4GZ6A

Crystal structure of human o-glcnac transferase with udp-5sglcnac
Total Genus 264
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
264
sequence length
716
structure length
700
Chain Sequence
b'CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 264
structure length 700
sequence length 716
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz6A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz6A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gz6A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gz6A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gz6A03
3S27A 2X0FA 4N2SA 8GPBA 2PZIA 4G24A 5EX3A 4N39A 4G23A 3CUUA 1KT0A 1Z8DA 3OTHA 2AVPA 2YJNA 5A7DB 3KAEA 2F9FA 2QN8A 4APOA 2QLLA 3T3IA 1Y6FA 1P5QA 2PQ6A 4EL5A 2Y4TA 3TG5A 3VTXA 2XEVA 1L7XA 2ONDA 4RIGA 3NAZA 3L7DA 4RG6A 3CUYA 1XC7A 1XKXA 3G2KA 4N9WA 1NZFA 3MV3B 2F3SA 3ESKA 4BQEA 4G2VA 1GG8A 3CEMA 3PE4A 4I9CA 1ABBA 4GZ3A 3T5TA 4WHMA 4J8FA 2J9QA 4F9FA 2GPBA 1NZNA 3TSAA 3VUFA 2PQNA 2YHCA 4I2WA 3URZA 1RRVA 1QQEA 4AMGA 1A17A 5JTUA 3CVPA 1B4DA 4YI5A 3C4VA 3QDNA 1J39A 1P2GA 2QZSA 4F97A 3NB0A 4REMA 4BFCA 1KT1A 3BEOA 1WV0A 3EBOA 1YA0A 2V5FA 4BTBA 2VG8A 2G9RA 1Z62A 3TOVA 5D01A 3WADA 4X7MA 3CK9A 3S7FA 5IKOA 3Q47B 4XIFA 3H4IA 2GPNA 1PYGA 3MQFA 3U4TA 1VGVA 4W9RA 1XL1A 4WNEA 1P2BA 2VGXA 2IV3A 1K06A 3LY7A 2PRJA 4YI3A 2L6JA 5FT9A 3ZCTA 3ZPJA 5ARFA 2FI7A 3S28A 1IYGA 4HORA 4GPKA 3CV0A 4AY5A 2FETA 1HXIA 2R60A 3DZCA 2Q7FA 3MTAA 3RHZA 1AHPA 1JG7A 2FBNA 1YGPA 4N3BA 3IEGA 4UI9J 1W3BA 4XI0A 5LCWC 2XGSA 1PN3A 3RSCA 3MA5A 5G05C 2C9ZA 3GZ1A 3ZCRA 5TMEA 4JHRA 4N3AA 2FFRA 4GYWA 4YVQC 3LKUA 3UQ3A 2GW1A 3T3DA 3E3LA 2IV7A 3PDNA 3CUTA 3S29A 1C3JA 3NPAA 4HLNA 1F6DA 4EQFA 1QKJA 2NC9A 3BD7A 5KJLA 5GPBA 1WM5A 2FO7A 5FZQA 4B94A 1XV5A 4M7PA 2H1HA 4NC9A 2PYIA 2O6LA 2KCVA 4LEUA 1HH8A 5EX0A 5DIZA 3G2HA 3KD7A 2VCHA 3FP3A 2F3PA 2QRGA 1RZUA 4GYOA 2QN9A 4KQ1A 1A8IA 1WUYA 2GPAA 2OFFA 1E96B 1FS4A 4WACA 1FTYA 4UQXA 3E4BA 3GYZA 2FF4A 2R68A 4NQ0A 1PSWA 3BCRA 4JA7A 4H7XA 2PRIA 2P6PA 1FCHA 2VSYA 1XNFA 3L79A 3QWWA 2QRQA 1B89A 4KYOB 4YVOA 4WADA 3SF4A 4Z5XA 3CEQA 4I17A 2IUYA 3D0QA 4MI9A 1IXYA 4G25A 4PQGA 3MBOA 4Y6WA 3NP7A 4GCOA 2BGTA 3CKBA 3BCSA 4J8EA 2BGUA 2FEZA 2VQ2A 2HYZA 4CGWA 2X0EA 4AM9A 3MS2A 2Q6VA 4UI9K 5EKQD 1NA3A 4N5CA 2XA9A 2PL2A 1WAO1 3FROA 1M5RA 3OXLA 4J0UA 2SKEA 2GT1A 3CK7A 5TVGA 3S2UA 4ABNA 5A6CA 2UY1B 1P4GA 4RENA 3NP9A 2MHKA 3UPVA 7GPBA 5CCMA 2BISA 3MT8A 4HOSA 2HY7A 1L5VA 2QN2A 3N71A 3RO3A 3QKYA 2IF4A 3IAAA 2XA1A 3L7CA 4A1SA 3Q15A 2IEIA 3DD1A 3LYAA 5FZSA 3MKRA 2FF5A 3CEJA 2ACVA 4MHSA 2YQ8A 1NA0A 1Z6QA 4L22A 3K9IA 5TMDA 2AMVA 3AS4A 4CTNA 1FU8A 2ACWA 3CKCA 1PNVA 5D0QD 4YUAA 3IA7A 1UQTA 4LEIA 1FA9A 5AYWD 4BT9A 3S0JA 3OKCA 1XL0A 1JIXA 1FTWA 3MTDA 4NRHB 3VDMA 4I2ZA 4N3CA 1C8LA 4GA2A 3GUHA 3G2LA 3QWVA 3CVLA 1WW2A 1EXVA 2XA2A 2WPVA 5KJNA 4U0UA 3CEHA 3CV3A 2XMPA 4EKYA 4UI9C 2XCUA 4U0SA 5M72A 3MT9A 4RIEA 1ELWA 2QLNA 4U04A 4MICA 1FC0A 3ASGA 5CCLA 2R5SA 3HYMB 4HOTA 1JIVA 3WAGA 3CUVA 4JL0A 1L6IA 1WV1A 3JYSA 3OY2A 3TAXA 3ASHA 4RG9A 5FJYA 3LCAA 3OTIA 3ZCPA 1H5UA 5DXFA 2C2LA 1C8KA 3QKWA 5HXAA 4KQMA 4BTAA 1P4JA 3MSCA 2R66A 4U07A 3ZN3A 3LPZA 4HOQA 3UUXA 5JJTA 3MS7A 4CTOA 4GZ5A 3MEKA 4RBNA 2PQRA 3OT5A 2AW3A 2QN3A 2SKCA 3RJVA 3LY9A 1GPAA 4M60A 4NEQA 1KTIA 1K08A 3T3GA 2I6HA 5JJ6A 3G2JA 4I9EA 3TG4A 3Q49B 4G1TA 5CHEE 1ZBPA 2LSUA 3T3EA 2F3QA 2SKDA 2PYDA 4G2TA 5DLDA 1L5RA 3G2NA 2WQHA 2IW1A 2X6RA 3ASDA 2DBAA 4BQFA 3T7DA 3VDNB 2KCKA 4BT8A 2GM9A 5G04J 2GEJA 3WXXA 3RIBA 2R4TA 2QFCA 3E3NA 1Y8MA 4UQYA 2UY1A 4WNDA 3CUWA 5ARGA 4BWRA 3HBJA 1OUVA 2HR2A 3CVQA 2C1XA 5DU2A 4X7RA 4J8DA 4GYYA 1IHGA 2BUGA 4F3VA 3RO2A 4CTMA 4MI3A 3MTBA 1FTQA 4HOUA 3MS4A 4W6QA 3CVNA 3GZ2A 3MRXA 2C1ZA 5I45A 3OY7A 3FFLA 3FWVA 1RZVA 3OTGA 3SYMA 4FKZA 5JJ7A 3QOUA 3C48A 1KLXA 5D0OD 3L7BA 1WUTA 2VCEA 4KXKB 2UWJG 3ZGQA 3ZCUA 4GCNA 3ZHEB 5JTTA 3BEEA 2IYFA 3S7DA 2G9VA 4YNDA 1ZU2A 2QRHA 3C4QA 1P29A 1QZ2A 3SYRA 4QLBA 3PE3A 1GFZA 5C1DA 3SZ7A 1NLMA 4X7PA 4Y6CA 5TMBA 3AS5A 4I1AA 1TJCA 3O3CA 4EJ2A 4RIHA 2QN7A 4FZRA 1QM5A 2H1FA 3MRTA 2F3UA 3Q5MA 1AXRA 5BW8C 2XCIA 1L5SA 4EL0A 1UQUA 2QN1A 3ASFA 2ECPA 3HBNA 4RIFA 1O6CA 1P4HA 4UQZA 2VYIA 4N2QA 2P58C 3BD6A 3AMVA 2WTXA 5LQDA 3Q4AB 3Q3HA 1JEJA 1GPBA 3OKPA 3OXGA 1JG6A 1Y6GA 1GPYA 4O6FA 3UYKA 2C0LA 1JIUA 2G9QA 3BDAA 3ZFWA 4X6LA 2E2EA 3LY8A 2C4MA 2IEGA 3G2IA 1V4VA 3QHPA 2XCCA 3RKVA 1UZUA 2KC7A 3L01A 3BCUA 4EKEA 1ELRA 3VTYA 4U0ZA 2XCBA 2X0DA 3T3HA 2XGOA 5BNWA 2BFWA 2GJ4A 3ZCSA 2JZCA 3E3OA 4KBQA 4AIFA 4LDPA 3UYLA 3MV2B 4WNFA 2GEKA 1IIRA 3D1JA 1HLFA 1P2DA 3Q3EA 2VSNA 5KJMA 3RT1A 2JJMA 1NOKA 3HBMA 4MRAA 4AN4A 6GPBA 3DDWA 4JA9A 4NESA 1PC2A 2C0MA 3DDSA 4MHOA 3OXFA 4WNGA 4CGVA 2ASVA 4MI6A 2QNBA 3H4TA 4RIIA 1E4OA 5D00A 1Z6PA 3L7AA 3NC4A 5G04C 2AZDA 1LWOA 1NVKA 4ME2A 3S7BA 3BD8A 3MRVA 3GW4A 3OKAA 4RELA 3KS2A 2X6QA 5FZRA 2ZB2A 4H7YA 1F0KA 4F96A 3ZHEA 4AY6A 1L5QA 3ULQA 1E1YA 5HQ8A 2AV6A 5IKPA 3VUEA 2KCLA 1L5WA 1GGNA 4M83A 2XGMA 2KATA 1EM6A 2QRMA 3COPA 3WC4A 1FU4A 1SXPA 2ATIA 1C50A 3Q3IA 2QRPA 3CK8A 2IFUA 3NF1A 2LNIA 4HWGA 1YA6A 2G9UA 3U3WA 3RSZA 5LCWJ 2QLMA 3GPBA 3S7JA 3QWPA 5G05J 3ZCVA 2R4UA 4WUYA 2JLBA 2VGXB 3TGOA 1NOJA 3EBPA 4KQ2A 2OOEA 4AMBA 4GA1A 4G26A 1SXQA 2HO1A 5HI7A 3EDTB 4GPBA 4GZ6A 2IYAA 3R9AB 3ZCQA 3NCHA 1BX3A 3HBFA 4IN3B 3MT7A 2VGYA 1NOIA 1Y8ZA 4GA0A 9GPBA 5KJKA 3CX4A 3AS8A 3RU0A 5FTPA 2XPIA 2LSVA 2Y4UA 1LWNA 1NZDA 3O48A 1GZ5A 5BT1A 1HZ4A 4CDRA 1XOIA 1FU7A 3D0RA 5ENZA 2KS6A 1WW3A 4BQIA 4XI9A 5DBKA
