4AY5A

Human o-glcnac transferase (ogt) in complex with udp and glycopeptide
Total Genus 272
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
272
sequence length
717
structure length
698
Chain Sequence
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYL TRANSF
publication title O-Glcnac Transferase Invokes Nucleotide Sugar Pyrophosphate Participation in Catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
total genus 272
structure length 698
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ay5A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ay5A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4ay5A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4ay5A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ay5A03
2XA1A 1GPBA 1Z6QA 1NOJA 1XNFA 2R66A 3CUTA 2MHKA 2KCKA 4Y6CA 4APOA 3T3IA 9GPBA 5DLDA 3Q3EA 2NC9A 1FCHA 2J9QA 3Q4AB 3HBFA 4ME2A 4YUAA 2ASVA 1H5UA 4X6LA 3MT7A 1ABBA 4LDPA 4NC9A 3T7DA 2G9RA 2YHCA 3OXLA 4GZ5A 5JJTA 3SYRA 5I45A 4W6QA 2VSYA 1IHGA 3OT5A 3ZCRA 4RELA 2XPIA 3H4TA 4HLNA 3RT1A 3G2JA 3DDSA 1K06A 1Z6PA 1QZ2A 1K08A 3OKPA 3AS4A 4AY6A 3BCSA 2FF4A 3DZCA 3IEGA 2GPBA 2KATA 3O3CA 4RIIA 4I9CA 4J0UA 2XEVA 3ASHA 1FU4A 3NPAA 3CVQA 1ELRA 8GPBA 4MI9A 4MI3A 4CTMA 4XI0A 5A7DB 1NLMA 5FTPA 3T3EA 5TVGA 4ABNA 4GCNA 3HBMA 5C1DA 2VCEA 2FEZA 2IFUA 1FU8A 3ZCVA 1RZVA 4G1TA 2C0LA 5BNWA 3EDTB 2C2LA 1HXIA 1IYGA 4YVQC 4GZ6A 1XV5A 3MBOA 4WADA 5TMDA 4GCOA 1YA6A 3Q49B 3TAXA 3CVPA 1IIRA 1Z8DA 3G2IA 2Q6VA 2VGYA 4UI9J 3MT8A 2QLMA 4N9WA 4RG9A 5ARGA 3FP3A 4N3CA 5KJMA 2E2EA 3H4IA 5IKPA 4U0ZA 2LSUA 4Y6WA 3ZHEA 3PE4A 3UPVA 5JJ6A 1P5QA 3VDNB 3GUHA 2VYIA 2HR2A 1P2DA 3QWWA 5EX0A 4XIFA 3KAEA 3Q47B 4HOSA 5GPBA 5JTTA 1KT0A 3QOUA 4RG6A 5KJKA 3RSCA 3UYLA 4JL0A 1KLXA 3RO2A 2IW1A 5TMEA 3LYAA 2QN3A 1SXQA 1FTWA 2WTXA 3GYZA 1P2GA 3NCHA 5G04J 4RIHA 5CHEE 1RRVA 4HOTA 5KJNA 4RBNA 4BQEA 3S2UA 2SKEA 1C3JA 4CGVA 3MSCA 3QWPA 4L22A 3CUUA 4GPBA 2GJ4A 4EKYA 3GW4A 4NESA 3G2LA 2AZDA 4F9FA 1WW2A 4WACA 2C0MA 3Q15A 4Z5XA 3QWVA 2XCUA 3CEMA 3E3NA 5AYWD 2H1FA 3KS2A 4NEQA 3S7BA 2SKCA 4UI9K 3WXXA 3OTHA 4RENA 4EJ2A 3G2NA 3LKUA 3GZ1A 1NA0A 3LPZA 3Q5MA 4A1SA 2Q7FA 1FC0A 2JZCA 2PQRA 1E1YA 1QKJA 3ZGQA 3CV3A 2YQ8A 1PNVA 2QZSA 2GT1A 3E3LA 4G23A 3ZCSA 4X7MA 3BD6A 4J8DA 1L5QA 3MTAA 4AMBA 1Y6GA 5BT1A 3MKRA 4I2WA 5DU2A 1GPYA 2HO1A 2QRHA 2XGOA 3DD1A 2WPVA 2BISA 2KS6A 3ASFA 2PYIA 4MRAA 2AMVA 1NOIA 3IAAA 1Y6FA 4EL5A 3LY8A 5LCWC 1Y8ZA 5D01A 2P58C 2FI7A 1A17A 1L5SA 3CV0A 4HORA 2PRJA 2X6QA 2O6LA 4N3BA 3CKBA 5FZRA 1P4JA 3NP7A 3ZCPA 2QRQA 3JYSA 5FZQA 4U07A 2FBNA 3IA7A 2GEKA 3BEEA 4KXKB 2IEGA 3S27A 1E4OA 3S7FA 2R4UA 3RO3A 3OTGA 4HWGA 5JJ7A 2G9UA 2UWJG 3MV2B 1FU7A 4CDRA 4H7YA 4M60A 1EM6A 4F96A 3CX4A 2H1HA 4UQXA 4BTAA 3SYMA 2VGXB 3U3WA 2IUYA 3G2HA 1B4DA 5FT9A 1C50A 2JLBA 2KCVA 4RIGA 2OFFA 5HXAA 4YNDA 3D1JA 5JTUA 2QLLA 2AV6A 1NZFA 2XA2A 2VGXA 1F0KA 3L7DA 2ACWA 2HY7A 3EBOA 2AW3A 4XI9A 3OKCA 3RHZA 2XMPA 1OUVA 2Y4TA 2BFWA 4MI6A 1WW3A 3RSZA 2QFCA 3EBPA 3S0JA 4WNFA 4JA9A 2L6JA 2F9FA 3ZPJA 2IV7A 3CVLA 3ASGA 1WV1A 2PZIA 3MQFA 2PQNA 4HOQA 2F3QA 2WQHA 4BTBA 1Y8MA 1QM5A 1JEJA 1GPAA 2VG8A 2GW1A 3VTYA 4MICA 1ZBPA 3OXFA 1IXYA 1NZDA 1XOIA 3CK8A 4H7XA 3CUVA 3MA5A 3O48A 3D0QA 2IV3A 4N2QA 2QRGA 1FA9A 1AHPA 1L6IA 2FFRA 1E96B 3HBJA 3MS7A 3BDAA 4BQFA 1L7XA 3GPBA 3VUFA 5M72A 4AMGA 3TG4A 4BT9A 4AM9A 2ATIA 4I9EA 1JG6A 3S7JA 3R9AB 3FROA 4CGWA 2IEIA 1L5WA 2KCLA 3CKCA 5ARFA 4M83A 3MEKA 1XKXA 3T3DA 3OTIA 3ASDA 4KYOB 2QN1A 3CK7A 4KQ1A 4YI3A 2PQ6A 3TOVA 2OOEA 4WUYA 2F3SA 2QLNA 4RIEA 1SXPA 2XCCA 3QKYA 1Z62A 3CUWA 4BQIA 1NOKA 2C9ZA 4GPKA 3MV3B 3PE3A 4KQ2A 5DIZA 2YJNA 2C1ZA 3LY9A 3KD7A 1FTQA 3D0RA 2HYZA 2QRMA 3CVNA 2KC7A 2QN9A 3TGOA 4N5CA 5G05C 4BT8A 3VDMA 3UQ3A 4F97A 4GYWA 1JG7A 2FF5A 3GZ2A 3BCUA 1KT1A 1KTIA 3UUXA 3BD7A 3N71A 4BWRA 4LEIA 2I6HA 1WM5A 1ZU2A 4F3VA 2XCIA 4GA0A 3ZCTA 1P4GA 4QLBA 4CTNA 1HH8A 2P6PA 4GA1A 1V4VA 3MT9A 3UYKA 4YVOA 4N2SA 3ZFWA 3OY7A 4EL0A 3NP9A 3T3GA 5CCMA 2QN7A 4UQYA 3NF1A 3QDNA 3ZN3A 2VSNA 3K9IA 3LY7A 5A6CA 2VQ2A 5D0OD 2F3PA 2C4MA 4AIFA 5D0QD 3VTXA 1XL0A 3MS2A 4BFCA 2R60A 5FZSA 2X0EA 4I1AA 1GGNA 4GYYA 2BGUA 3COPA 3MRVA 3S29A 3RIBA 3ESKA 2BGTA 2FO7A 1GFZA 1UQUA 4IN3B 1W3BA 1WUTA 2GEJA 2Y4UA 1PN3A 4WNDA 2G9VA 4GA2A 2PRIA 3E3OA 1AXRA 5LQDA 1VGVA 4FKZA 3ZCQA 1JIVA 5FJYA 2BUGA 5TMBA 2SKDA 4J8FA 2ACVA 3VUEA 4YI5A 3AS8A 1C8KA 1PSWA 2X0FA 1JIUA 4KQMA 1LWOA 1PC2A 3CEQA 3Q3IA 4WNGA 1FS4A 3L7BA 2XA9A 3L7CA 4HOUA 1XL1A 2GPNA 5LCWJ 4O6FA 1BX3A 1YGPA 2QNBA 4UI9C 5DXFA 4CTOA 1JIXA 3DDWA 3RJVA 3HYMB 5KJLA 3CK9A 4I2ZA 3WAGA 2LSVA 1NA3A 2AVPA 3QHPA 4UQZA 3FWVA 2XGMA 4GZ3A 3L7AA 1GZ5A 3WADA 1UQTA 4B94A 1P4HA 3MTBA 2IYFA 1WAO1 2QN8A 1C8LA 3C48A 4X7RA 4WNEA 2R68A 2R4TA 4AY5A 2G9QA 2V5FA 2R5SA 3BEOA 4EQFA 2LNIA 2IF4A 3HBNA 3Q3HA 7GPBA 5DBKA 4G2VA 4M7PA 3ZCUA 2XGSA 4LEUA 2GM9A 4G26A 5G04C 1FTYA 4J8EA 2C1XA 1J39A 4N39A 4G24A 4MHSA 3MS4A 3LCAA 2QN2A 3ZHEB 4JHRA 2IYAA 2ONDA 2UY1B 3NC4A 4KBQA 3OXGA 1NVKA 4NQ0A 2F3UA 3C4VA 4FZRA 6GPBA 2VCHA 1NZNA 1B89A 3URZA 1WV0A 3TG5A 3OY2A 3C4QA 4GYOA 2UY1A 3MRXA 1TJCA 3S7DA 3RU0A 3TSAA 3NAZA 3CEJA 1WUYA 4REMA 5HQ8A 3BD8A 3AMVA 2PYDA 2DBAA 1P2BA 4EKEA 3PDNA 3E4BA 4RIFA 3FFLA 4N3AA 1QQEA 1O6CA 2X0DA 2ECPA 1UZUA 2ZB2A 2XCBA 3SF4A 1EXVA 2FETA 4U0SA 3CEHA 1P29A 4AN4A 1PYGA 4G25A 1L5VA 1L5RA 2JJMA 4G2TA 1YA0A 1GG8A 1RZUA 4X7PA 3ULQA 4U04A 3OKAA 3QKWA 3MRTA 1HZ4A 3U4TA 4MHOA 3AS5A 1A8IA 3L01A 3SZ7A 2PL2A 4I17A 3S28A 3WC4A 1F6DA 1M5RA 3G2KA 3T5TA 1HLFA 4NRHB 5BW8C 3MTDA 2QRPA 1LWNA 2X6RA 3NB0A 4PQGA 5ENZA 3BCRA 1ELWA 5EX3A 3T3HA 1XC7A 5HI7A 3L79A 3CUYA 3RKVA 4JA7A 5CCLA 5EKQD 5G05J 5D00A 2GPAA 5IKOA 4WHMA 4U0UA 4W9RA
