA 5HCIA 1RQNA 3U0VA 1E4EA 1YR2A 4MUBA 3KOWA 4X90A 4W1QA 1HKHA 1ZH2A 1N0IA 1SVLA 3D3WB 2AVDA 2ZUWA 5IZCC 2WPDD 2BDEA 3JYOA 3SX0A 3D3NA 2XENA 4TYMA 4PRYA 3IUPA 1Z47A 3C3KA 1R4NB 3B7BA 1OFUA 1YE8A 3KTOA 4X1OA 4YAOA 4BN4A 2XUPA 2YMLA 3IDAA 2C7GA 4B75A 2QMZA 1RFLA 5E2IA 5FQOA 3NC1C 3O8QA 4I9FA 4NE7A 3DEIA 4AKTA 4ARAA 1MO2A 4U0JA 5LPNA 1JDSA 4W5NA 3INRA 4F91B 5AARA 1BCSA 5T41A 2XQFA 4WK6A 3M3PA 1DT5A 4AMGA 4M1ZA 1DC4A 1IEVA 3LUFA 4PS0A 5EFOA 3WL4A 5BV2P 4WSOA 5ES4B 1VBFA 1J23A 3NBXX 2NP6A 5FPQA 4L23A 1JTEA 4IV5A 4LDQA 4WVLA 3WYAA 4UVIA 4B3MB 3C3DA 1A4RA 2H2GA 3NIDB 1Y63A 1RR6A 2JAUA 2OBFA 1X38A 4UDYX 1Z6YA 3D7MA 1II8A 2F3PA 1P5QA 2I4OA 2Z5GA 3GZTB 3TLCA 2W6JA 1RLTA 5AJUA 1H3EA 4LNAA 3VKHA 3Q12A 3GEDA 1P4AA 4I1PA 1X1QA 3DYVA 5JPDA 5CFRA 1SB9A 3BCRA 1JG7A 2I7TA 1NNLA 3ADPA 5K4HA 1M7HA 4UU1A 3TOXA 1O57A 3I37X 1O6FA 3Q9SA 5CJ2A 2EYQA 1KQNA 5BUSA 5LN1A 3I6ZA 3K6KA 3W05A 1V3VA 3JWPA 1NYRA 5C4GB 1MABA 1T8RA 4MRMA 4QOGA 1VPEA 2I62A 4INOA 1DP4A 2BTDA 1P9RA 4UMDA 1UK7A 4MW7A 4QJBA 1GU7A 3EDMA 3JQ8B 4XR9A 3A7EA 3A11A 1NXQA 2ETVA 1ND5A 1EAMA 2WYWA 1N8KA 3CSUA 3EEOA 2A86A 4FSHA 2XF2A 4JROA 5ETJA 2GQ0A 3GNLA 1EFHA 3L46A 1F4PA 4XQEA 4ANVA 2Y1EA 2W70A 2GDZA 5TF4A 3ZTWA 4M54A 5H5JA 3R7LA 3WQBA 2PYDA 1K8YB 3HXKA 1N4DA 3INYA 1P9WA 1BD3A 4LRSB 5LZ2A 8ABPA 3QWPA 4Z49A 1SHJA 1E0KA 3G68A 4JHKA 1U5CA 2IY9A 4GM1A 1AD2A 4MKTA 1CY1A 2DE0X 5BSMA 2XXJA 1IULA 2PVCA 1J0XO 2NO5A 2WDPA 3DD5A 4BLUA 2PKWA 4PLVA 1QNFA 1ES9A 1D3AA 2GVDC 2JIOA 4P7BA 2CVHA 2WYIA 5L51A 2C2GA 2M6RA 1AMUA 2D0PB 1TD9A 3LY7A 2ZUBA 1VIDA 3Q3CA 4WLUA 1JU9A 4HNSA 4MB2A 4X1YA 1QYXA 1R2QA 2X6QA 1RLOA 2ON6A 1B8OA 1F51E 1YNSA 1Q5PA 1NBMA 1YS1X 2ETXA 4C6TB 4CKCA 3I2YX 4RMJA 4YGYA 5EX3A 2G80A 4KAXA 2N9UA 2H2FA 4M3OA 2F9LA 3WGTA 3SDSA 2WNIA 2F4NA 1ZM9A 3KCQA 1UG3A 5AJTA 1IRXA 3RB8A 2HL6A 4EHIA 4KYIB 4N8DA 1C4OA 1K63A 4O0LA 3W8FA 1C9KA 2C77A 1UXHA 3D8TA 1ORRA 3F5FA 4QELA 4RHEA 1Q84A 4RY8A 4OYHA 2Q8PA 5FV4A 2Z58A 4G63A 3TBFA 4B48A 1IPFA 2C5LA 5KTNA 4UQYA 4DI3A 4HOQA 1JBKA 1KJQA 2OWEA 5JJLA 3EPJA 1ODSA 3KRTA 1FSGA 1UXGA 3P9ZA 3VU3A 4CQLB 4H7JA 3BE6A 3V8EA 5KYXA 1PWXA 3UK6A 1Z25A 1E20A 5G04J 1XHFA 2PYIA 3ZHBA 1F20A 2ERYA 3N87A 3PL5A 3L13A 1W0KD 3G2WA 2AQKA 2NQ2C 3QHPA 4MMYB 4LRTB 3SJCA 2OCYC 4H9GA 3CLVA 3CT4A 4RHTA 3TL2A 1BRTA 1WKBA 2H18A 1ORWA 3TQIA 3VZQA 3IQEA 1PK9A 3RWOA 3F6BX 4JEUA 4UAUA 2UY1B 4J0CA 1M0TA 1FDOA 1VIYA 2BFPA 3MSCA 4IUCS 3TZLA 3V2UA 5B1BE 2QYOA 2RAPA 2SCUB 1OT5A 3KVVA 4U8HA 3I1FA 2ENWA 4X3CA 2WZCA 5DNCA 5JWRA 1J2TA 1G63A 3HU1A 3AVTA 4R2LA 2XGSA 5BN1A 1RYNA 3IQZA 5BN3B 3A28A 3EGVA 4WY2A 5DBEX 3TZKA 4C0SA 5IEJA 3E2IA 5CMWA 1G2OA 2XOKA 3JQDA 3NDJA 1Y4DE 4HMQA 3UFBA 5BXQC 1IXYA 1ZCAA 1Z7GA 3LYUA 3ZYLA 1IG3A 1MQAA 3MERA 2BM0A 5EG5A 4BKQA 4DUPA 3PE4A 2KM1A 3FCCA 3QPVA 1ORDA 4CLOA 5ALIA 4UUCA 5DM4A 1NQUA 4ENSA 3AR5A 3QKSB 4ZVVA 4PINA 