4GZ6A

Crystal structure of human o-glcnac transferase with udp-5sglcnac
Total Genus 264
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
264
sequence length
716
structure length
700
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 264
structure length 700
sequence length 716
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz6A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz6A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gz6A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gz6A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gz6A03
3BEOA 1L7XA 2IW1A 3GUHA 3S7DA 4WHMA 3TAXA 3LY7A 2XPIA 3MA5A 3GZ2A 3H4TA 4AMBA 4EL0A 1Z6PA 2KCLA 3SF4A 1E1YA 4RELA 1NZFA 2PL2A 1Z62A 1L6IA 4UI9J 3GPBA 2X0FA 4U0UA 4KQ2A 5G05J 1JG7A 3SYRA 4GA1A 1AHPA 2HR2A 3QDNA 3DD1A 1RZUA 2C9ZA 3ZHEA 4GA2A 2GPNA 5LCWJ 5KJLA 4EQFA 2XA2A 4MI3A 1P29A 2R68A 2NC9A 4IN3B 4BWRA 4UI9K 3SYMA 3NPAA 2QLMA 4Y6CA 1QM5A 3CK7A 3MKRA 2ZB2A 4I1AA 4RIEA 3LPZA 1GPAA 3PE3A 3KS2A 3NP9A 3QWPA 3ESKA 4RIFA 1IXYA 2XCUA 3ZCSA 3DDSA 2L6JA 3MT9A 1PNVA 1XOIA 3L7DA 4W6QA 4MRAA 5HXAA 2AV6A 2XGSA 4WADA 3ZGQA 4Z5XA 5D0QD 2GW1A 3QOUA 1Z6QA 1NZNA 4EJ2A 1P5QA 2G9RA 2ONDA 3TG4A 2C1ZA 3T3IA 5DXFA 3T3DA 2QN8A 3G2NA 4MHOA 1NVKA 4U0SA 1KLXA 4YI5A 1YA6A 3S7FA 2XCCA 5JTTA 5DLDA 4CDRA 3KAEA 3WC4A 2BGUA 2JZCA 2VCHA 3RU0A 1E96B 4LEUA 3S7JA 2JJMA 3T3GA 2XGOA 8GPBA 3CEQA 4N39A 3RKVA 3BCRA 4J8DA 2GPAA 4WACA 3C4QA 2R5SA 2IFUA 3LKUA 5ARGA 4AIFA 3CV0A 3OXGA 2BISA 1E4OA 2E2EA 3S29A 2P58C 4G26A 3RSZA 3PDNA 3COPA 4GCNA 3OTGA 4A1SA 3TG5A 1L5QA 3URZA 5KJMA 5D00A 4QLBA 4XIFA 1WUTA 2PQRA 2VQ2A 4BFCA 5JTUA 3KD7A 1JEJA 3CX4A 3FFLA 2UY1A 4RG9A 5CHEE 4M83A 3U4TA 3CUVA 5TVGA 4RIIA 2C0LA 3U3WA 3L7CA 2BUGA 4N9WA 4F96A 1WAO1 1XC7A 2WPVA 3ZFWA 5KJNA 3Q5MA 5LCWC 2LSVA 2UY1B 4I9CA 4G25A 1GPYA 2PYIA 4JL0A 4BTAA 4BTBA 2VG8A 2BFWA 4NEQA 5TMDA 3CUTA 3ZCVA 1FTYA 4CTOA 4G2TA 2BGTA 5I45A 3OXLA 3OTIA 3CKCA 2F9FA 2F3PA 3MS4A 3MS7A 1GZ5A 4GYOA 3UUXA 4CGWA 2VSNA 2QFCA 5GPBA 3LY8A 1NOJA 2X6RA 4LEIA 2YHCA 3S2UA 3EBPA 1V4VA 4Y6WA 1NOIA 3QHPA 2WTXA 4XI0A 5AYWD 5BNWA 3WADA 2I6HA 5KJKA 1FTWA 1PN3A 4HOSA 3Q47B 1IYGA 2G9QA 5CCMA 2AVPA 2QNBA 4FKZA 1L5VA 4KQ1A 1UZUA 3MT7A 3VUFA 3GYZA 3UYLA 1Y6FA 3PE4A 4JA9A 5FZQA 3ZCPA 3MSCA 4UQZA 2ATIA 2C2LA 4WNGA 4J8EA 3RT1A 1YA0A 4X7PA 2QLLA 1YGPA 4J8FA 2VCEA 3NP7A 4N2QA 2AZDA 4BQEA 5TMBA 2QRQA 4KYOB 1LWNA 3AS4A 3G2HA 4J0UA 4BQFA 1UQUA 3OY7A 3RHZA 1XL1A 2GJ4A 1A8IA 4MICA 1JIXA 4LDPA 1GFZA 2QN7A 5ARFA 1J39A 2PRIA 2QN1A 4CTMA 4M7PA 2ACVA 2QRPA 2QLNA 4RG6A 4B94A 2KATA 4N3CA 4GZ6A 3AS5A 1FS4A 2H1FA 1ZU2A 3UYKA 2XA9A 5M72A 2VYIA 3OKPA 3GW4A 3HYMB 1FA9A 1O6CA 3OT5A 1WUYA 4REMA 3D0QA 2FFRA 3G2IA 2XCBA 3BCSA 4X6LA 4I2WA 5FTPA 5EX0A 2FF5A 3D0RA 1PSWA 3BD7A 3IAAA 4L22A 3S28A 3ULQA 4H7YA 4ABNA 3Q3EA 3T3HA 5A6CA 2YJNA 2GT1A 3CUUA 4I9EA 2QN3A 1K08A 2SKEA 3T3EA 1KTIA 3T5TA 3MT8A 4WUYA 3MS2A 4KQMA 4U04A 2C1XA 3CK8A 5CCLA 4HORA 5JJ6A 1F0KA 3CUYA 2IYFA 4GPKA 2Q6VA 4I17A 1PYGA 3CVPA 1JIUA 4XI9A 3JYSA 4N2SA 3CEMA 1WM5A 4AMGA 2DBAA 3EDTB 3QKWA 6GPBA 3ASDA 5HQ8A 1P2GA 4BT8A 3Q3IA 1XL0A 2VGXB 2G9UA 3VUEA 1HZ4A 3HBJA 4GPBA 1FU8A 5ENZA 4KXKB 1P4GA 1XNFA 4ME2A 1P4HA 3BCUA 2IEIA 3CV3A 1EM6A 3L7AA 3LYAA 1FU4A 1NA3A 1M5RA 3MTDA 3ZCUA 2WQHA 4CTNA 5TMEA 2VSYA 1QQEA 3RIBA 3E3NA 1C50A 3D1JA 3NB0A 3HBFA 1GGNA 4MI9A 4WNFA 2HO1A 9GPBA 3SZ7A 5C1DA 2QZSA 3S27A 2QRGA 3ASFA 4JA7A 3G2JA 1ABBA 4RENA 1C8KA 1P2DA 1JG6A 1P2BA 4M60A 2FF4A 1BX3A 2PQNA 3ZCTA 3HBMA 1QZ2A 3MRVA 1KT0A 2V5FA 4NRHB 4F97A 3RO2A 4BT9A 3MBOA 4YNDA 3ASHA 5FZSA 3VTYA 1A17A 4GZ3A 1K06A 1FTQA 5G04C 1XKXA 5D0OD 2R60A 1WW2A 4WNDA 4GCOA 4GA0A 3FROA 3MTBA 2F3SA 4MI6A 3AMVA 3R9AB 3BEEA 2IEGA 2R4TA 5DBKA 3CEJA 1PC2A 3OKCA 1NA0A 1L5RA 4UQYA 3BD8A 1OUVA 2X0DA 5A7DB 5BT1A 3WAGA 1NOKA 1L5SA 3ZCRA 4GYYA 2FEZA 2H1HA 1NLMA 1WV1A 1GG8A 1P4JA 5LQDA 1HLFA 2C4MA 4U07A 4GYWA 4MHSA 3L79A 3CVQA 1F6DA 2VGYA 1LWOA 2AW3A 4HOTA 3ZPJA 1RZVA 4FZRA 2LNIA 2FETA 3H4IA 3QWWA 5IKPA 4AY5A 2Y4UA 1HXIA 4EKYA 4HOQA 2IV3A 4AY6A 4F9FA 2J9QA 4HLNA 2Q7FA 1JIVA 3O48A 2Y4TA 3E3LA 2ACWA 5D01A 2KCKA 5BW8C 5FT9A 4RIHA 3DDWA 4BQIA 4GZ5A 4O6FA 2QN9A 2R4UA 4U0ZA 2QRHA 3IA7A 3NAZA 3TOVA 4PQGA 3WXXA 2PZIA 1ZBPA 3G2LA 3S0JA 1XV5A 5G04J 3RSCA 1NZDA 3NC4A 2IV7A 2FI7A 3MV3B 3Q4AB 3G2KA 4HOUA 3C4VA 1WW3A 2UWJG 1QKJA 2IYAA 3Q15A 4YUAA 3ZN3A 3LCAA 3ZHEB 3RO3A 3UQ3A 4I2ZA 4UQXA 4W9RA 2ASVA 2VGXA 3FP3A 3BD6A 4YVQC 3N71A 3S7BA 1AXRA 3CEHA 1RRVA 5IKOA 4YI3A 4KBQA 1VGVA 1Y6GA 1KT1A 2GEKA 2KS6A 4N3AA 2XCIA 4EKEA 3E3OA 3O3CA 3CVLA 3MRXA 1Y8ZA 3CUWA 3RJVA 2XEVA 1FU7A 1HH8A 3LY9A 1FC0A 2F3UA 2X6QA 3DZCA 1L5WA 3NF1A 1C3JA 2GPBA 3CK9A 2QN2A 3TGOA 2ECPA 5FJYA 3L01A 3Q3HA 2IF4A 3T7DA 3QKYA 4CGVA 2YQ8A 2O6LA 5DU2A 4AN4A 3MEKA 1B89A 1FCHA 2FO7A 2P6PA 2HYZA 3UPVA 2XA1A 3MV2B 2OFFA 2XMPA 4H7XA 1H5UA 1Y8MA 5JJTA 2AMVA 2R66A 4X7RA 1SXQA 3ASGA 4NC9A 2PRJA 3HBNA 2F3QA 4JHRA 2G9VA 2SKCA 4N3BA 4F3VA 1UQTA 2HY7A 3VDMA 1TJCA 4NESA 3VDNB 4RBNA 2GM9A 2GEJA 4APOA 1Z8DA 2QRMA 2X0EA 4WNEA 2XGMA 5EX3A 2IUYA 4NQ0A 3ZCQA 2PQ6A 4UI9C 4EL5A 3CKBA 4G24A 5G05C 5JJ7A 1IHGA 3CVNA 2KC7A 3AS8A 2MHKA 5FZRA 1SXPA 3OTHA 4HWGA 2FBNA 3IEGA 3OY2A 3K9IA 4YVOA 3TSAA 1EXVA 5HI7A 4G23A 2JLBA 3BDAA 3QWVA 4RIGA 5DIZA 2KCVA 5EKQD 3C48A 3EBOA 4G2VA 4AM9A 3Q49B 3NCHA 3GZ1A 4G1TA 3OXFA 1B4DA 1W3BA 2LSUA 3L7BA 1C8LA 2PYDA 4N5CA 3VTXA 3OKAA 7GPBA 1WV0A 1ELWA 2SKDA 2OOEA 1ELRA 3MTAA 1IIRA 1GPBA 3MRTA 3MQFA 2C0MA 3FWVA 4X7MA 3E4BA