chains in the Genus database with same CATH superfamily
4HQDA 1NI4B 4D98A 3TLGB 1H6DA 1LF5A 3SYRA 2B94A 5K5EA 3NOCD 1T15A 3RVNA 2IW3A 3G2JA 1L8QA 3K9FC 1YB4A 5JSZB 3MWGA 4AY6A 2IUFA 2XVYA 4Y2YA 4TQUS 2IOLA 1EA7A 1KRHA 3JVEA 1SQSA 4M89A 1X9IA 1T13A 3QBJA 4Q12A 4QOJA 4NCKA 3WGGA 2PZMA 3AUKA 4U2FA 4N9WA 4ZODA 5LLDA 5DKFA 3ORQA 4S1WA 4FI3F 4IMJB 1SWVA 4KH1A 1Q57A 1UBLS 1LSSA 4P58A 1XO1A 4JLWA 4CR7A 2OOKA 2O14A 5EOVA 2DCPA 1Y3FE 2HDHA 4PPYA 3KLOA 4MVJF 2O50A 1ZK3A 2FEOA 1JQJC 1FSFA 4B7UA 1NRXA 5A0FA 4WKCA 3CHRA 3OO1A 3NRJA 1CBUA 2HIGA 4HJXA 2O2IA 1EQ2A 5KOJB 1XZAA 3FW1A 1RM4A 3HKBA 3PQEA 3ROGA 4B4DA 3BE4A 2FJEB 4IILA 3TNYA 3G2SA 1P2FA 1DDIA 4HDMA 3PB3A 3GIDA 2Y68A 3NBUA 4KRXA 1Y5IA 2CG2A 4EHBA 4TTJA 1N54A 4FFLA 2ZU0C 4BLVA 3N74A 1MD9A 1YL7A 2AOWA 1BMFD 3Q79A 4ZI7F 2HA7A 3ZLJA 1BXZA 2TMKA 1QO7A 2J6HA 5FBVB 3RSZA 1Y8RB 3ZY2A 3V3TA 3S0JA 3V8VA 2G63A 3PS9A 4ND5A 1BOFA 2ZRJA 4JVSA 2J0VA 1QM5A 4Y0AA 2WT9A 2MDTA 5GONA 1XOIA 4DN6A 4X24A 1X3SA 2AI2A 1KDPA 4P9NA 3S7JA 4PSVA 1OJ7A 2W6PA 2ZB8A 1NYRA 2IU6A 3QEMA 2AXPA 3E4DA 3MV3B 3ADPA 4ND1A 3T3PB 1NP3A 1Z75A 4MGHA 3BF7A 5AJXA 2BGIA 3HWSA 5CEJA 4K0RA 5BOSA 2BKXA 3ITDA 4B5KA 3HBLA 2Q0QA 3MT9A 2Q6TA 1TYEB 3AG6A 3VR2A 4IQ4A 4N8DA 4YJ2A 4Q7EA 2XYQA 4QTTB 1I7DA 2AS0A 4FFDA 3LPDA 1PLKA 1Z5GA 6YASA 4G11A 4CYMA 4YRKA 4EVIA 1IN6A 1TE2A 1YZGA 1VCHA 2ZIGA 1LF0A 1OLXA 4TX1A 2OBFA 3KSBC 4BZZA 3LUHA 2QY9A 4ZQEA 2FN8A 3RVQA 2Q2WA 1TAHA 4MWZA 2CSUA 5IJ9A 2JRCA 2XZDA 1JZSA 2DTDA 2K4MA 1V8ZA 4OQYA 5DMXA 3RTEA 1N5LA 2ON6A 5H9VA 3KJNA 1HT2E 5H7PA 3K1JA 1XGWA 1MVOA 4NARA 4BRSA 4ZT5A 4X95A 1PR2A 2WWYA 4OLFA 4RLHA 3I2YX 3FFLA 4BVAA 3WRYC 2XUQA 2VQSA 3LGAA 3ZE6A 4AN4A 5B5SA 2WJYA 3IBEA 5ANRB 1M6EX 1E2GA 4HN2A 1JQAA 4FJ2A 1HDIA 1YL5A 4AS3A 3ABQB 2QR5A 3LHSA 16PKA 1E7RA 2G82A 1BQ4A 2X6RA 1L7MA 1M2OA 1ZO8A 3NHFA 2B7CA 4TGLA 4AI6A 1G17A 4F2GA 4PLTA 1ZB1A 2FPXA 1GU1A 2DFPA 3PGA1 3GMDA 1P7PA 13PKA 3REGA 3EF0A 1BS2A 2XYRA 2RGXA 4GPD1 1BH2A 4H1HA 1QOQB 1UMDB 2CZCA 1CU1A 4BNGA 4HRVA 2O0HA 1WM1A 2E5FA 4R31A 3HO1A 2Y8EA 1XXHB 2GEVA 2H8KA 4GUDA 1AUXA 4L15A 5FPTA 1CY8A 1ODKA 2PE5A 5ENVA 2JABA 3IULA 1U5AA 3IRVA 4EVRA 1GZ3A 2CHUA 3ZGZA 2P4HX 3WSWA 2CDAA 3W4IA 4LG1A 1YTUA 3U7QA 2F8MA 2SECE 5JTTA 1T5DX 4FJZA 1FUYB 3ASOE 1G5TA 5CDYA 4BRZA 5G0SA 2ONYA 1C3JA 2PKEA 5G3ZA 1NNUA 4FFPA 4R41A 4LZJA 5KBYA 2MSLA 1ZCFA 1U0OC 3LNTA 3Q5MA 4YDRA 1J9ZA 3BJZA 2D3WA 4F1SA 4L7VA 3AAAC 5IAOA 1M2WA 5FPKA 1DIAA 1N4PA 3VHRA 1Y6GA 2EP7A 1AZSC 2VK4A 2Z5FA 3AR3A 3TZLA 1KVRA 1E9EA 1PQUA 1JDUA 3DWGA 1R7RA 2B0CA 3ROQA 3CV0A 3UO8B 4N3BA 3BG1B 2FMHA 3L9TA 3RSGA 5CA0B 3ZTYA 3VH2A 1H94A 1NLUA 4HB0A 2DXIA 4RK0A 1FDRA 1XZGA 3TVTA 1HG1A 2Q5CA 5A71A 2P6OA 1S3GA 3SHFA 5E1DA 4UDXX 3EHEA 5EVCA 1UEIA 2CKDA 3DQQA 4DIDA 2FX3A 4HHEA 4MB2A 3ZIUA 1C0EA 4IYJA 2AE1A 2IV7A 1INZA 1WZ2A 3H5WA 3WLKX 2C9YA 3ZJ5A 4LW8A 4MCIA 1VM6A 5JZMA 3AQIA 1CEYA 1IXYA 3WGZA 1SXJA 2VT3A 3BE6A 4U6SA 1JEQA 4FX2A 4DV7B 3S2ZA 5L9AA 2CXSA 3I39X 3DB2A 4AVYA 2X2PA 4NQZA 3MEKA 3SM3A 4DV4B 2PUAA 4XR4A 3WGUA 3HEBA 3RVDA 1LY1A 1V5EA 5JATA 2R6HA 4C5CA 2D1SA 5LFAA 1S2LA 1RR6A 1B26A 4YROA 2WHRA 1QS0B 3TGOA 5G05C 2Y1KA 1H93A 4B3SB 2IPNA 4LV5B 3DUFA 4AKHA 1VMKA 5JVDB 1FUEA 1KARA 2VHJA 1XFAA 5BVHA 1OREA 4MWOA 1TO6A 2WYVA 1C5KA 1ODCA 3TPZA 2X5NA 5AVWA 2WWRA 3DDOA 3ZVLA 3L13A 5C51B 1EFVA 2AYZA 5FJYA 1YI0A 2SKDA 2NLOA 3VV3A 4LX8A 2IYTA 3IKOB 3SJAA 4JBHA 2P5UA 1B93A 3GLIE 2OAQ1 3R3JA 1HNNA 4RY9A 1PZEA 3MTBA 2A9PA 3QLUC 4WLVA 3WG7E 4ENUA 2MJLA 4KN5A 1E1RA 5DTIA 1MGPA 1HKHA 2HT6A 3WMFA 3QNWA 3AY0A 2P6RA 5L40A 2BUBA 3E4CA 3C4QA 1I36A 5ALTA 3N86A 3ZQUA 3OH8A 4HAZA 1IVSA 5FWQA 1PUXA 3C39A 2IIVA 2JH9A 3TSZA 4G2TA 3IUSA 2APJA 3NIFB 4L0MA 4Z1MD 3MRTA 1RAGA 3TZKA 2QLFA 2ZXUA 4EPTA 3D5EA 3JAKA 2EHJA 1CVLA 4F6RA 1JQLB 3IQDB 4AJNA 3SZOA 3MWJA 4RMNA 4WERA 2NP7A 1PGPA 4BEPA 4R68A 4CUKA 1V16B 3WO0A 1XAHA 3Q4AB 1CRZA 2VDKB 2YICA 2I1JA 4XRGA 1JLSA 2OHJA 3G88A 3RUHA 5FWDA 5DNVA 2KATA 1AQYA 3HBAA 5C2JB 2R7AA 2QZ9A 3KUXA 4R3NA 1MPTA 3PPYA 1RE1A 1C4OA 2IHTA 1R6VA 1JLHA 3IC5A 3E37A 2R1VA 3UPDA 2R3SA 3AKYA 3WL6A 4IRMA 1T3HA 4ZP1A 1KL7A 5FUMA 4A3SA 3FGNA 3FZYA 4QQ8A 1EBFA 1QP8A 2AJ8A 1IM8A 2JGDA 4ER5A 4OMCA 3HYCA 2ODQA 3QW4B 4HWPA 4O1OA 2G07A 3DMNA 4WK2B 5ARDA 1YJQA 3TG8A 4MK4A 3UUEA 2WLTA 3QVLA 3WBKA 2WPDD 3LCUA 3VZPA 5AJVB 4XUDA 4X8MA 5F51A 5J23A 3HTXA 2YVLA 2L69A 4U3JA 1XDBA 5DH9A 2YW2A 2CB9A 1ZCJA 3N0RA 5E6SA 3HUEA 1OY1A 5A2GA 5ITSA 5LIPA 2QG6A 3MFQA 1QLHA 3K1ZA 3KQKA 3ZD7A 4NV0A 3OZUA 3G2MA 2WVGA 1XTTA 2P9LG 2R47A 4JHKA 1M2FA 4AN0A 