1H65A 1DQPA 4JELA 5DP2A 3SNKA 3WE7A 3JVVA 1N0VC 1E1KA 4H1VA 4TRNA 3RLIA 4MUKA 4C0EA 2H7CA 4LJ8A 1CR1A 1MX2A 3JUIA 2HO4A 1XRPA 2VP2A 4LVCA 4W9MC 4XWWA 3R7QA 4P2BA 4YT4A 3MMZA 1P9LA 1NW8A 3C4JA 5H16A 5BN4B 4D3ZA 4WJLA 1VMIA 3BHJA 3FBTA 1CE8A 1I0ZA 3EZNA 3T5MA 4N8EA 4EZLA 3GVXA 4U7PB 1XLUA 2ZYSA 2H9YA 4G9BA 5DI3A 2XBMA 1G3RA 2DP4E 3EQZA 3JVUA 5DYTA 5CFPA 3ST7A 1ACLA 4J0UA 3NEJA 4D45A 3FU3A 3VTXA 3AI1A 3H4TA 5EPEA 3SSAA 1JLRA 2V4UA 5IDQA 2PGDA 4X9XA 1X6VA 2DTEA 5FORA 2GCIA 3HGTA 1BAPA 1E3QA 1I4OA 1W4CA 2QTHA 3D5TA 3QYFA 5C3MA 3IP7A 1ETHA 5CXXA 1OLSA 3PKZA 4NAHA 5A03A 5KZMB 1TJFA 1XROA 2YL2A 4DX5D 3MF4A 1SNYA 2ZDHA 4MQFA 2IQCA 5FPTA 5HGJA 1ZRSA 3U4IA 3EY4A 3DT6A 5JAIA 4ARCA 1UN8A 2FEWB 4KSBA 4Z4EA 3LKVA 4QE3A 4GC9A 1UZLA 1ATIA 2J5KA 4RYLA 2R84A 2AR0A 1GJRA 4DLVA 1E96A 2PBFA 1SXJC 4RXUA 1T5LA 3I5XA 3EDTB 1YQ9A 4KH1A 1CF4A 5ARGA 5JAOA 1TQDA 1K5GA 9GPBA 2C7PA 4OATA 5HRAA 4IEIA 4NNPA 1VRWA 4C7BA 1V11A 3AUXA 1UJNA 3A4LA 3I1IA 1LC3A 4JBYA 4JNKA 2FMIA 3ZNPA 3ASUA 4EG6A 1WHSA 4Q7LA 3KXLA 1GL6A 2JGFA 4N9WA 4IMJB 5FF9A 3O94A 3RS4A 1HDZA 2X7JA 1ELKA 1ID1A 2IYTA 1C1DB 3D8UA 1X1SA 3G2MA 3N0TA 4D6YA 1TKRA 1RBQA 5K4AA 2NU9B 4FZRA 2GM3A 5H7XA 4MA5A 1Q1EA 1ZI9A 4O8CA 2G6BA 1DADA 4M7RA 2GN4A 1NVTA 3NXSA 3RYTC 5FT9A 1D6NA 3S5UA 4ESVA 3VOBA 3VYWA 1THGA 1UPUA 2Q3DA 3K8ZA 2XV1A 3HU5A 1VA5A 3ZBPA 2JLWA 5JDCC 4KNVA 1SQFA 2CNNA 2QTNA 1D4AA 3CTPA 3NWBA 1WVIA 3EEYA 1PJQA 2PGJA 1L7OA 3DEAA 2H0AA 4QTYA 1OPXA 5EKSA 1UBLS 2VNHA 3NBQA 3VAAA 1JAZA 3NHLA 1E9BA 1YL6A 1SR8A 2H4FA 3OP1A 1E7RA 2VXYA 4QQNA 3CZMA 3C1UA 1UADA 1X1BA 2CVPA 2PL5A 4F6RD 5ESXA 4US2R 3KJNA 2NTYC 4XWTA 4KQIA 1KZOA 5ED0A 2ZPUA 4L9SA 2OBNA 2W6JD 4L2YA 1G5RA 1PX0A 1X7ZA 1FE8A 5ELLA 4B3DA 4C14A 3OPYI 4YIHA 1JDVA 1MEEA 3LXXA 6LDHA 4ERNA 4CZ2D 4TXHA 4Q3CA 1YVUA 4CRWA 5E6SB 2WG1A 5K3CA 3SJUA 3H2GA 3OZXA 4L76A 4L6IA 4CM1A 3LX8A 1YR8A 2PZAA 4Y0AA 2QAGC 3I04M 4UVDA 1XN1A 7YASA 2OFFA 1A9OA 2OMKA 1S9HA 1SU8A 3ZIMA 1MX1A 3QVJA 4E3WA 1WB9A 4RGVA 3SLGA 1TYAE 2UVQA 3ICEA 3JALB 3IOYA 4HBGA 3CHQA 4U7WA 3CPSA 1NQTA 5CR9A 3Q73A 3DFUA 1RPZA 1ENOA 2BPOA 5EPOA 2FZ4A 1FJHA 3AFNA 4RKRA 5ILQA 4MS3A 4PO1A 3HNOA 3N07A 5FLKA 5I9NA 3KQHA 3DTVD 3JYQA 4IDEA 1W5AA 5EQFA 4F85A 3V8MA 1OWMA 1LBIA 5JEEA 2XOEA 4UHCA 5DOVA 1IM8A 1UQTA 3AU8A 3I4CA 3P2YA 4KX5A 4ZVTA 1EFVA 2FG5A 4OXNA 2G82A 3PYXA 4TS1A 3K2EA 3G2QA 3K8QA 4BUJA 3RK6A 4GYWA 1O08A 2J5QA 1IZ9A 1AHPA 2D6FA 4FFOA 4Q05A 2COEA 2DJ5A 3G5MA 3QTLA 3TW0A 3ZZTA 4EA7A 2YC4C 3RW9A 1K98A 2QN8A 2B5OA 2PX4A 3P5BA 4AMUA 1NBAA 3D9QX 4B9AA 2ZT5A 1OBCA 1ESZA 3RRMB 1SVWA 1F2TB 4L9WA 5ALKA 2DKFA 4JITA 4AM8A 3K0CA 4DM7A 3CCCA 3ZGVA 4JYZA 2O2XA 1JALA 2QUAA 2QPLA 3LFUA 3KJEA 5H02A 4IIJF 1PNTA 5JR3A 1LDYA 5H59A 2P0YA 5ITVA 3AT1A 5JS8A 4X1KA 3J5QB 1OI2A 3ZXSA 1C7ZA 2V97A 4CCYB 1N4SA 1VDZA 4A1FA 1O94A 4WWHA 1WLYA 4CMIB 5JI3E 2GZHA 3SP1A 