chains in the Genus database with same CATH superfamily
4LOLA 3HWRA 3LDFA 3TR0A 3G23A 3KSUA 4RJIA 3T3PB 3CZMA 4DCPA 1JG7A 3SYRA 1EWQA 1O94C 2X5TA 3PQ6A 2AD1A 3OU6A 2XEHA 1CUGA 3VSAA 4RL4A 4BMCA 2I80A 2FULA 3LWNA 5EIOA 2FN8A 3A2LA 2PH3A 3U7HB 5AIJA 4BNFA 2ZFUA 4O4IA 2HBQA 4H27A 5FD8A 5LQAA 2CHFA 1MCZA 1V4BA 4L4XA 5EIBC 5DCWA 4YI5A 1OOEA 1TNBA 4IYJA 3TLYA 4NVRA 3V7WA 4D3YA 3FDHA 1QVWA 1QYVA 5CD9A 3VPXA 1AUVA 3F4KA 3GDGA 4RHUA 1I2DA 3ONLA 3O9VA 2NX2A 3WZ2A 5CB0A 4X95A 5D00A 1BHQ1 2X9QA 3U48A 1ZLXA 3G17A 1ENZA 2G5PA 4OSEA 4RG9A 2PCJA 1ZFNA 2UXBB 2DPGA 4J07A 4YMWA 5EQJB 4F96A 3LCMA 2M1ZA 4I1SA 1TC2A 4R3WA 2AN9A 4YAKA 4QGGA 4E31A 3N3AC 5KVSA 4X00A 3AERB 2EFGA 4WBXC 2NIPA 4PX3A 1JU9A 5IJZA 3HVEA 3PDCA 3EWAA 1AUQA 5LN1A 3S5UA 5JLJA 3UWDA 1L8XA 3UXEA 4TMXA 1QE0A 4I55B 1NF9A 1DKUA 3IKLA 1DIOB 2MT9A 4FXPA 5AN8A 3TR6A 4KYOB 4LGCA 1E2UA 2RGEA 4DX5D 5E1BA 3W04A 3L0YA 1LJLA 3R5KA 2Y05A 1C9NA 4M0FA 1L3CA 4ZOCA 3NOVA 3HDVA 1GNSA 2FFRA 4NARA 4X6LA 2XUFA 1OASA 5K8IA 1KZ6A 4G0QA 4CI9A 4LOHA 4ROSA 2UKDA 1LZKA 3BFKA 1DAFA 1Y1TA 4GTPA 2R1ZA 5JJ5A 1DGQA 1TW3A 2VLBA 4B4UA 3K0FA 2JGEA 3FKJA 3OJ0A 1AHHA 2OXFA 4QWWA 1MF7A 1E8WA 3VHLB 1K4MA 3O3MB 3LKBA 3SO8A 4PM4A 4EZLA 4F06A 1ORWA 1ZX1A 4NCXA 2YXEA 1V37A 2PS9A 4HP8A 4K46A 3OKFA 5EY5B 5FA8A 3TQOA 2JFNA 3K1AA 1M8JA 3IVXA 1W6UA 2VDPB 5AM5A 5B4UA 3IMGA 2R8BA 1SPXA 4KLAA 1I2BA 1R15A 1RYBA 3D4IA 3PUWA 1ZHOA 3SBEA 2XLBA 1JR3E 3HRAA 1E2FA 1EI9A 1E9EA 5DGIA 3UENA 4PDXA 3OSZA 1G60A 1WPQA 2WMYA 4OD0A 2VWGA 4Z3KA 3U4DA 3BA1A 1TMGE 2QN9A 4F2PA 2ID9A 3QTLA 5CGQB 2QW8A 3I8OA 3KSQA 2PK3A 3G8DA 2WWHA 3GCZA 1L4KA 4L9SA 2NU8A 4P82A 3F3SA 4X9XA 4I2ZA 2Q3FA 3DZHA 1Y6GA 3ETDA 5BSTA 2ZR9A 4K5AB 1A9ZA 1ZEJA 3KAPA 2B30A 3S68A 2VWPA 4YO8A 2UUPA 3T7DA 2L0TB 4GX5A 2OAEA 4JB8P 4OAUC 2DQSA 1T0PA 3R5HA 1MNQA 1OCCE 4BFXA 2JGFA 3THWB 4GTOA 4P6VF 1KQPA 3A04A 3ZHSA 4B83A 1YR2A 4ERXA 3IJ5A 5E3IA 3N2KB 2EG5A 2W7TA 3H87A 3E9DA 4ANVA 4QG3A 3OPXA 3FUNA 1V1MA 5I5GA 1SM4A 1U2SA 4TV9A 4RGVA 2LDBA 3KZXA 4G1TA 5IBQA 1R9GA 3VDRA 3C8DA 1P5JA 3FMPB 2PXAA 3X2SA 1PNRA 1ZMBA 3ABRB 4M8SA 1JHDA 1PT6A 2EX0A 1ZWKA 3KSZO 1Z0DA 4NYMR 2E0IA 4AIIA 1GG2A 4GXTA 2CMHA 4YAUA 2VTVA 5FPYA 5BVHA 1AKNA 1IH8A 5ES4B 5U4QA 1RMYA 1OWLA 1WCIA 3GP3A 4W5QA 5LZ9A 1LF0A 4Q21A 3KKZA 5FX2A 2XGSA 1KDRA 2JJ8A 1OBHA 1TM5E 3OE1A 2DY1A 5F7OA 3PEUA 2Y66A 1INLA 2PMWB 3WYFA 4ND8A 3QFHA 3P9CA 1TU0A 3NEYA 5FV7A 4JKYA 5HS4A 2GBPA 5H5JA 3TQTA 3CQGB 3QMVA 4FDTA 3TRIA 3VRHA 4TMZA 5BXQC 4FLBA 1AGRA 3B3QA 3OBBA 1RYZA 4LZWA 3JSXA 5LCWC 3HCEA 2QJFA 1P2SA 2IXBA 3BS4A 2IOSA 4C2UA 3AIOA 4QQ8A 4A6XA 3P4YA 3CRQA 3NASA 1RZRA 4LV6A 3E84A 4L1BA 2N1MA 1RQ2A 3PWKA 4JJ7A 4EW1A 2GSWA 4AJ1A 1NXPA 3ICEA 3FFWA 2FEXA 4I66A 4Q01A 3VNQA 3VYWA 1ZPDA 5DHPA 3W8FA 1DBRA 1I0ZA 1NULA 3GZNB 1RYDA 5CBOA 2BBOA 4L8WB 3ZY5A 4V2IA 3PB3A 5A3SA 2R7NA 4IO1A 1JVBA 2P3SA 2IDZA 1M2WA 3JQBA 1XAJA 4MUHA 3K4QA 3T5TA 1LDGA 4YPVA 3FEXA 3VVBA 4D02A 2VJQA 2NXCA 2JFXA 5HQ8A 1ZCZA 2Z09A 3ENKA 1EUDB 1T5TA 2I5PO 1V11B 4EGQA 2C2ZA 2WJGA 3GDHA 1QQEA 4WH0A 4KP7A 1OXUA 1JMYA 3LVRE 3D8UA 4V0OA 4QPPA 1RWBA 1E1RA 1LPMA 4BGEA 4CZ2A 2I0FA 2HHHB 1CDEA 2PX8A 1MOPA 3R0XA 4CDGA 1XR3A 4RHTA 2OY0A 5AVXA 4D45A 4UC0A 4DSZA 4WLOA 2Q1YA 2BJHA 1LBTA 1T1JA 2RAVA 5KAMA 3T06B 4U2DA 1ZGGA 5E3JA 4MV1A 2H65A 4YV0A 3MWYW 1ZUWA 3W6OA 5MGNA 1ZIOA 3UJ3X 3LJNA 2J49A 1KDOA 4DE5A 3H1FA 2FEKA 3X1MA 1JL3A 3DGEC 2PWZA 3T9FA 1U1CA 4BWFB 1CUJA 1I51A 2WOOA 3GA0A 5JW6A 5ELLA 2WG1A 1K6IA 1YVRA 2Q45A 1E62A 3C3XA 4WDRA 1T3GA 3RROA 5EXDA 1GZ4A 2WXFA 3D7MA 3WGQA 4Q69A 4FGJA 3GFSA 1N1MA 3RVBA 2WFAA 1WKBA 3QQPA 1OLXA 3T3MB 4OI4A 1KRXA 2ECPA 2AEEA 1PFUA 5K3SA 2NVUA 4HNQA 3B1ZA 3BH0A 1SOMA 2C92A 4CM9A 3F6CA 3RS2A 4UDYX 2QVZX 1YRQA 4G8BA 1SBNE 1GSIA 1XRPA 3ONWA 4HNRA 4QEKA 4HI9A 2PL9A 5FI3A 1ZXBA 3L7LA 4RQUA 1ZP6A 3REOA 1OGJA 3HB7A 4MCJA 2CXXA 1II0A 5B30A 4RIGA 3RRFA 4BMXA 2YC4C 3AM4A 4RSRA 3DEPA 3E7XA 4LF7B 3G7UA 3RR2A 2ETVA 3AJEA 1XAHA 3BIWA 3DTNA 1VECA 4K5CA 4DRXB 3CHPA 4QOJA 5JALA 4CKBA 3WGNA 3S7DA 4HV4A 3OJLA 1V41E 1E1YA 1EFVA 1QCDA 2O7VA 1BS1A 3AETA 4HBGA 5CM8B 5LXTA 4GE3A 2VTKA 5GZ3A 4J4HA 3KS2A 4IGFA 3DLTA 2EFYA 5AVZA 2O06A 1PJTA 1X7ZB 3FTVA 2QSZA 1H2XA 5BVGB 2JHCA 3L4BA 2GW1A 3C6YA 4D25A 2O1EA 4MP6A 2QN8A 4J1QA 3V7UA 2II6A 4TPKA 3RUIA 1NQ5A 2V0GA 3G0OA 1PCXA 4RO0A 1SUBA 1LI5A 4CG1A 4Z7QB 2XB8A 4EZEA 2XRFA 2Z83A 3OXGA 2CFIA 1H6DA 5K0SA 2ZI9A 2DXIA 3HDYA 5KDLA 1YFZA 5CEEA 4BFCA 2CSXA 1A76A 2QE7A 2RE8A 4G5OA 1HYBA 3ORRA 1UJ2A 2D8MA 3MAAC 3CSSA 5D51S 1I1HA 4Z54A 4P86A 1GADO 2HYDA 2ZP1A 4J1TC 1LVGA 2CJWB 3S2ZA 3EJWA 3P2KA 3Q78A 2FZKA 3EEBA 3DMTA 3CUTA 3H1EA 3DBVO 2X6FA 1XZBA 1JRLA 3LXRA 1RTTA 3QGMA 5EJ5A 5CCMA 