4OAVB 5SYNA 2QI9F 4D9MA 2WYIA 3UXYA 1UBTS 4JCOA 3PC3A 4OQDA 4IYRA 2H08A 1Q1AA 3I9KA 1B0UA 4WNYA 2IYSA 4QUIA 1GPDG 5IULC 3WLAA 5AI9A 1PCXA 1ZISA 4MLPA 1OW3B 4Y9RA 3GELA 3QARA 1V6SA 3MAAC 4C7OA 5KQRA 2LKDA 1NBIA 2Z57A 1HFJA 3ILYA 2JFGA 5HKOA 5B4VA 2RBGA 4X45A 3WZMA 5CYFA 2WXOA 2J30A 2F1RA 4DIMA 4ITUA 2H8GA 2FPKA 3W2EA 4RWZA 4X1OA 1ZSYA 2J87A 1KWGA 1N9AA 3SO8A 3KBOA 3IIKA 1A5TA 1RI1A 4G0XA 4HH0A 2RG8A 3B1XA 3ZBUA 3UUFA 1TAGA 2Z8YA 3DBVO 2D06A 2HMTA 2OR3A 2ZULA 4YQEA 3RTAA 3RC2A 2YWJA 4KE6A 3QE2A 1QRSA 4E2WA 5IXYA 4CR6A 2XXAB 4A1FA 1LKZA 4WGGA 3WXMA 5BRAA 3VNVA 4P8RA 4DA8A 4Q4CA 4I50A 3WMRA 4K26A 3THXB 3KEGA 4CKEB 4UQYA 4ZPXA 4TL8A 521PA 3TEMA 4R0VA 3QX7A 4PYMA 4E4TA 4Q18A 4AIFA 2I5PO 1YS4A 3PRZA 1E9BA 5FZSA 1MNQA 3LRXA 2COEA 5EE9A 1NNLA 2CXNA 1E9AA 2VDUE 3FTDA 3VUEA 1WHTA 3A4LA 4DBLC 2I66A 4MV1A 1R66A 2I2DA 4MQLA 2GKGA 3KEQA 2DAPA 5TQ0B 3EHMA 3VU0A 2IUTA 2PU5A 3HPQA 4MS4A 5KDDA 4DLRA 3T52A 4KI7A 3RRXA 3RU3A 3MWEB 1TZCA 2JHFA 3RTBA 3O3MB 1P4HA 3DLHA 3DOJA 1C8LA 5LXTA 3E9QA 4MSUA 1JBQA 5GVSA 2QZAA 2A5UA 4I4LA 2AFVA 4HDAA 4NQ0A 4LA4A 4DMLA 1G8AA 2AXNA 3TG5A 1AG9A 3TNLA 4XWOA 5FOWA 2QJWA 5C80A 1D7OA 2VK8A 4NXNB 2X9GA 1CYDA 1Z5SC 2C2MA 1RNLA 1FVOA 1KI8A 3DKRA 3LGXA 5B64A 2VDMB 1HE4A 4UZSA 5LLSA 4BC1A 1HG5A 3VZBA 1YQTA 3BCHA 5ITZB 2Z6QA 1M5RA 4CKBA 3X1MA 1K7EB 3F98A 3W9YA 5HZMA 4HADA 1NASA 1DEOA 4NK4A 5D00A 5HMLA 1Z15A 1JU3A 3I5AA 3M6MD 4M98A 3TZEA 5JJIA 2KCKA 3RSLA 1QYRA 1Y8QA 4YRGA 1N78A 1GILA 3GUCA 2GRUA 4YUAA 1JFSA 4CFZA 4KFCA 2ZB3A 1Y3HA 3U3XA 4ZU1X 2PL5A 1RMTA 3IKLA 2PMCA 4RGQA 1K08A 2VNKA 3GH1A 4DNPA 4A23A 3PFIA 1VLQA 2I34A 4H0NA 5JRDS 5FTJA 5BP7A 4KR9A 1BXKA 4AUNA 4XFJA 4Q34A 1RYEA 1UP4A 4S05A 1QVAA 1E2MA 4LRWA 3TR6A 4CCAA 1JPVA 4HS9A 5ESRA 3S70A 1WIWA 2MWMA 2XMBA 4XVCA 1ZM3A 1P60A 2IY7A 3A3OA 4Y1RA 1QANA 3KSLA 3WMGA 3BYZA 1P2DA 2IIQA 4R9VA 5G4KB 3MJFA 3CKMA 3A37A 2V7GA 1N4QA 3AIMA 2JBAB 1QC5B 4MV8A 2HLDD 5AVUA 2AZDA 1IY0A 1F9AA 5K8CA 3CW8X 3EXAA 3TLBA 3FIUA 2H17A 2O20A 4L4XA 1N0IA 2AFIA 4ZCSA 3OTHA 4WASA 1H8EA 1N8KA 3FUJA 4ZI2A 2HMUA 4B3FX 2YOHA 4X44A 3ZQ4A 3ROMA 3S4YA 3RO7A 3UWKA 1LCIA 1I01A 3S7ZA 4JAVC 2XNDD 3DZBA 3VVMA 4F12A 2VDWB 3VSEA 2GCEA 3RO3A 4WAUA 5KDOA 1GGFA 1XRPA 4LJ9A 2IT1A 2GZHA 3E9DA 4QXRA 3M83A 2DUMA 1MN6A 1JIQA 3GZ4A 4TT8A 1PSZA 3A1WA 1NMQA 3K8ZA 4MI6A 4E2XA 2OAGA 1DEXA 2AOUB 3T38A 4RZXA 5DRYA 1ZINA 3WKBA 5D86A 5FFNA 4WDQA 3FA2A 4XWGA 2GRPB 3W5CA 4E70A 2J1LA 4EZKA 4AOFA 1OIVA 2W2XA 1G7SA 4PICA 1ECPA 3HP1A 1CUJA 5AK0A 5C5CA 1FS5A 4OGWA 2W2OA 4F38A 3OEHA 1NPTO 1RI2A 4LK2A 2XJ9A 4OXYA 1TVKA 4CGYA 4GP9A 1GARA 4GYWA 1H0RA 1K2WA 4HNSA 1XPRA 3FPBA 2FFGA 1DBWA 1JEYA 2C5GA 5FLEX 2Y1GA 1Q19A 1T3LA 4EL0A 4DDHA 3AILA 3S2YA 2CUNA 4PLYA 8ADHA 4I6EA 1NXVA 4GGOA 2FJDB 1PQ4A 1WSWA 3CJQA 2YS6A 3HPRA 3TLXA 5AICA 1P62B 1QVVA 4GZDA 2HSZA 4O3FA 4BVEA 4DA7A 1JECA 3ZKWA 4I5GA 4ZRMA 1YC5A 4WK6A 2CY0A 1HRDA 4TYYA 5KBAA 3HUDA 1E5TA 1GUZA 2CBZA 5K6AC 2CK3D 4P7BA 1NXQA 5E6RA 4E51A 3FCXA 4LJ5A 5EXXA 4R0MA 1ORHA 3L0YA 1P6QA 3JX9A 4CKCB 1ZQ1A 4DANA 4S1PA 1K5GA 1EINA 1XRMA 3DKVA 1SD2A 5TDHA 1HMPA 1PR6A 3TZHA 4O2AA 4ZYVA 2VBGA 2WHXA 5GV7A 1W0JA 4IDQA 2GRQB 3K94A 5BURA 2G5TA 1P6UA 3JTMA 3F3SA 3TZBA 4A0FA 4GIBA 3SIXA 2QMYA 2RI6A 3SP1A 5DM70 4RHYA 4IJWA 4FSXA 3K0FB 1X4RA 3EFEA 2NSYA 2Q3CA 2VZLA 2G25A 1SVSA 3Q41A 4Z4GA 1ZNWA 2XTAA 3TXNA 1XD8A 2QL6A 3AZQA 1E0JA 4RD0A 4UU7A 3VR5H 4TLLB 1SD1A 1XYVA 3GJRA 2P1ZA 4AJHA 5C32A 3ZJUA 2FZGA 4DG9A 2AG0A 3SVZA 5JJTA 4IIDA 3BHIA 8LDHA 4RELA 3AEZA 1X39A 1TIKA 2PMDA 2H18A 3BA1A 5BYKA 3Q9NC 5B1DA 4F71A 3LI2A 4OUKX 3R9XA 2EKDA 3PHIA 3RSQA 1YI1A 1J24A 4QYWA 5JSHA 2HNKA 2XZTG 2WJIA 3DEAA 2C2XA 3WHIA 1VPVA 5GM2A 1I9GA 1GTVA 3MGCA 1DELA 4JU9A 4WJLA 1IMOA 2EEZA 2YXPX 3ADCA 3RVJA 3SFYA 4IFEA 4JUCA 5JCOC 2F00A 4RAOA 4L9WA 4TRNA 3H19A 1E9VA 2DR0A 5EYPF 1DV2A 3S1LA 4AROA 4M0LA 2AQHA 1KAOA 2OQVA 1CEEA 2X9NA 1FBNA 2IHJA 4L5BA 2C7GA 2H57A 3RYFA 1G8FA 3IOBA 2FWMX 4NEQA 3TI7A 2NPFA 2ZBDA 2R751 2GAFA 3KYJB 3EZ2A 4FIZA 1ZMRA 4X7MA 4FNGA 4Z54A 1Y5MA 3WLJA 4EO7A 4Z51A 2OC9A 3B48A 3R9MA 3VSCA 2DUNA 1Q83A 3JW8A 4IO1A 1F9EA 4IEEA 3S55A 4Q4HA 1CY4A 1AKWA 1JIJA 2VHZA 4RVUA 3G6WA 3AESB 3E8SA 1T24A 2XEDA 4XX0B 3L16A 1ZWKA 4CEHB 2QR3A 2HY7A 5FD8A 1OUVA 4URUR 1ST2A 1A71A 2AKYA 3CO5A 3QMMA 5EIDA 4US1R 4MYUA 1OYWA 1TJ4A 1C81A 4I46A 3E0QA 4X9XA 4GBED 1DC7A 4V24A 3WXBA 3CLKA 2H6IA 1BEEA 3G2PA 2X8AA 2B98A 1T10A 4N5NA 4ANVA 2GZMA 4Q7MB 1GV0A 4PS3A 2ZVPX 4GMLA 3TL6A 3LZCA 2RH5A 5BW5A 5LU8A 4HXGA 1M2NA 1VJDA 1XMQB 5FBHA 3VKHA 5HIJA 5M7EA 2REOA 3A4NA 3L7NA 1PEDA 3K31A 1CZRA 4NABA 3D1VA 4KR3A 3ZDZB 4BT8A 3UQ3A 2AFHA 4J0EA 3EAQA 2HHLA 1IN4A 3IVGA 2PK3A 4I1IA 4QLBA 2FPIA 5DPMA 1OB5A 3J81k 1RJEA 1DLIA 3THYA 3OD1A 3B6EA 3NEPX 3GNQA 2GNAA 3CISA 4N5IX 3M81A 1YASA 4ZU6X 2R7MA 3BIJA 1ORRA 2ISCA 1NT4A 3EPKA 1XX6A 4UNIA 4FJYA 1PWZA 4LBYA 1CY1A 1NRWA 4IJMA 3ZH2A 3TXAA 4HV4A 3C97A 4O33A 2GD2A 3FF1A 4KYIB 4CTOA 4HATA 2JFQA 5JZOA 4TRMA 5JHBA 1H6AA 3KVOA 1SQGA 1MXHA 2IU0A 3B1YA 4JGIA 3VR3D 2GR9A 4UYKA 4J9VA 4IV0A 3WDKA 4HZUB 3UK1A 3MJHA 2C4WA 5DLEA 4YDEA 2JEOA 3WAJA 1FX0A 4L02A 