4JNCA 4WK4B 1WMSA 3FROA 4FCWA 1MQ9A 1EWKA 2R48A 4M60A 3RIEA 2F8XK 4FFDA 4MV4A 1RKVA 4OQXA 5IT4A 4DA4A 4CEJB 1FUKA 3VR2D 3RRNB 3MINA 2JRCA 4X92A 2XS8A 1NJ8A 4L7QA 4XIFA 3BWCA 3TN7A 5LM3A 1E9DA 1U99A 4YPOA 2NO9A 5U4QA 4RK1A 2BTQA 2CG3A 1TRHA 1QRUA 4BO6A 2BE9A 3O74A 4G07A 2Z9DA 1PLKA 2V4ZA 4OREX 4GMRA 4PC6A 3ZHXA 1HDRA 3QELA 4HDMB 4IWYA 5JO9A 2FWNA 4G85A 1EF1C 3HVIA 5GZ1A 1GLNA 2O7VA 1NNUA 1JE0A 5JNUA 1E8ZA 2EJUA 1KAMA 2G9NA 5KNCH 4BO7A 4NS4A 1GFWA 3CRMA 3E35A 2ZITA 3G1WA 4BIIA 1VJTA 3IPXA 4C1NA 3JQGB 1ACMA 1U11A 2V0NA 5J23A 3QPBA 4M1OA 2PA3A 3HS3A 4HDRA 2J31A 1JLKA 1THMA 2AJTA 1JHDA 3IPRA 3LJKA 3K0EA 1U8XX 4AMBA 3LDHA 3DTTA 1NDHA 2YXEA 4FFVA 2Q29A 4M9QA 3JYSA 4X8HA 4ZAWA 3AG4E 3IAAA 1CR6A 5DB4A 4CKWB 3HYSA 4H17A 1Y8RA 5AVQA 1N8TA 2REBA 1BD8A 4IOKA 2GW1A 2GSWA 3IA2A 4WAFA 5SZJA 4BX0A 1J00A 1XYGA 5DE3A 2J08A 3IAEA 4RTOA 2L0TB 1MO3A 4TZ0A 2JD0A 3KXDA 3I9KA 2D1QA 1ZITA 3RSLA 6CHYA 2ZUUA 3DKKA 2IONA 3AC0A 3H3XA 3TZ6A 1ZD8A 1ODFA 1ZKMA 3HB0A 3V2GA 1S2GA 4IPTA 4LK3A 2CKDA 4BQFA 1BE8A 3CRVA 2YX1A 3WGKA 2A59A 4MW4A 4YFYA 1DBIA 1NI4B 3P9YA 4GC5A 2GVNA 4A10A 2PL2A 2ZM5A 3UATA 4GCOA 2EKLA 1VKRA 5ANRA 1JZQA 1AKWA 1GEEA 2VG8A 3DFIA 3OE5A 3C0KA 2KYRA 4AS2A 2HWWA 4EHMA 2OGWA 4J49A 1EQUA 2PMBA 3HZOA 2TMGA 3WLEA 5FPSA 2HR1A 4IHAA 1NP7A 3CUSA 3FVQA 3R9MA 3OA2A 1L4HA 5A9SB 5HUQA 4LDJA 2B8WA 2O3SA 2CZGA 4B8ZA 2A5EA 1MX9A 1QKIA 2NYVA 4Q4HB 1CERA 2R8XA 4MUAA 3KQLA 2A0YA 1M7GA 1X7DA 5THXA 4MLZA 4ARZB 4CFZA 1V6CA 3R3JA 4ZAVA 1B6SA 3A3NA 3IQWA 1RCFA 2VSOE 1W2HA 2D4HA 3E5RA 4TLMB 3W0LB 2O3RA 1E32A 3GHYA 4DRXE 1FU8A 2PS0A 4A0FA 5AI5A 1U4NA 4ZAGA 1PZHA 3FTYA 1ZN2A 4FEEA 3HO8A 1J2JA 4I4NA 3ND8A 1ZJ4A 3RS2A 4ZHSA 2B25A 4CF6A 4KRGA 1GTVA 1KP2A 3LYAA 4N3BA 1NL3A 2YW9A 2F7SA 3PC7A 4U02A 5AIJA 5AK4A 5TQVA 1LFDB 1OTXA 1P1IA 3DKPA 5SZKB 4QGSA 5IJ0A 1FTNA 4QOJA 2XSZD 4U2BA 5BWCA 1X42A 1XDUA 1XZKA 3BXGA 3EWAA 2V6BA 5I8WA 4ZIRB 1RNLA 1GM5A 3B6JA 3EZFA 4NJMA 2QD4A 4KXYA 3N71A 4Z9BA 1AO3A 1AUPA 3NB0A 2ZIAA 3CISA 1ELRA 3CPHA 3WMFA 1N33B 3FPSA 3TD2A 2HPAA 1ZUWA 1Z4KA 3DS8A 2ODTX 1P9OA 1D7OA 2QT9A 3UGTA 2O0HA 1C7EA 3ZW7A 1NRJB 3R0XA 1VLZA 4A0QA 4EDFA 3KQKA 1RXVA 1TCUA 5C2JB 1JR3E 1UXJA 2UVPB 4MVJE 5JCOC 2B4YA 4I55B 2P9HA 2ID7A 3GHHA 1XXHE 3MTIA 4FVTA 3RJZA 1JWBB 1TC2A 4B4UA 2DRIA 4XGIA 1I6LA 2QVGA 2PO7A 4N18A 1J97A 5HUJA 3GGDA 2XNJA 1N7JA 3NAMA 2BGGA 4BSXA 5EE0A 5BQPA 2BKUA 3U3MA 3ZWPA 4IGFA 3B7GA 3RS8A 4TUYB 2DBQA 4MWBA 1DO8A 2Z43A 4BNJA 3EQ2A 4NRHB 2QEQA 3ZCTA 2QD1A 2QMYA 1PR9A 1HY3A 3G2IA 1U0OC 3QJYA 1SXJE 4IDFA 2WTMA 3U4TA 1E6CA 2A7XA 3I2IA 2YTZA 4IIDA 5C8YA 3ECAA 2FSSA 3AIMA 5U1PA 1J07A 2PQ6A 4GKBA 5JNVA 5B1DA 2AJAA 4BZZA 2FJAB 2W2OA 4PX9A 1E5QA 5ICFA 3D6JA 2VGXB 1QLHA 5JH7F 4FFPA 1YDFA 4B6OA 3B51X 2OAP1 2YBEA 1J8DA 3M1LA 2QE6A 5AI8A 4ARZA 1F8XA 2IYUA 5FWDA 1D8DA 1QPGA 2OB2A 1QNLA 2OEPA 3MZ0A 1KO1A 3QWHA 