2A9RA 5JG7A 3PSAA 4F9EA 5EIDA 1J5XA 4U95D 3M70A 4NXMB 2PBRA 1Q1QA 5HNKA 5CRVA 4MLDA 1SG0A 3CEAA 4R5HA 1SOWA 5LP6F 1AN0A 4DDTA 3KAQA 1KI1A 4V0RA 1EFTA 3MCTA 1HNWB 2GRMA 4NG5A 2IGBA 3HCAA 6AT1A 4CF7A 2G5GX 4O4JB 3TTUA 4WXHA 3DSWA 4AD8A 5HKAA 4ABNA 1QRRA 1S64A 3SEFA 3B3JA 3NM5A 3EXHC 1YS6A 2QKYA 2HU7A 3X2FA 1OREA 4JZKA 1KO5A 3RRNA 4K5QA 3GU3A 2PKWA 2GAIA 2YFKA 3B38A 3F6SA 1N4RA 5BR4A 2PV0A 3DWFA 2JA1A 4FR2A 3UMCA 3SFTA 1V5IA 3GWGA 4E1BA 4RLSA 5KKCA 4MV0A 4KRYA 5CEJA 2FJPA 3DFMA 1QRAA 5AW6A 2F8YA 3OTWA 1CRPA 1UC9A 2BLLA 4LW8A 4OQMA 2V3VA 4CN9A 4X94A 2GI4A 2AI2A 3WYDA 1YZFA 5JSHA 3AEKA 1YR6A 2C0QA 3MJDA 4D9BA 3N3BC 5JRZA 3AMVA 1Q3HA 1VCNA 2L69A 2WICA 4M1MA 1XNQB 1O77A 5EXPA 2G08A 3SR0A 3N6RA 4UOQA 2J6HA 2AQIA 3MJCA 2IBSA 1S02A 3GNTA 4ECEA 3HA7A 4UKDA 1JIVA 3A2NA 1QTNA 2W2KA 2XBMA 3AL0C 1TB4A 3VBEA 2OHGA 3HY6A 3KYCA 3NHMA 2QAIA 4HAIA 3KUUA 2BMWA 2JLWA 4CMHA 2V4ZA 4X20A 2HUPA 1GUYA 4BMVA 2D59A 2XZDG 2Q8QA 3C1TA 1XTQA 4MVJM 3URKA 5ERXA 4KBQA 1PF7E 4TXQA 4J2OA 3ZKWA 3BORA 1C7ZA 3LVBA 2FVXA 2AFIB 4EY5A 3N74A 1AS0A 4RY0A 1P1HA 1UKZA 3E7DA 1SBCA 1SCQA 4KRGA 1D2MA 2QMEA 1YVEI 3FUJA 1AGXA 1U0RA 1WMFA 1RLTA 2V7EA 4C0LA 2X2OA 4HWGA 3OF5A 2IOYA 1DFHA 1RHJA 2Q6KA 2GBLC 4F5WA 2WAYA 5H70A 3HJNA 4IIJB 2Z58A 1DC8A 2XD4A 2IX3A 5FBRB 3CNEA 1FDOA 3KJXA 4LX0A 4F7AA 2B7BA 4IHKA 1MENA 4F5DA 3LC7O 1LNZA 1Z74A 2D74A 2AEMA 2C31A 1FTSA 1T25A 4EHBA 2I6GA 2C0MA 3NDRA 4PINA 3RRUA 3L7JA 4DNPA 2Q21A 2W0MA 3TW4A 2NLOA 4EUKA 2FPSA 1ATZA 1NI3A 4DWVA 4MYTA 1J0BA 4N49A 3FNBA 3ZHEA 5BUQA 5BUCA 2X6IA 3AHCA 4KKVA 1GPUA 1EEXB 1IOZA 3GUZA 3FA2A 2PY6A 2YHIA 2DH6A 3K0AB 1QHEA 4EOGA 2HH9A 4L78A 5DM4A 1RQNA 1XEWY 4OHYA 4MRVA 4EVSA 1KO4A 3FNIA 3BGSA 1EPUA 4ALKA 2ZGGA 2WJ4A 4R9RA 1Y4ZA 2FEMA 2P58C 1K68A 4M0CA 1V8BA 4GP7A 3MJWA 3L05A 4ANWA 1JLRA 2R6CA 2R6GA 5IEBA 5H9VA 3RHTA 2BDTA 4BKPA 3ANLA 3GLKA 4UE2A 4F3NA 4UYJB 1A8QA 3LP8A 4RH1A 3HJAA 4G0ZA 2C0CA 1XAGA 1L6RA 3EPKA 4HK4A 4WFIA 5CVVA 1SUAA 1QO0D 4P7GA 2XRYA 1JVSA 3ORSA 5LD2B 3LK7A 4C0QC 1WRBA 1T26A 1ZL2A 3DAPA 1UK8A 4M76B 4KPGA 3WLNA 4RTQA 1XMXA 1NP3A 2K7FA 3E8XA 2FW6A 4BLUA 3ULQA 1F2TA 1YIAA 5JVDB 4FNGA 2X4LA 1OR8A 2CHZA 2PGIA 4MKXA 4IIDA 5AM0A 2XKBA 3KB8A 1GKIA 3CVPA 2YXPX 4LXHA 1EDUA 5A9SA 2PVSA 1ISMA 4K9NA 4MV9A 4H17A 2Z5FA 3GLGE 1ABEA 4MJ3A 2BM9A 1M1YA 4M55A 4RD6A 2CLHB 1HT3A 1RI5A 2P2CA 4TN1A 1IZ8A 3LMKA 3IS3A 4IEIA 3SN6A 2GBCA 2YRWA 3TNJA 4HNSA 4RNDB 1OFIA 4F97A 4UUBA 1WHSA 1YD7A 5FZSA 1KEPA 2C5LA 1VMEA 4IG4A 3AVVA 3WL4A 3GGDA 2X4IA 3V79K 3NEJA 1P5HA 4XYLA 2CLOB 4KSBA 4DS3A 5BSHA 3G2PA 2RHBA 2Q9AA 1U7IA 3ZWDA 1K88A 5CA1A 3CJTA 3KV1A 4NR0A 1YFKA 3W0LB 3BRSA 2D8AA 1LSJA 1S2DA 2RSFA 3PC6A 1TMOA 4J7XA 3EH1A 3ZU4A 4GGOA 3O7WA 4E51A 1XA3A 1ZNZA 3RM3A 4CM4B 3CX6A 3EGXA 2VWHA 3S1AA 1SUDA 4QNRA 2ISSD 4QDOA 4EUNA 1ORVA 3KTAB 2TS1A 2Q5EA 1AF4A 4LDJA 3K5PA 4KYVA 1ELKA 1YE5A 4RS4A 3N0XA 2W6ZA 4RFSB 5DO9A 4EEXA 5ECWA 4EHLA 2ZIGA 4TLMB 3ODGA 5CEAA 5IUKC 3RU3A 3EIQA 1J33A 4RL6A 3A9SA 4AX4A 5KI6A 3ISVA 3ZVMA 4O08A 1KJYA 3NVKI 2CK3D 1VJ0A 4DK5A 1SXPA 5ER6A 5J4KA 3BK2A 2P6UA 1DAKA 5G0VA 3FMVA 4G23A 3DZ8A 2BVNA 1NKVA 1RBMA 4ZVKA 3SPXA 3ZZTA 3PLNA 4GMJA 1E61A 2YWEA 4RC9A 5H4GA 5KOJB 3I9FA 1JG4A 5BQFA 2AWIA 2FMFA 1EX7A 5LP6B 3TBHA 1N6LA 2HRRA 4JVOA 3UCEA 4DLPA 4NBLA 2P78A 4L4SA 3SLKA 2O3QA 1PP4A 3JXEA 3VGJA 5HTKA 1IY0A 2L6JA 4F7DA 1VC2A 2OC9A 3D9JA 2PZ8A 3X2QE 2AV6A 2WWTA 3W9SA 3AC0A 1H2FA 1XA0A 3OWHA 4CWAA 1KI7A 1T9HA 1QK4A 3COSA 1GN9A 5EXEA 2OO5A 2GEFA 3SBTB 1ADYA 3GL9A 1T1IA 4WACA 2HU8A 4K6FA 2IFUA 2ZJOA 4UWKA 5IWAB 3TTWA 3DBHA 3ZXYA 1E5XA 4C3OB 1G8FA 2I76A 1ZH6A 2ZAIA 4LJAA 3GCWA 2OB2A 4LRZA 3LDUA 3FSJX 4UNQA 2EZTA 2Y1EA 4CMAA 4EARA 1V5EA 2ENWA 1TPYA 3QVJA 3PFBA 2CFZA 3IAS6 4O29A 4GOMD 4MS3A 5A4JA 2B4YA 1TQDA 2X5JO 4ENWA 2VF7A 4XWWA 1BXZA 4UQZA 1KEEA 4RKWA 1GAEO 1TF2A 2I7VA 4E4YA 5JH7B 3I0ZA 2AZDA 1DCMA 3TWOA 4BB5A 1E3IA 1Y6JA 2OR3A 3E1GA 3W3AA 5DNWA 2AOTA 4XFDA 4ZD6A 3OEEA 3AG4E 2FPWA 3EXG2 1Q3KA 3IDFA 3MOSA 4WLFA 3KPUA 4LBZA 3NEAA 1V5WA 2ISCA 4WGFA 1KHHA 3R7NA 3CIAA 4U8GA 3PEEA 1U1GA 2NO5A 2RG1A 3SIWA 3AY0A 4RF2A 4BQQA 2YS7A 1E1CA 4BFRA 4MVJH 1PYGA 4IYPA 4RSMA 3CEMA 1NLFA 1TT5B 4FYMA 3BWDD 1U3FA 2R87A 1E7SA 1WY7A 4ZEWA 1Z4NA 1FDTA 3I01A 4XB1A 2J0VA 1ENYA 4DLLA 4RGYA 3ICVA 4BB0A 1H2TC 3DHNA 1ZI6A 1YCFA 1E63A 3ZWNA 4REQB 5HIJA 1SKYE 2VQSA 3QX8A 2WA1A 1T6NA 4YWJA 1UT6A 5KYKA 2J9RA 3R0VA 4IMIB 3FMIA 3I2HA 1DJPA 3B9QA 4GA0A 4KE7A 5L3SA 1IG3A 3KXLA 4FMPA 1YRAA 2C7BA 4YLYA 2WXKA 2Q27A 2A7QA 4BNLA 1P17A 3KOYA 4H6XA 3D9PA 4LOKA 5G1NA 2QTLA 5FWAA 3KDSE 1ECBA 4J1NA 2MYOA 4L6CA 1KAQA 3WLOA 3N58A 1NXTA 3RSLA 4BQIA 3ON5A 5CH5A 1L4LA 4FNOA 1E9AA 1H2UA 4GBGA 1E3TA 2QMHA 3GXBA 2BP7A 4DLKA 1AQUA 3QBEA 4QQFA 4RHFA 3JX9A 1MX4A 3DLAA 2OAGA 4POAA 2H16A 3PQ2A 4ILIA 4CR7A 3E48A 3DVQX 3KAJA 2AF4C 4L2IA 1U81A 4YV7A 5B2EA 2ID8A 4OHOA 1BXKA 4MR8B 1EB9A 1KIAA 1EK6A 3SDSA 4CEHA 3UT6A 5TY0A 3NHLA 1A0OA 2JZNA 2QSJA 2NUPA 4RZ3A 1S7GA 3TTXA 4UI9C 5ALWA 1C5KA 3K9IA 3TD6A 1BCSB 2DWPA 2GJAA 3O6VA 3WY9A 3JD1A 2BMDA 2Y3IA 4IQ8A 3ELYA 4QQIA 3OWOA 3VJKA 1TYDE 3Q10A 