1SVNA 2VT2A 2PRYA 3CZCA 3KR2A 2N75A 3RLFA 4DMFA 1ZNYA 1H05A 3FOAA 3QXJA 4UDNA 3TE7A 1TJCA 3JQDA 3T41A 3LTEA 3R41A 4MVJH 2WIBA 4WZBA 4E5KA 2G1PA 1UMCB 3C8DA 1A1SA 5IC6A 1QHHA 1SCBA 4GGMX 2O8VA 2P30A 4PG8A 4C3VA 2H0QA 3EPHA 1FP4A 1U2GA 3NBNB 3CM0A 3DFFA 4X71A 3EXHB 3R4CA 2WF6A 1TNOA 2Y66A 1PX2A 4Y2JA 3ND5A 4DC0A 4X97A 3B89A 1XNFA 1FCHA 1BYIA 1JLMA 3W5HA 2YJZA 4Y6RA 2ZJ6A 3AUFA 2JJQA 1V8FA 1Z4IA 3ADOA 4B0OA 4Y2RA 1U3VA 2IYOA 3RIMA 3JSAA 3QF4B 4FYWA 2XOKA 3IR6A 3RUFA 2O07A 1M0TA 4RD2A 4XJSA 5GVRA 3LHDA 1RRFA 2A9KA 1WRBA 4WCVA 2BAGA 5YASA 1TUBB 3IRUA 3BREA 3V4PB 3TAXA 3VCXA 3ZHVA 4E85A 3H2HA 4W5TA 4FFVA 4JD5A 1GT6A 3V7YA 3UT5A 4I4CA 4RSGA 4C6HA 3ELUA 5TMEA 1LA2A 5L7TA 4PC1A 1NQAO 3NKVA 2QRVA 2VYVA 2VF8A 4OJTA 2M6SA 2DT8A 4K6HA 3Q0TA 2O1EA 3UM9A 1IVNA 3ZYQA 4YRMA 1DAEA 2PUWA 3MYRA 2ZJ3A 1RKXA 3F5MA 2EBHX 2PQRA 1ODIA 4UYJA 5CUQA 5B1BE 3C1UA 3IKTA 4J8DA 4LDRA 2R7LA 5F2NA 1UFOA 3ZDCA 1GWNA 4DBZA 5D3MA 3HJBA 5EE5B 5CDSA 4DHEA 1KH1A 3NHSA 3UJCA 1XHEA 1ADCA 3M3PA 4ND8B 5KTNA 3KZXA 3EHQA 4CL0A 2VDLB 3H6KA 5F52A 1ENZA 3VDXA 1ZM4A 4CIYA 5JS8A 3K71B 4NU8X 2C92A 2XMPA 3Q2KA 4OB8A 2W2LA 3EMKA 3X0DA 3VI4B 1RC0A 1UUFA 5CH8A 4HDQB 2GF9A 3O74A 3J81A 3QU4A 4EITA 4O4LB 5BYBA 5FB3A 3ZGNA 2HK7A 4INZA 4CQNA 4KVGA 5DISB 2V4ZA 3B7RL 4JHLA 2X8JB 3JD3A 2F43B 3ED1A 4CF6A 5JOQA 2IRWA 3EODA 1SUCA 3DQPA 1XRQA 4KQKA 2AG5A 3GA5A 1GG2A 2PLAA 4YAOA 3NHZA 5ALFA 4YALA 5EXDA 5HOQA 2HOQA 3ABOB 2QSYA 2V74B 1DX6A 3QPWA 4BMNA 2HHJA 2P6PA 2PUEA 3CWQA 3WJ7A 3O1JC 2P62A 1EZ1A 3DEJA 4ANUA 4P53A 3D7MA 3DLAA 4I1AA 2BGRA 4U63A 5FBZA 3WY9A 2J41A 1BLXB 1QQBA 4GPIB 3I5UA 2N3ZA 1Z0DA 1OZAA 4LIPD 1BD3A 4NJMA 1YZUA 4RYDA 2PLRA 3PR2B 4KQMA 2YS7A 3ZWXA 3RKUA 3WLEA 2GPNA 3K70D 2EW2A 1OBOA 5TGDA 2W2PA 4JDUA 2Y6VA 1EI9A 3B36A 2BY4A 3BWYA 4YXWA 4F6LA 3BEOA 4H16A 4DA6A 1D9ZA 5FHQA 5ADHA 4NLLA 3I09A 1LBQA 3TRIA 4KVAA 4IHJF 2JLCA 5KTTA 4PFQA 3GU3A 4FOSA 1Y3IA 3KHKA 1W52X 4YYEA 1DFGA 1E89A 2UY1A 1O6ZA 3BWDD 1XHFA 1AH2A 5JYCA 1AUQA 2XSZA 4M6WB 5I3CA 1FLAA 1FNBA 2PBRA 4IXWA 4Z0HO 4TUMA 3ULQA 4YLEA 2YIJA 4WKGA 4E1BA 3S2AA 2ZITA 3NJRA 1MB9A 4MQEA 3OCZA 2ODWA 4FHZA 5EX3A 1T1SA 3GDHA 3VR5D 3CX7A 3LC2O 2GZ2A 2PKWA 3FBTA 4LHVA 4COKA 3DAOA 3I5YA 1GPBA 3SHTA 4L6IA 2P2GA 4B3IA 1A9XA 5IBCA 4U95D 1N6RA 5DLDA 4KB5A 4DI3A 1SWWA 5CFRA 2HJ9A 4EO4A 4ALJA 1EP9A 3KOYA 2BBWA 4HMQA 2PEYA 1SBTA 3IQXA 3C6BA 3AFMA 5DO9A 4I66A 1QHFA 4N6NA 1L8LA 4ZAVA 1EVYA 2OFOA 3DLPX 3X1YA 2W0MA 1N0VC 1RYYA 1Y1TA 2W83A 2PL9A 4LVOA 3P52A 3A2LA 2NP6A 4OSEA 4MKGA 2G7ZA 3L9XA 1U5BB 1IBCA 2QZPA 5EP3A 2P9IG 3UJ9A 1BRTA 3X1KA 1ZSNA 1SXIA 3D9KA 2OK8A 2CYAA 3WYBA 1QBKC 1TNZA 2BTQB 3IP1A 1M0WA 4DYHA 5KSYA 4BECA 4D02A 2XNKA 3VDNB 4JEMA 3LQYA 4KDRA 1G98A 4OK6A 1B42A 1LI7A 2GRAA 1T8TA 5CHEE 4YAWA 4CGVA 1YCDA 4N5QA 2B1JA 3ON5A 2V7VA 1PJSA 2II6A 3SY8A 1SELA 3LO5A 5JARA 3GCWA 4CF4A 6PFKA 4HH3C 3OO0A 3DBHB 3G0CA 5CYGA 2C7RA 3KOXA 3E9CA 1XD2B 3P71T 2ZQYA 4INOA 1HSZA 4EHHA 3QEAZ 2WV9A 3Q75A 4L5AA 1JVBA 2NTVA 4G97A 5E7JA 1MW8X 5HBRA 1MHTA 5AKYA 2E87A 1SZAA 1WQ3A 2GKSA 5CBPA 5IPFA 5J2UF 2FSVC 2HUNA 2Q99A 3RFCA 3QVJA 1N2BA 2ZYAA 1SUAA 1HDYA 1QH8B 2H54A 3LAWA 4BASA 3N8IA 1DXHA 2R4UA 4Z3DA 2PRKA 3QI7A 3MV2B 2WG1A 5IM5A 4YJKA 5K3FB 4CF3A 1KZ4A 3AOGA 4GEKA 3LUPA 4H1TA 1FNCA 2GYWA 1U1IA 4ILIA 1E5XA 1X7GA 2VGXA 1T6NA 3GBPA 2HA5A 2CUZA 2FAXA 3FKJA 3DWIA 2YMPA 5EY5B 4OGKA 1V6AA 1Y4AE 5C8DA 4CEIA 1JEJA 1Z0KA 4L72A 2OL4A 4YLYA 3W3AH 1CERA 1C1DB 4JI5B 2ECKA 4QYIA 3W0LB 3KTAA 5J47A 4BN4A 2O2DA 4BFXA 2G77B 4GSLA 1T35A 5AUOB 3OTIA 3D7LA 1NVVQ 3FDZA 3UFXA 5DVZA 1DE0A 5EIXA 3A9VA 4KC0A 2VEOA 3SC4A 3EB9A 5AHKA 2BF0X 2VEDA 3V55A 2L19A 4IJQA 1DKLA 2LRHA 2FF5A 2P9FA 4DUGD 5KNBA 4DCTA 3RRNB 2DKOA 5T4FA 1KYTA 3KKQA 2A7QA 1QQ5A 4AK9A 1CR6A 1Q1GA 4PLWA 5EIHA 3JWEA 4JLMA 1TZJA 5FI0B 2CV1A 4NONA 4ENWA 3O95A 3BXZA 3L22A 4L4RA 3MS2A 1XTPA 2BLNA 5EPUA 4IKOA 1Y6RA 2CV2A 3CRQA 4GTSA 4C4RA 3BFKA 3IUNA 4NU6A 3DNPA 4GOMD 4BNTA 3UJHA 1WXDA 4US0R 2Z8YM 4TMTA 1JXAA 4UI9C 5L7YA 1JIXA 4COOA 4AIRA 4NFSA 1RBQA 3EUWA 2GD1O 1Y4UA 4CL2A 2R1TA 1Y37A 4ZI7B 4E15A 3QFCA 3T3OA 2W6IA 2IHZA 2J3JA 3PG5A 1CR2A 2ATXA 5M04A 2YWEA 1SIUA 2VNSA 4DQLA 3B2NA 3L8FA 3MHPA 4MVJD 5I7RA 1MH9A 4YUYA 2QPOA 4FPXA 5I9BA 5A4JA 3IURA 1Z2CA 3NDPA 3AVQA 1I3LA 5IT4A 5D6NA 1WHSB 1EGQA 5BXUA 3PNOA 3TW0A 2V8BA 4BMOB 2RAUA 3E48A 1SUSA 2BFCA 3O9MA 2X6TA 2CXHA 4XTCS 5H80A 3KG2A 4WZ6A 2XOEA 1F6DA 4F1JA 2O54A 1X7DA 1PT8A 1RAAA 3M89A 1E2FA 2GA8A 2HLNA 4Q9IA 4UHCA 1O97D 3H2IA 5KI6A 1NOJA 3K9GA 2PSHA 4KRYA 3NVAA 4IDEA 3DVLA 4OLAA 3CNLA 5KNGA 2NSHA 3OEWA 4MQFB 1QU2A 2Q2QA 1DC3A 4L07A 1BVYF 2ONKA 4ZT6A 4ZYYA 4DLQA 3TLMA 4NPAA 2QY7A 4NS4A 4F1PA 1K66A 2VDPB 3K05A 2WHPA 3BRWD 2A9OA 3TU3B 3AS4A 1I7QB 2OM2A 1EQUA 1CY2A 1J0CA 4W5HA 2V0PA 2TMGA 3LP6A 5CB4F 1TX4B 2PBZA 3C6KA 2AG6A 1P7CA 2Z5GA 4PINA 3CH7A 4KQCA 4EAAA 4AYWA 3DVAB 1QF9A 1KSGA 2A9RA 2J67A 3L5KA 5KYWB 4L8GA 1XQ9A 1JEOA 4PTZA 1GXSB 4B1FA 2CHGA 1GGMA 1P31A 3PFBA 3F47A 2JAOA 1JDBC 1Y98A 4FN4A 5MN6A 3D2CA 1FFXB 3W2GA 2HJHA 3A9SA 3OF2A 5HQJA 5KUTA 5TXGA 4CMJA 4I1RA 5ENNA 1UDBA 3TYXA 3GFOA 5HIIA 1UKVY 