chains in the Genus database with same CATH superfamily
4N8EA 3S27A 1BW9A 2BY4A 4YLGA 3K1AB 2W4MA 1GL7A 2OWDA 1C3EA 1YR6A 3E7XA 4RACA 1ZD8A 1ISMA 2CD7A 4UEKA 2UYYA 4OHCA 4HMQA 4DX1A 3PXUA 2VDRB 4R7LA 1U81A 1N7JA 1SUCA 4C05A 1XXHA 1X7XB 3EBOA 5CM9C 3DO8A 5EILA 5D01A 1YWGO 3WK6A 3HIZA 4QBIA 4YI3A 3W1EA 3QB2A 4WE3A 2JFBA 3AESB 1Y48E 2X13A 4MS3A 5TB5A 1IY9A 1DAHA 3SKVA 2BZGA 2QENA 2WXGA 1DJQA 1JA9A 4CM8B 1POXA 1G98A 1E6KA 3OQPA 2GBFA 4MDEA 5T3RA 1TNOA 4WBNF 4MRUA 2OQIA 2CCJA 5IXYA 1RXUA 4Q1AA 4MVJM 1WD5A 3RVBA 1Q1BA 3APDA 2ZYVX 4NU0A 4DSOA 4DLBA 3UXMA 3EGWA 2GRJA 1L8XA 2ZU6A 2WKSA 4I81A 4N3GA 4TZTA 5IYZA 3K31A 1Q0SA 3M5WA 2GR9A 1KR5A 1NMEA 1PBNA 3TEMA 4JI6B 1C4KA 3A14A 4ZEXA 5H4HA 2W2NA 4EI7A 4RNCA 4C4RA 3BSFA 1ZW6A 2NOAA 2HB6A 2BISA 4UHDA 4IICA 2DUMA 1DG1G 3PG5A 1SBQA 1WOYA 2R6GA 1NUUA 4MYHA 3OZIA 4N41A 1NUPA 3MBIA 2PUHA 4DSNA 4F4FA 2FPLA 3G85A 3AZOA 2L18A 3L3BA 4BERA 3KYJB 1WG8A 2PZGA 2EL9A 2HCTA 3CV3A 2QTNA 2Y0BG 3HYMB 5ALZA 4UUAA 4WZAA 1TQ8A 1OZGA 4OHFA 4ZVVA 2JPDA 3FTDA 2WVGA 3T0FA 1N6IA 1FDSA 4CEJA 2A0UA 3P96A 4HOQA 3F47A 3L6DA 3DFKA 5A5DA 3E53A 4ZVQA 3A6JA 2GRPB 1OIWA 1XN1A 2Y05A 4G5YA 2PLWA 2PZBA 2HSZA 3NBZC 3WVNA 2XEXA 5DHTA 4EQZA 3Q11A 1YOVB 4MOWA 2EIXA 1I51A 2OBFA 3ETDA 4JIMA 1A8HA 1FXSA 3K70B 1KMNA 1UXJA 4BTVA 3PQ7A 4Z8YA 3EJ6A 1L4FA 1IN6A 2IDKA 4HDKB 4TQGA 3LS8A 4U7DA 4B80A 4OVKA 5KWEA 4FDTA 1Z35A 5U4QA 2FG7C 4CMEC 1JYSA 3D59A 3H9JA 5CT8A 1RXVA 4KC0A 3LT2A 2Z2XA 4FHJA 2C9OA 4YJ3B 3EWSA 1TMYA 1TM5E 2ZB4A 3GJ4A 4EBAG 3ASYA 4DK5A 4RZ2A 4MK4A 3PHLA 2HT6A 4HUJA 5LR6A 2P5SA 1E7SA 1JIUA 4M1QA 2GNPA 4HL6A 4LV5B 4K28A 3COZA 3G7NA 2NVBA 4DV5B 2GSWA 3KOUA 4RKQA 2JATA 4FIDA 5KNBD 2NAPA 1Y4ZA 4Q9KA 2JGKA 1PP4A 3A9VA 1WDMA 1V47A 1FMTA 1ILEA 4OFBA 2DJ5A 1E98A 4PSCA 4ZYUA 1ID1A 1KFJB 3BIXA 1HDYA 2O2SA 3NB2A 1RQXA 2H1SA 2FEPA 3DNFA 1BHO1 3TDNA 4CF7A 4XXHA 2QAGC 2B30A 2V7XA 5FF9A 3ETGA 2C4NA 4FDAA 4WLOA 3VR6H 2R1ZA 4CQLB 2FW7A 3ZCVA 2LXNA 2AEFA 4KRYA 4MPRA 3PWTA 1GARA 4DREA 1D8DA 1X1BA 3E81A 1ZNXA 1VL5A 4PCVA 2J6IA 3ZHOA 1LWNA 3OE7A 3PVCA 5BT1A 2QUAA 3V7NA 1OGIA 4WJLA 4KG7A 1JKFA 5CM2Z 1VYTA 4JBGA 1VRWA 2X8JB 4II7A 4Y30A 1QH1B 3OFJA 3O82A 1EDBA 2D1TA 2DR3A 2PQ6A 5CA1A 2X6JA 2YS7A 3MJ4A 4V0RA 3W04A 3LX6A 5L3QA 3NBAA 3Q7EA 1KRHA 3PNBA 4ZJPA 3K6SB 4LTDA 2XMRA 1QK3A 4BVFA 4F9FA 4EY8A 1PTJA 3QLVA 1Z88A 3S1AB 1OZFA 3GVXA 5J4LA 3EQZA 4GOLD 5EWLB 5ANRB 2HKIA 4HYTA 3ZK8A 3WADA 1BI8B 3L0BA 3SEAA 1E2KA 2PD6A 1P9LA 1DV1A 1NF3A 3J81k 1B42A 2V58A 4AVYA 1RCFA 1T8WA 1YA8A 5BSUA 1P2FA 5ALYA 1ZK1A 5IVDA 3PDNA 2YWEA 3WDMA 4NK5A 2HK8A 4MW1A 2P3SA 4G1BA 2FO7A 1VM6A 2JI7A 5KNLA 1QFYA 1YS1X 1EQAA 2GJKA 1E96B 2IYXA 1P33A 4HQ0A 3OZGA 3UIPC 3SX2A 2RMKA 4NFLA 2ZK7A 3RUDA 4A03A 2BFAA 1YRLA 3LDUA 1TGVA 1N9KA 1W85A 1BU5A 16PKA 3D4LA 5AW8A 3R3VA 3TWSA 5ALHA 1IB6A 2WZCA 4JI0B 3O26A 1LCIA 2PUEA 2PL2A 5IJAA 5JMWA 1E6LA 2Q7XA 2O4CA 3IB3A 4BDTA 1NI4A 1XVUA 3QVLA 2JZNA 4HLLA 2OSBA 4KVFA 1B1AA 3C6YA 1QS0A 2F4NA 3O4HA 4R1UA 1SXJB 4R9UC 2Q4EA 2OAGA 1V5IA 2DH6A 4Q1EA 1J20A 1QJ4A 5KSOA 2HOQA 2X6FA 4BX9A 3GEGA 1SQMA 1X8XA 4X94A 4WFKA 3HM2A 3IUPA 5DTEA 2SKCA 2XQKA 4GTPA 2P0AA 3HDHA 4J7CA 2Z8YA 2W6CX 1IXZA 1UMDB 3FKJA 4ACAA 3FYUB 3DV2A 5BWMA 1QO0D 4O0MA 4MUMA 1RZRA 1HDZA 3A1TA 5G2NA 4NZYA 1CD5A 4BS9A 5KTTA 1BFUA 3RWOA 1A2OA 5HIAA 5ESRA 3SOZA 1C14A 4ARIA 4KU4A 2MOWA 3SYMA 1XTKA 3B7WA 2OP0A 3RYCA 4NMWA 3LBNA 3ZHEB 4Z0TA 2ILVA 1IHOA 4LNAA 1CIJA 4FMPA 3X44A 2XB9A 1WCIA 1KY4A 4W4TA 3U6BA 1M0SA 1GR0A 1FCJA 4WY8A 1IXKA 1JQ3A 2P9ZA 3OAAA 1Q1NA 1C0EA 1PJBA 1HL7A 1OKKA 3EISA 3EFEA 4ZYVA 4D4HA 4YFVA 1JVBA 1U94A 3LD9A 5I9TA 4BO2A 2X0DA 1O95A 2IYPA 1JIQA 2H9YA 2FN8A 4Q9HA 4S05A 1LRLA 1JBQA 2O3JA 4UYKB 4WWNA 1YK0A 3V7WA 2TMKA 4DIEA 1U3UA 1RYNA 1HZZA 1J8VA 1R1DA 3QX8A 3IDFA 3U3ZA 1G2PA 3UTMA 5FTWA 4IP0A 4RD4A 2WI8A 3K9GA 1R7RA 1AA6A 3HWRA 4M86A 2KYRA 1ZMRA 3JATB 3NUGA 4PAWA 3JQ9C 3V33A 2OGSA 1BX1A 3V7UA 3R7LA 2D2EA 4P31A 2CE2X 2J9GA 3ZEAA 4BVBA 4PLVA 3WFIA 3IEUA 3ECSA 4E6EA 3RU2A 4TSFA 2FEOA 3NM6B 4N5QA 1XALA 1A5TA 1DC3A 2QB5A 1SA5A 4WCDA 3T4UA 2G0NA 1KOLA 3ZV4A 2Y0PA 1ODLA 3BQOA 3WLMA 5J9FA 2IYNA 3TW8A 5FHRA 5JS7A 4IHJF 3LNTA 4WSOA 1H0RA 4DLTA 3H3JA 5FQ4A 1P3DA 3EC2A 2PKQO 2E55A 1A9RA 1JEYB 1LW7A 4Z2AA 4HORA 1WA5A 4AKSA 5TJHA 1BA2A 5JC1A 4C4OA 2AJDA 2BN4A 1N25A 4PTYA 1KFKB 3EXG1 3KT3A 3TWQA 4U7FA 1DXQA 4KQFA 5IHXA 4TKZA 2BTQB 1KVQA 4N76A 1X2BA 1L1RA 4UQPA 4QZVA 4J1NA 3WTBA 1YL5A 3MCUA 4DR7B 1KC3A 3UJBA 1HT0A 4TMZA 2HDWA 2BGRA 3GFTA 5J2TF 4YMGA 4R6WA 3HKDB 1SCNE 2RGUA 1TJYA 4GNRA 2Z09A 3LS2A 3VU9B 4YVFA 2PTHA 2FZVA 3L0IB 3I2HA 4GX2A 3PUVA 3IT2A 3DD5A 1NUQA 5DYIA 1AY0A 4JI8B 1ZI9A 5KBAA 4EUHA 3FIJA 4DR5B 