4GZ6A

Crystal structure of human o-glcnac transferase with udp-5sglcnac
Total Genus 264
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
264
sequence length
716
structure length
700
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 264
structure length 700
sequence length 716
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz6A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz6A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gz6A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gz6A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gz6A03
3C4VA 3MKRA 2UY1B 3ZCUA 3OKCA 5TMDA 1WV0A 3Q47B 3URZA 1SXQA 4N2QA 4W6QA 2VYIA 4AY5A 2X0EA 4RIEA 3VDMA 1L7XA 3CK7A 4UQZA 1UQTA 2VCHA 4N3AA 3CX4A 4CTOA 2IEIA 2C0MA 2IF4A 3L79A 4RIFA 3VDNB 3T5TA 1NA0A 4KQMA 1F0KA 3RIBA 3L7CA 3NB0A 3S7JA 3GZ1A 3COPA 4CDRA 2GEKA 2GT1A 1L5QA 4RIHA 3VTYA 1NZFA 1XL0A 4AN4A 4MI9A 1Y6GA 2GW1A 3DDSA 3T3IA 1GFZA 3AS5A 1JG6A 5ENZA 1P4HA 3HBFA 4Y6CA 3ASDA 4G23A 4HOSA 2BGTA 3MTDA 4HORA 1NZDA 1O6CA 3E4BA 4BTAA 1IXYA 4IN3B 3TAXA 5DBKA 1PYGA 2Q6VA 4HOUA 3WXXA 3MBOA 3MT9A 4MHOA 1LWNA 1FU4A 1NVKA 4EQFA 4GYWA 2P6PA 2WPVA 4Y6WA 3TG5A 2JLBA 1FC0A 1NZNA 3AS8A 1VGVA 3MT7A 3Q4AB 3MRTA 4WNFA 2F3QA 3U4TA 4GCNA 3G2NA 3D0QA 3ZCQA 3ZHEA 1Y8MA 3ULQA 4YI5A 2C0LA 4WHMA 3WC4A 4N39A 3CVLA 1P5QA 4EKEA 3RSCA 5D0QD 4MRAA 3KD7A 1TJCA 1Z62A 3TOVA 3CVPA 4J8FA 1JIVA 2JJMA 1PNVA 4JA9A 1Y8ZA 2GPAA 4U0UA 1KT0A 3L7BA 5TMEA 4NQ0A 3OY7A 3ZCTA 5G04J 1C8KA 2PL2A 4EJ2A 5KJNA 3O48A 2X0DA 3ZCSA 3S7FA 2GM9A 3RO2A 5TVGA 2F9FA 3Q49B 3QWVA 2I6HA 4I17A 3HBMA 1C8LA 3MRXA 2XGSA 3OXFA 2IW1A 1YA0A 3ASFA 1KTIA 3MV2B 2FEZA 3OXGA 1UZUA 3QWWA 3QKWA 1GGNA 2G9UA 5IKPA 5BW8C 5ARGA 3L7DA 4BQIA 1ELWA 2HYZA 4G1TA 5FZRA 4NRHB 2QN9A 2XEVA 2V5FA 3CUYA 3EBPA 3TG4A 2O6LA 2XMPA 3RSZA 3OKAA 1FTYA 3ZN3A 1A17A 4GYYA 4J8EA 4GPKA 3ASGA 1L5WA 2HR2A 4LEUA 1Z6PA 2GJ4A 4JL0A 1P2BA 2X0FA 3SZ7A 4I9EA 2QLMA 4I2WA 2XA9A 2VGXA 3MRVA 3OTHA 4WNGA 3PE3A 3CUUA 4HLNA 2G9RA 4KYOB 1QZ2A 4CGVA 2R4UA 2KCLA 4MI3A 2XCUA 3CUTA 4U07A 1FTQA 2GEJA 2P58C 4N3CA 2FBNA 4RBNA 3CUVA 4BFCA 3LY8A 4UI9K 3OY2A 3D1JA 2XGOA 4RIGA 1RZUA 1FA9A 2IFUA 1ELRA 5JJTA 1QM5A 4J0UA 4WNDA 3RU0A 3UQ3A 2IEGA 3GUHA 4RELA 5HQ8A 4EKYA 3RT1A 2F3SA 3VTXA 4EL5A 2AZDA 5DLDA 2SKDA 3BD8A 2QRGA 3G2IA 4GYOA 3AMVA 2VGYA 4GA1A 1NLMA 1P2DA 5DIZA 3LPZA 2ZB2A 3Q3EA 3L7AA 4YVQC 3PE4A 2R68A 3CKCA 3S28A 