4JS0A 3HXFA 5F76A 4NESA 3S81A 1W4RA 4G0YA 4CR8A 4J8SA 2NPOA 2WEKA 3ILHA 4L6AA 3KU4A 4J2HA 3C3PA 1NKSA 4IGIA 5FYQA 3IT3A 1PNVA 4F21A 1GL6A 4IULA 1Z74A 2GDJA 3ER8A 1UPAA 4RM2A 2QRHA 4EEKA 4YC7A 3P0JA 1R3DA 4G6ZA 3LVRE 2GTHA 2AMYA 4PIPA 3TIIA 4UE3S 3DE0X 3H6GA 3SHQA 2QKYA 3L6DA 5JS7A 4DLOA 4CM4A 1A8HA 5F7JA 3OTGA 4GOND 3LZDA 3AOEC 2UWJG 1ZWLA 3G2HA 2Q4DA 3N7TA 1T8UA 3JATA 4H7HA 1G21A 2I0FA 3UXMA 3LUKA 3FMOB 2PZFA 2O4CA 3AP1A 1F6WA 2X13A 2YRWA 1BD8A 4GXNA 2PZIA 2JK0A 1H1TA 3FUFA 4OAQA 5H8WA 3M5CA 3D0QA 3CX6A 4UD6A 1KMCA 4KH0A 4R8SA 3LP5A 3TG4A 2XNCA 3CHMA 3LWZA 4W5JA 3NTUA 1CIVA 3QWIA 3JRWA 3DV9A 4P35A 3EGXB 1HFWA 1FTQA 1Y6IA 3MWFA 4PFSA 1YZKA 4A27A 3GK3A 4WUTA 4YUXA 2EIHA 4EPWA 3KLPX 3ROEA 3QBVA 2DPYA 2YASA 1LSUA 1WM5A 3NT4A 1BDHA 4NZMA 1FVXA 1UN9A 4DIOA 4X6YA 3NF1A 1CQIA 4EB8A 4R8LA 4TV9A 3UCEA 2QXTA 4LHWA 4EG7A 1GSOA 1JL3A 5ES3A 3LF2A 4ANXA 1ZHFA 3B5JA 1FP6A 4MGIR 2Y05A 2GOYA 1ZKDA 3WHLA 5IP5A 1X7XA 3FTVA 3UV6A 4EBBA 2JGAA 2HV9A 1NM5C 1LWOA 4EG8A 2ZPUA 1RWQA 3I64A 4JOBA 5TJ9A 2XF2A 4DCNA 4KWEA 1J0BA 2ZWPA 4MZXA 5KJEA 1R2QA 2WWWA 3ICEA 4HGNA 4BFWA 2G9QA 3T5GA 2PV0A 3MTGA 3WAKA 4FMCF 4H7PA 1FQOA 2ZT6A 1DXYA 3FVWA 1LUAA 4XLTA 3Q9UC 2HNAA 3SVLA 5AW8A 3FPCA 1HH4A 1A7UA 2UYYA 3RU0A 2Q5FA 2X40A 2RAPA 2YYZA 2J9ZB 1XMOB 4JJ7A 2QP3A 1BE8A 4EJSC 1G3RA 2YRFA 2PH7A 1GW6A 4HFMA 4KEAA 5IF3A 1B14A 1SVKA 2OUIA 3D5TA 1I3KA 4PQGA 3OOHA 4EZEA 1ZXXA 1TPYA 4GM0A 2WKRA 5JZ9A 4D4MA 3D1LA 4UMEA 1E8DA 3ZWQA 2RHGB 1GADO 2EDCA 4ANWA 2GN4A 2G9RA 4LWQA 1NI1A 2VF5X 4QJ3A 5JDCC 1NX6A 1TF2A 5J4HA 3AL2A 3AR6A 3JWJA 4JYMA 2X9QA 1BD4A 3BN3A 4WECA 2WIJA 621PA 3ECSA 1KFBB 3FYCA 4P4NA 1NKVA 4G1TA 2DQ4A 5DM2A 3FPEA 2GTIA 3LQ2A 4UHFA 3K09C 4CV1A 3CIAA 5BMVF 1Z8DA 4QL3A 3QBTA 2VJ8A 4NENA 4OHFA 1WXXA 4PU0A 3I37X 2QIOA 4YWHA 1M1UA 4FZJA 4U96D 3L4BC 3KEOA 4GFDA 4H08A 1NT2A 4TT3A 4A91A 4Q7QA 2CLHB 2B0JA 1PG5A 3GYGA 4L0CA 4TWZA 3KPJA 5K3SA 1VYTA 3BJIC 2BEUB 3B9QA 3WFZA 2R02A 4ZICA 1WXEA 2Q9UA 4ZMBA 5CGQB 3R9KA 4PNHA 2WFLB 3QKRA 5A5DA 4DSOA 3U7HB 1MOQA 1AUPA 2P6MA 4FZVA 5ED0A 4KPUA 2WJPA 3O03A 3OE1A 1USVA 3O0TA 4CT5A 4PCVA 4TTVA 2J33A 3AU8A 3A3KA 2YY6A 4CM8B 1Y7HA 1D4FA 1KJNA 3AHCA 3G7NA 1YFZA 1TFRA 4E5DA 1XNQB 1HGXA 2VTDA 3DAYA 3EHRA 4OI0A 4XFKA 4PBSA 4GMDA 3DE4X 3WRYA 4YUWA 3UAYA 4XI9A 3EFOA 2CF6A 5JSUA 2EZUA 2DYKA 1SVMA 1DC2A 3VV2A 3MQFA 3W3AD 3Q7RA 1G66A 1II9A 5A4KA 1YXMA 1DQPA 4E13A 5I8WA 4HY3A 2FF7A 2Q1UA 5HS4A 1GSHA 1H1DA 1KMQA 1AS0A 5CMYA 4YLGA 1DZIA 2J0EA 3UUWA 2J49A 1KQNA 3L2OB 3RE1A 2X5KO 1HNWB 2OWEA 5HWSA 2NO1A 2IU4A 1JFFA 1YE5A 3LXRA 2GPWA 3IAM6 3TLKA 3IHYA 3LSTA 2AG1A 3TMKA 2ZYTX 5JSFA 3AUTA 5A6SA 3J80A 1GGVA 3DL4A 5IC4A 3CQCB 2EIKE 3H2ZA 3UIPC 4C1NA 1JUDA 4N2SA 4GI7A 3K8OE 1S64A 3PJFA 3DKPA 2BGKA 1VGQA 2EWWA 2RB5A 1RABA 3RYHA 4E4YA 1JMVA 3DJFA 4GWKA 4Q7KA 4A0RA 1F7VA 1RQLA 5J2TF 1YYHA 3R8XA 4TPKA 5TSDA 2RSFA 4NPHA 3W6NA 4M0EA 4AU1A 1ONSA 4BP9A 5JQGF 3AZPA 4KOAA 2PZLA 4F91B 1QG6A 3WNZA 2QNBA 1ZOLA 2YWBA 4MQ6A 5AMXA 5DB4A 4OHYA 4OMDA 4D92A 5REQA 1F14A 3ZHCA 3ZU4A 4O2BF 4HZGA 1MG0A 5H83A 1E4YA 2BFDB 4MVYA 1C7IA 7MHTA 3AW9A 3QJZA 2X3UA 2ZRDA 4J0DA 4J03A 1H2VC 3RRUA 1S9DA 2J0UA 3AVTA 5ECDA 4F7WA 5E4YA 3D64A 5HP4A 4ZEWA 3MCWA 3U9SA 2D0OB 1N4DA 1NMEA 2D1QA 3ONLA 3GP5A 3IIIA 1G42A 1IATA 1NJ5A 4G8CA 2NZWA 2B9VA 1N9GA 4Z6KA 3GEGA 2P5TB 3U3MA 2OE2A 4RTNA 1HEIA 2OCYC 4DRZA 4BFTA 4LCEA 3IMGA 2FQ1A 2FV8A 3HVKA 5FWNA 4F4DA 2ZQ5A 1UDRA 2ZBGA 5K8UA 2AZTA 4B74A 3BXPA 4FGJA 3G5MA 5EMMA 4AJ1A 3KZNA 3T1HB 3IO3A 3TLZA 3ZKJA 1QAQA 2X1VA 5EERA 4U0JA 1E6CA 3ZHQA 5K4HA 5COBA 1NYTA 2BHRA 3F6BX 1ESDA 2IZ6A 3EYWA 4ICIA 5BY2A 4ZT7A 4DRXB 4PG6A 4HAVA 1N2GA 2I1WA 2Z43A 4UHDA 4PCLA 1T0IA 2VT7A 2EZ4A 4IIXA 5KMGB 3HI4A 2PLNA 3TWTA 2JF0A 5DYNA 2E55A 1J0AA 2ZPAA 3PGMA 2IDJA 3T9FA 2AQKA 2X5GA 2XE8A 4BVKA 1MJNA 4A63B 4G1FA 3TIXB 1UW4B 3TF5A 3QLTA 4PLPA 1VDYA 2XUJA 3FVQA 2XUKA 4DZRA 4TV8A 4HVLA 1P91A 2VP3A 4AFNA 3GF4A 5IU6A 3A1SA 3QWPA 1IEVA 1EZ4A 5F33A 3VH4A 2OZLA 3N8DA 1LBIA 2JLVA 4RK6A 4XXHA 2F17A 1Z5UA 2WTUA 4ER6A 1U2DA 1KMHA 2BD0A 1K4KA 1QIHA 1O5OA 1OUMA 1ETUA 3OE7D 3LPLA 3UHJA 4IGAA 2HRDA 4L23A 3QLUA 3PH0C 3C3JA 4RS3A 3YASA 4TWJA 2JJYA 4HORA 4WOKA 2RHDA 2DQYA 5LYJA 1KZOA 5HCIA 4X6UA 1DO0A 3AGPA 3GLUA 2QX4A 5E9AA 1GRQA 3ORRA 3ZXIA 3GLGE 1E5VA 1N11A 1F0KA 3B6JA 3KWMA 5FO1A 4RACA 1TK2A 4LYEA 1GPLA 3K6SA 4RVBA 3NIDB 4IVRA 1LPBB 2X5XA 4QASA 3A2NA 1P81A 4HD8A 4IOKA 1YKGA 4A4DA 5K0NA 4TWAA 5KJ1A 3OXFA 3MA5A 2H9IA 2BI8A 2WYHA 3GY0A 1JWGA 3N05A 4KYOB 4IDAA 1E1CB 3TKAA 4GPKA 4P0PB 3T9DA 3LY9A 5TY0A 1QYWA 4DDWA 2OVBA 4G8BA 3FFAA 1DSSG 1MV5A 2CYCA 2FPWA 1SVIA 4JELA 1SR8A 3TQTA 2GBPA 5BSGA 2QBYA 4EY5A 3T7KA 4HWKA 4OU4A 5ILOA 4NMMA 4CQLB 3W5VA 3OCYA 3LPAA 2RHLA 4EJMA 1WXHA 1T2AA 4DM3A 1UZAA 4CU2A 4HPXB 3NBFA 5EWLB 4M0CA 3LDZA 1AXRA 4QGSA 3CR3C 1MHPA 3EA5A 5G0UA 4MPRA 1MENA 4CIBA 1UXOA 2RDMA 3RJVA 1POWA 4FGWA 3M4ZA 2YJ6A 2F0YA 4LXYA 1JDSA 5CVDA 1D2NA 3KE9A 4WZAA 4X7RA 3KTFA 3P9PA 4BAUA 2KJZA 2QVBA 1NLZA 2WM8A 3ZHEB 2XQFA 4QBGB 2WM9B 1FXWF 2XTNA 3A8TA 1W85A 4B87A 2DJIA 4NMWA 3A7DA 4GZCA 1ISRA 2Q0SA 4Y6GB 2C4VA 4PCAA 1IHDA 