4GXNA 1Y5MA 3T4XA 2DB3A 1FTQA 3QFFA 4P3NA 1Q91A 3LZCA 4D2IA 1CNFA 3NGLA 4I4TF 2WHEA 3GUUA 3WGJA 3SXUB 4JP5A 5HPYB 2HNKA 3AUJB 1FBNA 3BFXA 3D2LA 2HHAA 3HV0A 4P0TA 2J32A 3X2FA 2ODPA 2QJWA 4GPEA 4E0BA 4OOFA 5DX1A 3VNRA 1NQVA 3TWVA 2GYVA 2ZCVA 1R1DA 4RZIA 4V0KA 1P5RA 5SZHB 4AIIA 1J70A 1VLQA 3C1AA 4FWIB 4A26A 4Z54A 2C1XA 1KZYC 2JAOA 2Q4BA 821PA 1SY7A 3IR7A 3WIEA 4CQMA 2SKEA 2KHZA 4W9NA 1VP9A 2UUAB 1TVMA 1QH8B 5DK4A 1K86A 2PAAA 2WR8A 5FBHA 1IXKA 4Q6WA 3WIDA 4AYTA 3FUIA 2QTCA 5FKJA 2ZPTX 5JASA 4TMXA 4IAOA 1UW4B 1A3CA 1OX6A 3W3AH 3JATA 3PCTA 5JBNA 3TW8A 3PNQA 5FA8A 4O4LB 3UOAB 1FLVA 1QFYA 4TM8A 1EESA 5E7QA 2YYZA 2QGZA 3RYFB 3EPPA 3PPYA 1MKYA 2WK1A 4PGMA 4JBGA 2GR9A 3OHSX 2B1RA 5FBKA 5KYUB 2ZKLA 2HPVA 3THRA 3TH5A 5TEVA 4HH1A 3WI7A 3JQQA 5AIBA 5IJ0B 2XCSB 5BQ5A 3EVCA 4L2IA 1M7BA 4FKZA 4Q9JA 1ONNA 5FUQA 4H60A 4KNYA 2W6PA 1RI5A 2FDXA 4CKEA 1NC1A 1OBFO 3H6KA 5AJWA 1XV5A 4ZV7A 3HMKA 3ONEA 3GD7A 2DWUA 2EQBA 3CVPA 1E1LA 1ZL2A 2L18A 1OHHD 4BMOB 2R87A 2YJTD 2LPMA 3KZ1E 3KOYA 5HFAA 2G5PA 4F3NA 1DOAA 1E2IA 1BKSB 4LAFA 3RLFA 5EXDA 1DKNA 5B1AE 2CLHB 4B4KA 1XXHA 4LW8A 5JXGA 3NQPA 1L7PA 1G8SA 3FPFA 3D9JA 3MX3A 4KWTA 1E18A 2KBEA 1CV2A 2CWDA 2JLAA 3PIDA 5DI3B 1V7PC 4XSHA 3LO5A 1JX6A 3DDNA 2Y69E 1DUIA 3PWSA 1U31A 1W48A 2PX2A 5KU1A 4GA1A 4X63A 4AJWA 4YAEA 4TXRA 3PHGA 5KJNA 2EIHA 4HQLA 4ITRC 4BWFB 1N94A 2WJPA 2BN4A 4MVJH 1ORVA 4UBIA 2QV7A 2ZU6A 2FUCA 4BKUA 1PT9A 4YMSA 1HL3A 3HFRA 4F5DA 3D9OA 3RO2A 2ENUA 1FPPA 3BXFA 3RSEG 2WJAA 5AR1A 2AMYA 3ABLE 3E61A 4MR8B 3RSCA 3TZBA 4D9EA 2WC1A 4WUVA 4IGIA 4C06A 1UMKA 3LC1O 1JU4A 2YHBA 2AVNA 2FR8C 1QF6A 1NW4A 1JSRA 4UEJA 1Z15A 4QQKA 3QWAA 4D8TA 1SVXA 3B7UX 1UMDB 3MCZA 4NSNA 2LIPA 4TKVA 2C9OA 3GLHB 3TF5A 4HAWA 4TTTS 2VP6A 2ANCA 4RIHA 1NQXA 3LUKA 4BPRA 5TMPA 2P6OA 5T7BA 4XGRA 2I1WA 4AROA 5I7VA 4AIFA 1CRZA 2ZG6A 3GGOA 5AHOA 2Q2QA 2ADFA 5E75A 3NYQA 4X71A 4TQAA 4ESEA 1KWGA 1H05A 3FFXA 4C21A 5HI7A 2GDJA 1K89A 1Y6QA 1XTZA 3AETB 4L07A 3TLJA 2FN8A 4B93B 1O5OA 3ETJA 4D5EA 3BGIA 2CFCA 2AG5A 3LP6A 4K6FA 5I51A 3BMOA 1BS1A 4LCBA 2LNDA 4I4TB 1G7TA 1NIJA 4AF6A 3KD2A 1FNSA 4YI5A 2RKBA 1H5NA 2XX3A 2ZVJA 3MGBA 3ENKA 3K0CC 3RTBA 4AWBA 3KYJB 4YPVA 3CGHA 2H6IA 1CDEA 3C7AA 5EL0A 1XMVA 1NR7A 1NN3A 2R7AA 3GUCA 5AW2A 4P8RA 2N0SA 4ES6A 3D7NA 2AOXA 2QYHA 3DEFA 2ZE6A 1RWWA 1AWCB 2NLOA 2Y1XA 3TKLA 3TLBA 3FOWA 3VR0A 3T3PB 4B45A 5CFMA 1MX3A 1T5BA 4JB3A 3WK4A 1K97A 1X7YA 2G9RA 2PV7A 4MS6A 3HRIA 3KDSE 2UAGA 2IP2A 3L8CA 4OMFG 5L3ZA 1C30A 1ENYA 3H99A 1Q1BA 2XMPA 1E9FA 4PPNA 2R751 2X2EA 1PKXA 1BCRB 2Z98A 1W4LA 4JSRA 4UJ3A 1KMIY 5KMGB 4U0SA 3JQ8A 3OT4A 5T64A 4DUGA 3UX4A 4D0RA 5JBIA 1SA5A 3G0GA 3Q9LA 3FDHA 1BXZA 2ZRDA 4OQQA 4Q0MA 3QOFA 5K3SA 2P2GA 3FI0A 3BX1A 3KT6A 4I1OA 1UK9A 3AIOA 4NJOA 3L0ZA 3M89A 1BDJA 3LW8A 2D5LA 2YWDA 5LB4A 4NRDA 2VT7A 1HTTA 1P2TA 1UT8A 3MLAA 4WWPA 3BWYA 1GPBA 2R8ZA 5KTTA 