4RF3A 5LMZA 1G2IA 2YQ8A 2ZJ6A 5IHPA 1O6ZA 4EZKA 5CLFA 1YUMA 4HUQA 4X3CA 5F1PA 3ZV7A 5FOTA 1HEUA 3NCTA 2OV2A 3F4KA 2VGEA 4XR4A 3PZ3A 3QWIA 1L5ZA 1FFWA 2ENUA 2AA3A 2R00C 4HLDA 1E0KA 3QNKA 4QUAA 4X93A 4FYWA 4XX1A 4KAXA 1U8UA 1SOUA 2HBZA 1K8RA 4EY3A 2J49A 1CZOA 4KOAA 4DDVA 3REGA 5HJ7A 3G5AA 1U65A 1P5RA 1FPPA 1XDSA 2Q0HA 4JUFA 4QPCA 3EXHB 4PIVA 3ZGVA 1EXDA 3VISA 1TOAA 3FNQA 1B6GA 1M1ZA 1UBHS 5BURA 3GIWA 2O9JA 1DINA 3WGZA 4BMSA 2C98A 3SEQA 4WXYB 2CWWA 1Z16A 3MRXA 3WB2A 4FKZA 1VMAA 1CJCA 4FTWA 5DGHA 1NW9B 2QR5A 1BJTA 2O8CA 4G0OA 3ZE8A 1O9BA 1Z38A 3K0SA 4QNNA 5C1DA 5HHTA 3AS5A 1G8JA 3KOZA 4Y2QA 4EA8A 1YXMA 2WWVD 1XPOA 4W5TA 3BWVA 3ZJYA 4FHEA 2ZRIA 3E7FA 1JKIA 3U60B 3B1FA 4Z86A 2A3NA 3O2NA 1UM9B 4ZVOA 1CULC 2QY7A 121PA 3ILXA 5DI3B 5AUQA 2C59A 2WTAA 3VLEA 5C8ZA 3N1UA 3ZX4A 1M7GA 5CB4B 5LCXA 3WDLA 4PQRA 1HU3A 4L75A 1W5EA 2O3UA 1QX4A 1AK9A 1S2IA 2B37A 2LBPA 3WLOA 1MO6A 1GGEA 4RIIA 4A0QA 1U8XX 3E58A 2QJOA 2FPSA 4G2NA 4RXTA 4UXHA 4QGHA 4OSEA 3RTDA 2X6QA 4H3HB 3KJNA 4N48A 5HQ8A 1QQBA 4WCFC 3VR4D 1P5ZB 4MVJH 3AG3E 3GG9A 2ATIA 2OGUA 4Q69A 4M0UA 3IUNA 2AMJA 4EJSC 2V3VA 1H0HA 1FNNA 3C14C 4EHDA 2HMYB 4CKWA 5DRTA 3BQ9A 4HAZA 1AK1A 4GOOD 3M6LA 4QBHA 2WD7A 2MSWA 2LXLA 4Q48A 3NW9A 2RHLA 2NZJA 3IILA 1RQPA 3WYNA 3MTQA 1R4NB 2D74A 4MI1A 2Q1WA 2ZIRA 1PV2A 5DMXA 1IEVA 1D2NA 5D2MC 2XEVA 4ER0A 4ZCQA 4O08A 1H93A 3ETHA 4J29A 4U2CA 3LLUA 5EMHA 4EGAA 4TTJA 4HWSA 1ZCAA 5JS1A 1X92A 3Q9UA 3GLVA 4JB8P 1HOTA 421PA 1T8UA 3K09C 2ZYSA 5C2JB 1IUKA 1WV0A 1UFVA 1H85A 3KXPA 4P4UA 3FM9A 3MQFA 4MQ5A 2PT7A 5KYGA 2B8EA 4U63A 1K66A 2Z3WA 5SZKB 4AL4A 3SKYA 4JLUA 1A4IA 2Q7FA 4BVJA 2VIIA 4GVPA 3RVSA 1YONA 1YKSA 3PI7A 2I3ZA 3UMBA 2GPYA 2YRFA 3WQSB 4DDKA 1K7YA 1ZA1A 4AYTA 2YZGA 5AQ9A 1I01A 2F6RA 5CG2A 4IVQA 5K20A 3NYRA 3FP3A 2ORVA 1XHEA 1J2YA 1FTYA 1OHHD 3A6LA 1U8YA 4JZYA 3QQPA 1Z4IA 1R64A 5GONF 1DAKA 3E22B 3W2GA 3F96A 2XF8A 2GAOA 1PY1A 2AZXA 1F8XA 5KI6A 3JQBA 3W90A 3H7IA 4BB6A 2NSYA 3PNKA 2DJIA 1ISJA 4TTVA 4EVIA 1QVAA 5JQGF 2DBVO 2PT6A 2ABWA 2QN2A 5JDIA 5FOXA 2FPKA 2DWZA 2IEIA 3NVDA 2Q0SA 3ICPA 1Z8NA 4NFYA 5C7YA 4FLEA 1SVIA 4MWGA 1V96A 2HK7A 5EE1A 4NARA 2QVYX 3CJQA 4QTYA 2OK7A 1MPXA 2JIZD 1CIVA 5IAJA 1XLVA 1TL7C 1XMJA 3TRDA 1JEAA 4YRGA 2UYGA 1KKLA 4GZ5A 1KP9A 4PR3A 5FA8A 1LZKA 2Y71A 1YQUA 4OJNA 2GX6A 2W2VA 1CS4C 2R1VB 4Z7OB 1L5RA 2CK3D 1UKZA 2NZ2A 2DBAA 2RHRA 3TWVA 1B43A 2DX7A 5DGDA 2Q5CA 1ZAYA 7MHTA 3RFCA 1CUCA 4EO7A 1FP1D 1IY8A 2QMZA 4K6GA 3PC2A 2P9NG 2IXAA 2OLKA 1OY3D 4HBZA 2LKDA 1IQRA 3BGWA 1PG0A 4XARA 5EHNA 3BGIA 4DNXA 3K9LA 1FMLA 4EHNA 1Z3CA 2LIVA 3DWEX 3OX2A 1GV0A 1IPEA 1JG3A 4BKRA 5BYAA 1E9BA 3UI2A 3C2QA 2YXPX 2OG2A 5DJ5A 3LY8A 1DC2A 5FULA 3GLTA 4C6TB 4N8DA 1OH6A 4O4IA 1U8ZA 5F2KA 4DA7A 4HWRA 3GP5A 3WMRA 3SZ3A 4MV1A 2JI9A 2ARKA 1HDIA 1IXVA 3HN2A 4G67A 3UA3A 3VSEA 1WSDA 2J4CA 4DV7B 3WWYA 1QLWA 3GHYA 3VLDA 4BFTA 4PCUA 1MUUA 5G04C 4ZO9A 3E1GA 5I4BA 2OUIA 4OA8A 4JB0A 5L51A 4JEHA 5AJDA 3H2ZA 2GBIA 2QV0A 1W44A 2FFJA 2Z1DA 4CMIB 4QGFA 5F4ZA 2O5RA 4B5KA 4O4JA 4R9SA 3IH5A 2FPWA 3ZVLA 2ZGGA 2Y1OA 4YFYA 3SNHA 4R8MA 2YJ5A 4M7CA 3KEQA 3BJIC 3MGGA 1QAOA 2XVAA 4RH0A 4NV1A 3M4ZA 1YYHA 1AGNA 5FNVB 4MQ4A 3L1HA 3THSA 1H4VB 1QH9A 3B2NA 3ANSA 1KZ1A 4DX6D 2IYSA 3FH0A 2XYHA 3G8YA 3OIDA 4P83A 3QVVA 2OYCA 2YDXA 3UT8A 3HFJA 1FSZA 2OORC 4BQEA 4XEHA 5TF4A 3F8SA 2H2AA 2NU6B 3LUHA 2IS2A 1WULS 1XYGA 4HRLA 3NTXA 4J2TA 2BFFA 4EBFA 4I5IA 1L4UA 1VLVA 3ZXIA 2C8LA 4J76A 4ILGA 3V4ZA 4MKFA 4U7PB 1ZP6A 3GGGA 4JLDA 1KY2A 4FUTA 2AKEA 1E1CA 2JEKA 1SHJA 3AVXA 2BHSA 4X9XA 3K2QA 3OT4A 1CB0A 4DEYA 3MF4A 1QHHA 3I9MA 2ZBDA 2XE4A 5K3AA 1OI3A 3RK1A 3EAQA 2XZTG 1I1NA 4GGPA 3D5TA 3GDGA 3CKMA 4QRDA 2Y1GA 4BO5A 2GPAA 2IWHA 1914A 3EB9A 4G97A 5IZ4A 4Y2TA 4QDKA 1OH8A 2WWGA 3FR8A 3X2FA 2HD4A 3FMGA 3UNXA 1DXYA 4FLMA 4HDAA 5KJEA 3O8QB 2XIQA 2GVDC 1JXAA 3RHTA 2JLAA 4F46A 3ZH2A 1N7HA 1XMIA 1MJNA 3FSRA 1JZQA 2REQB 3PYMA 5KNCD 5A5FA 5BPFA 4RFSB 2MHKA 4UM8B 3EFHA 4UU7A 2GDZA 3ZJ4A 1CJTC 2W8BB 4JQZA 1KH2A 2I2BA 2J4BA 3V9AA 1BE0A 3V80A 2H48A 4PH4B 2KZTB 2GZ2A 1QVRA 3TQSA 1AZLA 5C5CA 3E03A 3MHPA 5M5BA 2QGZA 3I12A 3AEUA 3LVBA 4PINA 1CVLA 1GQRA 3OZXA 1RQLA 2M63A 2O0LA 1EBFA 5ITZA 2VBIA 3JYSA 1E58A 4BV3A 5AH0A 4C5CA 1M2OA 1NI5A 3UKUG 3JCKC 1WXXA 3WJ7A 4PM4A 2HSDA 1KSJA 4NIKA 1I0ZA 1UJKA 3D7LA 5E9WA 1Q91A 4MAAA 3KQNA 4FEAA 1ZI6A 4JC0A 4URZR 2VSXA 5B37A 3V4VB 2XMBA 3E0QA 3TVDA 1MH9A 2HBYA 4YP7A 1OLXA 4ZVKA 2XNKA 1U0HC 3RRMB 3FFWA 2VK2A 3G8DA 5IJ0B 4B3IA 3FJOA 4CZ2D 1N3IA 2WPNA 3WG9A 1IOVA 2FUEA 2G07A 4AKTA 1R4MA 1F48A 4P7KA 1P29A 2ACEA 4MMYB 3VR5H 7MDHA 1OILA 2WXHA 4TS4A 3LPMA 5C53B 4QOIA 2JGIA 3GDHA 5AW5A 2VA8A 3QI7A 2BPOA 4Y7DA 3HXKA 4DC1A 1AO3A 1GKLA 1YZUA 4LNUB 2FN9A 4JOCA 5AVRA 4J0EA 1SRQA 2WMNA 4UHJA 2UZ3A 3ZC3A 4TWZA 1M1NA 3K73O 4PN3A 4MS1B 5JZOA 3SF8B 1ZU5A 2Q28A 4YRTA 5AUPB 2VPWA 4LZPA 1FQJA 2EW1A 2ZULA 4N0EA 3CUKA 2VTBB 3VU8A 2HREA 2Q9CA 2NV2B 4L9RA 1N2CA 1U5BB 3TF5A 3W2HA 1S1CA 3ZZ0A 1L5QA 1TNYA 1QHIA 4J6FA 1U2SA 3A1DA 4O4HF 3J5PA 1CUVA 3FDIA 3I9NA 3LGSA 4MTCA 3V8QA 1TUBA 2WA1A 1Y63A 1CUJA 2PKEA 1DX4A 1GYRA 4OX9B 1IOZA 2IA5A 