5CGZA 4JI0B 4R71A 3BILA 1YCFA 4MWBA 1U8AA 2IVFA 2HPVA 1KMMA 4B2IA 1ZW1A 1PFGA 2ZJYA 4G0NA 4N0DA 3UY4A 2M6RA 1Q0UA 3HR7A 2C8LA 4RV9A 3OZSA 4P80A 2GEDA 4Q1CA 1U8EA 3TWOA 4C07A 3OM1A 4L8VA 3D8HA 2IY8A 2AOTA 3ISMC 1NU8A 4MRUA 2HQ1A 2WVJA 1Z3XA 2WXFA 3M2TA 1ZONA 2ZRAA 4K81B 2XNSA 3GVXA 2GROB 1P2UA 1IPEA 1ADYA 4JBNA 4JB8A 1K3ZD 3WWCA 1Z3YA 3BMCB 1ZSVA 3WQSB 4TVSA 3GZNA 2ZXEA 2VR1A 1OWOA 4M46A 4C2TA 3GJZA 4UHHA 2X58A 3CNBA 4NH4A 4BFUA 4AY3A 1U1CA 3HA2A 1N36B 4PZ0A 5LDHA 3D8TA 2H6FA 1FRVA 5GWXA 3VHXA 3F4LA 1CWUA 3ANTA 3WNQA 2ZKLA 4K6CA 4EDFA 2IE8A 3CW2A 2QTZA 3HADA 4YMIA 4DMKA 1FFEA 4JHJA 3KT3A 4CDMA 3KAKA 3WVNA 1GQSA 4WCFB 3LJKA 1UJ6A 3KWJA 1TJ5A 3NCHA 2BKEA 4OLHA 1XRRA 2DWOA 4B4OA 4AY2A 5IF9A 2PT7A 3KJHA 1NF8A 1TQHA 2F48A 2JZCA 1X86B 1OLOA 3BQMB 2ILVA 2BPOA 4JR0A 1RDFA 1WZEA 4ACKA 3DA8A 4XIGS 4U7WA 2WJZB 1OWLA 4ZYUA 3IAAA 4MWCA 3I3NA 5EEGA 3KXIA 1XZEA 1NNEA 3LKZA 2O6LA 3MUFA 3EF3A 3OLXA 3QX9A 2VDVE 3ZV7A 1XCJA 3RRZA 1K68A 5JJ7A 1BFKA 4HUQB 4KJXA 3V31A 1JAHA 3SE7A 3RBAA 2W4QA 3L82B 5I4IA 2WXLA 5FL7D 5CFPA 3ZHBA 4NF2A 3GGPA 1QIIA 4DRYA 4MS1A 3QF7A 3VOSA 2DFLA 1AO0A 3GPDG 4J4BA 5IEJA 3AVOA 4L0DA 5LBIA 2IYYA 1JALA 1JCSA 3DEIA 3ZWKA 2KSQA 4PIVA 3KOOA 2Q1TA 3UB2A 4X1YB 5AW5A 3A10A 1DFHA 3VR6A 2I1KA 4DT1B 4BC0A 3QBDA 4GH5A 4RIEA 3ML8A 1H4TA 3SQLA 5EYPB 2OP1A 1NUPA 1QLJA 5CA1A 3LWBA 3I2GA 5F9HA 1WPQA 1OWPA 3KQOA 4Q24A 2FHPA 3ZYCA 2G36A 4Z4IA 4EK9A 2ZBFA 1JSXA 2HW8A 1EFHA 3BS4A 1MRSA 3A1NA 2P41A 3M1IA 3H9EO 5BQOA 3ZN3A 4YRZA 2VDJA 3JQ7B 2HBQA 4UTOA 3IQZA 1T8PA 2ZR8A 4P3YA 4IYPA 4PYQA 2VQ3A 5KOIA 2G9VA 2WYOA 5AQ1A 3NM5A 1Q0TA 2MYNA 5AM2A 4YRBA 1DRUA 1QWOA 3IPXA 4CKWA 3V2OA 2INGX 1DDOA 3AXTA 1KEPA 1DCQA 5KC8A 4C4AA 1GZ5A 4YTEA 4RY2A 2F67A 4C3UA 4EGSA 2IS1A 4LUCA 3Q3HA 4G2VA 3PDUA 3ZEAA 3E5HA 2A5DA 2V7EA 4JA0A 3R7WB 1UJNA 1NFQA 1UDWA 3DBLB 4EW6A 2NYUA 3MNFA 1YRAA 2CBGA 9ABPA 4CCSA 4EKEA 1ORIA 5LQUA 5ALMA 3G85A 3ZU3A 2AUTA 3C45A 1NKTA 1M1ZA 3X43A 1LI5A 5FOSA 4BKRA 1HDXA 2FUNB 5F1KA 4OA8A 4B76A 1FFCA 4ZYZA 1CY7A 3B7SA 1E2PA 2G04A 4GP6A 3NB0A 4LJRA 2Q28A 3TRDA 2XQ0A 4AUEA 3OA0A 4EFDA 1V1JA 1Y9JA 2FN4A 3TTTA 5HFNA 2V1XA 3DBSA 1XZHA 2VWHA 2YXDA 4PG4A 1SU8A 1ZD1A 4IJ5A 3P9NA 4R6WA 3JUEA 4NBNA 4DCPA 4U7HA 4JI2B 1RLUA 2FW6A 2DQZA 2P78A 1NQ5A 2C4HA 4NMXB 1Y3AA 2W2VA 4WY8A 2VSOA 4PXSA 4GMRA 1K06A 4U2BA 5ECGC 2CNLA 1IE3A 5LDGA 4HF7A 1XI2A 3SSAA 3O94A 2ETAA 5ALNA 4YRIA 4M8LA 4QYMA 4WTOA 5EP4A 4UBOA 1KY2A 4Q03A 4OXNA 3QSYA 3E22B 1OBFO 3DXMG 1XJQA 1A5SB 3TAUA 1G8YA 1W5AA 1PS0A 3L1IA 4B4VA 3SKXA 2Q45A 2OB2A 2ZRCA 3T5VA 5ALHA 3DOOA 4LJ6A 1VXOA 1V43A 3K96A 1XTBA 1IEXA 4QDUA 1AKQA 1VIMA 2WIKA 1K7FB 4XYBA 1HM5A 1K5HA 2YN2A 2RHHA 5KTOA 3CWZA 5K6AA 2WUFA 4ZEMA 1L3IA 1SY7A 2WLSA 4BQRA 3O3OB 2IEAA 4M53A 3RJZA 5AOAA 1OB2A 3VSBA 2PXHA 4CM1A 4ZCIA 1YB2A 4ONEA 1QHEA 5BSVA 2B61A 1T9AA 3FPLA 1I0ZA 2CLDX 4Q6BA 1IXKA 1ILEA 2X6HA 1Z6XA 2B34A 2UZIR 3E5NA 4RFSA 4Y0VA 4KK3A 3R7NA 4AJWA 2EW1A 1XMVA 4UHKA 3B52X 1AN9A 2HHCA 3WG9A 1C80A 4LHXA 3UWMA 4H7XA 5E0OA 1S2MA 5F23A 2IYLD 1U3DA 4K9RA 9MHTA 3N8GA 1L7XA 1KE2A 4M1TA 1Z9BA 1AWCB 1E90A 1A7KA 3SK0A 2X38A 4G07A 1R9GA 3IJ5A 2GH1A 4P0TA 3WNVA 1CCWA 3WWYA 3FUNA 1IXZA 3OJOA 1G60A 2HIAA 1TNBA 1QO0A 3S8YA 4M22A 4PHGA 1OF1A 3K5PA 5AOXB 4OIFA 8AT1A 5C81A 4KP7A 2WSLA 3NIBA 2FUCA 3L43A 3Q9NA 2WF8A 1G5HA 2ALJA 4JEUA 1ILWA 1JG3A 4DNFA 2VHWA 3VNQA 5T6BA 2FWPA 3HXBA 3S29A 4EJ0A 1ZH2A 1FMLA 2ZRMA 1TQ6A 5U1PA 1VRVA 2EX4A 4AZ0A 1VCMA 3OLVA 3R6TA 3X1XA 5JCOA 1YMQA 1N8NA 2PKQO 3NHPA 3WZLA 3BTVA 5E7IA 3H1BA 2R6ZA 3VKGA 3LK7A 1B1AA 3HR4A 3JAWB 3RG8A 2A5LA 1J2UA 5ELMA 3FNHA 2V7XA 1KYYA 2MINA 4W5RA 1ZN2A 4QIHA 3OJ0A 4BLUA 1DP4A 5AW9A 2HU2A 1G3IA 4JT4A 2CJXA 3WLTA 4EKNB 2J4BA 3QV2A 4UQPA 4HL6A 1T29A 4BKQA 1E1DA 1SB9A 3I9FA 2Z6VA 5L53A 4OEHA 2QRZA 1KXZA 4QYSA 5DWDA 3ITEA 3DMHA 4QUGA 2XRYA 2V7UA 1M8GA 1J33A 4FOTA 4A2PA 2W6QA 2ZG6A 4MMZB 3RTCA 4NE7A 3RQIA 3ZI4A 1MX3A 2V59A 3AU5A 4TLEA 5AVKA 4OVKA 4JB8P 1SKMA 3H42B 3DLIA 3O82A 2DLCX 3DCJA 3IIJA 1KTVA 1EWKA 3SS9X 1M6YA 3WV4A 4XUGB 2FWJA 3K9HA 1YQ9A 2FTKE 1QX3A 1UC4B 1IG0A 1A9SA 3C3WA 3H1PA 4PQRA 4G0OA 1LZKA 1SG0A 3B9RA 1TNUA 1NXPA 3FMPB 1RPTA 1N1EA 1JFRA 3RGWS 3GRFA 1IZYA 3MFYA 1Q0LA 1GEGA 3F7OA 4WH0A 3HDJA 1Q1NA 1HMYA 2O5VA 4DARA 1IHGA 4DQDA 1WMEA 3HCDA 5DZSA 1TLTA 1SBIA 2PAFA 5AXAA 3RBXA 3R5FA 1VG9B 4F8EA 1P1FA 3L6RA 1SQMA 1HE8B 5C5IA 4KUHA 4YAUA 1CUUA 1WOYA 1MNAA 3CX3A 3K6JA 2QD5A 3LRTA 4YFYA 3IXMA 4U7EB 1P9OA 1KBZA 5KVAA 4N3CA 2C3YA 2O8CB 1MABA 2WWXA 4IHJB 2JC3A 1FJHA 3RSCA 2EFEB 3IODA 3L0DA 1OTXA 2WTNA 2OHVA 2NPIA 3U40A 4N8EA 4H4DA 2ZI6A 3ICOA 4XOUA 5GV8A 2WVHA 4MCAA 4JZYA 4Z3OA 4ZKDA 5AW0A 3ZJ4A 4IFIA 2FXIA 2OXTA 1YTLA 5BNIA 4YECA 3CEMA 4MUAA 3DPIA 2HMAA 1U3UA 1FFGA 3CW9A 5AW6A 1UPUA 4G5XA 1XTJA 1YCHA 3AFIA 5AR1A 4OXKA 5JIBA 4QPNA 1PZXA 2O57A 1B8UA 1HLGA 2PNFA 1FP1D 1MXFA 1G0OA 4JLPA 2D2FA 3M6IA 4H31A 2P90A 3JARA 1Y8ZA 2A59A 3KZMA 3R5JA 3PD1A 4JLAA 1E0SA 1EM8A 2OKGA 4A82A 1ONBA 5IANA 4OSOA 4MRNA 3AF2A 4YUZA 4O02B 5KYYA 4HVAA 3SFXA 4YJ3A 4YDYA 3UWOA 4LF5B 2J3QA 3G2WA 1VPTA 4UD2A 1YQDA 4HOQA 3K7EA 1R16A 5EQTA 3LYUA 1C30A 