1U2TA 4DYVA 4LYEA 2IVZA 1EXWA 3G0IA 4G0QA 4KK4A 4RIFA 3HCCA 1YKSA 3Q72A 3JALA 4FHZA 4ZT2A 2QDKA 3T0IA 5CCBA 1H2HA 4V0MA 1RJGA 3GOHA 1OF1A 2PHZA 4HDSA 1AQUA 2JW5A 4PXAA 5DJ5A 3ZLBA 1C8VB 1OLXA 4N2QA 1PG0A 3FMVA 3H5WA 3WRVA 3UY4A 4BNGA 1UWVA 2IIPA 3FKSD 1IEQA 5HX7A 1O95A 3H75A 1MH9A 3WWDA 4FGWA 2B2NA 2JD1A 1QRSA 2R2LA 2ALJA 4EBFA 4UBJA 3HB4X 4FYVA 4UKDA 4I5IA 4JLAA 5J9FA 3NWJA 3EULA 4E14A 4MWEA 2XEXA 3SF8B 2R02A 3MGGA 1BDMA 2YVUA 2VK8A 3EE6A 3VI3B 1DINA 4BEJA 4D80A 2FJUA 4ZVRA 4Z9FA 3TOCA 2Q4TA 4US1R 3H1GA 2CNWA 4MRMB 3EAFA 1XPRA 4IZHA 3TR0A 1RE0A 1VPLA 5LDDC 1ABEA 4P80A 4BP9A 3T8KA 3MAGA 5KO2A 5M2QA 3E4DA 4A82A 1T6NA 4EBBA 3U5ZB 1XP8A 4GHWA 3SZLA 1XLWA 3AB3A 1ZJ6A 3STYA 4HI9A 1QIJA 3D6MA 2OXCA 1JIVA 3CV3A 1INLA 3DL4A 3QRWA 4Y2PA 2HYIC 3ECCA 3K2QA 2EX1A 2GPTA 3GW8A 2QLNA 3I4LA 3QE2A 3V9AA 4JLJA 1MOSA 4BLOA 1SCNE 4DZZA 1AMOA 1ZQ1A 4B3IA 1P7WA 5KYWA 1UR5A 4KLZA 5DN6D 2OHHA 4U96D 1VJDA 2PRKA 4HFMA 5LDHA 1NF2A 4LDPA 2AN9A 3EIQA 5JSZA 3R5FA 5JCZA 3AX6A 4EY3A 4DG8A 1IBSA 3R7AA 4A36A 4DJFC 3ZWMA 3DVQX 3FIJA 2ESRA 4D3YA 4V1CI 2NX2A 3KXPA 4UMEA 1DQSA 1Y7TA 3AG1E 3M0EA 2JLVA 1XJ5A 1C2TA 4AZ0B 4N01A 3K9GA 5BQFA 2PD3A 4Q39A 1Y3IA 1NN5A 1QQTA 2XRZA 2KW5A 1ADGA 3Q9NA 4G5RA 3V8NA 1XNGA 2I91A 1H8EA 3HSKA 3AVOA 4NNOA 5FCDA 2RH8A 2LR0A 4YQFA 3C8MA 2ZGVA 1XMQB 1ZCBA 1COWD 1Q0PA 2PWAA 4UU0A 4Q4AB 4JT4A 4C7KA 3BICA 3OJOA 3RRJA 1EAYA 1N2BA 3CF0A 1EE9A 5JLAA 3UV6A 1OV6A 4P9NA 2PKCA 3CVQA 1NPYA 1JG3A 1UBGA 3MIIA 3NZEA 4QGHA 4L4SA 3VTAA 3NORA 3BJMA 3TWSA 5F5NA 1B00A 3R3XA 5DK6A 7REQB 3L0IB 1DI0A 2WUEA 3HB7A 2L9BA 2J1LA 4PLPA 1XD2A 1BGWA 2R6GA 2ONJA 3LKUA 1U7DA 3N2KA 3RSGA 2APJA 4XDHA 2PMCA 1B15A 2CNBA 3OTIA 4FX2A 1L4GA 2H17A 1Y5LA 1V96A 2JLSA 4PU0A 2FF5A 1VI6A 1SC1A 1VMEA 3UM1A 1I7QB 3C43A 5EQTA 1XZLA 4AKHA 1QYMA 3FOAA 3L82B 4B6FA 5AUPB 5LP6B 3TQSA 3SSMA 3ZR4B 3N59A 4H7EA 2YNQA 3O31A 4FT2A 4N0PA 3B2QA 3HA5A 4FJ1A 1OILA 4DLKA 1PFYA 5A4IS 4P22A 3ZYZA 4KREA 2LZ0A 3HGQA 3ZZ0A 4AS1A 2YXLA 1P74A 2XCOA 4LY3A 1EDBA 2O7NA 1OPRA 1NUTA 3F1KA 2ZIVB 2VPZA 3OEHA 4L8VA 1P0MA 4MPRA 1K08A 4DB4A 4U7TB 4BTAA 5JQGF 4BLSA 4EHNA 3AEUB 3E3NA 5BMVA 3LQFA 4UUBA 3NDRA 2R60A 3C6XA 3N2KB 4YJ3B 1RU3A 3VAYA 2QY9A 2YFKA 3G7UA 4HDNB 5DTRA 4KQ2A 3IMFA 4BIMA 1OAAA 1VG9B 1DIAA 2C5HA 5I5EA 3PFGA 1AQJA 4R7LA 3WXMA 1ICIA 4XGNA 4ZPJA 5K45A 1WE2A 4M9XA 1I6MA 1IONA 3GVCA 5FOTA 3GT7A 3MLEA 1QP0A 2YVLA 2G4CA 5FFNA 2BFBB 4P4TA 4BMCA 5JJIA 3EFOA 3SF0A 1I7PA 3N2ZB 3PDCA 1FXUA 4RACA 4EB8A 4ZT4A 3DXZA 2OLJA 4O5OA 4UMFA 3EHMA 4UWFA 1LK7A 3FVRA 3HYTA 3UAXA 5D1NA 4ERXA 2E2EA 3S7DA 1LVHA 2G76A 1X1TA 4NICA 3P26A 4N0DA 3B7RL 3KQTA 3HB1A 1NUUA 4NG5A 3QBTA 4P4SA 4ZMRA 4PICA 5CFQA 3EGCA 4Q18A 4PZCA 5CG2A 2X14A 4YK7A 3LECA 3DXMG 2MOKA 2F9MA 2IH5A 1ZJYA 3DRAA 5DIZA 1EUZA 1UDXA 4U00A 2VUUA 1DQNA 4J9UE 4B1FA 4O3FA 1S2LA 4W82A 4YS6A 1KI7A 1H2AS 1ZLYA 