2QLFA 4B8CB 3C70A 1L7XA 2AK2A 1YBAA 3PEWA 3DMNA 3KBBA 5KVCA 1J25A 4YP7A 3JTMA 4Y8VA 5CX1A 2HQ1A 3D5TA 3G5AA 4RIFA 1WKVA 1A8SA 3QPDA 3H86A 2RC5A 4II3A 3EZ6A 1Z6QA 1J9EA 5LWHA 1T2EA 3UAZA 3V3KA 1KZ7B 2A3RA 4EJ0A 3PGA1 3WL8A 1CR2A 4QTTB 4E15A 4WTOA 4YP6A 3KD3A 1U28A 1JWAB 5I3CA 4EHDA 2V3CC 4LYGA 1L0BA 4HRLA 3I12A 5IAEA 5I3ZA 2F67A 5JA4D 1UBKS 3CMCO 2IOHA 3O8QA 1A82A 3U4TA 3OMSA 4B7AA 4IJUA 3IQEA 3GVXA 2RD2A 4JT9A 4QQNA 1T2FA 2JDIA 1U31A 4P1ZA 4MDFA 1ZVKA 5FWQA 1R6BX 2FEOA 5CB6A 4B3XA 4MZDA 2VHJA 4B32A 4RD3A 1Z0KA 4MOWA 5HF5A 1CZLA 1L5VA 1R27A 1Z63A 2GM5A 4WOCA 1KP9A 5JZBA 1PY1A 4TTVA 4X45A 5BRNA 3FTYA 3ZVNA 1ZM7A 1WA5A 1KP3A 2QMUA 3H6HA 5ARFA 2FN9A 4I55F 2PRIA 1O89A 4NYIR 4NH0A 4NBTA 4WWPA 1YU9A 5IRCD 2D5BA 2OQ2A 3KYDB 1Z3IX 4MITA 3JUIA 3GW4A 3KKKA 1U1FA 4OHZA 2WJWA 4PLWA 2KSQA 4YUXA 2QN3A 1U7HA 2I22A 5EPUA 3FPLA 5E95A 1YQTA 1CRQA 5KC9A 3JZAA 5JU6A 2FSIA 5CYFA 4EYGA 1EAMA 4OXNA 4IOKA 4UNIA 3H9CA 2QXTA 4YFVA 3CRZA 5AWFC 2DHDA 3AHEA 3PEYA 2IYOA 2NTNA 5CA0B 5BSEA 3BCUA 2I1JA 3O8LA 2GYYA 2GM3A 1P6UA 3B5IA 5DYWA 4JLNA 3A10A 4V0LA 3EY4A 2O14A 4YREA 4JR2A 2VRCD 5I48A 1VDZA 4I5EA 2D1SA 4QG7A 1HH4A 2Q2NA 1TGYA 1K5HA 2B6CA 5ALSA 3WB1A 5JNWA 3I6BA 1EWTA 2UYHA 1KVTA 1XTTA 1SVXA 3BEEA 4AVYA 3P94A 1YF3A 1CUIA 3ZHUA 4E11A 3G8YA 2HDHA 1J8MF 2CDAA 1UJ5A 2A78A 5CCDA 1VKHA 4HAYA 5D2MC 4JLBA 3REFA 2O05A 3QXJA 3V8QA 1C9MA 1H19A 3MIZA 4DUGA 4HN9A 3EB9A 1KDZA 1JHPA 2WD7B 3H5TA 2ZYVX 2QT1A 1MJ0A 2HK7A 4W1QA 1NLYA 3WL3A 1Y8RA 3TGLA 3ASZA 1JKFA 3HKBB 1JJVA 4UD2A 2A0FA 1WDTA 5BORA 3G8BA 5HGJA 1PJCA 4HI0E 3G0BA 1BWSA 2OTCA 4BLVA 3RSHA 3U3RA 3P2EA 3M89A 2HF8A 4CMKA 5BSUA 5THXA 2P3QA 3O3CA 4OQEA 1CE8A 2IVZA 1Y8ZA 2EHDA 2ORYA 2AB0A 4L8LA 4LVOA 3VA7A 3MJEA 4IDNA 1B3BA 2O6LA 4M0EA 3R3WA 3ZWYA 2FMTA 3A4VA 5HA5A 1SG9A 2LAHA 3RAEC 4MWBA 3G7SA 2WIFA 3FUDA 2CHGA 1Y3IA 2AWOA 4IJVA 5G05C 2DT5A 2OWDA 1N9ZA 1RQRA 1GNVA 3IEGA 4BVKA 2DBZA 3OQJA 4BO3A 3SXUA 1E6WA 1OZ0A 1IQUA 4JH0A 4LX8A 5A3RA 3C48A 4ZCSA 2NN3C 3C6MA 4OQNA 5BOSB 3L7BA 1TUBA 3MGBA 3WLJA 2LIPA 1LDNA 2JGLA 3VTXA 1BKDR 2X1HA 2CBXA 4TZTA 1X2EA 4YASA 5KOHA 4FCWA 1HFWA 2TMKA 4L0DA 3AVUA 4R1QA 4DBLC 4B46A 4NP6A 4O5OA 5GINE 4ZVSA 3ECAA 2G7MC 1J90A 1QHHA 4TRNA 1DTWB 3KLOA 2G07A 1E3JA 2ZE6A 3I9NA 3EYAA 1EIZA 1ZUHA 3N2GB 4FP7A 3D5QA 4ZOAA 1V3QE 3K31A 4Y1RA 3ZE2B 3W77A 3CVYA 1E2JA 4WSOA 3E7FA 3FYUC 3UT4A 3R7SA 3MINA 3ITEA 1Z9BA 2X6TA 2AN3A 1JCRA 3M6VA 4OQYA 5C9ZA 4RY9A 1E9FA 1V4NA 1ODKA 1L1RA 1BZYA 4WESB 3CEQA 1M6EX 3JZMA 3RKVA 1X3SA 1RE0A 5E6SA 2LVBA 1TD1A 2RHRA 2NMVA 3V30A 1SOAA 4N4AA 1MJNA 2P9YA 2ECOA 1O95D 2ZPTX 3GBPA 1NL4A 4D80A 5T3RA 4RTNA 4JB2A 2KWIA 1X7XB 4HMOA 2QPAA 3LBYA 4BTEA 1ZC3A 4PX2A 4G25A 5B3JA 3U3OA 2ZEJA 1EUCA 1QIFA 5C8VA 4R8MA 4R0VA 4TXHA 2WKPA 2BGTA 3EXFA 3CKCA 3GMIA 2Z43A 3V1YA 5FAXA 2IYZA 4QUHA 4JL8A 2L42A 4RK1A 3LI2A 2I33A 4PZDA 5AICA 2R7LA 1Q3TA 4WNGA 1I7DA 3D8HA 2X1LA 4N2QA 1GP2A 4Q3EA 4U6QA 1HDGO 1WQ1R 2Q4DA 5KYGA 4EBBA 4TLDA 3DCJA 2FFAA 4CI0B 2KJZA 1S89A 4F3KA 4K9LA 1CY7A 1OB5A 1CUHA 2FRXA 4LHSA 1KZGB 2H1FA 3D6JA 4HNUA 2A0XA 2NUTA 4CKEA 3THSA 1G0OA 1XWWA 4A2QA 3GFVA 1UK7A 1E8XA 2DUJA 2MSDB 2DT8A 3ZNNA 3QYAA 1DKPA 3AEXA 2V6FA 3QKWA 3B7RL 5K5EA 2DULA 2JFUA 1JI0A 4OB7A 3ZWCA 5BWBA 4RVBA 2BM8A 4COKA 3FH5A 521PA 3VC7A 5DYYA 1QH0A 4TVBA 4E22A 5AKLA 5KYUB 3D1JA 2ZOSA 2BEVB 2EX1A 1Q1BA 1R4NB 3E2PA 1BEUB 3T5PA 1DVPA 4G9GA 4UREA 2H11A 3QJGA 1QHXA 4UM5A 2WFMA 5CH8A 4MAMA 1KU6A 4L5JA 3AFMA 3NVMB 4GTRA 2DVWA 1P31A 2FX2A 4LXGA 2F9MA 4BE4A 2JKVA 5JFOA 2YWGA 2CB9A 4URZR 3H2JA 1E2IA 2NUAA 1W0KA 2Q4OA 5EMJA 1KYZA 1CETA 4HSGA 1GNTA 2C5BA 4W8OA 5EVJA 2NZVG 1L5FA 1X87A 1EE1A 2I4LA 1J42A 3F6BX 3UV3A 2JRLA 4K6GA 2Y4TA 2HMYB 2GZSA 3WTBA 4D4HA 4IZHA 4WNAA 4KTVE 2OGZA 3P9PA 2NM0A 4RF3A 3AGPA 1LD8A 3EODA 3DTVA 3FTCA 1DPGA 4NE2A 1LBSA 3ZN3A 1AKTA 4W9RA 2I7CA 3IUSA 1V47A 2FP3A 3QPAA 3IAUA 3HDTA 4PRLA 5AVYA 1VZ2A 4GI5A 4LHYA 2NUBA 2XUDA 4D4GA 5TGTA 1E1NA 3HCOA 2EIHA 2R8OA 2W8BA 4RVDA 3GAAA 2FSSA 1SK9A 3V2OA 3A3PA 1MJGM 4NDZA 4O4LA 3ZJ5A 5A4AA 2JLAA 4Q9HA 5EWMB 3MPOA 3A9UA 5HMMA 4LE2A 3SDBA 2VEDA 3KAKA 3LFUA 3EG9B 2C42A 3P0JA 5B36A 1W9HA 4YONB 2JCVA 3OQVA 3VZBA 3K2BA 1BXGA 4NV0A 1ODLA 1D2CA 3NPMA 3OPVA 2I2OA 4H31A 4IOMA 4KV9A 2CD9A 2ID4A 5CCBA 4QEDA 3QELA 3VPDA 3WGHA 4F8YA 3KQHA 1SY7A 1KARA 4Q9AA 3MTAA 6CHYA 1NE7A 1U9IC 1FDSA 2BKVA 2O4UX 2PKCA 4Q00A 4B2PA 4X1IA 1EMDA 3Q2KA 3WB0A 3GEEA 1KPIA 3U17A 1YI1A 2QJRA 3DR5A 3JQDA 3QI2A 4C4YA 5HZKA 2IPAB 3GLFB 4E6HA 1EK5A 2FZVA 4H15A 3AHDA 5B37A 3II6X 1UDXA 3EXEA 4C20A 4P5EA 1Y9JA 1W87A 1II8B 4UVIA 2AQ8A 2DYRE 1OZGA 3ZD9A 4RM2A 4K26A 2IDKA 1DC5A 3PFNA 4W4TA 4Y9SA 1YQUA 3SWWA 1F3LA 3OQHA 1XB2A 3EARA 1QZZA 4XD7A 4QO7A 1KK0A 4YUYA 2J3HA 4D0RA 1UP4A 4TTSA 2ABWA 3CUVA 2DWOA 1T4CB 2C2KA 4L3VA 3FVWA 4WOJA 4DADA 4TRJA 4FWBA 2IH2A 2G8NA 2UVPB 5LYJF 2BI8A 4B6SA 4DXAA 3RK4A 4ZCPA 1PJ8A 3G2MA 5JASA 5KVQA 3YASA 1BWPA 1SUWA 2AZ4A 1FNBA 4QC2A 4B6JA 1KAGA 4LY9A 1CJMA 2FWRA 3H99A 1QUFA 3FUVA 2HMUA 2YV2A 2RFAA 4RNCA 1MPTA 5E6UB 1U3CA 3UKOA 2CB0A 2I8CA 5U4XA 1TI7A 1WMEA 1U3DA 3ZDBA 4DANA 1WZIA 