3CVQA 4HOQA 4AM9A 1GG8A 3GZ2A 2J9QA 2PYIA 1ABBA 2SKEA 5CCLA 2PQNA 2PQRA 1IYGA 3PDNA 1WV1A 5D01A 4F96A 2LSUA 1QKJA 3ZCVA 1JEJA 1L5RA 3G2JA 2XCIA 4F97A 5KJMA 3LCAA 3CEHA 5IKOA 5A7DB 1IHGA 2LNIA 2AV6A 2C1XA 6GPBA 4RIIA 1EM6A 3FFLA 1A8IA 4GZ5A 5DU2A 3NP9A 1LWOA 2QLLA 2QRQA 3CEMA 3OTIA 3HBNA 1P4GA 1XOIA 2VCEA 2UY1A 2QNBA 5FJYA 3S7BA 2ONDA 2FF5A 1NOJA 5LCWC 2QN7A 4B94A 1HZ4A 3Q3HA 4RG9A 4YI3A 3N71A 3UUXA 3RHZA 1RZVA 1J39A 5G04C 3ZCRA 2R60A 2R5SA 1E1YA 3LYAA 4F9FA 5TMBA 3VUFA 4G24A 4J8DA 2BISA 4X7RA 4AY6A 3SF4A 2FI7A 2QZSA 5BT1A 1XKXA 2QRMA 2XCBA 4RG6A 5LCWJ 2PQ6A 3T3EA 5EX3A 4CGWA 2KCKA 4WACA 3OKPA 3GW4A 2BUGA 1HH8A 5GPBA 2H1FA 1FS4A 2C2LA 4YNDA 5HI7A 2PYDA 4REMA 1XNFA 5G05J 2C9ZA 2XA1A 5EX0A 1QQEA 5FT9A 2KCVA 5D0OD 4X7MA 3RO3A 3S2UA 3RJVA 1Y6FA 1WW3A 1OUVA 3RKVA 3S7DA 1WUTA 9GPBA 3FWVA 2AVPA 4KXKB 3T7DA 4ME2A 3BDAA 4LDPA 3OXLA 2ACVA 3SYRA 3NF1A 2LSVA 2L6JA 4HWGA 4LEIA 3CV3A 2FO7A 2XCCA 1PC2A 3UYLA 4WUYA 1JIUA 3MT8A 3OTGA 3CEQA 4JHRA 4F3VA 4XI0A 2C4MA 4I9CA 2IUYA 3BD7A 2KS6A 1UQUA 5JJ6A 4CTMA 2BGUA 2Q7FA 3LY7A 2VQ2A 4BQEA 1WW2A 2ECPA 3E3LA 2HY7A 3R9AB 2PRIA 5ARFA 4APOA 3E3NA 2FF4A 3CK9A 3T3DA 2H1HA 3NC4A 1NOKA 3NPAA 5CCMA 4W9RA 1BX3A 2R4TA 1GPYA 1HLFA 4X7PA 4Z5XA 1NA3A 2DBAA 3LKUA 2MHKA 3MV3B 3WAGA 1AXRA 3MSCA 4PQGA 4GA2A 3QDNA 3HYMB 3D0RA 5HXAA 4G2VA 2NC9A 2XPIA 1KLXA 5A6CA 1PN3A 3QHPA 1FTWA 1GPAA 2ASVA 1B89A 3VUEA 3IEGA 1W3BA 3AS4A 3QWPA 4H7XA 4O6FA 4AIFA 2AW3A 1XV5A 2IYAA 2VSYA 3G2HA 1SXPA 4NESA 3ZCPA 5KJKA 3CVNA 2YQ8A 3KAEA 4EL0A 3ESKA 3BD6A 1B4DA 2JZCA 4UI9J 2G9QA 4KQ1A 3NP7A 3UYKA 3DD1A 2X6RA 3O3CA 4NC9A 3MA5A 3QKYA 4N9WA 1P29A 3GYZA 1L5VA 4GZ6A 4G2TA 1P2GA 2HO1A 5FZQA 3NAZA 4BT9A 5D00A 2VSNA 1Z8DA 1WM5A 4H7YA 4KBQA 5M72A 4U0SA 4FKZA 1FU8A 2QN3A 1ZU2A 2QRPA 4BTBA 2Y4UA 3ZHEB 1XL1A 4G25A 2PRJA 4WADA 2KATA 2X6QA 4UQYA 1GZ5A 3ZGQA 3IA7A 3MTBA 4NEQA 3MS7A 3MQFA 2ATIA 4M83A 4U04A 4YVOA 4N5CA 1GPBA 2IYFA 3Q3IA 1WUYA 5FZSA 2XGMA 4GCOA 2SKCA 4FZRA 4X6LA 2GPBA 2C1ZA 2XA2A 3H4TA 1WAO1 5G05C 2QN2A 5JJ7A 1PSWA 4AMGA 1FCHA 5FTPA 2GPNA 7GPBA 4BT8A 3EBOA 1JIXA 3C4QA 3DDWA 3CV0A 4M60A 4I1AA 2OFFA 4I2ZA 3E3OA 3K9IA 3KS2A 3BCSA 3EDTB 3L01A 1E96B 1EXVA 3Q15A 4KQ2A 3G2KA 3TGOA 3SYMA 1XC7A 3MTAA 3QOUA 3CEJA 5KJLA 3ASHA 3BEOA 4RENA 4N2SA 5JTTA 1M5RA 3FP3A 3ZFWA 5I45A 3C48A 5JTUA 3BEEA 3MEKA 5EKQD 3CKBA 1YGPA 3MS4A 3UPVA 3DZCA 4U0ZA 2F3UA 3BCRA 1KT1A 5DXFA 2FFRA 3JYSA 5BNWA 