3SFXA 4BKMA 1HNWB 4IIEA 3IJPA 2CSXA 3WLAA 3QVOA 5G55A 1KGDA 3DVAB 5J5VA 4R7GA 2F1HA 2X5KO 2JNWA 3IIKA 1NP7A 1LS6A 4D4IA 1WL8A 1YQDA 3V7YA 3TZKA 1DUVG 4K7JA 4MZXA 1GPNA 1B74A 3QJYA 1MBZA 3ICEA 1QGYA 4AQYB 3QIAA 3M5CA 3TG5A 2FVYA 2F3RA 3CUYA 4ZEMA 5CVVA 1MA3A 2AN3A 1V39A 4Z9FA 1S2NA 1G5PA 1VJ5A 2D2VA 2YHCA 3FX2A 1RRVA 5JTUA 4XKJA 1E1LA 1C3OB 1JSCA 4D8UA 3KXKA 3KSUA 2DQKA 2ORIA 4A8JA 5FLEX 3EC1A 4PWYA 4UHFA 1LBHA 1OXBB 1VGVA 4B2YA 1ZN8A 3CRRA 1QXSA 2WU1A 4R9RA 3K0BA 2D3TA 4Q93A 4HQRA 4IFEA 3ZU6A 4YRAA 1SVKA 1XZAA 5G05C 3ITEA 5TF0A 3PHCA 5LWHA 3ZXYA 1CV2A 1NBOA 2BEVB 1SMKA 1I6WA 4YJGA 3CKKA 4G8CA 4EYOA 3K35A 3AIOA 4BNLA 3L84A 1SXIA 1UK6A 2W70A 4X44A 1PSWA 2WUEA 5DM4A 3TB4A 1XU9A 4YBZA 4QQNA 1E2JA 4E5PA 4TRNA 1TEXA 3NOVA 5HQ3B 4PSDA 4HXGA 1UDBA 4AJIA 4ZMRA 4OQNA 3LCMA 4WH0A 1DWPA 5H3HA 4LYAA 5DBHX 4LCJA 5BN5A 1M2WA 4KI7A 2OQVA 2H1LA 3TZLA 4Z4CA 2E3JA 1SZAA 1CWUA 1IL0A 2DYKA 2XA1A 3TZHA 3K70D 1Y82A 1MO5A 1VPVA 3H17A 3J7TA 1GFSA 1KFBB 3EUVA 1PG2A 2EBUA 2GCEA 1LLCA 1U28A 4A5OA 1MENA 4NRHB 4UHHA 4JEUA 1ZL2A 2ZT7A 3FN4A 1MHPA 4HH4A 1M8JA 4ZOLF 1OXSC 2X9LA 3KT6A 5A4JA 4BX3A 3QKIA 1T6XA 4ZRMA 4INAA 2PAAA 2VBFA 3U7JA 1GG5A 2CDNA 1IONA 1GXSA 2ODAA 3AM4A 3OIVA 2I1QA 2Q1SA 1Q0HA 3HRKA 3RK4A 4IIXA 1FE8A 3ZNQA 3VDQA 2WAOA 5KYVA 4NBSA 5DLPA 4WOKA 1OXUA 3UKJA 1TYAE 5G0SA 3KZOA 2C1XA 4M9ZA 4B4VA 1RR6A 2IIQA 4I66A 2J3MA 3EMKA 2QKYA 1H5NA 1U8EA 2I3DA 1HYBA 4F7AA 5FL7D 3CX6A 3LPAA 1XJ5A 2GTIA 4YALA 2DOKA 4QD3A 5IXSA 4ASUD 3PA6A 4NECA 4B6PA 4KGXA 1LSJA 4ALLA 2CWDA 4RA6A 1ZKMA 4MGKR 4KK4A 4FDLA 3KQTA 4AF8A 4YRIA 4WJZA 4NE2A 3RFTA 3IOMA 3C8MA 2ZDHA 2D5CA 1JUQA 1KSFX 3M70A 2AJ8A 2AIRA 2I76A 1NDHA 3DSSA 3Q3VA 2VC2B 1VI5A 1RVDA 2YHIB 5LQKA 4C01A 2IY9A 3DWGA 3VJRA 4NH4A 2DWPA 4L6IA 3PFNA 3BUSA 3TIXB 4W5HA 5HKBA 4HH0A 3E5MA 1RADA 5LMCA 2WSMA 2X0KA 3SOPA 4X91A 3IL2A 1ZBQA 3EDQA 3ETCA 2CZGA 2IDMA 2R6HA 1E1YA 3QU7A 5LOVF 4BQSA 2VQSA 2H29A 2HJWA 1EM6A 2FW9A 3O9VA 3VH4A 1PNTA 1W4ZA 4OBXA 3HXQA 4A6XA 1KK3A 2WFAA 4KQ9A 5LYJB 1QR6A 1WDWB 4UJ3A 4FCTA 1VKJA 2ZRCA 4AAYA 3FCAA 3N6RA 1Z0JA 2PRSA 3L17A 3IPAA 2YVKA 2F1OA 1RKUA 3FSEA 1NBME 5EUQB 2PKXA 3PZBA 3JVIA 2OVFA 3SQVA 4ALMA 5ISMA 1ZXBA 1HEYA 3G2TA 2DPYA 3JYPA 4K5QA 3ND7A 3VDRA 1ZJWA 4JR2A 4MEJA 5EC8A 7REQB 4KREA 3Q79A 2KW5A 3GGJA 3A2NA 5DI9A 1Z2DA 1HDOA 2B94A 3PQ8A 2BKEA 2I6GA 1ML3A 4UHCA 4X8LA 4H1HA 1Z6ZA 1VE9A 1HOXA 3O7MA 1GADO 1OD6A 3T7RA 3GFRA 3P9KA 4E2YA 3HSYA 1TTHA 3EXFB 4P35A 3N2KB 1N0VC 1TQDA 1QHXA 4FN5A 2QP4A 5DO9A 3M33A 2FSPA 4YY3B 4KMMA 3WKBA 3O38A 3AF5A 2A6PA 1QORA 4Q1VA 4DA8A 3I6ZA 2DHCA 4M0FA 5B55A 4WEOA 2V0GA 3IEGA 4K9RA 2ESRA 3OWOA 4N54A 3QTTA 4MV3A 1E63A 2PS1A 3UT6A 2IV7A 4I1OA 4LJ4A 1Y1SA 1XWWA 4AP6A 1VOTA 1SXJD 3KBOA 4IF4A 3ZYZA 5KJCA 1XTTA 4JN6B 2D1YA 2OENG 3DAFA 1O8BA 1PFGA 1R66A 2MR6A 2DFVA 1AZSC 3KAPA 4FBMA 4C4SA 3MWFA 1VJTA 2D13A 3FOBA 3ZWVA 1ZM4A 1MPTA 3JAWA 2BSAA 1SW6A 5K45A 1KEEB 3ADDA 3HLYA 3C1TA 1FVXA 3VPBA 1LBQA 4ZT4A 3EWIA 2HM8A 6PFKA 3CSTA 2O19A 5M04A 7GPBA 4ZCMA 4TMFA 2LR0A 2HHLA 3FYDA 4GQBA 5CCEA 3OURA 1DEHA 3RTEA 2G0TA 3KZVA 3F2VA 3L7LA 1V25A 4A1SA 4ZAWA 4KYIB 1JCRA 2XQGA 1YZYA 2BONA 2JCGA 4NOMA 2ODPA 5EEHA 4Z9YA 2R02A 2RE8A 3AW8A 2ZT8A 2PZAA 5T6BA 3FWHA 3EVFA 4FMBB 4CF3A 2F48A 3LPCA 2HLNA 5AD1A 2ZRQA 3UJ8A 1I7PA 3EGCA 6AT1A 2C7BA 4TXHA 3RS0A 5F98A 2FPXA 2GPWA 1OFHA 5T4EA 3HM9A 5TGDA 2CY0A 4G0VA 2Q45A 4HS2A 3T5XA 4IOKA 4LDAA 4EA6A 2MTBA 4CEMA 4JLPA 4MEAA 1Z47A 1A50B 2IU6A 3CIFA 1HFKA 1YS9A 1TO6A 3GFQA 3ZCXA 5M29A 5LZ2A 4O4LF 1CP3A 1A2QA 1UPFA 2HSGA 4KN9S 3TOXA 3HR4A 2NPFA 5D0OD 1X14A 1X1DA 2W2MA 3X2SA 1YRQA 1M1YE 1U90A 3OQ1A 5CCDA 3VR6A 1QO9A 4OX9Y 1FNBA 3RANA 3ZWQA 4EHBA 3CQ9A 3ABIA 4BXOA 1IU9A 4H1UA 4KPEC 1C5KA 2QQEA 2XS8A 5GIPE 3NAMA 1QNLA 4DRYA 5CX1B 2X0RA 1ZIOA 4ND6A 4URVR 3ZYMA 4C4TA 5CFZA 3ZJ5A 5K8JB 2CN1A 4U7HA 4D6PA 4BJHB 1NVEA 1MORA 1HV8A 2C2BA 4LXYA 2YMMA 1ZD4A 3Q3EA 3HBMA 2UZ4A 1PC2A 3DLTA 4B33A 3T1TA 3A6GA 2QG4A 1CZHA 1NI3A 3QXXA 2Q0XA 3GW4A 3ZDFA 5AVYA 3I53A 3DMTA 3VU1A 3NHLA 2FG6C 1EVYA 2X1MA 4PZZA 1TM4E 1TT7A 1U5CA 5CIQA 3N86A 2A35A 2PS9A 4GLJA 5T4BA 1I13A 2QRLA 2VP0A 1UT5A 4EY6A 3OZRA 1VXRA 2PR7A 3FCUB 4Q1FA 4IF6A 1FVOA 2ZXFA 4WN3A 3OZBA 2BCEA 3B52X 5B1DA 3LF2A 4F2GA 4IOJA 1ZZGA 2PT9A 1AK2A 2YICA 5K9ZA 4FHFA 2PL1A 2RBGA 4F8YA 1P2VA 1II0A 4DCVA 3WLHA 4MPJA 1NZFA 3ZKWB 3F7OA 2C4TA 4CHGA 3R8CA 3RVPA 1KO5A 4X5OA 3WLRA 1KJWA 4IJQA 2ZJ5A 2WHQA 1N0WA 3L6EA 1NW7A 1Z6XA 4ZK6A 4XX0A 3BEOA 1FFCA 1UC5B 4YAJA 4OH7A 1RWBA 2NVUB 1JH8A 3QTLA 3KZCA 3ZD9A 3LUKA 2Q5LA 2WFLB 1Y7TA 4H7IA 2EEPA 2OK8A 1P62B 3NBXX 4ZAXA 4I4TA 3L1VA 3HVEA 1BQ4A 3AVWA 3GZ1A 4PG5A 1RP1A 3YASA 4BE9A 1MC5A 3PFWO 3FDFA 2GRQB 2YBEA 1P44A 3ZU7B 1WKCA 4LEUA 3PF9A 4HSEA 1XO1A 2OFXA 3CLKA 3V1MA 3I42A 3A36A 4A3SA 5IW8A 3OOJA 2JGEA 1II8B 3OMXA 2P2ZA 5HE9A 1MB3A 2Q4TA 5E75A 1IXYA 2E48A 3V8VA 4HBDA 1UIRA 1MW8X 1E8ZA 5SYMA 5JZSA 2I03A 3FROA 1BXRA 5EPOA 4NZ9A 5K8IA 2QLBA 3JRXA 1U2DA 1WDTA 3DEYX 3IX7A 4I8XA 4LHZA 1L7VC 3CFYA 4KR2A 1O9HA 2FSGA 2C99A 4DABA 3HA5A 3BZUA 2P4EA 3H1GA 3CCCA 2HSEA 3GN1A 3QHQA 2NUPB 2R5SA 