3FJOA 4BNVA 5AKHA 3ZK9A 2D5AA 1GFZA 5BW6B 2VK4A 3R3JA 5EESA 1F1BA 4YCDA 4EG8A 5ALNA 3L0PA 3I05A 3BCSA 2P4UA 5GM1A 1HQKA 2GTPA 3VV3A 1RRFA 2PX3A 2V6JA 4Y6RA 4FSXA 4PAQA 4HEA6 3BTSA 3CK8A 4O4JF 4LERA 4RORA 1FSFA 5TR9A 2QEQA 3LCCA 4H7HA 2XMGA 4UUMA 1NLUA 3OWXA 3C4JA 2OBYA 3WWOA 1A7JA 3BKWA 4O0LA 2Q46A 1Q19A 2BGNA 5GJVC 4ALJA 1O6BA 1J6UA 1QYRA 3EQ2A 1IQRA 2OSVA 1HTWA 1BQ4A 3CNLA 1ZK2A 1H0AA 4F11A 1POXA 4RPGA 1TO1E 2Y1XA 1O5OA 1WNTA 2P77A 3WO0A 4KI7A 1HWYA 2VT6A 5I4IA 4MR9B 4Z7NB 3O83A 4KODA 3E5RA 3QU9A 4WJZA 5A7DB 3JVEA 4RVGA 4KQJA 4IFIA 4EELA 4BFYA 1EXNA 3A36A 1JDNA 4YMGA 5HFNA 2GRQB 4NBRA 1T15A 3GD5A 3EC1A 2JCYA 4HLNA 1X1QA 2WW8A 3HGTA 3T7EA 2IHJA 3ER9A 5AXDA 4F8EA 3IA7A 3IUNA 4HQOA 4DIMA 3UCFA 4BGUA 2BGWA 3C6QA 2H07A 2B20A 2JGKA 4A91A 2IP4A 1Q14A 4NBUA 4R41A 3X1KA 4HEA1 1VGVA 4EKEA 1GM5A 1YBFA 4KJZA 3FBTA 4FC8A 1TKBA 3TVYA 3STUA 3PJRA 4P80A 1TF7A 5JSUA 3VPSA 4H18A 1O8BA 4MV8A 4CIWA 4GC5A 1O9HA 4TLEA 4NIMA 3TLAA 1G6HA 1XFDA 3I5AA 4C7VA 3KLMX 2A5UA 4ZAZA 3EOBI 4Y6QA 5FINA 3ZCQA 1WD7A 4PS3A 2GZ3A 3K9HA 3AGQA 3AS8A 1MA3A 1Q7CA 4FFLA 3EZXA 2PUJA 3G2TA 2HSDA 2W4MA 2FG5A 1GTVA 4QM7A 5JI2E 4WQMA 2B4RO 1MDBA 1WY5A 4IIJF 3BXXA 3TCXB 4M37A 4PBRA 2QVGA 1Q0UA 3RBVA 4EGFA 1YZQA 2G83A 3VR2A 4P3XA 3IT0A 3VU9A 3RYIA 821PA 4RZIA 3M1AA 3PGJA 2AC2A 4UI9K 1L8QA 1QF9A 3UK2A 3ESKA 4RVSA 4AF8A 1IXYA 1N1EA 1C1DB 3ZDYB 3HA5A 3L0BA 4WVFA 5HS0A 2H5JA 2ST1A 1PYOA 2ZYRA 3JW8A 3UT0A 3GLTA 3SMVA 1KMIY 2GA8A 2X41A 1O8CA 3WAJA 4RTOA 1RIIA 3F5MA 2AEFA 2XB9A 5K3FB 1Z35A 1Z38A 3TLGB 3I01M 3OLXA 4YWHA 3DNPA 3ZHYA 2DWZA 1A9PA 2ON6A 1YR8A 4KRXA 4X8MA 3IP5A 3JQ8B 4G1FA 1HT1E 4G9BA 1RXUA 4P4GA 4FHZA 5KPJA 2ZETA 3AR3A 3RUAA 1S8OA 1MAWA 4FGSA 2C95A 3CSUA 3R8FA 2YZNA 4X0EA 5EJ8A 1R6TA 4TKMA 2XT6A 2FX3A 5HUHA 5GPBA 3K1JA 4H7JA 1P2UA 3OFSA 1PEYA 3JR3A 1CB0A 5CFMA 4D3XA 3BILA 1GZ7A 4J8EA 1Z3YA 3D4LA 4XDZA 4PO3X 1ORHA 4N0DA 3G2HA 1GLVA 1KEVA 3BXFA 3W5SA 3IMCA 5BRAA 5JD3A 3DYVA 1IOLA 1XZNA 3EDOA 2G1PA 5JO9A 1PDWA 2YV3A 3THYB 3OSUA 1ODFA 1IM2A 4E2YA 4D46A 4NENB 3U4IA 4WBNB 5KJCA 3BM5A 4UHEA 2C8JA 5F7XA 2I6XA 4IIYA 1DOAA 1NAHA 4BCBA 5JVDF 4BKUA 4NS4A 3CKLA 2VJAA 4NEGA 5LQRA 2QMOA 5LLDA 4I1OB 3OEHD 1U4SA 1XNFA 1H93A 3LX4A 4RLQA 4UJ3A 2V3WA 4NKRA 5J9FA 1IB0A 4MTLA 3I0NA 3JVVA 4R1OA 2QUIA 1C50A 4U6SA 3F3YA 2UUOA 4AJ4A 3DCNA 2HO1A 4LSMA 2FZ5A 1CJCA 2H2IA 1QR6A 4WIAA 1HF8A 3FDZB 3IJRA 2IYRA 1WWKA 4E5MA 1RMQA 2IZ1A 5J58A 2XGJA 1SC6A 2XTZA 3TWRA 4GT1A 1XQVA 2PMFA 5D3MB 2ZU0C 4GECA 3B1KA 2QZ4A 4GPAA 1QDEA 4OLHA 2ZBDA 2VJNA 3AUSA 4S1OA 4E32A 1D6JA 3DSVA 3B13A 2IQIA 5JDIA 1T4MA 3H4IA 3FZEA 1EB8A 4HEQA 4CKYA 4D44A 4PQFA 1E18A 4M8KA 3SZUA 3O48A 3PWSA 2YW2A 2IY0C 4EHKA 3OPMA 5LYYA 2UZAA 3RSCA 4QA9A 5CDFA 4P54A 2B1QA 4IMJB 1T0BA 4IFBA 5KTMA 2GF2A 2O0LA 1V8ZA 5A03A 1F4LA 4LK2A 2IO3C 2PUVA 2RB5A 2V7UA 3BWMA 1VG8A 4C30A 4DMGA 5M04A 3R7LA 2OBNA 2O2SA 1THTA 4GSYA 4D3SA 1P1KA 4PFJA 1YDEA 2APJA 1F48A 1IIBA 4AQDA 4X3OA 3NO4A 3UX4A 1VYHA 3SXJA 1TECE 2OM6A 3H1PA 3OZXA 4APOA 5LYJB 3TXXA 4XPIA 1IHGA 3I1FA 1XZLA 1OCOE 5GOTA 3VNRA 1OTHA 2JABA 2TRSB 3LQ2A 5IS2A 3B1JA 2E5LB 5KS2A 3Q8LA 1IQPA 4L74A 3AKEA 3KR0A 5BN5B 4YQFA 3MD0A 3D8SA 4JDUA 4WAFA 4W6ZA 2BBTA 1HMYA 1JHMA 3GPBA 3RHSA 1Q0RA 4A8JA 1C30A 4BVFA 2JVJA 4KN9S 5ERYA 1L4EA 4XTCS 3V4FA 4ZT7A 3X1JA 3V2HA 3MKRA 4NTZA 1PDVA 1EK0A 4YX9A 4KSCA 4I1IA 3FWZA 4MPTA 1KEUA 2EG9A 4KQIA 1RPJA 4PYJA 1T8RA 4Y0NA 4AUKA 4AS3A 1KC3A 4DLOA 4LZNA 4N9QA 1BD4A 3U2QA 1X7WA 2BCJQ 5F77A 4B34A 1DAGA 1NGSA 4A0GA 3JAMA 1FP7A 3EQ7A 4BNWA 4X61A 3L4JA 4KTTE 3VH1A 1QGED 4YQYA 4ENPA 1JU3A 2BZSA 4JLVA 2PUAA 4FZVA 2GF9A 3I9V6 2AG6A 2XQ0A 3IESA 1Y9EA 2Z1MA 1V43A 1PUXA 3TKLA 4E12A 4FT4A 4TWIA 3INGA 3ZHQA 1U0GA 3G5MA 4IV0A 1GL7A 2P2NA 1S3GA 2HA4A 5IAJA 4BBPA 3J81A 1NRXA 3NM6B 1KFCB 1CF2O 3EBPA 4WDQA 1V4VA 3RRMA 3AU8A 1JLMA 4U7JA 1J07A 1GLGA 2VPYA 1JIJA 3UGJA 2KPOA 4Z4QA 3VISA 4AX8A 5G0UA 2BFPA 2HF7A 2XZDA 3OUTA 3ZDQA 4WFQA 2QAGA 1NXQA 5GJWC 4CTMA 3OURA 2JIZA 2IEJA 1B8PA 5JH7F 2YY5A 2ZJ4A 3K15A 1IMJA 1DB3A 1S2GA 3H5AA 3WMXA 3NWJA 2NV0A 1VPVA 2ZAOA 3G2IA 3EPJA 3QYPA 3TINA 4O2RA 2WXGA 5A6CA 3AJIA 4NOMA 1YQDA 3ZYKA 1KE2A 3TG2A 4OXKA 2PXCA 3RU2A 1R4ZA 3PE6A 5CAEB 3PQCA 1BO6A 4WXRA 1HURA 2PMBA 2XF2A 5FXMA 5EZSA 2BSQA 2HMWA 3GRAA 4EUEA 4DQVA 4DNFA 3L5KA 3N5CA 3I9V1 1GCAA 4N5HX 2OV3A 1C41A 3S27A 2GUGA 3ROEA 5BMOA 2MSNA 3J5PA 5CLQA 3TBKA 1JJFA 1VOTA 1X74A 2ZZNA 5JXHA 3CR8A 1K63A 4O1IA 1FFYA 5HG0A 4DPMA 5HE9A 1Z5VA 4LOJA 5FWNA 3KJFA 4V38A 3KCQA 4CL2A 1E8ZA 4XYBA 2IEAA 2BZ1A 3L79A 2E21A 3QKSA 4HZIA 1Z37A 2JFVA 4Z4FA 4KUEA 3PI7A 4X8OA 3F7OA 2OUKA 4W7HA 2FY8A 4DCNA 3VDXA 8MHTA 2GASA 3W3AH 1BU5A 4WZAE 2XDQA 4C43A 2G6BA 4H35A 4FQ8A 2CN1A 3O4RA 3W7VA 5KBYA 3KSBC 4KYUA 2F8SA 2QTVA 2C20A 3GGJA 5M7EA 3VYUB 2CFSA 4W5JA 1OC2A 2V96A 2P2SA 2YYSA 2TSYB 4AMZA 2XB4A 2XUJA 3V97A 2WXJA 3ILXA 4RZQA 1S3SA 3AXTA 3EUVA 1VLMA 3AI3A 3IEMA 4XVHA 3E34A 1F14A 5IAAA 4YJGA 4QBFA 2HPAA 1CY1A 2FO7A 4BAUA 4MUIA 4FLEA 2YZ2A 4GICA 4EQ6A 1I1OA 2YMQA 4HFGA 1HFKA 2AF3C 4ZYVA 4BTVA 1QG0A 4L95C 1JNYA 1WMAA 4GGMX 3E33A 1MJGA 3RWMB 