5E76A 1A2BA 3WSWA 2VGEA 2Q1WA 3BK1A 3JAMA 3JYHA 3P4YA 4BB0A 3U19A 1AHIA 4YHBA 2DMRA 2A4MA 2IWRA 3CUKA 2QZPA 3UJDA 2YMPA 2DSTA 5CDFA 1ZQ9A 4A5SA 4ENPA 1CEQA 4AZ0A 2OV8A 3EJ6A 2ZWIA 2WAMA 3PFHA 2JKZA 5JDIA 4ARBA 1FX0B 3AHDA 3TBHA 2D1FA 4DRYA 2WB4A 3EY9A 2FUG6 4NK5A 4EHBA 5EIOA 4XWKA 2AI1A 9MHTA 1N9KA 2GZMA 2O8NA 5FRDA 1GNTA 4KPGA 4IWNA 1KK1A 3FTDA 3BKWA 3I2KA 2PMWB 1QMOE 1CUHA 2WRZA 3FNFA 3PNSA 2C84A 2D1RA 3VYUB 3ZI4A 5IPFA 3HB5X 1TM2A 2QRPA 4EYOA 4HG2A 2NU6A 3FUXA 1SBYA 3L8MA 1P7VA 1RWVA 4MMXB 3BMQB 3D9LA 1KEKA 3AU5A 3KEZA 2Q50A 4OI1A 3J81A 4ZN6A 3UK2A 4WDQA 1PUIA 3PF9A 3H9CA 4NENB 4V0ME 5JNWA 4JYBA 2DBZA 2HSDA 4D25A 5CYPA 5D5HA 3IHWA 4LWZA 3ZE9A 3WA7A 1QX4A 1NNEA 3HL4A 1FS5A 3M2TA 1I3KA 4CUZA 3ILVA 5DM0A 1RJEA 4A3SA 1XQWA 2AJBA 1TZCA 4XI9A 1M3SA 1P3DA 2CJFA 2HRZA 1IVNA 1KQGA 1FTWA 1KMCA 4MDYA 1D9SA 1RRKA 1WNFA 1Z0AA 1DX4A 1ZIOA 1O8BA 2FN7A 1N2GA 1PL7A 3DXYA 3NU1A 4GBED 4R3UC 3UGQA 1SUDA 4QT4A 5BT8A 3DLTA 1MDBA 1ZGBA 3CZ5A 4RGBA 3NI2A 3UXMA 4PSKA 4BWRA 2ZTLA 5TDHA 2IF4A 4P08A 1I33A 4YEDA 1L5LA 3UCFA 2FUKA 4FJZA 1JDBB 4QVKA 2Y4UA 1M2EA 1QB8A 2H8GA 3GPIA 4C7JA 4JB8A 4FULA 4DEVA 2DULA 1QF7A 2FPKA 5E9WA 1OAOA 5KC9A 3UWSA 2YNMD 1YQDA 5B30A 1CS0B 5TPZD 1NBOA 2QSJA 5IJXA 1THZA 2FSVC 5AI4A 4AY6A 4B0OA 2OT3B 3DV0A 4HN2A 1UEJA 4NVRA 3L77A 1A88A 3RWBA 4RH3A 3WLHA 4AZWA 3L6OO 3SBTB 4Q1CA 4FFSA 3TIIA 2B5VA 1SXIA 4IL5A 1YRLA 4DGSA 1HKUA 3CJQA 3PIRA 4KFSA 4CYMD 4F5WA 3Q7EA 2OC4A 1KEEA 2L2QA 2WG0A 1SVOA 1ZA2A 3HKBB 2DUMA 2YXPX 1A04A 4HWGA 5EE3A 1L5OA 3QELB 3T1QA 3UMYA 1FYDA 2XE7A 1UK6A 2PRSA 3ZY2A 1WTCA 3H4IA 5JQWA 4UREA 4W5QA 4KT6B 1MHPA 4YJFA 2FDRA 1IM2A 4JP2A 2EHDA 3UB3A 3WLQA 2FEKA 2HMUA 3DDSA 2F8LA 1BEZA 3KSDO 3KZMA 4ZO8A 3AFHA 1HURA 4I2NA 4M86A 1CULC 4BQPA 5IFLA 5TF0A 1CW2B 1MVLA 5KI6A 1GA4A 1E4VA 1GGHA 3E7DA 3EASA 1B0AA 4GU5A 1D4ZA 2YVAA 2GRAA 3BJIC 1MJHA 5FOSA 5K7SA 3L1UA 1V1MB 4IILA 3R3ZA 4KN9S 3JWGA 2QLMA 2J9YB 2C3MA 2P6MA 5LJIA 2VJKA 1WRBA 4BETA 4F1SA 1K3TA 3DVRX 2KM4A 4GFDA 1QO9A 3LVFO 4M1MA 4EPWA 4F4JA 2JLUA 2OYCA 1WDTA 1YJ8A 5IBRA 4B6QA 1H9CA 1ENZA 2VF5X 2JK0A 3OZDA 4WNGA 4KVZA 1JA9A 4I1AA 3TLXA 5EIWA 1AP7A 1U7WA 2X77A 3IPCA 2A9OA 4D3FA 3KJXA 5BOSA 1FP4A 4X7PA 1T1GA 2B82A 5LQKA 1HT1E 3HG0D 3CHRA 3QH4A 4FYPA 5JS2A 5AOAA 3WWYA 4DCGA 5A5FA 3JQRA 2QENA 4JENA 4KXLA 3VVLA 3DSUA 2CVOA 4DCTA 5A4AA 1JCRA 1KPSB 4BNLA 1GGVA 1B6TA 3LFHA 2ZIZA 1YDGA 4MKZA 1O87A 1RYDA 1X7WA 2IU3A 5KCZA 3ZKWB 1ZW6A 2O2JA 1C1YA 1A77A 4E7PA 2PKQO 1M34B 5ALGA 1KOFA 3S2GA 3WGQA 3RYCA 1VLJA 1ZNWA 1Z56C 3KOZA 4ZU6X 3SEZA 2X76A 3SI7A 1T91A 2XYHA 3HHMA 1NOJA 4UHHA 2FSPA 1OX4B 3A1SA 3DHWC 1L5VA 5CT5A 5ECGC 3B5JA 3O3MB 2XUHA 3L04A 1UM9A 4A63B 2I6GA 3WWEA 4P29A 3USCS 1EM8B 3ZTYA 2YFHA 3F74A 2FTKE 2OZEA 2PT9A 1GSHA 1FY2A 3EIOA 4MDFA 2FI1A 2M1ZA 1Y4ZA 1KDVA 3FNIA 5KVAA 1DKQA 4C07A 1FB5A 1RP7A 5DM2A 5J5AA 2Z3ZA 