2VG8A 2VGXB 2UWJG 4MI6A 3S0JA 1YA6A 4QLBA 2IV7A 2YHCA 3GPBA 2E2EA 4BWRA 1K06A 3CUWA 3H4IA 4HOTA 1P4JA 3NCHA 4G26A 3ZPJA 2AMVA 2WTXA 1ZBPA 5LQDA 1K08A 1IIRA 4GA0A 4XI9A 3LY9A 4BQFA 1AHPA 2BFWA 2QN8A 1JG7A 4N3BA 3OT5A 3G2LA 2G9VA 4ABNA 4MHSA 1HXIA 2QRHA 3TSAA 4YUAA 4GZ3A 3T3HA 4L22A 2WQHA 5AYWD 2R66A 2QFCA 5C1DA 5CHEE 3T3GA 2FETA 4MICA 2Y4TA 4UQXA 1L5SA 2YJNA 2QLNA 2KC7A 4UI9C 1NOIA 4M7PA 1V4VA 2OOEA 1FU7A 1RRVA 4CTNA 8GPBA 1E4OA 2ACWA 2QN1A 2IV3A 3U3WA 1F6DA 3S29A 3FROA 1Z6QA 4JA7A 1C50A 1L6IA 4A1SA 4GPBA 3CK8A 1C3JA 1H5UA 4XIFA 3HBJA 4AMBA 3MS2A 3S27A 4WNEA 2PZIA 3IAAA 3WADA 3Q5MA 2F3PA 3BCUA
chains in the Genus database with same CATH superfamily
3FU3A 5HNKA 1RFLA 2C57A 2YMMA 3ZZUA 3CLJA 3MSXA 4JBNA 4BVJA 3IQEA 1II9A 2VJLA 4PSVA 3VTAA 3L13A 2OVBA 1Z9BA 1E2QA 2PJZA 4YAJA 4B3GA 4RNCA 5TPWA 4DI3A 1Y6IA 4M8NE 4BATA 4GAAA 2GASA 1FMTA 1FVHA 2OFPA 2VGEA 3BE8A 4EG6A 4BTAA 4OHBA 2CN1A 3ES9A 4A26A 1SAYA 3E5RA 3OJWA 4RVBA 1I14A 1KQOA 1X1QA 5FHQA 4Y2UA 4EG8A 2FQXA 2HCRA 1TJ5A 2BGRA 2HADA 3B12A 4G0MA 1BQ4A 4RM2A 1A77A 3CWCA 4AUEA 1HE4A 3FKJA 1ECJA 4N18A 2OBFA 4ZZ3A 3AG4E 2C29D 4XVHA 5MHTA 4QOJA 2QY6A 2HX1A 2XVAA 1EVYA 5EMHA 4ANXA 3INTA 1UK6A 3SZOA 5ENPD 1Z2NX 1ULUA 2DU8A 1W0KD 5JIBA 2QAGA 1K8ZB 3RUDA 1F2TB 1TN7A 4D9NA 4I9EA 5IAOA 4R41A 3DEFA 4UE6A 1TNYA 2GBIA 4DIMA 4J0FA 1P1BA 5KSWB 2GA9A 1K4MA 3ZJYA 4YRTA 3EWIA 1N4RA 4ATGA 4XIGS 3MB5A 1CUJA 2NGRA 4QTTB 4HNAB 1JRLA 3PUJA 2V98A 4QO8A 3QU9A 4V2IA 1EDOA 1UXIA 2I7TA 3IVRA 3KYDB 4G9GA 2VSXE 1ESNA 1RKQA 4RY8A 4Y6SA 5CBOA 2BUCA 5CAEA 4YWHA 4KVZA 5DWVA 4KMOA 4HWPA 1GV1A 5FR1A 1OTYA 4BV2A 4P3XA 3QIAA 5KVQA 3LYAA 2OEPA 4L7TA 3V79K 5B1HA 3NTVA 2J6CA 1LTQA 2NT3A 2HYIC 3I52A 1FNMA 1E4EA 3H2ZA 4QULA 4REMA 1A82A 1OQAA 5K6RA 4MV0A 5P21A 3PHJA 1UJ2A 2WXJA 3IAUA 3CC8A 2B1JA 4HSEA 4DG5A 1FS6A 2Y99A 2FUEA 2RHBA 1OFUA 5A3VA 1ODTC 3DZGA 1SJ9A 3EA5A 4Q37A 2IOSA 1GNSA 3AF6A 3GLGB 4EG3A 4KPYA 1UPBA 2HY7A 3NQ41 1FQJA 3T3DA 4FOLA 1FFCA 1VIVA 1NC1A 3HKCB 2R1TA 1E8OA 3FD8A 4DM7A 1PJAA 4ND7A 3ND6A 4RGVA 3TZBA 3PTLA 4ER5A 4BIIA 2HWXA 2AUNA 1ZM3A 5M2QA 1DQSA 1XF9A 3MQ2A 5CEDB 1ENZA 2PMKA 1YAHA 2O9JA 5JPCA 5AIJA 3ZE1B 3AEUB 2OR3A 2CLOB 3P5SA 3DB2A 4AV7A 1K8YB 1K86A 5TJ9A 1E1QA 2IELA 1C81A 5DRYA 1UBCA 5D86A 4Q9AA 1U31A 3UJAA 2UXDB 4CRWA 4DCVA 5MN5A 3OMXA 2WD7A 5CT6A 3CSDA 1OGYA 5JJ7A 3L5KA 3UHAA 3APCA 3DDWA 4GVLA 1X77A 3C5EA 4V0MA 2PSJA 1H4QA 2V6GA 