5GY7A 4G24A 2P4HX 2PTGA 3C3BA 2O0MA 2EQXA 2KQUA 1HV8A 5EVCA 3CLSC 3E8MA 5DISB 5K0LA 5F3RA 1FFSA 1JFFB 4U7FA 2XZOA 2PIDA 1TQHA 2GM4A 1EFPB 2FPIA 2IBMA 3UMBA 5JV5A 3RVNA 1RFGE 1HDYA 3AQ4A 4AZSA 2IX9A 4TMFA 2YYYA 1F38A 5FQNA 3U3DA 2RH9B 4FK8A 2X9NA 1UCFA 1TO2E 4MYRA 2ZSUA 2P41A 4JUBA 5ANRB 5J1SB 4OGFA 2RJ3A 1JKMA 3TKYA 1TNUA 5L3QB 1VXOA 4RZUA 4M0PA 3Q7EA 3MFQA 1Q16A 4BLWA 4BLSA 1YONA 4OFWA 4JUDX 3CJRA 3NHUA 1XTZA 3P9YA 1IVYA 5EXXA 1R6DA 3G2NA 4I1RA 3SI5A 2Y9PB 4LNUA 3UJDA 4JNCA 1UWVA 5EUQB 1XCMA 5HIIA 3LT0A 4RXTA 1VHWA 3RU0A 1UG3A 1CQIB 5AVTA 5JHBA 1I24A 1VBNA 1XBTA 3RSSA 2E2WA 2VQ2A 1X86B 2LPMA 4NCAA 3H5VA 3G9QA 1N54A 3AW8A 4AF7A 1COWA 3IV6A 3TSZA 4FHCA 4IJMA 1O4WA 3D8TA 4QYXA 3IVAA 4S05A 3KTOA 2XVAA 3VPFA 4CIAA 1B73A 1JHXA 5CFPA 2W6MA 5REQB 4NZMA 4CDNA 1ZD2P 5J08A 3B6EA 3CSFA 3HNRA 4RJJA 5JYCA 4YJFA 3T0FA 4RGBA 3QARA 1GGKA 3RUCA 3AVYA 2ZWPA 5K1ZA 4H4CA 1PL6A 1QGOA 1Q0HA 1BVHA 4MINA 4B73A 5I7UA 3ABIA 1H8EA 3B6ZA 3WNCA 1EUYA 1DIAA 2R6FA 2YV1A 3EGCA 4DG9A 3V8MA 5C3UA 1IVSA 1E79A 4GNKA 3DP7A 1P72A 3PNQA 1E32A 1JJAA 4MMXB 2P9BA 4KBGA 1SXIA 2HWWA 1NVTA 4WUYA 2Z98A 3L4KA 2OB1A 4UULA 3GMSA 1RHQA 3S1SA 3CGHA 1WZNA 4L0MA 4PZPA 3VYVA 2VGXB 4C0AC 1UDAA 1YRHA 2VHTA 2WWYA 3TE7A 3WI7A 2B25A 1J20A 1P4HA 1XTVA 1UBSB 1MEJA 5J43A 1XRMA 4BP1A 3LO5A 1FFBA 1MYOA 1RXYA 3GA5A 1ULBA 3TZHA 4I1PA 1NWCA 5CA0F 5GTDA 2WXPA 4JVNA 1J0CA 4YT8A 1OT5A 2GD2A 3B7TA 5CW1A 5CLIA 1YR3A 2CL7X 4JCOA 1ZD8A 1Y98A 2QM8A 4JLJA 1BDJA 1FTQA 3I8XA 3QU7A 4X65B 2B82A 3JQBC 4EMSA 1LBHA 5BSVA 2AT1A 5EYLA 4W7IA 3HWX1 1W0CA 3NYIA 4BE7B 1HPLA 2ZI6A 4A16A 2XH8A 4DA6A 1ZR4A 1DQSA 3KHSA 1RHKA 1D0SA 2HQSA 4YQZA 1F3OA 2J08A 5HKKD 3WV5A 2PS0A 1YTUA 4K9MA 2MSCB 1JR3D 4EABA 1NZDA 4BFVA 2A33A 3H9EO 3G2KA 4PN7A 4FP9A 2F8LA 3G9ZA 1GPH1 3NTQA 3AJAA 3EIWA 4B6RA 1T9CA 4D6XA 3B6MA 4NPCA 3MMZA 4UEOA 3QPUA 3L02A 2FW7A 4L9PA 4Q7MB 1W5TA 5DOVA 4HL6A 1I01A 2UYQA 2X6QA 4G4GA 3SQVA 2FWNA 5C52B 1VI5A 3OA0A 4BLQA 2BFEA 4QLAA 1HDCA 3I5UA 2LNDA 5IDQA 5F9HA 1G98A 2HCBA 2HL6A 3FH8A 3MZLB 3LW8A 1P74A 1BRMA 5ICGA 2QD4A 3NR2A 1HM5A 2WKSA 4BP9A 2A1IA 1UWCA 5IZ4A 4BDTA 2GEUA 1AV7A 1AGPA 1Y9ZA 3BDAA 3F97A 1OI2A 3DXYA 3RARA 1N7JA 5IFLA 2FHSA 3IPXA 2YFHA 3HA2A 1D04A 3JALB 1NDQA 3NJ4A 4JI7B 4FYXA 4WZBA 3UJ7A 4Q4CA 3RVJA 2IONA 1LV7A 3N7TA 1NR7A 4CG2A 4C08A 2SBTA 2Z5VA 4Q6BA 2HV9A 4LY3A 4X3PA 2B6HA 5TPWA 2GO7A 4UI9J 1XYGA 1E64A 4R98A 5HK9A 2YHAA 5KTOA 3EVAA 2Q62A 1NFRA 1TVKA 3BIXA 3O74A 4MR7B 3TW6A 2FPGB 2VJDA 2AI1A 1LQUA 1VJCA 3SF0A 2O8CA 5JSFA 4YLGA 1ZOIA 1T5IA 1EHYA 2G9RA 4B4WA 3BRWD 5LMNB 1YA6A 2I67A 1TIKA 3ZE1B 3ES9A 1OA0A 4BMSA 3QG5A 3JYQA 1FYDA 5KYWA 3LW7A 4IHJB 3CV0A 1O1SA 4K5BA 5TMPA 1G64A 5I7SA 1U0HC 5JTUA 2WKQA 2WBLC 3FFLA 5JIBA 1VYUA 2VJLA 1G41A 3P26A 3BL8A 3IODA 1UOEA 2GXUA 3N2LA 2FFHA 2PT7A 5EZ5A 2WJ6A 4BPRA 5HE8A 3PZ2A 3MZ0A 2F17A 3I0MA 4I36A 4OHMA 4BVJA 3A1DA 1C7QA 3KKLA 5FBZA 4LKRA 3L4BC 3O26A 2VPXA 2YINA 1YA0A 4IVNA 1Q7EA 2C4VA 2OHVA 1J09A 3T7SA 4EA9A 5DTRA 1E2NA 1E9SA 3H5NA 5AI8A 2EQ5A 3K70C 1JW9B 3P4XA 1HZJA 4CGZA 1MPXA 1ODIA 4KIWA 1EA5A 4RAOA 1BYUA 4C21A 3GFRA 4EJSB 2PS3A 1E20A 1AKMA 1NPTO 2IYFA 3TX6A 3LF1A 2WV9A 4BC0A 2NADA 2Q0HA 3DMTC 4UBLA 1CVRA 5FBLB 1HZZA 1PJLA 3EISA 2ZUWA 2IO2C 2D5CA 3KJNA 4KACA 3T4PA 3ET4A 3I52A 3QNMA 1D4FA 5DGTA 2AKEA 1XZEA 3ROGA 3AERA 5CITA 3TFOA 3IL2A 1Z15A 5ALXA 1PQYA 4A8JC 1W0JD 4R2WA 2GD0A 1NMXA 1DRWA 2UVQA 1TIBA 1RE1A 3DDCA 1Y1RA 3DHWC 4R1MA 1HG5A 1X6VA 3FTPA 3KKOA 3LM8A 4YNDA 3D1VA 3RFXA 3SZOA 4ALLA 1XROA 4I55A 3IOCA 3AU9A 1YCGA 5FB3A 3BHMA 3HSKA 4MI6A 3ZYCA 3IB3A 3TVDA 1NXWA 4RU1A 2JJQA 2CVOA 4Q4HA 1QVZA 4LGMA 2Z95A 3K73O 2X4GA 4JP8A 1FMTA 1U7TA 1RHRA 1WSWA 2WG2A 3WQRA 1G5TA 1NIPA 3C0KA 1M9NA 2V4MA 5C4MA 3ZEFA 2DR2A 2VKQA 4JL5A 3INRA 5FQ8A 1NRWA 1QV7A 1E6CA 2EU8A 1ZINA 2E4WA 3PF8A 2HNAA 1WUKS 4KX5A 3EN0A 4D5GA 1VI2A 2P1DA 4LNHA 5CDUA 4DV4B 4Y1GA 4YJHB 1IY9A 3D6VA 3GT7A 4PPFA 3ZKJA 3WRXA 4EO7A 2FSPA 3Q3HA 4ESEA 1DKNA 1Z5OA 4XM1A 3DXFA 1LA2A 1J97A 2GPJA 1S1MA 3BMQB 1G5QA 4RDHA 5A7FA 2DUMA 2KC7A 1OJLA 4CMEA 3WGUA 2WEKA 1EVJA 1A88A 3MJ4A 4LOIA 3S5JA 1F8FA 3PNKA 2IH5A 4AM9A 5F12A 3EGDA 3NWPA 4RSGA 3FPJA 3OECA 2PYDA 1BAPA 2JAHA 1L5HB 3LDHA 4WCFB 2CLDX 2EVWX 3BWCA 4WXEA 4KWHA 3GXOA 2QPOA 5EJEA 4LNBA 5G4LA 4RZXA 4YR9A 5G05J 4M98A 4YV2A 2QT0A 4ZHQB 2FTKE 1XCPA 4C4TA 5GVSA 2Z2JA 1DC2A 1TW2A 3DB2A 1LI7A 4ARCA 3C74A 4Z9BA 5IXSA 3DL7A 1HTBA 1QMGA 2ZIRA 4DM3A 3VAAA 2J3JA 2VQ3A 1EP9A 4MS4B 3MKQA 2OKGA 3ANXA 3JPWA 3HIZA 3PUHA 4A0RA 1CX9B 3FWYA 3IOMA 3L07A 3HPQA 3THWA 4PLFA 4WFJA 4XIYA 3I3OA 4XIJA 4QLBA 3N2KA 3R9KA 4KMOA 3L6OO 3E15A 1ZCAA 3ZYLA 1CNMA 4HS4A 1LJ8A 1U5AA 2YUTA 3DA8A 4OFXA 4NPAA 5IN4A 3MWJA 4RHCA 3PF9A 2SCUB 2VJ8A 4J0KA 3TL3A 4QJ4A 4G1MB 3IP3A 3TJZA 1N2SA 4HC4A 4NHEA 5I45A 4PANA 1B8OA 4A0HA 4FWTA 3AL2A 3GCDA 2IH4A 1XYYA 2EJVA 5DBEX 3W9UA 1B2RA 1UKCA 2R9VA 2F8MA 4CM5A 2IE0A 3RKRA 5I7HA 1XXLA 3NMUF 3KZNA 4AP9A 3DM9B 4MLZA 5SV2A 2JH8A 4Y6GB 2PBFA 1DRVA 3VC3A 4HDQB 5BNZA 3RHZA 2VK1A 2CLMB 2I4OA 1QP4A 3GP5A 3TXNA 3WDSA 2A30A 5F33A 1CUXA 4A1FA 4ZAWA 4G4SP 1FRZA 1QQ7A 