1NT2A 2ECKA 2RHTA 4NY1A 1SIBE 5J2UF 2DR3A 1ONSA 1DL5A 3AHJA 4I1YA 5KJMA 4ZOQI 5J3JA 2RB4A 3WLPA 1PSDA 2YNMA 1ZMRA 4CT5A 1SC4A 2QJOA 4G0ZA 4YMLA 1N95A 1YCSB 1LNQA 5P21A 3B2EA 3ORYA 8GPBA 5D6OA 3ZI7A 5EJ5A 1WTAA 1DE0A 2CK3D 1U28C 4M8SA 4YR9A 4YCSA 5DT9A 1G3MA 3C7KA 1TVKA 3R75A 1F9EA 2ORYA 3TIVA 3ACCA 4B5LA 3DL2A 4Y9TA 5M3BA 4NQZA 5AOCA 3OEEA 2RCYA 3PICA 4N47A 3D6HA 3AS5A 4NBUA 1FFWA 2P0AA 5B1YA 2CDNA 3ADOA 1JIJA 3GC6A 1S01A 4M8NE 2B4RO 3BS4A 2XYPA 3QLVC 5FINA 1TYCA 2IHBA 2PJUA 4KFRA 2XD9A 2Q3JA 3JX9A 3LT1A 4LRXA 4Q24A 4O2AF 2PNJA 3ZIDA 1WETA 3TMYA 4B3HA 2IP4A 2IUEA 3D4NA 2CMGA 3GU3A 3H1BA 4RV4A 4YNDA 5J40A 3RYFA 3J81k 3NAGA 4QBTA 2O54A 3PKJA 4R5HA 2X0FA 2G7ZA 3B9QA 3G88A 1R5OA 3LUPA 3K0FB 1T9AA 3H04A 1GUBA 3IBFA 1ECCA 1VFPA 1QRRA 1XRSB 5DI9A 4ZCPA 1H0KA 4FB5A 4DUYB 1ISRA 2ZWVA 1L5WA 5HOEA 3SQMA 3KKQA 2AR7A 1QHYA 2WEKA 4ROSA 4QDUA 5FQ8A 3LUCA 1J9GA 3WXXA 2DUJA 3DAOA 3FXAA 3CA8A 4KGDA 3BUAA 5J5CA 4XSVA 1OA1A 5JMWA 5CRUA 2HXYA 4A5OA 4IEFB 5AQ1A 3SBOA 3VC3A 1E7MA 5FL7D 3AL3A 3L0OA 1E2EA 3E7PA 1P33A 2YV3A 1T6YA 2WHQA 5JJCA 3PPXA 4DV1B 1HV8A 1QIHA 1XQXA 3D1VA 5LWQA 4ZVUA 1RYBA 4NMXB 3L40A 1L7VC 3S3TA 3WL8A 5IANA 3WLTA 3C2QA 4X6XA 4MUMA 3IIEA 3HDJA 3EG9A 4U8YD 3BFJA 4NQ0A 5JUWA 1Z68A 3ASDA 5D3QA 4C0MA 4G56A 4UULA 1UP7A 5GJVC 3MSXA 2VGXA 4D41A 3U0BA 1N9ZA 3AR3A 3PT9A 3VVMA 1I5OA 2P9TA 1PEDA 2W4QA 5F35A 3T1OA 4GZ6A 5EERA 3W2FA 1T9ZA 4MV1A 5DIFA 4Q47A 3WWOA 3R6WA 5BO5A 1XN4A 3RYHA 4F1WA 4HI8A 3GIWA 4I36A 1Z4MA 4MJXA 2XXBA 2OMEA 1II9A 1QHHA 3K15A 3R4CA 3VDXA 5A3RA 4NXMB 2GZ1A 2IW1A 2V0PA 1HLGA 3G9ZA 3TXNA 3K0FA 3LJ3A 5FWAA 1MC4A 2XH8A 3E84A 3OG9A 4XEUA 4R54A 1GUDA 2OQRA 4TTRA 4BVGA 3VNVA 4U4AA 3ERCA 1HEIA 3D9HA 4YJHA 1AV6A 1TA0A 1BNCA 3E9RA 1Y3BE 3K1ZA 4XSGA 3UJ8A 1SUIA 3OCJA 4E03A 4YRGA 1QCZA 1X94A 1Z0FA 2AJ8A 3BCUA 4HVTA 1OR8A 1C9JA 4LCTA 3BUSA 3AUTA 4D9MA 3NOCD 3SK1A 1ADYA 5AKGA 4OHRA 4BCCA 4ND8A 5A5EA 4CEIA 3PSHA 2X3UA 3AYXB 3HEBA 1P0CA 1RMQA 4MKGA 1D2RA 2OQ2A 1O1YA 4QBIA 2J3DA 4R6WA 4A2PA 4MB0A 3IPAA 4X8OA 3TPCA 2C2BA 1R0YA 3UJBA 1GRNA 4KU4A 4IFTA 1N3IA 5I6DA 3AV3A 3IP1A 4QSMA 3RBAA 2C8KA 1IWBB 4EH1A 5EYPA 2VZLA 3ROFA 2MT9A 3EGEA 2AT1A 2HWXA 1EGQA 1GZVA 3AG2E 1Z83A 2ZWAA 3BMNA 4HGPA 4E5NA 1CB7A 1MFZA 4JLKA 1GCOA 1M9NA 5JO0A 1QHNA 2Y66A 1W36B 3V34A 4GKKB 4EA6A 4QTTB 3BXPA 2LAHA 3K9HA 5EQJB 3DKVA 4ZT6A 4ZC1A 4YDEA 4HQ0A 1Z88A 4EO7A 1NW7A 4X61A 1AGRA 4XPIA 2H3HA 3VNUA 1QIKA 2MIIA 1MA3A 2D8MA 2AKYA 2MDTA 1RXSA 1YDHA 3GJ6A 4TUYF 2C3YA 1NBME 4DWWA 3HUEA 4ZHQA 2I4RA 1U8EA 1UZMA 1XTUA 1GCIA 5FZQA 3VTYA 3N0RA 3N0WA 2N75A 4OGWA 3DLCA 5G0SA 4A2CA 2ODAA 3H5VA 1VI5A 3EC1A 4X85A 1D0VA 4GWLA 4EUNA 1DELA 2CV1A 4YV7A 2YWRA 1H0AA 1DT3A 3TECE 2DC1A 4E5MA 2I2XB 1UKVY 2B2CA 3D54D 3E22B 3P9RA 4P36A 3LP5A 3LV8A 3DG9A 1JTVA 3IS3A 4XA8A 3QXJA 2M1XA 3GH3A 3BIOA 3LFTA 5K6AC 2QM3A 4CGYA 2GXAA 3WV4A 