1BXGA 1F7UA 3W5HA 1TO6A 5JAMA 3DV0A 1R6TA 2HNBA 3F0TA 1QF6A 4AF7A 1NBAA 1TYZA 3LDHA 5GONA 3L7KA 4ENUA 1WF3A 3P8ZA 2ONYA 2DP4E 1R4NA 2O4CA 4QGBA 2WD9A 2D7CA 3OE4A 2ETAA 3X1MA 5KVCA 1HXIA 2G40A 2WQHA 2B7CA 2CL0X 4JLAA 3AILA 4EF4A 4ZQGA 2B78A 4G4JA 4C5BA 3NYQA 2HPHA 3NYIA 3MWFA 1YRAA 5CHEA 3OOEA 4TSFA 1V7PC 5AXAA 3AV3A 4EB6B 1XTJA 1KJQA 3UB4A 4LECA 1GDTA 4XIFA 4BV9A 2PRKA 2OXCA 4XR4A 2H2GA 1HL3A 3LQFA 3B8HA 4Y2VA 1LBIA 3R20A 3WLKX 1G3QA 4JP8A 3HRKA 2O8EA 1BS1A 3E34A 1G5IA 1O8CA 3QPDA 2HL6A 4GI3A 3ITWA 4DJ5X 1F7VA 3PEVB 1N6NA 2JIRA 2CMDA 4EA8A 2AFHA 1NVFA 1SA5A 3MHTA 3DZDA 2Z2KA 5ER6A 3TAXA 2CK3D 4M22A 4DANA 3LQ2A 1KS9A 4I6EA 1TRKA 2QP9X 2Z58A 1QE5A 3FKSA 3EX7C 2C0LA 4WHMA 1BE0A 3AW8A 3RV3A 2UYGA 1M54A 2Q0HA 2A35A 2YXPX 4L8FA 4L85A 4Y2PA 3E7WA 2GPAA 1D6MA 4L7QA 4U0UA 2OV1A 5GWXA 5J9FA 1TM1E 3DBRB 1V5GA 4PIVA 4U0JA 4UAUA 3VNSA 1FUYB 1H2RS 3THOA 3K92A 1CDOA 3OAWA 4EBFA 5BRJA 5H3LA 2WF8A 1MRSA 4JQZA 2IHZA 3ASVA 4D9GA 2WT4A 3TLEA 1LI7A 4L4UA 1NJ6A 2H11A 3KD2A 1XMSA 2PLNA 2XWJI 1V8ZA 1P4RA 3FRJA 1GZUA 1M2OA 5K0SA 4YMGA 2J0UB 2ORED 5AKGA 3DBSA 3CHPA 5K51A 4LSZA 2J85A 3QLJA 4EL5A 4CYMA 4JUDX 3SC6A 5B1IA 1JHRA 4V0QA 1ZBDA 4A6XA 3V80A 2DYSE 1HRDA 1ETUA 3IXEA 3GG9A 3PE4A 3BFJA 3CKCA 4EZLA 3ABZA 2PWBA 1YJXA 2IO2C 4A4DA 3T3NA 5FOWA 3JWEA 5H81A 3LDUA 1M6WA 4QXAA 1UBSB 4NBLA 1JG4A 1EM6A 4FXOA 2A0WA 1DQNA 4M86A 2TMGA 3GGCA 3GN1A 2ONDA 3RSSA 2E48A 2ZT5A 4URUR 1SZCA 1A2OA 1IIBA 3ED1A 4EQ6A 3RHZA 1WQ4A 4AQYB 1Q74A 2ZBPA 1KO7A 4KSBA 2XE4A 2LKDA 2HFJA 4UKDA 1ZHOA 1ORWA 2OHGA 1O1TA 4U9HS 3UAXA 5EZYB 1JQBA 4UAVA 1KSGA 4I50B 4JJ7A 4I55F 1R4ZA 1LDBA 1AKNA 4UQLA 1X8XA 1NC3A 2JGKA 1JHQA 1GGHA 1AS3A 4LE0A 3LL4A 3UBMA 4CEIB 4C7OA 2DHEA 2R6AA 1K3FA 1EVLA 5TLSA 3VLFA 2H29A 4KMMA 3QP9A 3CK9A 2A4ZA 3VCXA 1ZD9A 2B92A 1G5QA 1V54E 3CNBA 4I1OA 3K9NA 1F8YA 1QG4A 5IZCA 2EX0A 4I9NA 1OZGA 3OOJA 1FYVA 3MUNA 1W9HA 5HPYB 2IYWA 4EL0A 5HF6A 2X6RA 1C29B 1VA4A 2JBWA 2FCAA 2IOFA 5HFNA 2O7RA 1BQEA 4P7JA 1SVKA 3T1QA 1ND5A 3UCXA 1AN0A 5FLKA 3S7TA 4X90A 2JFNA 5TV2A 3ET4A 2BFCB 1P62B 4OLFA 4CEHA 3H75A 3JRWA 3J81A 1VRWA 3RR2A 4N5CA 3Q3IA 1EJ6A 1HF3A 4XSHA 2RDMA 4BYMA 3FMOB 1SOUA 2EBUA 3STWA 5JZ9A 4DRZA 5GOZA 3SLGA 1XZMA 4O6VA 1VSQA 3X1DA 1XDBA 4MS3A 4PC2A 3LT4A 3UWKA 2M9MA 2AQIA 2H4XA 1DS6A 3DEHA 3FRHA 3KL4A 2BM9A 3DOOA 1IAVA 1EX7A 3V7NA 4N2SA 4P3PA 1G5HA 3RVOA 1P9LA 5C9ZA 3PVLA 1YU6A 1NAIA 3RF7A 4JDPA 1M5UA 