3RC3A 3DOHA 4CIBA 1U90A 1N4SA 3PICA 3NV7A 5BWLA 3A31A 1YDWA 2H54A 3Q4GA 2Q1TA 1BFDA 4K3VA 4KRFA 2C3OA 1GSAA 8ATCA 1OHHD 2PGAA 1WW8A 4OPMA 1XD2B 4J29A 3O21A 4MX8A 4DC0A 2QV7A 4BTLA 5ENZA 1A9XB 1BE0A 1DAEA 3ETLA 3GW8A 4LDAA 3CUSA 3G9TA 3PZBA 3HVKA 3EEYA 4WA7A 4MROA 4ZCTA 3AB8A 3TE6A 2W6QA 3MRVA 4ER7A 5IM4F 4G11A 2WV7A 3HYTA 3TECE 3LQRA 1P75A 1XRSB 2OCGA 4JVMA 2GAOA 4O8CA 1NA0A 4UQYA 3GZNA 5K0GA 4XFKA 4TT3A 3C1OA 3VR1A 3ZCXA 3IDZA 1F6DA 4YROA 4F04A 3PRZA 3QWWA 3P0EA 3A1NA 5D1NA 9LDBA 3CHQA 2BFCB 2GS9A 1VE7A 3CPHA 5E0KB 3D9IA 5FT9A 1H2RS 2C4KA 4I2VA 4BIMA 2BHRA 4DXHA 2Y1WA 3JWIA 7REQB 2FI7A 2BH2A 4HH3C 1ETHA 2FKAA 1AKEA 4PSCA 3ZH9B 5JNSA 1D8TA 4QFMA 1EUDA 3ULEG 1AF7A 1X0XA 5JMTA 2EOAA 4IDOA 3DXMG 3ZQKA 1BDHA 2JIRA 3DBRB 5EP3A 1RAIA 4PO8A 3TL5A 4S1WA 1ORDA 4K9DA 5ENOD 1QGDA 2A9OA 2OZKA 3NBZC 3ASYA 4XW2A 3UPDA 2J7PD 4FUTA 4H3VA 3PT9A 3M33A 3GVCA 4Y2YA 5JCZA 2XNHA 3CVNA 4AZ3B 2V4LA 1SHJA 1JBQA 4JYMA 3SBXA 3WXMA 1G5RA 3IV0A 1QIMA 4TXMA 5DXAA 4FFNA 4LSWA 3SFVA 1NMQA 1ZNQO 3V33A 2VJMB 2SKDA 3A32A 2MSKA 3UNXA 3PHJA 2XYVA 3RRBA 3BFVA 4Z9XA 1ZJ4A 1NXSA 4JBGA 4YDYA 1KFEB 2YJZA 4D9NA 5K0EA 3PQ8A 1E4EB 4L57A 3ACBA 2WU3A 2XRMA 3FCEA 4ZK6A 4GEGA 2Y1GA 4DR6B 3G1WA 1DDIA 1KY4A 4YIHA 1EE2A 3EIQC 2R8YA 1F2VA 1F51E 1TYQG 3OLCX 5EL0A 4PV7A 5L45A 5ILQA 3KHUA 4OLFA 2V6IA 1CY6A 1KQGA 1H2AS 4XGKA 1GITA 4IRXA 3HSYA 3QX9A 2HU5A 4J7WA 1E99A 1N0IA 3PIRA 4XWOA 3FI9A 2ILTA 3PR2B 1KAOA 4ZI5A 4DAEA 5KCZA 2J1LA 1K6EA 3KUDA 4BQNA 3FUTA 4LF5B 2W42A 1TK3A 2IY8A 4KW7A 3U4AA 2WF7A 3H13A 3HEMA 4NFHA 2B4AA 4HGYA 4CTOA 4DRXA 1IHXA 2CL5A 4NSNA 2WPNA 1G19A 3OCYA 1IM8A 4LQ4A 1IZZA 1X7GA 5AYWD 3LZ6A 4B3GA 4JU8A 2EZ4A 4MUAA 4WAUA 1J21A 2YOFA 5AW3A 1W7AA 3WLHA 3PEFA 3HXQA 1GVHA 2FDXA 3NNNA 6LDHA 1WB5A 1X7ZA 4FLFA 2OO5C 2K2QB 1ZDMA 3BQ9A 1JIXA 4QTXA 4B94A 3A1CA 3CNHA 1A1VA 2X6KA 3ZC3A 1DJNA 3E3AA 3KXKA 3C3AA 3DL0A 2Q3CA 1OYWA 4HORA 4L7VA 3L6DA 3W4KA 2QIPA 3CE9A 2NOAA 1CQJB 3OTNA 3AF3A 3PUYA 4WBNF 2BHSA 4KQ6A 3DOOA 2HLPA 1U0TA 4N76A 1XTPA 1WU8A 3FHCB 2L82A 1GQQA 3ONNA 3MJTA 4TKUA 4WA8A 3GK3A 3OVMA 1C3OB 4AZTA 2CJWA 4TYQA 4Q7KA 4LKOA 3VKGA 5NULA 1EZ1A 1M2HA 3KYIB 2H7XA 3L0OA 4L9WA 2ADFA 5HFAA 1E8MA 1XEXB 4JBWA 1XSEA 1Q6ZA 3ND6A 4MPDA 2JGMA 1N6RA 3VVLA 1FJXA 1XIVA 4JJIA 4HDNB 2O8EB 1AVTA 2PSFA 1MRNA 5I7EA 4Q9JA 3EIFA 3AZPA 2H2HA 4YRCA 1T6BY 1YCHA 4KPEC 3V1UA 4V3CA 4F5EA 3DFUA 3MSXA 1K3TA 1YBVA 1QZXA 3D02A 3OQIB 3O75A 4EBFA 5DHQA 2IV3A 3ZU2A 1ADJA 4BNDB 3DF9A 5G2OA 2DQKA 4U0ZA 2WB4A 3TQFA 4ZVLA 2EYUA 3H9BA 3KHKA 5FH9A 5P8WA 3JVUA 4MKIA 3K71B 4N0MA 3GZ4A 4IUCS 3T0IA 4BN4A 1V55E 1QMOE 2UVDA 4DPRA 1DNPA 2W43A 3IELA 3C97A 2PR7A 4TWRA 4BRSA 2R6HA 4ZJYA 3HCRA 1Y48E 3WFJA 2VN8A 1EX9A 2IODA 2NT4A 1H4VB 4Q4JB 4V0QA 2YINC 2NYUA 3CO0S 3DE1X 4EA6A 4RBNA 5DLYA 2I6QA 1PJBA 1JEYB 1N6HA 4CJXA 3KKQA 2MHKA 3G2SA 4DLTA 3NHWA 3C87A 2NO7A 4LTMA 1CU1A 4ZMSA 1M2OB 2A9FA 3UT5B 4WECA 2QNIA 3BZBA 1EDDA 1RR6A 3FTXA 5IX8A 4DVGA 3RADC 3R7FA 4QDZA 4MO9A 1MVLA 1RJEA 4MRUA 1DKMA 2P9FA 4YBZA 2J5BA 5A3VA 1G63A 2N46A 4WK6A 1JZQA 4CLXA 4L51A 1OF1A 5LCWJ 3UB2A 1WU7A 4PAWA 5CYPA 1H05A 1MB3A 5A4DA 1P7YA 2YN2A 1GLNA 4Y2UA 2ZBPA 1V6AA 4G86A 4INPA 1ZMOA 3SZMA 3OZWA 3USES 1NZNA 2AFIA 4QOGA 4U0SA 4NCKA 2ETCA 1AC5A 1FDUA 4AT1A 1GFIA 1HT0A 4JJZA 1U0NA 3DTTA 5T4HA 2AXNA 3GLGB 4RVCA 4YY3B 1Z06A 4BFTA 4Q7QA 3R6GA 2AFHE 4E6EA 3CF4G 3GEHA 2IXTA 4QJ3A 3CX4A 4BX0A 1NNEA 2VTDA 1JBEA 1IY1A 4KLCA 2BF0X 3CLUD 3U60B 2DPMA 4OAPA 1F8GA 2OZLB 1I3OA 3MHPA 4LJ9A 1A96A 4B6EA 1ZISA 1BXRB 2H48A 2BFWA 2X5HA 1A4RA 1ONOA 1QHFA 2D0PB 4CR8A 4O5AA 1CY8A 4AS2A 2MRIA 1MZPA 1K86A 4MMYB 3N8NA 5FZQA 3A7DA 3KSAC 3QOWA 3WGLA 4XRRA 1XRJA 1YS1X 3D3WB 1Z82A 3NAWA 2G80A 3JR7A 4HEJA 5DNCA 3KOOA 1U28C 1WPRA 5DX8A 1OD6A 1JKJA 1TM4E 4COOA 4LCJA 1LTXA 1M6NA 3PC2A 3ICCA 5B3AA 1I2ZA 2I2XB 2YJ5A 3HDQA 1LRJA 1SVKA 5LDGA 4DIEA 3TLKA 4UQPA 3QMWA 4KBFA 1W2WB 4CHTA 4ZGBA 4C0BA 4F6RD 1FFAA 4INAA 5FOQA 4A23A 3GA7A 3QVKA 1OXJA 3UG6A 4FYHA 1GTRA 4W5TA 1XMIA 4UCFA 2TMYA 4BUZA 3FLEA 3WNQA 4HLDA 3REQB 4LXIA 1GQRA 4H7FA 2CYCA 3TXMA 5C18A 1OXMA 1KU0A 2V7QD 4EPYA 4X1YA 3RTCA 2X8LA 1HDIA 2WZQA 2WJAA 1PD0A 2Z08A 2P35A 4MV3A 4TSFD 2F37A 2XW6A 4IOJA 1AN9A 1PNQA 1U0OC 1YJ8A 2V5QC 4FMBB 3WKCA 2WTNA 4D81A 4GZ3A 3W05A 2W9JA 2R60A 1RYYA 4U8YD 4KT6B 3M6WA 3HKEB 5CK5A 2B4KA 4TTTS 3ZIMA 2AN4A 4OFBA 3AAAC 3PITA 1Z5SC 1W19A 1GZHB 3H2YA 3CPEA 3RU9A 4NEHB 3DWIA 3HMKA 3WJ1A 5B3KA 4RTMA 1EWVA 1RJ9B 1DG3A 5JVDA 3QAQA 2Q41A 3VZRA 2OPHA 4XTRA 5ICEA 2IITA 5BYAA 1MTOA 3TUZC 2AVDA 4HRXA 2IYAA 1OXTA 5M3BA 4UQXA 2H92A 2ASVA 3ESAA 1J22A 2GPTA 3B9RA 1AA9A 1J8QA 4HQDA 4OVKA 5C2JB 3G79A 4ZRDA 1HSZA 3WGYA 5D1HA 4GM0A 4BVLA 2QGNA 1SCKA 2VBFA 5E1MA 2VSOA 4UQOA 3GARA 5DU2A 1ZI9A 3EHRA 3CTMA 2I66A 2FZLA 1VKOA 2VYNA 3SSAA 4PHHA 1Y3BE 2ZUSA 3FMFA 1R0XA 2Y93A 1VIVA 1BDBA 2QTGA 4EYEA 3ZLVA 3BWXA 1ZU4A 2NO1A 1I36A 2B1GA 1TEVA 4ID9A 5ALQA 3ROMA 2J4CA 4LCTA 3PFCA 4MA5A 5DGCA 2HCTA 2PU5A 3DWLG 1ADFA 4J9UE 1LBIA 4HS2A 4LMRA 4FFWA 3HFRA 3BULA 3VNUA 3X2EA 1UBRS 3LG2A 5EYPF 4TV8B 4XQ9A 2P62A 5AQAA 1H8HD 2IYVA 1QIEA 3TAXA 