2GJ8A 4MS1A 3ZPJA 1TQ4A 5I7RA 3PFFA 1LDGA 5CB6A 5LKAA 1RZRD 2WMYA 3WLSA 4AZSA 3X1JA 3GJTA 2WUVA 1QV7A 3DR5A 2RHMA 4L22A 4TMVA 4BOYA 5CA1A 1IUPA 2A84A 3EDCA 4IDNA 3I12A 3QNUA 4B34A 2J09A 1DKLA 4LDRA 1R4ZA 3KEAA 2CCJA 5DH9A 1OCRE 1ZD1A 2A67A 4PWYA 3ZCQA 2F0YA 3CE9A 3RUEA 4E4YA 4NURA 3N8IA 4JA0A 4QC2A 4CV0A 4FX5A 3F97A 1W2GA 2DUNA 4IQ4A 4GLFA 4LPKA 1FT1A 3MWYW 3OOSA 1WB4A 2Q5JA 5B4TA 2BDUA 2ZJOA 2IUYA 5C1IA 4JT2A 3JQBC 1NI4A 1M6VA 3OLCX 4GI3A 4X54A 2XJ9A 4QQFA 4DX6D 4DREA 121PA 5ENOD 3ZWAA 3LVQE 1U7HA 1FVHA 1BXGB 3W1WA 4Q66C 4BV2A 3SY2A 2ZAIA 1SQ6A 3F6RA 3CEMA 1JFFA 3GPCA 1L7MA 1FDSA 3AERB 3P8ZA 1T4DA 1T26A 4KBGA 4AJ2A 5DSZA 4HT3B 4F93B 1JVNA 3U3XA 3L01A 4BFUA 2M6KA 2GRJA 2H2HA 2V9CA 1T0HB 3P2EA 5ITZB 2X5GA 1IMJA 1J9EA 1TCBA 2WMDA 2FMFA 3G49A 3OJWA 3IBEA 1M33A 4UJ5A 5F2KA 4Q93A 1SC9A 2XW6A 4L5CA 5TVKA 2XWBF 4B87A 1N5KA 2R6HA 4DLQA 3D5QA 1PJ2A 5E9QA 1KE1A 4O4LF 3KO8A 1IIBA 4RDCA 4D9FA 1V0JA 1U4SA 1V47A 3FYUB 4LC1A 2XIQA 3P97A 4R9SA 4ZJUA 5BR4A 1EYZA 1U7IA 2QF7A 5EWMA 1PV4A 2OXTA 2C2LA 2JCVA 1Q77A 2OM6A 3GNSA 3HKDA 4UM9B 2R1TA 4MR8A 2DLCX 1LBEA 1BXGA 4ALLA 1VJ5A 3OFSA 1A2OA 3Q7FA 3OFNA 3NLLA 4MQ4A 4XB2A 3QHAA 1BG6A 2GFQA 5H83A 1QDLB 4DCSA 1VP3A 3FTPA 2J6IA 2Y1DA 2H07A 4Q03A 3THXA 1DXOA 1JHAA 3NJ8A 4JL6A 5G1PA 2ZT7A 5CH5A 4JP1A 3G13A 4TYYA 1DOZA 3Q0TA 3OFVA 4CCYA 1YA8A 3SG0A 2B6CA 4J0IA 2GKSA 4JGIA 4PLTA 3ZQUA 1FMCA 2CL6X 1YR9A 1ZSYA 3RASA 4RL4A 1BQEA 3SX4A 4DA6A 3RC9A 4LJYA 1K8RA 4G1BA 3RSOA 1OFTA 5IG2A 3N28A 3P2JA 4BFWA 3QK7A 3FCOA 2GRLA 5FWYA 3RU7A 5K0FA 4E70A 3FHTA 1BD4A 1KEWA 4C04A 2BEWA 4YAUA 1FYFA 3EZXA 5EJ7A 2JJQA 3UJAA 2XR1A 4B8YA 4O1PA 3DMRA 5JS1A 4UUAA 3A25A 3L84A 3A9SA 3CWZA 4I99A 4WCFC 5C0OE 4JOBA 4P4LA 4B32A 1W29A 3RV3A 4CKXA 2RHDA 2W5UA 3LAWA 1O6CA 5CIQA 4KW7A 4KLAA 4IKPA 4WFIA 3U1VA 2FPRA 3Q4GA 5D5QA 2XUKA 4PAQA 3TG5A 4BO5A 3VTZA 4D0NA 5AKZA 3TZCA 3HADA 2PDAA 1V1JA 1K3FA 3ZW3A 2R85A 5C3UA 1GV1A 1Q1QA 1N5OX 3T5BA 3TB4A 4RZ3A 1LH0A 1EFPB 4LZJA 3LUBA 2QY6A 3EPLA 5GGXA 3EPHA 3RO3A 4KUGA 2C4NA 4B4VA 4AJHA 4HX9A 4F3KA 2LBPA 4TT3D 2J49A 2JGLA 3QNWA 2R4UA 3EB9A 3QPDA 1CQJA 4B2LA 5JMND 3PWTA 5F4BA 1NSTA 1S5PA 2EGUA 1EP3B 2JGRA 3AL2A 3TVDA 3ICQB 4GTVA 2JFGA 5ELMA 2Q9AA 3VZCA 3U2QA 4WNIA 1X92A 2QUKA 2FQQA 1E79A 2VPWA 4HXIA 2IOSA 1BKDR 1Z6AA 4E6HA 1Z16A 2ZYDA 3HPQA 3IJ5A 3W8NA 5JH7A 3A2NA 2P3LA 4Q7KA 3NM6B 3IEXA 2A88A 5CFLA 1T9GS 1YS2X 5FX2A 1XIVA 2QUHA 2XYGA 4R98A 4B2PA 3FNBA 4MARA 3NDBB 4U04A 3GEBA 1KDPA 4QULA 4YIKA 4JW1A 1HE5A 3P9PA 1JFLA 1JWLA 3T06B 3DLAA 3KSBC 1AKYA 2HPZA 5AHWA 2JH3A 5KUTA 2DETA 2CD9A 3LDZA 1TU0A 3EH1A 3QIVA 2GWRA 4MP6A 4TTPA 4MIYA 3PLRA 3RK1A 5A2GA 4CV3A 1R50A 5LD2B 1XJ0A 1I0LA 3EUFA 1Y4SA 1WW3A 1O58A 2WKRA 3C3JA 3O48A 4C6SA 2FEMA 2W2VA 3DVSX 1NYLA 3B5IA 1Y6ZA 1P7ZA 3O2JA 4HD8A 2AE2A 3DMGA 4JWTA 3W1EA 5JJBA 4D7AA 2GJAA 4DUGD 1K5HA 1QO0D 4RWZA