2ZAMA 1Y3AA 1HFEL 3NTOA 3TOCA 3IUPA 3W1EA 1TC2A 5KWEA 1W29A 2DK6A 5EFZA 3GZSA 4I4TF 3HJTA 1U5BB 3B89A 2V97A 4KJXA 3CVXA 2CVOA 3IKOB 5DULA 3EE6A 4L0CA 2I0FA 2O6HA 2J87A 3UINC 3R7QA 1A4RA 4U2KA 3CK8A 4X24A 3R9IA 1H5UA 2DBYA 3V6MA 3MM4A 1U8EA 5ETJA 5JSKA 1IAQA 4RIEA 4UQZA 1O08A 3K9WA 2XUJA 3B3GA 2P9IG 3GK3A 1EDDA 2W4QA 2K87A 3FNBA 4MEAA 3LSYA 5AWFC 2OLEA 5D3QA 3BKWA 3M4NA 4FS3A 3IX7A 4E3ZA 4B6RA 1SKMA 4K6GA 3L8CA 1VLZA 4FHKA 3ZTTA 3HC7A 4NATA 4JJIA 1YI8A 3GEMA 3ICVA 4EKEA 3ELWA 2EFYA 2PFSA 1N0UA 1J6UA 2XLBA 3FNIA 1TCCA 4O33A 3BWYA 4CN8A 2PL2A 3HU3A 3FSGA 3TDKA 3EWAA 2GILA 4IYRA 3ZI7A 1W87A 5JD5A 1TJYA 2DRIA 4QATA 1UM9B 3WQBA 1UZUA 5A0VA 5K8UA 2BGWA 5F7JA 5FINA 5KWIA 3ZV5A 4YUWA 1HKHA 4NRDA 2OHJA 1U0TA 4LOIA 4DLWA 1KI6A 1S5PA 1NXSA 5JSYA 4OMDA 4GUAA 3ZEIA 1OLOA 2G9RA 4ZVNA 1AM4D 3WL3A 1TUBB 2P58C 1PO7A 3EQ9A 1QHNA 4OP2A 1RZUA 4WNDA 1W5AA 3H2KA 2J9FA 3U7HB 2ILRA 4XQGA 2GSDA 3PGA1 3HBLA 2WYVA 1UDWA 3QEBZ 4JT4A 3W6ZA 3O4VA 5C7YA 1H0AA 3L22A 5JECA 1PDOA 2J4BA 4MIEA 4TMXA 3ZNGA 3DJYA 4DCPA 2XB6A 3TLXA 4BX9A 1DZIA 3C1TA 2AG5A 3MMPA 3BQ9A 1AG9A 3ZVKA 5FNVB 4M36A 2FSGA 4Q39A 3GDOA 1GGFA 1FYXA 4C7KA 4HQFA 1J39A 5CVEA 2DFNA 4HK4A 2HF8A 4JB2A 1GL7A 5EX3A 2VHYA 3R7AA 2XYVA 2BH2A 2FZLA 1NQ5A 3ZBPA 1M6VA 5AR1A 1US8B 2M2IA 4OQEA 4EF6A 3N6VA 2Q6IA 3R40A 4YGYA 2FAXA 3HGTA 4YPFA 3P2KA 2IS6A 1T1SA 1Y5MA 1V2GA 2F2TA 5HRUA 3OPQA 3MT8A 1G1MA 2VPQA 4W5JA 5AXDA 4FR0A 1NIPA 1DLJA 5HJ2A 5BN5A 2VQ2A 2HLHA 1G21B 5C3UA 5B58T 5JADA 1XMJA 1GR1A 3D2AA 1QIEA 1BVHA 1EA7A 1NG1A 2RIPA 1QIKA 3RUIA 4RL6A 3D0RA 3SF0A 5TPWB 2B61A 4LK3A 4CJXA 1FE8A 2YQ8A 2AW6A 4XSGA 2ILTA 3BBPA 1LVGA 4M9CA 2CFIA 2C8LA 1U2DC 1A97A 2QLBA 2UU9B 3VAZA 3Q10A 4BTBA 1EM8A 2PVCA 1T1IA 2B2NA 5GV7A 2EGHA 4NEGA 2ZJ0A 3GBSA 4LJKA 4B32A 2SKCA 3R4VA 5BT8A 3I28A 1PBNA 2HJRA 1A5EA 4AN1A 3G1TA 4JLOA 1G8FA 4BLOA 4CM9D 3E5HA 3D0OA 1HDGO 1U7DA 3VR4A 3DMNA 3PRKE 1MAAA 4HLLA 2W93A 4RZIA 2QAGB 4LJAA 3JTEA 4QHSA 4DV3B 2YXLA 1QQ5A 4KODA 1DXHA 1SCDA 1P4JA 3U0VA 2ODBA 2OBBA 3N3BC 3RT7A 4ABNA 5IARA 1W35A 3BZUA 5E1DA 4EUNA 3HTXA 1OIWA 2OK7A 3NWBA 1FQWA 1G18A 5GJWC 4YT8A 4S1TA 2B21A 4L15A 3BXGA 5C31A 1QF9A 3S29A 2VHCA 3JPYA 3KLOA 2Q99A 1E7UA 3NALA 3D9NA 2C84A 3O8DA 3EUAA 5CAEB 5F2KA 3VPHA 1UFKA 1XMIA 3ZDYB 1EK6A 4PC6A 2TS1A 3C6KA 2O3TA 1ULSA 1T35A 3DJFA 1DSSG 1LC0A 2FMKA 4LXXA 2I3GA 2X6KA 3JYPA 1E4EB 1NZDA 3AJDA 3TLGA 2RHHA 4X41A 4DBLC 3GFGA 