3QP9A 3U1VA 4F4HA 3KZ1E 3N5CA 4KX3A 5AKGA 1BMQA 4ZYLA 3WB2A 4BO2A 4JWTA 1K6JA 1U63A 4DCOA 4BSXA 2QIPA 5EAIA 2VDNB 3HVHA 4W9NC 5HFJA 5KOYA 3LQRA 2F3TA 1PGJA 7YASA 4BZPA 2OTCA 3TQOA 4EELA 1RYBA 2QN9A 1QJCA 3H5NA 1K8QA 3QJ5A 1WQ1R 1X19A 2NNWB 2PUFA 2K5UA 1VKJA 3B3GA 1BEZA 2WA2A 5KU7A 4UVIA 4R2XA 2AX3A 3KKOA 3RHFA 4C2UA 2BMFA 3ZIAA 2C2GA 1B73A 3TIGA 4X90A 3RWOA 1KP2A 1N6HA 3Q7EA 4J91A 3PLAE 4QGBA 2VPZA 3BHJA 5A4IS 4H27A 3P0IA 2QXUA 1LJUA 3QPCA 4ZAZA 1U94A 2Q3HA 4L4YA 4I1YA 1ZOPA 3K8YA 4FKZA 3CR7A 3RAJA 2R86A 4PGFA 1JJAA 3KEMA 5J2UB 4O1PA 1BDBA 4KHPB 3SPXA 4WNIA 3HXMA 1X92A 4I9GA 3B1WA 3VC7A 2WIAA 2GFQA 3DDWA 3QVWA 1JHOA 2R25B 2UZ1B 3SR3A 1Q0HA 4PQFA 4MQ4A 1GNLA 1LPAB 4WNEA 3QAQA 5IXJA 5KQPA 1ZLXA 3K1TA 1WOMA 4I14A 1CQJB 1GLVA 1JG2A 5HEKA 2R00C 5A5EA 3B6KA 2MT9A 2HV8A 2DETA 3P96A 2UYCA 2RI0A 4X20A 2EU8A 1O5MA 2R6R1 4H4CA 4FR2A 5JECA 1L5KA 4QGGA 4MP3A 1JV2B 2HH9A 5A1JA 4EPVA 3PNPA 2EL7A 1E9RA 2F8SA 4O8ZA 2WMOA 3I4LA 3DLBA 3SF4A 5F1OA 3HXCA 1O9HA 4BYGA 1LVGA 4X1IB 1KU6A 1L5VA 4GU5A 2GNOA 4B43A 4A8TA 1QJ4A 3KU1A 4IH9A 4ILKA 1A8IA 1EF1C 3ZNNA 2G28A 3PNYA 3CU5A 5HRAA 2WSSA 2AD5A 1ELWA 1ZJYA 3R1IA 2RAVA 1PL6A 5BT8A 4HWSA 2AXEA 3W8RA 3RKVA 5EKQD 4QVIA 4DCVA 4QAQA 2EFYA 3I6BA 2OV6A 1AA9A 5AHRA 5HF6A 4XARA 2PNNA 3WSTA 1MUUA 3MLAA 5FLXA 2R03A 2VZ0A 4ZCQA 1PG2A 1NW5A 1N2CA 1G64A 3BB1A 3IMFA 3MOSA 5AKKA 5ILGA 2W70A 2FUG6 5EJ2A 5K0JA 3I5XA 2IYRA 1NUHA 1YV9A 1OI2A 4BMXA 3GCZA 1ECFA 1RZRD 1DKRA 3NBYC 1PR3A 3CEPB 1Q0QA 2WMYA 1M1YE 1SBYA 2SNIE 2DX7A 3KXPA 1Q3TA 3OZAA 4B93B 4BX2A 2G9NA 2CLIB 1Y6ZA 5E6UA 1USKA 4D9NA 4TS3A 5AWFC 4H6WA 2HLPA 2VC2B 3OCVA 4NG4A 4IDGA 4N0QA 3UENA 3EU9A 2Z0MA 1XA3A 2PGAA 4G0ZA 4QRHA 3S2UA 1YQWA 3U4QA 1D6SA 3CPHA 4MV5A 4BB5A 4LJ4A 2XMCA 2ZB7A 1YL6A 1FSSA 1ZRMA 3H9GA 2OSBA 4HAYA 2QYTA 4PAMA 3LVQE 2R7KA 2OQIA 2GT1A 4YRAA 1IRIA 4I2WA 2Q9AA 3OAAD 3PDIB 4GSKA 1XZFA 1WD7A 2ZI7A 4M8NE 1RMYA 4GLFA 5D01A 2P9BA 4AN1A 3JVDA 5FWYB 2BFNA 2ZJ0A 5KYKA 4M1EA 1SVOA 4EWLA 2HT1A 5L3QA 3Q40A 5AH0A 1AKTA 2O8FB 4Q3KA 4KYUA 3DGFC 2BMJA 4HYEA 5CB4B 2C0QA 5DF1A 5LOZA 2BEWA 4YR9A 2JD1A 1EAMA 3RFVA 4Q3AA 2GBCA 5BVGB 3GT7A 5LQSA 4M88A 4WKBA 4QOGA 3FWNA 2OFWA 3FSEA 4IOLA 1BU9A 1WLYA 1MVNA 1SZJG 3D9HA 1BROA 2X22A 4TYNA 2D3TA 1E7SA 1Z08A 4Y2XA 3C8HA 2EOAA 3RHTA 1SD5A 4GEGA 1VL2A 3OIYA 3I32A 5JHHB 3LLVA 4URYR 3H16A 1S89A 1UM9A 1L1FA 3F73A 2D00A 4P93A 2VTBB 1O58A 2IZ7A 5A3QA 3ZZNA 4LRTB 2FN9A 3HSSA 3QYJA 5AK5A 3P2OA 3PWZA 3ZNPA 4F72A 1BNCA 7AT1A 3DNFA 5ETJA 3B85A 2PRIA 3I30X 4PRYA 4YT8A 1OY3D 1OCEA 1ZD8A 5CLHA 5KWEA 1OXSC 1YDGA 3FLMA 2J3DA 4XUCA 2OC4A 1UG3A 3ZVMA 1CY6A 4GX2A 3A04A 5JAQA 1MT3A 3UNXA 3ZR4B 4RTKA 1ZICA 3OPYB 2R1ZA 2IUSA 5THKA 1A69A 4M21A 1HTBA 1JFLA 1X8KA 4QTUB 3AEYA 1XRSB 3PEYA 2CC2A 2YBDA 3WO1A 5T5QA 1MX5A 4B89A 1L4MA 2R9VA 2X1HA 2ZATA 4Q69A 1D8TA 2FSVA 1X9GA 1NBWB 1QHGA 3PVSA 1ADBA 3IOEA 1TN6A 1N2XA 2C96A 4BNYA 2ZSHA 1WKVA 4HDNA 2R0QC 5K09A 1OWMA 1UFVA 4FFBB 1RWPA 3ZV6A 2WVIA 3PZ2A 2QT1A 1O57A 4NULA 1LWNA 2W5UA 4YIKA 2Q3LA 2PDAA 2DR2A 4Q3OA 3PEVA 2WOJA 3FWYA 3V8BA 2EIJE 1I2CA 1CS0A 2I22A 3WWZA 3CN7A 1WVIA 1IU9A 3P0EA 3OXLA 1VYVA 1TMOA 5BSTA 1GFWA 3U37A 3EPLA 4MS3B 2XZLA 8GPBA 4ZVNA 4RH0A 4E6PA 3WK8A 2C57A 4HBDA 2VUHB 3Q98A 4F3CA 4DLAA 4OJQA 1TMYA 5FYDA 1X7ZA 1QGDA 4II3A 1N5IA 2DPLA 1ELKA 1ESEA 1QYIA 2FEAA 3TZ6A 5T8KC 4NY1A 3GEDA 1J20A 2PNJA 4UWGA 1P77A 3PZRA 3PE4A 2GVDC 2XKJE 4OV6B 2I1QA 2XUFA 1ONOA 1SPXA 4XIFA 4FMCB 3HABA 4RG6A 5E76A 2I6UA 3GYZA 1RYNA 1YBFA 3DZFA 4Q93A 4L3WA 1YCSB 1LBEA 4C87A 2ONJA 1SBQA 4CLEA 4F9FA 4X6XA 3NUGA 2B30A 4M4SA 4I1PA 5AYWD 3LQQA 1MJFA 3H17A 4H59A 3O8NA 1IOWA 3TCNA 1PYDA 3VPBA 2VPYA 4C30A 4IVPA 5IARA 2JI7A 2FZVA 3HY3A 2J9RA 4RK4A 4LFCB 4Q00A 3WKAA 1VSBA 3DAFA 2VUUA 2KS6A 4YJGA 1E8OA 2P3SA 5DHFA 2PRJA 1CUGA 3JYSA 2CFIA 4QU5A 2C7BA 2JI9A 3D2LA 1B3RA 1G9TA 2G9ZA 3WGJA 1R5NA 2WIDA 2C59A 4Z53A 3EVAA 4BMPB 4U7TB 4ATNA 1IWBB 1E7QA 1UCFA 2YNMD 1C1XA 2ZT8A 2M6KA 1NF2A 3ZDDA 3NGXA 1MX2A 4HXYA 1PV1A 2E6KA 3G9QA 2FFBA 4CNBA 4B6SA 2ZTUA 2VJCA 3T9EA 2C78A 4B46A 1JJFA 3GRCA 1S70B 5HFAA 3JZDA 1E96B 4ECEA 5BMVB 1KERA 4UOQA 5CEDB 5HK9A 1J42A 4D41A 2V0GA 3AWDA 4I1SA 1ZCBA 3X44A 3QKYA 4U5QA 3OT1B 4LRXA 3EJWA 3DHVA 5U9CA 3CF6R 1KWKA 4TUYF 3B6ZA 1GGJA 4CGZA 2I8LA 3G5LA 3P9YA 1OA0A 5JQWA 4I5DA 2KE5A 1SCUA 2VS1A 2XH8A 2CHXA 5AQBA 3LJNA 2WD9A 4JBYA 3HGMA 1YONA 4RJ2A 3KLBA 4DCSA 1I4LD 4BJ6A 2NAFA 1HE3A 4M7RA 2OLKA 3DZDA 3TSOA 5IKEA 5EIOA 2MYUA 2ADMA 3NETA 4EKDA 1G8PA 1OJLA 2LTAA 3NHAA 5IDQA 1YR6A 3H5LA 5J9FA 1OQAA 4M1QA 2ZIRA 4ILGA 1VJTA 3H2KA 2Q5LA 3JWPA 3FCSB 1DBIA 1RJ9B 3L7KA 2WQZA 3HWX1 1J1ZA 4PNPA 2I1VB 4V3BA 2DK6A 1Q7EA 1J07A 4PZEA 4AF7A 4XZ4A 4XWKA 3PL5A 3L6AA 4OQMA 3HJGA 3V7NA 4OYLA 1UBEA 2FSHA 5DIFA 1RYDA 4JX9A 4P5EA 1SQ5A 3D3MA 4UDOA 1TN8A 2B1GA 4DV2B 4EVSA 2X0DA 5EHGA 1GUFA 2Q4BA 5I7UA 4XA8A 2Q4TA 4DR5B 2UKDA 4E2YA 2XPCA 2TMDA 1CR0A 3AOEA 2WQ7A 3KQWA 1YE3A 1GQ2A 1KO5A 2J9GA 4TL7A 3B13A 2EX1A 3LMKA 3QM1A 4ZVPA 4JJGA 2EQBA 1HYGA 3NOOA 1H2FA 1AKUA 1G20A 1QIKA 3K1AB 5CNIA 1KAEA 1R9JA 3FEYA 5CXQA 4JITA 1T25A 4H3VA 3ZU5A 3UKJA 5TE9A 3FU0A 