2WHYA 4EHKA 2JGJA 2V4UA 1XYVA 5AXAA 3CNBA 3MSCA 3EIUA 5BUQA 1T0HB 1H1DA 3RTGA 3SXUA 1OWOA 1MZCA 1CUHA 1OXKB 2FEMA 3N2GA 4HMPA 3LPNA 2V7GA 3HZRA 3AUKA 1A8UA 1XQWA 2MSKA 1M1UA 1SXJC 2OZLB 1VJGA 4NZNA 2QVGA 4M9UA 5MN4A 2BTDA 2ZSIA 5A05A 3E61A 5ARGA 3IIJA 3RM3A 5LLSA 1TA4A 3SYNA 3NATA 4AECA 4IIFA 3X1KA 4FX5A 5KQRA 1G3UA 3U4IA 4AKHA 2II6A 1YQEA 4IQFA 1L7BA 4W7SA 2HJVA 3H9UA 3RC1A 3UX4A 3IV6A 2IYUA 2GGFA 1RAEA 5BR7A 3HG7A 4X7PA 4B89A 4IRXA 2EGUA 2ZBFA 4JUDX 2IYTA 3JAKA 3LQFA 4DRZA 1JWAB 1AXRA 2WE7A 3U3KA 2XCIA 3OP1A 5HF9A 3QV1A 4RIFA 2H2WA 1ORIA 1QVWA 4XA8A 4UUPA 3KUCA 3F5FA 4KUGA 1KSGA 3RSFA 1NVTA 1FMJA 2AX3A 3T3HA 5E38A 1T2VA 3P1JA 2JB9A 3Q9SA 5AOXA 3PRHA 2ID7A 3N8GA 4QFBA 4JS0A 3AJDA 1B0PA 4Y2GA 2G1KA 1ODJA 2HT1A 2G08A 3D2LA 2FO1E 1GPUA 3A4YA 3RIXA 2J46A 2ERYA 3ENWA 3OPMA 2A1IA 2HU5A 1E1QD 4DJDC 5JSZB 2YX1A 1N2EA 2RAFA 2GXSA 1YQGA 3U9WA 3O1HB 4I43A 1S2LA 3PU6A 1RWKA 2AKAB 1K1AA 4B79A 2O7QA 4BAGA 1JDZA 2WOJA 1G291 4I9GA 1JJIA 3L1IA 4UATA 4BP9A 2BJWA 1GQOA 3VSBA 4J49A 1F7UA 3ROPA 3BWDD 1FMFA 4IAOA 3HBFA 4YJ2F 5CT6A 4LRUA 3QSGA 4AP2A 1Y7HA 3RS9A 2JA1A 4MB6A 5CD1A 4UAJA 1ZICA 1C7QA 5CIYA 2XKKA 1VQ1A 4RV5A 2WM9A 3NXSA 3DTNA 1HFWA 2ZTVA 2WJ4A 1G0OA 2O8BB 1H23A 2VPXA 2WF9A 3VVBA 2JAHA 3RBZA 2FFGA 4HEQA 1YB5A 1E7YA 4JEIA 5F5XA 1R6AA 1V45E 5HKKA 3U4GA 1TTPB 1A1VA 4YV7A 4CPDA 5IAGA 3DRAA 4MYCA 2H65A 2KM4A 2FFAA 4CM4B 1ODKA 3IUQA 2B2XA 2E4AA 2ZBVA 4Q3KA 4OK6A 4BZQA 3M6MD 3OIYA 3EG9B 2BRUA 2Y9PB 3PXCX 2V6GA 2LCQA 5HRCA 1UEXC 3MTAA 1JG7A 4ZYZA 1DX9A 2VQ3A 4U7GA 4EUSA 1U98A 4D3XA 2QF7A 3UQ3A 1TRKA 2RK6A 1N11A 2ZUSA 1NRIA 2OXCA 2ZUTA 1A0OA 4ZCTA 2XXAB 2WIGA 3QA3E 5ALNA 4LF5B 4HAUA 5DTMA 3E82A 2VCHA 4F91B 5DV9A 4HGYA 3SLRA 2AOWA 3T3NA 4B32A 1TCBA 1LI4A 3ESCA 4OG2A 2J9FA 1PG5A 4DUYB 1IWOA 2IU1A 3W3AD 4AS1A 3AONB 2HHCA 3GJ6A 3CEQA 2FQYA 1MF7A 3FUXA 3AY6A 2E82A 3A3NA 5D1HA 1Z4QA 4WKBA 1E8MA 1PHPA 5F1YA 1MG5A 2DHEA 4EENA 2QQ0A 3D1LA 4XLZA 3E8XA 3EUWA 1EDZA 3BKXA 1NVMB 4PYIA 3LT5A 3MKRA 5FBLB 4CNBA 4XPIA 1W0KD 1TO1E 4YAGA 5FBKA 3U3DA 3W4JA 4QUDA 4NNPA 1E66A 2JL1A 4YJDA 2QROA 2JI8A 5FBHA 4JXTA 3NC0C 3CM0A 5J2UA 1JG1A 1W8DA 1WV1A 4I36A 5A02A 3EIWA 2FZLA 5KKNB 5HK8A 5KVQA 3DNMA 4M60A 5BN3A 2VEOA 1SH7A 4B7XA 2FJPA 1YQTA 1RLTA 1BXKA 2PQ2A 5AW1A 3WB1A 1Z2PX 3CY6A 3SXPA 4UEOA 4GECA 3MEQA 1CNFA 2WDZA 3DCYA 3E9EA 4ARAA 3L0SA 3L4KA 1OVMA 4ZOBA 4QTXA 2PV0A 4PUCA 1Y8CA 2IDJA 2GYWA 3ESZA 3H13A 4F3VA 2R6CA 3SZLA 4F72A 2GVZC 1F2DA 4FS3A 3C6ZA 2Q3EA 2C1ZA 3GEPA 5CMLA 3GT4A 1GSOA 1SG6A 1M6NA 2AUMA 2HYDA 2MMCA 4W1PA 3GQBB 1ZU2A 4TYPA 4YJHA 1HT2E 2QRVB 2J7PD 1TJCA 5LLDA 4EUEA 2QMQA 4ZMBA 1D0IA 1FX0B 4QOJA 2H7CA 2BDUA 1RJEA 1EHCA 3LC0A 4Z0NA 1K7SN 2WM2A 1BVRA 3IA2A 3QHAA 3PPXA 2G71A 5JNUA 3V4PB 3F6RA 1JWBB 5MGNA 1CJVC 4MUJA 2J85A 1WF3A 5HBGA 1HLFA 1P2DA 3FAZA 5ARDA 4LJ5A 3E7PA 1DU4A 5KSPA 3RUEA 2GXUA 1XF1A 3MTIA 3OCJA 4HKTA 2H1OA 4O02B 2VJKA 3R8XA 4RELA 3W1VA 1F17A 3MCXA 5F3WB 3U62A 1SHLA 3O4JA 4DLKA 2E4XA 5IKPA 1PWEA 2F0YA 3AKEA 3VTAA 3PSHA 4OYHA 2Y1WA 3SDZA 3B1WA 5F7XA 1JILA 4DLLA 4LNHA 1K7FB 2C9DA 2DFNA 2J32A 5FQ6A 5PNTA 1G21A 3KSRA 3LAWA 1FK8A 3BMOA 5E4FA 2RGGA 2FMHA 1U8TA 1NZDA 2ZIAA 4NE9A 1X7HA 4OAUC 4ENTA 4KYTA 1GL9B 2PUDA 2PL3A 4UVHA 1QIMA 5IVHA 4C3VA 3NBKA 2O54A 4LX8A 4Y3UA 3MUEA 5E0OA 3T3IA 1BCRA 4YWJA 3IAEA 3UCXA 4FE4A 4HX5A 1EE1A 3U44B 3MT0A 1DT5A 1TNDA 4B83A 3I62A 3DE2X 3G5MA 1V55E 1D2HA 4L6CA 2YIDA 2Q3JA 1TYCA 4ZMSA 3T5TA 5C8YF 2Y6VA 5EZ6B 2V3CC 1Y8RB 1LTXA 4C6HA 2ZDQA 4OLJA 4ZQIA 4JBHA 1E79D 3BL6A 2B0CA 2E87A 1ADFA 1W581 3THXA 3DKKA 4QM6A 4F6RA 4EA7A 1S2DA 3QELA 4NK4A 2QU8A 2JGDA 3B3FA 1EGHA 1SD2A 1E32A 4H3SA 3X0DA 3KYCA 4NU8X 1ZD5A 2EFJA 2Q5QA 1W3BA 2FZEA 4XZ4A 4C5BA 2Q4DA 4GOND 4YECA 5TMEA 4LRQA 3B82A 1U7IA 4D3FA 5EERA 4JSYA 4XVRA 3G7SA 1K0UA 1WM5A 1NW8A 1UEJA 2FW0A 3QYJA 3CNNA 2IPOA 2VHTA 4Y9TA 2Q29A 4CM5A 2BFBB 2HA6A 1RT9A 4HS4A 4TTTS 3BCHA 4WESA 2UYHA 4MP6A 2BKUA 5EJ4A 2ZQZA 3TEFA 1GDTA 4L9SA 4P32A 4KSCA 3AHDA 2K2WA 2Q1TA 2I78A 3KEFA 4GE3A 2A7QA 3O84A 4QEZA 4OF4A 3OE5A 1V48A 2YW2A 3FHOA 3AR6A 3FUWA 2P8SA 4ADSG 3F2IA 4OEHA 4NICA 2R7LA 2WABA 3ZHBA 1ORTA 3ASZA 1NX6A 3ABRB 5ALWA 3G8AA 3B1KA 4KACA 3GZJA 2V7UA 2PX8A 4EKYA 1J42A 2ZJ0A 3FUMA 2YASA 4CRWA 3D6FA 5F2OA 5BR4A 1BDIA 3S44A 3OVMA 3MVEA 1J2RA 3ZD6A 3CONA 3O0TA 3GPIA 3WGTA 4UFPA 4IUCS 2YIJA 1U3CA 1U3GA 3TG4A 3B13B 4ZCSA 2XMQA 5A9SB 2HA4A 1ODCA 2O1XA 4PV7A 1ZJ5A 1Z68A 4LNUD 2H2DA 3NVAA 3UXHA 1NVAA 1KJYA 4C3OB 1FXWF 1REQA 5FI3A 5CLQA 3ESXA 4H16A 4NMXB 2P75A 3LI2A 2HO4A 2XJ4A 2CDCA 3S55A 3JTEA 4P93A 2AXQA 2IHKA 5AI6A 2CHVA 1I3MA 1G7SA 2R6ZA 4NE7A 4L72A 5CFLA 1MDBA 4GI3A 3D02A 2YW9A 5BW8C 3RTCA 5JS6A 1UQUA 3O74A 1I7NA 3PQ5A 1WABA 1VGQA 1T9DA 1HMYA 1JU9A 1GPBA 1KO7A 4U6SA 4IV0A 4L7QA 4N40A 4Z4HA 1HMPA 3AFNA 3DKPA 3OCZA 1XR3A 3DBLB 1BFDA 1SOMA 3HCCA 1G9TA 3PD0A 3H04A 3A37A 3ZCSA 1SHZA 4B4UA 4D8VA 1UT8A 1XK6A 1ISRA 4ERXA 4HLCA 4C7VA 1C9EA 1F2UA 5IU6A 2OCAA 3W78A 3SD5A 4TV8F 4UUCA 1MTZA 3FEXA 5FZRA 2FU5C 2O1EA 4B82A 1DIRA 5L7TA 1EIZA 3WY9A 2GK6A 1I2CA 4W63A 5L53A 2MSNA 4ZVLA 1QGZA 4LG6A 3HBAA 4V0ME 2KATA 