1R9GA 1FC0A 4M0MA 1NJ5A 3QV1A 1ZVKA 1CR1A 1YDGA 2XBMA 3LT2A 1NNSA 2YDYA 4AYXA 1MR3F 1IN8A 5ES4B 5KREA 4B3DA 2IHKA 1LS1A 2VQFB 5LQCA 3EHNA 1A96A 3NAMA 2EARA 3A4MA 1NP7A 2R1TB 3ZGVA 4NCHA 3AL2A 1YS6A 1E8OB 1HG1A 4EJSC 2NVUA 5EIXA 2X0JA 1BG6A 3AKDA 4A1OA 3PNBA 4WI1A 3OKAA 5EA2A 1N8KA 4YRIA 1JEYA 3DEIA 2D59A 1DDGA 1XF1A 2FW0A 1H3EA 5DYTA 5KAPA 4UULA 2PVSA 3FHEA 1XYVA 3WNCA 4GHWA 4RSYA 2ZRDA 5I4KA 3JY6A 1AK1A 2BLNA 2PL9A 3OY2A 5G0VA 1CUBA 3BG1B 3LUGA 1C80A 1NI4A 2MWMA 4CRWB 1TLFA 2OO7A 4JSRA 1RWNA 2O0KA 1ICIA 5BQ5A 1A8SA 2WD7B 4ZAWA 4PYNA 1MX6A 4GBJA 3LYLA 4F93B 3LFTA 1YCFA 1PTJC 4RWEA 5AW9A 3IUYA 5ALYA 4C76A 1RAIA 3G2TA 1JE1A 1BXGB 4ZAGA 3CS3A 4ALNA 3DV0B 2I4TA 1T8UA 3T9KA 1JAXA 5GONB 2H2DA 4JLWA 4GGPA 1LFDB 1DEAA 4EG7A 4BQSA 1R4NB 4EGCB 3GT4A 1FVOA 2H1FA 3VZSA 2PX3A 1H1LA 1VPLA 3GPDG 1HXHA 2D6FA 4ZN6A 4TXHA 3I09A 3KQQA 5EGNA 1CY1A 3EBLA 4S12A 4LC0A 4Q1AA 1AGPA 4QVGA 2JHAA 5JQWA 5CNJA 4BXOA 5LP6A 4BC1A 3A36A 2HKIA 1I5OA 3E9MA 4BNGA 1NL3A 1SQ0A 1XA4A 4PHFA 3VC7A 3VR6A 1YFKA 2ISCA 2ZVQX 3QWIA 421PA 4HDMA 4HQDA 2PNJA 5H7XA 1JPNA 4HY3A 3BK7A 1H2XA 1Z7GA 3N0VA 4M1SA 3F47A 4OPMA 4DAOA 1JQDA 2O8EB 3UXEA 1VHWA 3VVMA 1YTLA 4G01B 3KVRA 4Z3OA 3MA0A 4RD1A 2AB0A 1NMQA 2AFHB 1E9AA 3ESKA 1JDBC 2N46A 2IP1A 2ZI6A 1N92A 3EIJA 1LY1A 3L0CA 2FX2A 3WLTA 1E61A 4INAA 3B1FA 2QPLA 4APFA 1J33A 5I8ZA 1O9GA 4Q1BA 1HS6A 3UMGA 3TWOA 1GQSA 4ZT3A 1C7ZA 1O95D 2YWBA 4HDKA 3D4BA 5I9NA 4F6RD 4KP7A 1ENPA 3ZU6A 4F1JA 2ZGDA 5GIOE 3PSHA 3BCSA 4QJBA 3FVVA 4KOAA 4DHEA 5JXHA 3MTAA 3S2ZA 1GNLA 3BXOA 4KTTE 3QUSA 5C2YA 4KT6B 3FU0A 2F3UA 4AICA 4YRKA 4MYTA 1NLUA 3LPLA 5GGXA 1M2OB 4MI6A 3JD2A 1COZA 2SICE 3TWUA 3N0XA 3FW1A 2R751 2GK7A 4FYIA 5IWAB 1WDWB 1LSUA 4DWOA 2HEGA 1B0AA 3L2OB 3NVKI 3TM4A 4XWKA 2QMZA 3P9QA 4WK4B 4AJEA 5F33A 1SBCA 4H15A 1WZ2A 1J9GA 1T8YA 3ONKA 2OYRA 4QKQA 1XMQB 4LJ4A 3WB9A 2BDEA 4BLQA 2J0SA 1UBHS 1OGJA 4HYEA 4J7XA 2C2GA 2RGGA 3QEOA 3HO6A 2OC9A 3PEFA 3K0CC 3L7YA 3PUHA 1VL1A 4C0BA 4EQ6B 3TL5A 2O3RA 1NNUA 3WK9A 2YH2A 1NA0A 3M9WA 2EX1A 4YQZA 1N7GA 1SXHA 2LRHA 1FUIA 3LP6A 2XMQA 1PR9A 1RRMA 1ADJA 4E7OA 4S0ZA 4ZO9A 2QYOA 2WDZA 3MRTA 1ZW1A 2Y3AA 3WC4A 4IDAA 4C7OB 1W36C 2HJVA 5ALRA 2JK0A 2Z08A 4YCLA 2R7KA 2D5IA 1TK9A 2WJWA 4D8WA 1MTOA 1HETA 4KPEC 2CLMB 1OC4A 2YNMD 4YAUA 4QYWA 3I1IA 1VJCA 4I1OB 3NRJA 1WZUA 3SBXA 1MABA 1N2SA 3AY6A 3DT8A 3C2QA 3F6EX 4M0UA 3GFSA 1WM1A 4YHHB 5BR1A 1VL8A 2H1CA 5JU6A 