1YUMA 3ZD6A 4MV6A 3UGKA 4QFVA 4F6RB 4Q93A 4CM4A 3VYRB 4ZANA 2R68A 3ZIAD 1PL7A 3EZYA 5DWVA 3GYBA 3SCZA 3KTAA 5DBGA 1WJGA 3ZCSA 2ZIAA 4WLEA 1FQKA 1WABA 4OP1A 3C7DB 4YRBA 5K4AA 1L7VC 2ZXWE 1SXJE 4OHRA 4JI0B 2D3TA 3LT5A 4RFSA 4CDRA 3ICWA 4F4DA 1LDYA 1XJ0A 2XGOA 3G0HA 2AK3A 1KQNA 4R69A 2SECE 3TSYA 4QBKA 3HZOA 1AK2A 4D0GA 1DAHA 2YJTD 1OAKA 5TNXA 3BXGA 4DB4A 1OFTA 3NONA 3BKXA 2C5HA 1NVXQ 1SKYB 1YL5A 4YAEA 5KOJA 1P1FA 1B0UA 5DN9A 1X2BA 2P30A 1DZIA 4DXDA 4P22A 3BJMA 1IEWA 1TJYA 4HXGA 5LP6A 5GOZA 1X1CA 1NVAA 3TZQA 5ALTA 3UXHA 3U3JA 2HIGA 5H59A 3PXBA 3JQAD 4HADA 2PNNA 1PWZA 4WKGA 1RHMA 1IN5A 2RAPA 1OGIA 3AHFA 4IXWA 5ALIA 2XENA 4US0R 5J3JA 4HRMB 4JBLA 2R11A 4H1VA 1G8PA 3HI6A 1NBOA 4UXHA 4ND5A 2GAJA 4WNIA 3D4NA 3BHIA 3T3HA 4Z0NA 4ANUA 3CUUA 3WE7A 3NOQA 3DQQA 4QBIA 1QWSA 1GD1O 3IQFA 3RS7A 1JQLB 5B3JC 4GPKA 1E3QA 1CIJA 2C7PA 2RIRA 1IZ0A 2YXNA 1LLCA 2WUFA 4FEYA 2R8XA 4KAXA 4F45A 4G0MA 3JS5A 4C0HA 3L49A 1YDHA 3LTNC 1HDXA 5JMND 3JYLA 5JARA 3RC9A 5D7NA 2HE0A 4D0LB 1P0CA 2XXJA 1N8NA 3B7BA 3GJZA 2B83A 3WGIA 1BX3A 3TRHA 5HUJA 4WY2A 4GOJA 5JH7A 3V48A 1I8TA 4OMDA 4UEQA 4YHBA 2X0RA 3OCJA 2MIIA 2MR6A 3DMHA 5AHKA 1TOAA 2ANBA 3M6IA 4FYIA 2J5KA 5LB4A 1KAHA 5E3HA 3Q79A 1LSUA 1QQTA 3ZYQA 4C88A 5L7TA 2XCLA 1K1BA 4DYVA 4KDEA 2C9CA 3TOVA 2RI1A 4MUXA 3KLBA 1ZBPA 2CK3A 2VH5R 3Q72A 4HNGA 5FCDA 1QKJA 3RSGA 5AD1A 1TT5A 4PCLA 1DARA 1PV1A 1Z2AA 4JXTA 1OZFA 1TVEA 4IINA 1F06A 4W1RA 3I5YA 2G76A 5KYTA 1DC6A 2CMFA 1USUA 3CZ4A 2M9MA 4C0WA 3BWVA 3P0FA 3DZJA 3C85A 2QL5A 1N7IA 4GTSA 4ZEVA 2FMHA 4P4LA 3USCS 2SKCA 2ATVA 4RJKA 3R9IA 4DTIA 3V31A 2ZBVA 2IIQA 3JQAB 3L9WA 2BMVA 2VXOA 1PR3A 5HBRA 2ZTVA 2JAQA 3U44B 2DHRA 4XE0A 4F56A 2RHLA 1JP7A 3SR3A 4ILGA 1NN0A 1RWOA 3APCA 1PWHA 1YS4A 3WQBA 2Q7XA 3R3YA 2QTFA 2W6NA 4GWGA 1C1YA 1MAAA 3JSAA 4PNZA 2HJHA 5EKDA 2PUEA 1Y7PA 2B78A 3VKWA 1R8XA 3AVOA 4Z0PA 4U7GA 4LE0A 5JSZB 1BN7A 2XWSA 2IKSA 1U2EA 3IC5A 1Z33A 2FG7C 3E1KA 3PRKE 4PSKA 3IERA 1BHO1 1YHZA 4UWGA 2PGDA 3WLKX 2ZUFA 5EMHA 3I76A 1GKKA 2ERCA 4MR8A 3WOVA 2A92A 1HL3A 4HFRA 2FLKA 2N9UA 5JWOA 1CVIA 3IO3A 3FJYA 3G2OA 3EW9A 3QM1A 4P92A 3MN1A 1P45A 2H2GA 3GRPA 1CD5A 2YZGA 1GKYA 4TX1A 3TDKA 3R74A 1BCSA 4X8QA 2PQ0A 1MVNA 3HCCA 4IHJF 2F1OA 1COZA 3EAFA 1ZKDA 3D0OA 1E7MA 2PSJA 3L8DA 3BUAA 1L5YA 2OBLA 1H6KA 1OZHA 2QQFA 2PFKA 1R6AA 4UJ5A 2HT6A 1EX6A 4K28A 4BNKA 3A27A 4ENQA 4Z2YA 5IXYA 3GPLA 3IGFA 2WVHA 5IARA 2HCJB 3EFOB 2EWVA 3U0BA 4UUAA 1U1IA 1V6CA 4M89A 3PFHA 4L85A 1N7GA 4G0XA 2CZQA 3UKUG 2AN1A 2OILA 3AG2E 3I61A 2QG6A 4D10C 1JQEA 4B45A 4YAFA 5HSGA 5F4BA 3JXJA 2FEPA 5CNKA 2EXXA 3G1TA 2B94A 1H6AA 2VLIA 3DOUA 4CEJB 3KWMA 4HKTA 5AW8A 2MCFA 1KMMA 1FVOA 3OKPA 2MJLA 4FW9A 1EFCA 2W00A 1Z45A 3BBPA 3LPCA 3GFTA 3H8VA 4I6GA 2OWEA 4RUKA 2R3SA 5BYJA 4J7CA 3HWSA 1AU9A 1FLDA 2EKBA 2RHGB 2QL6A 1FDRA 2VFAA 1KXZA 3AM3A 4KK4A 1JF8A 4IUYA 3MJSA 2Q4BA 2ZSIA 2C3MA 1V7PC 2EIME 1YZVA 1TUGA 5DBHX 3CX7A 4OVVA 5TT0A 1CQWA 3OZ7A 3V8VA 3QNKA 4UU1A 1Z73A 4M7CA 2X86A 2C9OA 3GDOA 3A25A 5DNEA 5KTTA 1N34B 2F1HA 5BSWA 4Q05A 3GLVA 3O1JC 2JD2A 4DUYB 3CLKA 1PQUA 1XAIA 9LDTA 3UW1A 2O2CA 3L0ZA 1SBTA 2IHVA 1O96B 4G0PA 5EYPB 1XZGA 3KM0A 3NORA 3F5SA 3ANNA 3KX2A 4BO8A 3PTLA 3K94A 2HK6A 5IUNC 2QRVA 3THOA 2C2BA 3OPYI 2C8KA 4QTYA 2VDNB 3UJ6A 1U3VA 3R75A 1Z3CA 3BAFA 1M2GA 2LXMA 1LDBA 5IVIA 5AW5A 2IHBA 1ZJZA 5J5AA 1OI3A 1UJMA 1ZSNA 4KOEC 5CG2A 3QBVA 1WXWA 4CQMD 5ALFA 4FINA 5CA0A 1XTIA 1CZOA 4BO2A 2JFBA 3WZMA 4ZV4A 3E81A 3F46A 5CXXA 1EGMB 1C3JA 2HA2A 3BH7A 4ARUA 1FNDA 3L5OA 3WMRA 3E9NA 1B15A 3BJEA 2X0IA 2HQRA 4TL9A 1LK7A 2NZ8A 1Y63A 3S55A 3LS8A 3UA4A 1XG5A 4RY8A 3K9QO 1O6ZA 3R44A 4BQPA 2Y99A 3EA0A 5JD5A 3KCNA 3FM9A 1AKWA 4C89A 1J1UA 4Z4EA 3ZV3A 3KZOA 1G59A 3R5JA 2VBIA 2VHZA 1XP8A 3KEZA 1IUKA 4K6HA 3WRVA 1X15A 5JSKA 2WD7A 4FYYA 4EL0A 2WSYB 1V48A 3CTPA 4R51A 1R0LA 2CYBA 4B3BA 2AA3A 5SY6A 4RPLA 1C0KA 4BPBA 2GETA 5CERB 3P9SA 3SQXA 3PE3A 1DC4A 3F4LA 2BE7A 1UIRA 2WWIA 2ADMA 4ZHQF 2I4TA 4CKCA 4AKIA 1UAAA 1Z0IA 1LGYA 2X5OA 1NYTA 1LI4A 5JEDA 3TG4A 3BFPA 4ZYLA 1UXHA 2YW9A 4F84A 4TRMA 4RDCA 5DX0A 1DOZA 4ONEA 1RP1A 2IOLA 1FLAA 2VZ0A 4OXYA 4LV5B 4MQEB 5EIEA 3GJ7A 1ONNA 3U4QB 1NC3A 3MOIA 1G7RA 1U2RA 5AKXA 2AMJA 1YA8A 3NX4A 1QORA 2RG7A 4MA4A 2PS1A 1MC4A 6YASA 3R3HA 5GV7A 3Q5MA 3GLUA 3WISA 1A2OA 2P9GA 4UM8B 5BOSA 4FWIB 1QYXA 1EXMA 1H6OA 1V7CA 4UHDA 3B78A 4RH0A 1RBZA 4YCSA 4R05A 4JP3A 1E1QD 1HF3A 4GOKA 1LPSA 1VGRA 2C2GA 5IAOA 2CWWA 2F2TA 5DWQA 1PN3A 4O2BB 4PYNA 2ATCA 4U2BA 1E2BA 3LX5A 1VPWA 2DTDA 3EE6A 4JLOA 3L4SO 1YHNA 4DUPA 1DTWA 3FOAA 4UHBA 1ZM3A 1TTTA 3BTUA 4CQMB 1KOGA 4J8FA 3N2GA 2X0KA 4LBVA 1V9SA 2GYVA 2Y4OA 4GOXA 5DRTA 2BSAA 1CR4A 3D54D 1USKA 3QEKA 2XBLA 1IBKB 4XCVA 4BJ6A 2XJ9A 4KCGA 3TRFA 1G16A 2VRCA 4K81B 4PX9A 3Q85A 4I9UA 2FEWB 1YKSA 4WESA 4B2YA 3D3KA 2DWCA 3SS9X 2HGSA 1Y1QA 2RC6A 1L7BA 1R16A 2Q6VA 3IFSA 3OH8A 1PR4A 3ZXUB 2XQFA 1E6UA 4G8CA 5EFZA 2E7ZA 2AOXA 3BL5A 4DEYA 2HT1A 1CK4A 4R2KA 4NJMA 5L40A 5FHRA 1PEDA 1GNRA 3TOCA 4ER6A 1LLUA 4XDGA 4WNFA 5EC8A 5F5NA 1Q0ZA 5FOWA 5BOVA 2JC3A 4RSYA 4DZZA 1N78A 1ZRSA 5I01A 2HFJA 2DFVA 3KPYA 3WYAA 4LECA 3ZQ6A <