4NACA 2QRPA 2WIBA 5DYWA 4YP1A 4PRZA 5C5IA 1R00A 1IBRA 4G5OA 2WICA 4F2WA 3L13A 4NCJA 2FE4A 1DIHA 5EINA 1RMTA 3MB5A 3T1NA 3W4IA 4QU0A 2FSFA 3IUJA 2W6NA 3CKYA 1UXIA 3ZG6A 2M6RA 5AXCA 2OHXA 1ZH2A 1E6EA 2WF6A 2PSJA 8GPBA 2VT3A 3KDSE 1GCOA 1SAYA 1YT5A 3DP7A 3QI2A 4JROA 4YP6A 2C2YA 3C6QA 1YFLA 3EQ8A 4HJXA 3B1VA 2B4TO 1W6UA 2QX7A 5B2ZA 2CUZA 1H0AA 1ZUNB 2DLDA 3K9QO 5LN1A 4D0GA 1TC1A 2BBWA 3C4VA 4M6WA 4DE5A 3ETNA 4G0UA 4OHBA 4E2ZA 4QHTA 1PK9A 2QI9C 2QSYA 4Q4AA 1E2QA 5AKKA 2YWDA 3L6OO 4KE9A 2YJZA 3TDMA 2RG7A 5DM1A 2PSFA 1IYGA 2JLUA 3TOSA 3TGLA 2ATVA 1RHJA 1MC1A 1N92A 3R3XA 1TLLA 1YHZA 3ZCRA 3OQHA 1KPSB 1OZ0A 4N5IX 4YJKA 4REQB 4PSKA 1GFWA 1XVVA 5F9HA 1V2GA 4RTRA 3CLTD 2PUFA 3ZHQA 4EATA 2AD5A 3W1WA 4GMXA 1WP9A 1M2GA 2V1UA 3A9CA 2ZR0A 4L5YA 2IGTA 3OZDA 4V1CI 5EE9A 2YYYA 4QPDA 1WQ3A 4L16A 1Y89A 4B6QA 3KB6A 2GM5A 2P7IA 4UWHA 4MRMB 2QYTA 4LJRA 4HT3B 5LQRA 2HY7A 1JLMA 3K1ZA 2A1TR 4LOJA 4RHCA 5JHAA 5H02A 3U2QA 5AVVA 1CR1A 3C3QA 2PA3A 2HCJB 4GI2A 3EZGA 2AMVA 2H4JA 4OQDA 3WWPA 4JUBA 1FSGA 4TYNA 4P3PA 2VHQA 4PAGA 1MLDA 4Z8XA 3RW9A 3G2LA 5TXGA 1GGJA 2XA2A 4X6YA 2YHSA 2CMKA 3OJXA 1G66A 2R6FA 4AICA 3L7JA 3JX9A 1QV6A 4YTEA 3SFVA 3ZNGA 1TN6A 3HVRA 3BFJA 4W5RA 4EEXA 3CHOA 2VS1A 5JJTA 1OVGA 4TQ9A 3SSAA 4GW3A 3R75A 4OGGA 4GZLA 1U0EA 1YU6A 1DBRA 4S12A 1AH2A 1PIWA 2EJTA 4NP6A 1ZVVA 1H3NA 4MZDA 5FCDA 2HMSA 3PJDA 3SHOA 1NKVA 4FOPA 5AM4A 2PRZA 4E6PA 3KHTA 3G2PA 1C1XB 3MCZA 3Q6MA 3HXPA 4QYMA 1G6KA 1IRIA 2VJLA 4ZN6A 2HU7A 2IOFK 2C88A 2NG1A 1ZKDA 1UDXA 1P8JA 1B0ZA 3CSFA 3LUBA 4A73A 1T2FA 4QXQA 4W9NA 2J3QA 2H00A 3NXKA 3U9LA 5CB6A 4WA7A 2ZRJA 4M8NE 5AJZA 1MB0A 5LKAA 4GDFA 4Z4GA 1K7CA 3T54A 4BU0A 1USVA 1QGED 2CNBA 1F1BA 3N2LA 1Y9ZA 3CCBA 4QFCA 1ZHHA 2WJIA 4UTZA 2I65A 4RVGA 3CYFA 2VHWA 4IDFA 1XZHA 4MDYA 3SWWA 4FCVA 2H6GA 4C4AA 3EAFA 4BPBA 5AVZA 1DPFA 1HDCA 4II2A 1ZISA 4EG8A 2GFHA 4YIHA 2AFVA 3VV3A 4XQ0A 1OA1A 4NQRA 2GSDA 4RU1A 5P21A 4AP5A 3WIVA 5AW4A 4FFWA 2WDPA 3NHRA 1SCKA 2AKYA 3HL4A 2ZB3A 1H19A 1V5WA 5HRUA 1CJKC 2PT5A 4EARA 4YAEA 5A71A 1P74A 3DE4X 2HO1A 3V4OA 2ZBUA 3IAXA 1OBFO 3UT5A 2VAWA 1LEHA 3OCVA 1MR3F 5JH7F 4G23A 5DSXA 3AKCA 4F4HA 1IHDA 1GOTA 1EYHA 4X92A 4CDMA 2IH4A 3HXDA 1QRRA 2GK3A 2FDRA 2FPPB 2UDPA 2OBMA 2XT6A 2A84A 1R74A 3EHNA 4CF5A 1P39A 2ZWAA 3HCBA 1IG3A 4PNPA 4LRXA 4N5HX 1S89A 4QEDA 3DEAA 1XZLA 1YA0A 1NJGA 2DLCX 4B4KA 4R8KA 1L5GB 2C5SA 2GPNA 5IPFA 1CY8A 4ATGA 1H42A 1A9ZA 2V4LA 3WLPA 5DK6A 5AENA 1QUFA 3AEKB 1VLQA 4C4YA 5JD4A 2XXJA 5JHHB 1UJ6A 2E49A 1M5TA 5KQLA 1TYZA 1OYYA 2DZNA 2HF9A 4LQCA 3TRFA 2VQ6A 4ALIA 2RHDA 1B8PA 1P7PA 1GRCA 5E7QA 1XJ0A 3BE6A 1FRVA 4MJLA 1PJSA 4KGVA 1E3EA 5HK9A 4G56A 2OOKA 5CBPB 1DGQA 3DSTA 1WZNA 4GLFA 3L9WA 2XNJA 4C7BA 2D59A 4UTVA 5A4MS 5BSRA 1FCHA 5CNJA 3OQBA 1CQJA 5D87A 5G0UA 1W59A 2NVOA 3LWDA 2DH5A 4XDHA 4QT4A 3CKBA 3A2LA 1V43A 3RS4A 1GZUA 4DKXA 3LCCA 5I8PA 4EJ0A 1UZAA 2P6NA 4WNIA 2OO5C 3N2IA 4O3FA 1BTOA 4QUBA 4S1WA 4R81A 2FHSA 3L7CA 1Z6GA 1BXGB 4LZZA 1NKTA 3A6FA 5F23A 1IKND 4QARA 4KIUA 3HYSA 2ZZKA 4X1YA 1U7OA 1KYQA 1C8LA 2DQZA 1V7CA 4IH4A 4JXXA 1RJFA 1AXEA 5B58C 2AJLI 1OOEA 1NMZA 4HNAA 3OIUA 1DVRA 3LXXA 3WRXA 3I3NA 5GZ6A 4LF8B 2XZLA 3K0EA 2FOLA 2LIPA 3NHYA 2PL5A 2L82A 1NSYA 4I0WB 4D0NA 3UGQA 3OQOA 4PYKA 2P9FA 3QMVA 3QRWA 4R1NA 1T36A 2CL0X 1YHYA 2YUIA 1JBKA 5K6AA 5JCOC 3DDOA 3QPAA 2X5JO 1GAWA 4BJ1A 1E3IA 1KJJA 4LRSB 3TM5A 2XCOA 3RD5A 2ZXUA 4MKXA 3CW8X 1YDHA 3S1LA 1EE2A 4J8DA 1VKZA 1I8TA 4QIHA 4QJ5A 1QIEA 5F9MA 4LERA 1NYRA 3TW6A 4YGYA 1QHYA 1IZ9A 3MIIA 1JQJC 1AQ6A 3GLGA 2VUHB 1G5QA 4EJMA 4WPGA 1IM5A 5BSGA 2RH9B 1N75A 1WP4A 2FEWB 3DT9A 3P4XA 2Q3BA 2G1AA 3NNSA 4WBSA 1H69A 2JHCA 4KPUB 3AHIA 1BVYF 1ZOSA 2ZIUB 3EOBI 1VE6A 3GRZA 1VA5A 1WU8A 3D6UA 3O5AA 1XAIA 2OEVA 3OXGA 1G4UR 2PS0A 3P26A 2D62A 3O9MA 1GO2A 3RTAA 3V2GA 3DMFA 3K71B 1S3SA 4OQEA 3B5IA 1UC8A 2QUKA 1X1AA 3TZQA 4UVGA 4C30A 1GGVA 4URHA 4UM5A 1NYQA 1ND6A 4DLPA 1G5FA 3UK2A 5JRZA 2O5VA 3CGGA 4HLUC 5BSHA 4C14A 2HTFA 2DVWA 3S2IA 2JLVA 4BB9A 2Q50A 3TXAA 4B3XA 3RSQA 5IDWA 2B4YA 4KUHA 3HB5X 2C54A 3B53X 1UKCA 4F5YA 2I2CA 3EIFA 1JFVA 3WYBA 4KR7A 3QF4A 2VGXB 2Q1YA 3S7ZA 2QPOA 1CZRA 5KQGA 3OWXA 4F3CA 5DLEA 4LG1A 3P0IA 1DKOA 3PTAA 4YXWD 5KJKA 2B78A 1T6NA 1V1MB 4IIJA 3G2SA 1R0KA 3MK31 2QW1A 2VK1A 3D0RA 4W5QA 5I7FA 2WYOA 1D0VA 2HGZA 1SFRA 5FJJA 3GLUA 4J94A 3TD2A 4XCVA 5A7DB 4BASA 1IWPB 3GLFA 3RUCA 4BRZA 3MCTA 3FYTA 2Z9BA 2VHEA 2VTEA 5L3RA 3CEMA 1QRTA 3GJ3A 3B8EA 1N8SA 5G0TA 3WTCA 2VRCD 2IYEA 2OHJA 2DYSE 4O2LA 1KMHB 2JI4A 1UK8A 3RRNA 2EYUA 1QIFA 2IPLA 1TRHA 2HCFA 3HDTA 3JCZA 1M10A 1OT8A 3C4JA 4H1VA 2GBPA 3OC6A 4DTIA 2HRZA 1BI7B 3DT6A 2DIWA 5JVDA 3D5EA 4ZKEA 2WP0A 2VDMB 4UVIA 4KXUA 5IFKA 1O87A 1X39A 1FIUA 4XGKA 2LW7A 1P1KA 3MWKA 4QO8A 3N39C 2I34A 3HA2A 2PYIA 3IPCA 1KS2A 5TV2A 1QMPA 3U4AA 1JB9A 5I7SA 5GWXA 1A8IA 2RAPA 1UBLS 3WBFA 2YCLA 3N59A 4IQ8A 2L0IA 4DLZA 4MS4B 2JVJA 2Z9DA 3GGPA 5IJ9A 5FPKA 3O95A 4M36A 2ZUUA 3IDSA 4JY7A 2BE9A 3OD1A 2NQTA 3TL6A 1YC5A 4BEPA 5BYBA 4P34A 4B7AA 3Q7IA 4N5CA 4K46A 4JZKA 5K8VA 5LP6A 2GT1A 2J5KA 3AJAA 3LCVB 4PLFA 1ESNA 3LWZA 5CB4F 1U8AA 4BAUA 3D9JA 1NUHA 