1SQMA 4WKNA 2WMOA 4BVLA 3HUUA 1DTSA 2XYGA 3OPXA 3NHZA 3F8TA 1NP6A 5LP6F 1GZ6A 2DB3A 2YIDA 3AL0C 1MN6A 3FZGA 4EHNA 5MFZA 5HQ8A 4EKYA 3D9PA 4CEHB 2CNWA 4BNDA 5K3OA 4ZYVA 2CEAA 1AGYA 1ZA1A 1D1PA 3ABSB 1PS9A 2KLHA 1ODSA 1XVAA 2PQNA 2RHOA 3AEKA 3TGPA 1DBVO 1RIIA 3BRSA 2LNIA 1KO1A 4Q9KA 3VYVA 2QSZA 4MS3B 3IO5A 3QNUA 3DSUA 2QDKA 4FR2A 3G6WA 1QAOA 2FV8A 4B09A 3TJMA 4FONA 4FOTA 1FUKA 1H6BA 2ZWMA 2HTFA 2JHPA 2HRDA 3H7AA 4N9QA 3T7SA 5A4MS 1IUOA 1JR6A 3LUAA 4BAUA 3DQPA 3HN7A 4KAFA 5E4FA 1PW5A 3TEFA 3CO5A 5AVQA 1MP0A 1Q95A 1WP9A 4I6GA 1WVIA 4DMCA 1PG5A 3G5TA 5F2OA 5B53A 2QVGA 1KS2A 2JLVA 1XHEA 2RHMA 5HZHA 3GEEA 3C3AA 2WKPA 2Z1DA 4Y2QA 4E1BA 2DSNA 2BJWA 3K15A 5F78A 2C2XA 2R03A 3WLMA 5HK9A 1XUOA 1JIIA 1DRJA 4D9MA 1KU6A 2ZCVA 5JS6A 3A1SA 4HQOA 3VSAA 5EJ4A 4OAPA 5EMMA 2EIJE 1KOFA 4PZCA 4Y2JA 1X94A 3UMCA 3A1NA 1J0XO 2XNDD 5A4AA 1ZD5A 5JJLA 1RAGA 3QHPA 3F8SA 3AUAA 1NW4A 1B89A 3D4LA 2IEZA 1NBMD 1ZOLA 3WGZA 4YRRA 4BNJA 1KTVA 2QMHA 1VPDA 1XKQA 1NR1A 5EUBA 3SHOA 1YGYA 4OUDA 1PZFA 3IH5A 4RK1A 4OHUA 5BSWA 3QLTA 4NBRA 4TS4A 3G2PA 3ZY2A 2IPXA 3D4PA 5FHRA 3VI4B 3ETHA 5FTPA 1Z6TA 1ZLYA 3PB3A 1LX7A 4D80A 4FGLA 2A57A 5AUNB 2ZIEA 3FYDA 2DPHA 4K28A 2E4WA 3IODA 1KGSA 3J5QB 1Z68A 4EFMA 3B9PA 2P5YA 4LV8B 1NRWA 3OA0A 1KI6B 1RRFA 3BXZA 1WOMA 2VDRB 3BWCA 1MO4A 3SIWA 3C5CA 5K3FA 4EB8A 5DW0A 5DHTA 4ZVKA 4EPYA 2LIVA 3UK2A 4GA0A 5HQ3A 1Z22A 4XGNA 3WS7A 3F6BX 2J9FB 3G2QA 4MHSA 2VTKA 1T9GS 3T3HA 3A4VA 1JN0A 5THKA 2Y4TA 3Q4GA 2DH5A 1MBZA 3W7VA 1DKPA 3KE9A 1YO6A 1FF9A 2GCOA 2QOEA 3QJYA 3GV0A 1LRLA 4R6XA 1FCJA 4DI4A 4N2QA 1T25A 3MAGA 2JGLA 3TXAA 5KMGA 4X60A 1YXMA 1EBUA 3Q3CA 4CG0A 2ZBGA 3F3YA 4YP0A 4AT1A 4XQEA 1JTFA 3WLSA 4RWZA 4PZEA 1M6VB 3H5NA 4HJXA 1E6EA 4XLLA 1KA9H 5KU7A 4MKTA 1GNPA 3D3EA 5AESA 3MERA 2OD9A 3CH6A 1OZ0A 1U5CA 5ALWA 4XWGA 4YRAA 1T2CA 2O8NA 4MQMA 5EVCA 4MVJE 4BFTA 3DCIA 4PFJA 1OWPA 3LS8A 5BN5B 2UYQA 3OZWA 3KR2A 4Y8VA 2WM8A 3CTMA 3HNRA 4UUCA 3O4RA 2VDJA 4ZGWA 2D1SA 2Y0PA 3EHDA 4KE6A 1TO2E 3LXUX 2BFOA 1GIAA 2ZE5A 2CBXA 4E08A 1L5WA 2H54A 4I19A 3RRNA 3BA1A 2FW8A 1XN1A 4X54A 3IMGA 1UMBA 1VBNA 2NYVA 4A55A 1XNRB 4J4TA 4MMYB 1NUTA 5BWOA 1XDZA 1EM8B 4DQDA 1SBNE 4K88A 2IDZA 3M1LA 1J4AA 4L0MA 4TUMA 1E1NA 3G3EA 3D7LA 3CF0A 4R40A 4MLPA 4WJLA 1H2UA 3E9CA 3WY9A 4F97A 4R1TA 3VGPA 1QLJA 4A9AA 3BJMA 1X87A 2QLLA 3H0EA 3CKYA 2QRLA 3U5TA 1GQYA 1P1RA 1Z8HA 4GKJB 1Z2DA 1R0WA 3AVOA 3U44A 2WMNA 4J9UE 3H87A 