1T9ZA 1PJ2A 1WMBA 1NVXQ 1U3WA 3BG0B 5J2TB 4IIJA 3VVBA 5ERXA 2RD2A 4E5VA 1U3CA 1WABA 3HYNA 2R8PA 2YJ3A 2Z56A 5K0LA 2VPXA 4MI9A 5JQGB 1AM4D 2W22A 2QTHA 4WBSA 4A7PA 2B4KA 1LFDB 3OWXA 2ZU6A 1WKCA 5B1HA 2C2LA 4KGZA 2A84A 5HYVA 3EIFA 3KWFA 4XDZA 4C5BA 2H2DA 1RC8A 4O2BB 4BLSA 1QUEA 2Q6LA 3JCKC 3AJIA 2JRLA 4UBIA 2VYIA 4BLTA 3LLUA 1GRRA 3L41A 3HUUA 4V0ME 4CQMB 1TMGE 2QW1A 3G9TA 2ZYSA 3OBIA 1NM5A 2DBVO 4HLQB 2F90A 1QCYA 5DN9A 1FC0A 3KR1A 4Q9LA 3U4GA 2PXCA 3JZFA 1K92A 3P5SA 5ULLA 2Y99A 4AMBA 1VQ1A 2P2ZA 1GPYA 2YY5A 3OM8A 1U2TA 4I4TA 1L7VC 5LMUB 1LLUA 3F5QA 3O4HA 3NZSA 4EW3A 3IA7A 1X8LA 1BCRA 3Q0IA 3Q9UA 4KXNA 2JANA 1EVEA 4AJ9A 2DTXA 1O1YA 2EX0A 3C7AA 3GL9A 3QQPA 2Z3VA 5EWJA 3KKNA 2B99A 3ETHA 3D6FA 1V11A 1JKXA 2FP3A 5FUQA 1XYYA 3INGA 4W6ZA 3WFJA 4EJSA 4L9RA 1D1SA 4F8JA 1ICIA 3FUWA 5EIBE 2GF0A 3LCVB 3UANA 2LVBA 1N9ZA 1PNQA 2CF5A 4W1QA 4N2QA 4IZHA 2AEJA 4XDYA 1KOGA 2H1VA 1UZMA 3UAZA 4MDYA 4FB5A 3JQ9C 4D9IA 2Q4RA 2WM2A 4D74A 3AR4A 4WNAB 3Q3VA 1VCIA 5BXQC 1MO5A 3MVEA 4MO9A 3GFPA 3KAPA 1MW9X 3M5DA 2OY0A 2PFSA 3ACCA 2HYIC 3AI2A 1T9DA 3L4SO 2OXFA 1KZGB 5JDCA 1Z39A 2DY0A 2ACEA 4WKNA 3QTBA 2IIPA 3RUDA 2G09A 1N95A 3W2FA 5BWOA 2V97A 1A27A 4H1VA 4L2IA 1MVLA 2PXXA 1W19A 3LY7A 2IPOA 4GICA 3EEYA 2YDYA 3WQHA 4MR9A 3AKCA 4M76B 2Q8QA 1H6BA 2W58A 4AZSA 5DTRA 5JANA 4IHAA 2BM1A 3CS3A 3P4YA 4JBGA 5KVVA 4IN3B 3K09A 1NVWQ 3Q8XB 4OVUA 4TRJA 1UBUS 4MB0A 5K05A 2L9BA 2LUOA 1Q74A 1XP5A 1IUPA 2NZYA 2XVMA 3S40A 1OZGA 3BGVA 2E4VA 4HDSA 1ZUD1 2PR7A 4TSFD 4LMAA 3L4BA 1W4LA 2BTDA 5K01A 4LGYA 1WTAA 2WPNA 3C3YA 3UWDA 3A26A 1YIDA 3R3SA 3L7AA 2FPGA 4J1SA 3JYHA 4K40A 2XBMA 1KO4A 2QRLA 1EWTA 3NJ4A 1LDMA 2ZGDA 5KYXB 1FY2A 1MEOA 3S68A 1NVBA 2VJBA 5DI3A 3DONA 2NZUG 2A1IA 4WWNA 3TSAA 3P9CA 3RS2A 5GZ1A 4DLXA 2ZRKA 1U0HC 2PZJA 3FOZA 1HQKA 5DMHA 1UJJA 3NAGA 4D9JA 3UF0A 2IF2A 2FPOA 3KYIB 2OGTA 1SXHA 4MO2A 3L84A 1CDZA 3E8XA 3KVVA 4W5OA 1BE0A 3I6YA 2WUDA 1HLPA 3V1YA 1PRYA 4P81A 6REQA 1GZ7A 2FOIA 5H81A 1AKYA 1G2QA 4F11A 3OOSA 4NYIQ 4H7DA 1T9GS 2VF2A 4NICA 4LRYA 1F3LA 4DEVA 1O9BA 4X65B 3A9TA 2P65A 3EZLA 4UVDA 5EGSA 1BTOA 4NIKA 4NDNE 1B6SA 2VYFA 4EY8A 1KQFA 5L3SA 4E2FA 2ETXA 3ASHA 4YJFB 4F9TA 5GONF 5B3KA 4ZJYA 5DGIA 2GAJA 2F9MA 4Y2SA 1ULUA 2YKGA 1US8A 4LZOA 4EABA 1MV8A 1SA5A 2J9FA 3V9AA 1JCRA 4KO8A 2VCYA 5JFTA 4KWIA 3OD5A 3FMIA 2R79A 4HYQA 4KQJA 3TPCA 4PF1A 1R4NA 5LIRA 2ZJ1A 4W82A 3ZU6A 1E7WA 3U31A 4B8WA 1V3QE 1WCIA 3UJNA 4AQYB 3KIPA 3K9LA 2IDKA 3FDFA 2J8SD 1UDCA 2ZJAA 4ZOLA 3ETGA 3APCA 2OAEA 4U8YD 3ZY6A 1W2WB 4HYTA 1PI3A 3RYIA 1D2AA 2GD0A 2V7TA 5EQFA 3EIEA 4YJ2F 4YCDA 2OCIA 4I4IA 2DFDA 3D59A 4UEJA 3FPKA 3MTQA 5SYMA 4HLEA 1UJ4A 5TVKA 1LV7A 4QTYA 1UKBA 1GYRA 1ZP6A 3AM1A 4EBFA 2IHKA 4RGVA 5BSFA 1H9CA 4M7WA 2VVTA 4OB7A 3NLLA 5GGXA 4DJDC 5JXWA 4K0KB 4RSYA 3H05A 4LJ7A 3V8NA 3ILXA 5BNZA 4Q9DA 4R1QA 3KE8A 2VGEA 3E2IA 2OCGA 5LB4A 3CCBA 1AY0A 1GNPA 4KQIA 3WGVA 1MKYA 3EHDA 3UKDA 5IN4A 3FR7A 5CT8A 2GK6A 2QVZX 3E3MA 4PXAA 2OBLA 4J7CA 2P2SA 3OZBA 3SYKA 4RNDB 3FAKA 3W6ZA 4DMRA 1LC3A 3I62A 2YY7A 1Y8MA 4WXMA 2DBRA 3GAAA 4CNQA 1OHHD 2B5VA 4I9HA 1S4MA 3TW6A 1TK9A 5M5BA 1PFYA 4Q66C 2ZRHA 4CRWA 4C0KA 3MS7A 5KNDA 1E7MA 1NYLA 1M7HA 5DSZA 1B1CA 2E4ZA 1NV8A 2V6GA 4DLZA 3W79A 5BRJA 4JSTA 1LW7A 2E4XA 2Q2VA 5AW2A 2AOVA 3A28A 4MAAA 3QXXA 3DYVA 4QXQA 2DBQA 4ZO9A 1UJ2A 4GM1A 2FLVA 3N59A 3PGJA 5CLJA 1M34B 2GARA 4M0PA 1G16A 3AW8A 3L1HA 3GLFB 4PM4A 5SY4A 1TF5A 2ID9A 4FHDA 5JS2A 1W96A 5B1EA 4G0UA 4RZQA 3TZQA 1E2DA 4ZFNA 2WJGA 5A9TA 4ID3A 1TJPB 4FUTA 2CZQA 3ERCA 3UT4A 1G3QA 3EIHA 4GYYA 4IZIA 3ED5A 1MJHA 3CHPA 4LDNA 4M87A 4N3GA 2UYHA 3ZI7A 1TO1E 1YB7A 2XHEA 5I8ZA 1U9CA 4B5LA 3IBTA 4GRAA 5LJLA 1DAHA 2LZ0A 4MRPA 1W88A 3W6OA 3G0OA 3NTXA 3BVPA 4XYGA 5DX8A 4KR6A 1BJKA 3TQQA 5IJWA 4TUUA 4W99A 2ZYUX 4KVZA 1Z47A 4KO2S 1IC6A 4K6FA 4R1OA 3PVLA 4JUDX 4LK3A 4R2JA 1XEWX 5EZ6B 3LA6A 3SJBA 1O03A 1JB1A 4U8HA 3LHIA 3SI7A 4URWR 1RKBA 3LLMA 3ZV4A 3ZBTA 3HZZA 2VSQA 1O95C 2XECA 4BE9A 1KI6B 3BIOA 4MI1A 2NSLA 4MGKR 4OMFG 1RM0A 5KTYA 1XNRB 1EXMA 1LQUA 3C3MA 1F1JA 4KXMA 5CHEA 1NW9B 4RU1A 2UXBB 4WIAA 3E9EA 3CRRA 4CEJB 1VE3A 1VZ3A 1Z82A 4I5EA 5CCLA 3L93A 1KS2A 1J5EB 2XIJA 2O7RA 3IEKA 4E94A 3R2JA 4B3XA 2J08A 4XX5A 3BD9A 3VPDA 4FKMA 3P2JA 1TLFA 3HBFA 3CZ5A 4B80A 2PX0A 4CL8A 1EFCA 1SW6A 3HGTA 4HLNA 3W77A 1YQUA 3I2KA 1ZJ5A 1OPXA 3WK7A 2QAIA 4YAIA 1G3UA 1ZX1A 1FVFA 2WAMA 1L2TA 2I80A 1ELRA 1KORA 3GDFA 1BIFA 2GPYA 2G83A 2X6FA 3HCAA 2AN1A 2EJUA 2J8ZA 4BNDB 3WI7A 1T9BA 2B6CA 4YIHA 1L8OA 3OQMA 4MRMB 5HG0A 4D8WA 2PMEA 5JJKA 2Y1WA 4EI9A 3GUHA 4A2QA 3QLVC 3O8DA 3PF8A 1IBKB 3IQWA 5JNSA 1KVQA 1EE1A 3K2BA 4QREA 4QECA 2JA1A 5DP1A 4DNXA 3T7EA 3VU9B 2NYJA 3EVCA 3CR3A 3GOHA 3SX4A 4NJEA 3DXYA 4IIYA 3AR5A 1URPA 1RQPA 3K5IA 2R6DA 1O9GA 3AJAA 2R5FA 2UUBB 1YZHA 5KQSA 1YR2A 1IHUA 1QTRA 3HYRA 1G18A 3KXLA 3VOTA 4EA6A 3PTAA 2ZQZA 1JEEA 4EY3A 3W8EA 2XCTB 3HKDB 1KYIA 1J90A 3T5AA 4KDFA 1PL0A 1WY5A 2GCNA 1W1WA 4UHJA 4BTAA 1R0LA 4WE3A 3L6CA 4GX5A 2FW8A 1FFSA 5EP1A 1SUDA 5F5LA 4NI5A 2AW3A 2E85A 3DV0A 3ONWA 4HGOA 4KNVA 2VAWA 2X76A 2J4DA 2UXDB 3GLQA 1J09A 2X2FA 3U5TA 2JBWA 3TUJC 1ORDA 1RD4A 5M34A 1RHQA