2KI5A 3FI9A 3KLPX 4H4EA 3M6VA 1VCNA 1WW8A 3AS4A 4GI1A 1HC7A 3ONWA 3SS8A 1COWA 2HUNA 1VL6A 1LLFA 4OIMA 2WTUA 1C41A 5IK2A 2HZ7A 4HOTA 2G67A 3VFDA 4XYBA 1JPVA 3SVLA 4GG1A 3ZCPA 2NSJA 1HTBA 4G0XA 4CCYB 1KO8A 3KPYA 1USGA 1BGVA 4QQ8A 3RO7A 4XM0A 4GICA 3EG5A 1G8HA 2AT1A 4XDGA 3JYHA 1YNOA 2CLFB 3QH4A 3MHTA 1KZ7B 5DN9A 4HQDA 2ZRNA 3ORRA 4RVFA 4Q3LA 1NQXA 3QLUC 2KBEA 5F77A 3C3CA 3TTYA 2BFCA 4FFRA 4L0DA 5JWHA 4C7OB 5FOWA 1QMOE 4BP3A 1GGHA 4UVDA 4ZI7A 1GUBA 3ABLE 4BNMA 4JLSA 4CBVA 3AVTA 1JIIA 2C5GA 1Q0UA 3F6QA 2B92A 2VNIA 3NO4A 3FDJA 2HL6A 3L6AA 1KZOA 4YQEA 5JTTA 1FFEA 4R54A 3IP7A 3FF4A 3GHHA 1I4OA 4I4IA 2BHLA 3DPUA 5FTMA 4GTTA 5JXJA 3CC8A 2DUUA 4FJ0A 3F98A 1O6CA 4TYMA 4GX5A 4WECA 2WD8A 3WXMA 3TSOA 1SZPA 3DXZA 2H52A 1W52X 1IY1A 1F4PA 5BNWA 3EE6A 5DGTA 4AWXA 1Y0BA 3ESDA 1FVFA 1BS1A 1KZPA 2IQCA 3DDWA 3M5DA 3VKUA 2X9VA 4FQ8A 4CEHB 2Y1KA 4ZI3A 1CUBA 3ZVKA 3AETB 1OWNA 1AKWA 4F56A 3AVOA 3NGMA 2JVKA 1XEXB 1GQYA 5JWRA 5EDSA 2FDXA 2VPPA 3U0VA 3BKWA 4RGVA 4DPMA 4F3NA 3IKTA 4KBGA 1FU4A 3N05A 3L8MA 1CB7A 2R47A 1Q77A 4KBFA 5DTIA 4DB4A 4Q34A 4YJFA 1MRZA 5KYWB 5JFOA 1OB2A 3DMYA 3FVTA 4H60A 2XOXA 5DNUA 1KI4A 4GA0A 1CF2O 2ZTLA 4FGWA 1OI4A 1JR3A 1Q6YA 4G1EB 2MINB 3BMNA 2FJDB 2J8SD 4MKHA 5TR9A 3L16A 2IBMA 3K32A 4ZCPA 4HVBA 4M1OA 2JAPA 1UZLA 3HUDA 3QV2A 1C9JA 4QDTA 2BKXA 4W8GA 3NTRA 3AIKA 1DRKA 5CGZA 4ODIA 5EUBA 4ZRNA 4M46A 3TX2A 3C3RA 4GP9A 4UUOA 5EZYF 4YI5A 3CVUA 2WIKA 3TNYA 5EE5B 1GRNA 4BETA 4CU5A 2JFGA 4XM2A 3DSVA 1CR0A 4XOUA 4QPPA 4J0KA 3CK9A 4F9GA 2CV2A 3EARA 2O59A 5FT9A 1JQ5A 5AK5A 1O6GA 4WZBE 2OL4A 4HRNA 3PLNA 4YMHA 3HXOA 2JKYA 3JQRA 4E0BA 2IXDA 5B1IA 1IVNA 1FJHA 4CKCB 2V54A 2R59A 5JEDA 3OEED 2IHJA 3G79A 4I2NA 5C34B 5FWNA 4LCBA 1Q95A 4RSRA 3JQ8A 1U3FA 1SULA 1T91A 2RAVA 1CUXA 1D8TA 3HFGA 4DIUA 5JI3E 2DERA 1QLHA 3EIQC 3ULKA 3W4KA 1KP2A 3VKHA 4ZT3A 5C4MA 3WICA 4D0LB 2IHYA 5A5GA 2DR0A 3DLHA 2EG5A 5BR8B 4O3MA 3B7TA 3HCFA 3TO5A 1MRSA 2HMUA 2OCYC 3EZ6A 5DT2A 3C6XA 4HPJB 4N7JA 4R2XA 1DFGA 3B9PA 4KZKA 1GA6A 4BWGA 4F1WA 4HS9A 4FJYA 4LDQA 5JCJA 5D1NA 1Q2UA 1GAEO 4BKPA 4Y2VA 4WOJA 3II6X 1P4AA 1L5VA 2W90A 1QP8A 3QVJA 3K70C 4BO3A 1YZVA 5F1OA 3L7MA 5B64A 1KDYA 3QW4B 5D0QD 3D9HA 3U7GA 5AYWD 2GLXA 1XZBA 1X86B 1QB7A 2HJGA 3I5PA 2MCFA 2ZS7A 4KL8S 1NVUQ 3CZPA 3L6UA 3CR3C 3H1AA 4HDNB 1KU6A 2Q46A 2P6UA 3H11A 3NHMA 3LQYA 4ZTBA 1G8GA 4NMMA 1M8FA 5KS2A 5K3FA 3RS3A 4TN5A 4WA8A 4K03A 4WERA 4IVRA 2PLNA 4IKOA 1QU2A 3Q9NA 2QYHA 1ENZA 1U9ZA 5CH8A 1F0YA 2PQ0A 3ILVA 4S0XA 1KE2A 2X42A 3UPUA 2GD6A 5JS8A 1M34E 5J4YA 5AQAA 5BVHA 1DAIA 3SCZA 1H6BA 4WGGA 2VHCA 2HR2A 2G06A 1TVKA 2HQSA 1XLTA 4HRYA 3AHHA 2PYZA 1SWVA 4QBFA 2NTYC 3FOAA 5EKXA 2QI9F 4K87A 4EJ6A 5CTAA 4W5JA 3OF3A 4AT1A 3SQNA 1E5XA 2B5VA 3S40A 1DKLA 3P2JA 4RVUA 5L40A 4O60A 4AO7A 2D8MA 1P1RA 1ZLYA 5DMHA 3BTOA 1SIUA 3WHLA 1DBIA 5DXAA 4Y0AA 3WYEA 4NCXA 5DASA 4BKOA 4C2BA 1STOA 1YD7A 3UG7A 3QMPA 3RVJA 4QHYA 4KIGA 1SUDA 2R62A 1HTTA 1R16A 2PTGA 1UBJS 3IPLA 3AINA 1Z82A 3MJEA 1D4OA 1ZGZA 5EKSA 2VEDA 1I3LA 2GCOB 4FM9A 3OOHA 4Q7KA 2Z9CA 1P7ZA 1VSTA 4A0HA 3RYHA 4HDCA 4CG1A 1T9AA 1WWKA 3JALB 5ENRD 2YZKA 3HNPA 4MJXA 4JAVC 3GVCA 1LDMA 4Z3KA 5E8RA 4AJ9A 3RIYA 3JWIA 3SKXA 2JFXA 3ZRHA 3JQEA 3SBEA 2P0YA 2OCPA 3CK8A 1MX4A 3GPBA 1FFGA 4RADA 1F6BA 4PWZA 3UJ6A 2QJFA 1KTVA 4YRSA 1KAGA 1AKYA 1N5RA 3CKLA 1WCV1 4Y9UA 4OY3A 3GEBA 4LMPA 2VZEA 3KSQA 4B74A 1ECFA 3FVRA 1VZ2A 3O8OA 4N39A 3CLHA 4MYDA 3A1WA 3GLHB 1U7UA 5A7GA 1JHQA 2B1IA 4UXJA 4TTRA 4EY5A 2UYOA 2AI2A 3AP3A 5LVAA 2IU3A 5L95A 1AP7A 1DVPA 2FK7A 4EVRA 3L07A 1OTYA 1NT4A 3G9TA 3OIFA 3BTSA 1XHLA 1PZEA 3RVDA 1O96A 2VDUE 4U2DA 4PNHA 5CVTA 2XTJA 5JBIA 3JWHA 4Q9AA 2C5FA 1NJ5A 4ZQGA 3FMVA 1B3BA 1J07A 4FK8A 2X8WA 2XMGA 2XAAA 1QYDA 1RD4A 1DTWB 3ODGA 2O05A 2XEDA 1QAQA 1XEWX 4PN7A 3VVMA 4O25A 4U2FA 3FU0A 1ZY2A 4LWOA 1JRLA 1JPLA 4GYWA 1QK4A 3IS3A 2HQRA 1XZGA 4DLQA 3I9KA 2J9YB 1BA3A 2HQOA 2PFGA 3GZ4A 4FT2A 3C3MA 4E21A 1F12A 4ZGBA 2IHTA 5L3SA 4EG5A 3C8HA 2F55A 3VNRA 3S2FA 1N57A 4E07A 4BOYA 1GNSA 3U37A 4Z5XA 3NNDA 4HZUB 2KQUA 1Q1AA 1AKEA 5D84A 4BO1A 3FYUC 3L18A 3R7AA 2C92A 1DCTA 3DBIA 3TK1A 1L7EA 3LY5A 1HE8A 2RONA 3A0UA 3TJMA 2XX3A 5EUMA 1BN7A 3QP9A 1QF6A 3ME5A 3PJRA 3M2TA 3UWMA 4M9RA 1AF4A 1MT0A 4PLGA 1R0RE 3CVLA 3MLAA 2GBGA 2JK1A 1XT6A 4Z7JA 4RESA 2GVNA 2ZIVB 3L02A 1I1HA 2ASEA 3W2EA 5H0IA 4Q01A 1BZYA 4YCMA 3UWPA 3J7AC 4TMWA 2O8FA 2PQRA 1MEOA 2CEAA 5FDFA 1QTNA 4B31A 2F3QA 1WU7A 3KQYA 4G2TA 5H80A 3HB4X 3I52A 3KALA 4MPTA 2NACA 3SP1A 4BNDA 4ZJYA 1ZK3A 4RDXA 1KYXA 1EA5A 1CQIA 4CKEA 3GA0A 4MWEA 3PZ1A 1WDLA 3WV5A 1MJGM 2Z2JA 1NBIA 1CUUA 1MIOB 3RAGA 4U0JA 4JKIA 4GVXA 1CFJA 3GELA 3T3PB 2A59A 1RU3A 2BF0X 4ZYXA 2P9PG 5TS2A 4WASA 1OLSA 2IP1A 4S3MA 3L4BC 5K6RA 4G5XA 3ED1A 3G8CA 2DZDA 5KYYA 1U7XA 3RRUA 5CD9A 4H3VA 5JASA 3Q4AB 3A25A 2E6KA 4OP1A 4E33A 3KKPA 1E9FA 2C4KA 3GCGA 3H5IA 4C9BA 2AOUA 3SIXA 3HXEA 3E7DA 1J5PA 1RFLA 3O3OB 4L76A 1ENYA 4M55A 3CNOA 3ONLA 3VNAA 1EJ6A 1ZIPA 3IKJA 1ZR2A 5HFJA 3IAHA 5IUNC 1EJ2A 2OBYA 3TQOA 1B73A 3SI5A 4BJ6A 4E30A 4NONA 2MIIA 1SZDA 1GU1A 2H2GA 3Q6NA 3COPA 3I3OA 4Z49A 1SKMA 4B6SA 5B7PA 3RT7A 1ZK4A 1D1TA 4HDMA 5AM5A 3LP6A 4D82A 1LVGA 4UWFA 1KDOA 4DLRA 1LI7A 4QUGA 3H5WA 3ZHCA 1XRPA 4OREX 5JNSA 1UBFA 1YL6A 4Q19A 3FTVA 3PWZA 1CY2A 1RC1A 2CKMA 4O2AF 4OL9A 1XMSA 2OGTA 4NNJA 4GX1A 4BQIA 3W7VA 2JD1A 4KO8A 3EVCA 3CTMA 5EQFA 4Z54A 2F62A 1CUZA 4FFPA 4O2BA 4OIFA 1B0AA 2J87A 4AZ0A 3LWBA 1U2GC 2GHQA 4DLSA 3TTSA 2J3IA 3B8HA 1WHTB 3O0DA 4G2VA 4LGYA 3IUEA 1CZNA 2XTNA 4X84A 5BPHA 3P9SA 3KG2A 3W9GA 3C5WP 2UUBB 2ZM6B 3OUZA 2PMFA 2I3GA 2QWXA 3Q47B 1HKHA 4GKKB 2O06A 4AY4A 1EP2B 5FHQA 2JDIA 1MNQA 1W88A 4E2XA 2FBNA 4JC5A 4ZJZA 1OFVA 4Q3AA 3RSCA 4AIRA 4O63O 3TIGA 3H2SA 5KOHA 2OHHA 3S5JA 3B95A 5KJ6A 3OQIA 1PV1A 3ETLA 4IPTA 3MWDB 4JJ4A 3NIDB 1UMBA 2PX0A 3JVUA 2AXVA 4M1TA 2APJA 3O3MB 2QXYA 3ABOB 5FQ8A 4V2UA 3ELUA 2D3WA 1Y5NA 4TV9B 4D99A 2B6HA 1T9KA 1S3GA 3ONDA 4MVJA 4JVLA 4ZVNA 2ZIXB 1GRVA 1GT6A 2MDTA 4Y9SA 2XZOA 4QEKA 3DCIA 3EXHC 3ZK9A 5REQB 1NF2A 4UJ5A 1L3CA 2GH1A 2UZ1B 1QSGA 1PWHA 2IDZA 3O9ZA 4C1NA 4IYJA 1IN7A 2HLDD 3EH1A 1H2EA 3PX3A 2JAQA 2EZ9A 4KZPA 1QG2A 1JCQA 4A3TA 4EGJA 5AVXA 3DTYA 4BY9E 2GUWA 2WNHA 4XFKA 1U6JA 4PG6A 3MJDA 2Z1NA 3D31A 4FYXA 5LXTF 4EMUA 1DFIA 4YCLA 4H59A 3LO8A 1I1OA 3H4MA 1W49A 1TLFA 4IDCA 5FQNA 3M6IA 1ZN7A 3PDUA 2Z1MA 5FV7A 3LFTA 3G2JA 5LYJF 1XVTA 4PG4A 3DFUA 2V6FA 2QBYB 3B6JA 1XTVA 2Q9UA 4J7WA 1YR3A 2WPDA 1OX4A 3DC2A 4RHTA 4OAVB 5CITA 2V0CA 5U4XA 2FULA 1G9SA 2XS1A 3UAZA 2C84A 2GILA 3HN6A 5BVGA 5DNVA 4CLRA 3PK0A 3KLOA 1H9BA 2WWYA 2BYTA 5JO0A 1ORWA 4AZ3B 4H77A 4EKNB 1TK3A 3IBSA 3G49A 4GPEA 4PVDA 3ZDAA 1RVV1 1ONSA 4S1OA 2GRRB 3PCRB 2H1FA 1GZ4A 4K5CA 3HLTA 3T7SA 3Q9LA 1P4HA 3BM5A 1ORHA 4XVUA 4A9AA 4M37A 3K72B 4Q18A 1SKYE 3CPHA 1I2BA 2WHPB 4RETA 5JEEA 4AJNA 4PCLA 3P45A 1SK8A 3DTVA 2GJ4A 3BF8A 1C9YA 3A9UA 3MV2B 3M6XA 1PLJA 1OBCA 4BGDA 2QUIA 4YEDA 1NXVA 4R05A 3BAFA 4IRUA 2O7RA 5TPWA 3FRIA 3PC8C 4F71A 4EKGA 1BMDA 1BXZA 3IHWA 4B8AA 4DLVA 2WG1A 3QJGA 3S81A 2PZMA 2C77A 3V55A 2JJ1D 3I4FA 4HN4B 3BHIA 1EDOA 1PQWA 4TYWA 3TGOA 1MAHA 3A58B 4KQKA 4EUKA 4R01A 2BJVA 5CH5A 1Q1EA 1N8TA 4KWEA 3TU3B 4KVGA 4RWZA 3A3KA 1ORRA 4BRWA 2GWHA 5DYYA 1RXWA 5HILA 3ZHYA 4LE2A 2PZIA 4HV4A 2J5QA 4U2EA 3UJ9A 2GB4A 1NVGA 2JEZA 5EKUA 4E1AA 3I4GA 2IXGA 3LIPA 4V0SA 2ZZNA 3PE4A 1PDWA 4M99A 3OZFA 1RWPA 4ZEWA 3EGIA 3IMEA 4KXQA 1NJ1A 3KWMA 4NOLA 4N7MA 1ZC3A 3NIBA 3NZEA 5ECYA 4XIFA 1QP4A 3U4TA 3TWWA 1T8RA 1P2BA 4RD6A 3A27A 4KCGA 1YDGA 1VB5A 2V6IA 5BWLA 3HHPA 2XUOA 4ANVA 2X7HA 4L4XA 1D1SA 1KA9H 4GD3Q 2P1RA 1JMVA 5BN4B 4P38A 1K6MA 1ZW1A 1GUAA 2BGGA 2I91A 1ZHFA 3NBYC 1IUOA 1UDAA 3O6VA 2DTXA 5CNIA 1N0HA 5I7EA 3QM1A 2IP4A 3PTZA 1Q83A 2FQXA 3TRKA 4EHAA 4N03A 5ECGC 3DKVA 3ECAA 4RMJA 5ECWA 2QMHA 2PNJA 2CF5A 4Y6WA 3RC9A 4YDYA 1JI3A 2HV8A 4TUUA 1UAGA 4P58A 4NS1A 1U7HA 4K9OA 1YFZA 3MOSA 4B35A 3BQMB 3DBRA 4UUMA 3LBIA 3ZHZA 3HV2A 2BI7A 2C3MA 4G07A 3KYDB 1D8AA 5A5EA 1L0BA 1Z17A 3KOOA 2RKWA 4JMPA 5LIPA 1OXJA 1W29A 1GNLA 3C3BA 1OCZE 2A58A 1QU3A 4ZIRA 2ZQYA 4XIJA 4B7CA 4TUYA 4H1TA 2H6HA 1L4BA 1KJ9A 5KTOA 1D9XA 3KP1A 4E5NA 3WK8A 1HTWA 1YKGA 4EO4A 4FWTA 4UBMA 4H17A 4KR3A 2CFTA 1BMQA 1G8FA 5DISB 5JNWA 1EPUA 3DPSA 4YLYA 4RTJA 3IUMA 1O1YA 3P27A 3MD0A 4GKAA 1W9MA 2XVYA 1Z63A 1WPRA 4P4SB 2XQIA 2IH5A 1OYVA 2GM9A 4YCBA 4G5RA 1NA5A 2WB4A 3LBYA 5SZIA 1AWCB 4HQLA 3IKOB 1XNJA 3Q0IA 3WA7A 3GO4A 1O5IA 4ZHQA 2AG0A 3MS4A 3EHRA 3CW9A 5LA6B 3W6UA 5CYFA 2ZRFA 2B4AA 1ZXLA 5EIXA 1Z0AA 1QFMA 2RGAA 3DPYA 4YNDA 4KXLA 2G82A 4KE6A 4YAWA 1H1LB 2ZIFA 5KWDA 3LEWA 1IBKB 5B7QA 1CUGA 2YN0A 1R0BA 1ZJJA 5AK6A 3GIDA 1C7ZA 4N7RA 1ZA2A 4BX0A 1IB0A 3KKMA 3HY3A 3N7UA 1BS9A 2C5EA 4ZTZB 3L93A 3M3PA 1PVVA 2EVWX 4PIMA 3CW2A 3M89A 4BFLA 1L2TA 3V3KA 2AVDA 1KI1A 1N1DA 1XTRA 1X1QA 2WXFA 4WNGA 4PQYA 4RAQA 5JC8A 1XRNA 4TL7A 3ZJVA 4CLHA 1CUDA 4GTSA 5LX8A 4UEWA 3BH0A 2NO7A 1XZEA 3AG2E 3MBKA 4MIEA 2DY0A 2WWFA 5FWXA 5DNWA 4PYOA 4OD0A 1XA0A 4AUEA 3W5VA 1EJBA 1DCFA 1IMJA 4BO8A 2PSDA 4D8YA 1KMIY 1YR2A 3VAYA 4U7EB 1GTSA 2OY0A 3O2SB 5EP3A 2AOTB 5E6UA 1QQTA 3B1ZA 1Q14A 2FR8C 2K5UA 3T06B 4LWPA 5TQ2B 2O3QA 4YJ3F 3SSNA 5EN5D 5ENTD 4CM9A 3NBNB 1XOIA 3OOEA 1RM4A 2GFIA 1R5NA 4MGIR 4D10C 2IIPA 1K3UB 1KDZA 4UEQA 2ZSAA 4F9EA 2V9CA 4F38A 4YCSA 3UXEA 4TMTA 3P9YA 3AP1A 3I72A 3ESKA 4XGIA 1UBTS 4F5DA 1O5OA 1WUJS 2FH5B 2P5UA 4EAAA 3BXZA 4LXQA 3I61A 2WMDA 3EF0A 4Q4LA 1CETA 3D54D 1KEWA 4TT3D 1BNCA 3W8RA 3VR5A 2RGXA 4F8JA 3R76A 2NZXA 5IULC 3QVXA 4BLPA 3AUUA 1E7MA 1KZ4A 5DZSA 5HCNA 3QG1A 2V7TA 5I8WA 3R0XA 1K98A 3BZBA 1US8A 2WYHA 1Z83A 2B9VA 2PUJA 2F9MA 4E4RA 2EQAA 3LA8A 1Y1KE 3EXEA 2NM0A 2XDQA 3DM5A 2G5TA 3E3LA 3KZMA 1DAEA 5CNMA 1E6WA 1VRVA 3X1XA 1KH3A 1XLWA 4UE2A 3D3EA 1TMGE 3N8DA 4D2IA 5AKEA 5I9BA 4EMSA 2RI0A 1EINA 3QGMA 2E1RA 1YJ5A 1USWA 5GMOA 1QYRA 1OI2A 4ESEA 4R7TA 1I14A 4WKOA 4ZOQI 1BO6A 1L5HB 3QE9Y 3DDNA 1A69A 4HWTA 3GLIE 4C22A 3LUFA 1D8EA 3ZS8A 1PW7A 3UWOA 5KINB 2ONKA 1KHHA 2CYAA 4KHZA 3UPVA 1LX6A 4LKOA 5CCMA 1XDZA 4QU8A 4BZPA 2JCXA 5KZMB 3EPKA 1HURA 3L5KA 4ANFA 4CG2A 4RZQA 1JN0A 4D96A 2P78A 3L1JA 3NEAA 2CL7X 4NJEB 3VYSB 3R9IA 4EB6A 3DA8A 3VYTB 3P71T 4KAFA 1PFKA 1MP0A 4BCBA 4KTVE 3Q5DA 2GOYA 5EXPA 5EKTA 4OHZA 1D2CA 3JZMA 3JQ7A 2RKBA 2VSOE 2FRDC