2XAUA 4IIDA 1NV9A 3PZRA 5JASA 4CM7A 4Z4CA 4MA0A 5IJ0A 5DOVA 3UG6A 1YR7A 1OC2A 3OC6A 1A0OA 3AESA 4H60A 1LD3A 2FLWA 2O5CA 3EUWA 3W04A 1FP6A 4R05A 1XTQA 1SUBA 3MTJA 4I9CA 2BONA 3JZAA 3EZ6A 2XTMA 5JJKA 3O8CA 1QJCA 2HUNA 2ZKLA 4BSXA 4QO7A 3MJVA 4RVFA 2B9VA 1G291 4QDUA 4GTMA 4MV1A 3QHQA 1NULA 3ENQA 4QYTA 3DQZA 3D9HA 4QEZA 3HK2A 4FWIB 3TLGB 3MN1A 1AC5A 4KB5A 2D5LA 3NEPX 1JU4A 1U7OA 4KFRA 2GTIA 3G9XA 2NPFA 3R0IA 5JXWA 4KAJA 5C5CA 3Q7AA 2IO3C 2DPXA 3Q1LA 1K7SN 1FL9A 4KITB 4TS3A 3DL0A 3U3OA 3ZOKA 1EK5A 3PF9A 2YY7A 3QVOA 3BB4A 2Q4DA 2NVUB 2NQ2C 3PFKA 4FK8A 3FP3A 3O6VA 5JXIA 4ARVA 2OV8A 4EEKA 1JHOA 1JEYB 2XWQA 2C7QA 1TJ3A 1A1SA 2J41A 4MGEA 2P41A 3W7BA 1VL0A 4L7VA 1P7CA 5IN5A 2X3UA 4I81A 1VG9B 4PQEA 5ITWA 3N0WA 2B37A 3GYGA 2P4HX 5KDLA 1ORIA 3OC0A 2BGGA 4QFMA 3JVVA 1NI4B 4BNVA 3BXFA 4IZIA 2BCJQ 2IL1A 3AVVA 2Z9DA 2OOEA 2YBDA 1W88A 2ENUA 3NOCD 4UHBA 2P7HA 4MUBA 2AYYA 2GTHA 2GBPA 2OPBA 3EIHA 3RFUA 2F3PA 4KIJA 1UPXA 2WVHA 3L77A 5AHXA 2I4NA 3HB0A 3FTVA 3ZYZA 1NM5A 1WR8A 5I5GA 4IULA 1LDYA 3C74A 3K0AA 2FSVC 3U19A 2PUWA 4V0RA 5H68A 5B3JA 4EKGA 1BWSA 3T3IA 3GY0A 1H1LB 2BGTA 5DTEA 2QD4A 3X1JA 1HTWA 2ZYSA 5E1OA 1I7QB 2QZ4A 5CCXA 3VR2D 5BSHA 5ALHA 4XYBA 3X2SA 1AURA 5AJYA 1T8WA 1WEHA 2IWRA 3I30X 4BXOB 4RHUA 3OQHA 1RI1A 5LP6B 3ZWOA 3G5MA 4MGYR 4OHPA 2QIPA 4NTZA 3SQXA 2E85A 1YVRA 4MVJG 1KT0A 3PV0A 1CJTC 5AKEA 1E64A 5EI5A 2JFYA 4HDMB 3TR5A 3AR2A 4C4TA 2GJKA 2CL6X 1HDRA 2VH5R 3IR7A 2WB4A 4P6VF 2X6FA 3AR6A 1AK9A 5IK2A 5AJUA 3PTZA 3OJEA 3VYTB 1FOEB 4TM7A 4PTLA 1B1CA 2X23A 2AR9A 2V0GA 2ETVA 4YCDA 2QLMA 3EYWA 5EJ7A 3JZIA 3MRVA 1ZGGA 2QT0A 2R4UA 1I10A 4WZZA 4ZANA 3A4TA 1YR6A 3KDAA 3LUBA 4WK0B 3QFFA 4H4CA 2Q46A 1JVBA 1JHVA 3U2QA 2GF9A 5PGMA 2GGFA 4UC0A 4DMFA 2J32A 5AHKA 3MWJA 5EZYF 4BPRA 1OCEA 1HMPA 4G56A 4DIUA 4HDKB 2JGMA 2RGCA 5JEEA 1TPZA 4BERA 4GLFA 1ZL2A 4ZYLA 1PZXA 5ILGA 4AKTA 3A6KA 2F1IA 1I13A 2XB8A 3BRWD 3FH0A 1JS1X 4FULA 1RXVA 2GERA 5BQFA 3WBKA 1TI7A 3CHMA 5IAKA 1YUNA 2VNKA 1I6KA 3D6NB 4WACA 2BUGA 4MJ3A 3UI2A 2A3NA 4WA7A 4EW2A 4QDZA 4Y2SA 3OJFA 2ZRFA 4NOJA 3LPAA 1LW6E 1RKBA 3HR4A 4UCQA 4XYEA 1XQVA 3QENA 3LUJA 1SOWA 1BI8B 4R3NA 3ZX5A 4ZP1A 5KYNA 1P8JA 2PWPA 3FXAA 4JI3B 2JAUA 2ECPA 5J23A 1ESDA 4APOA 1F12A 2GETA 2XXJA 3JQ1A 1DCKA 1B16A 4M1TA 3D9KA 4MPDA 1QCDA 5ELLA 3VGJA 5HJEA 4KMRA 1BVUA 5D6OA 4PZ0A 1EUCA 3Q2KA 1OH6A 3KPJA 3FOCA 4MQBA 1H9CA 2NU9A 2VF5X 4FC6A 3G85A 2JJ1D 3A31A 4TL7A 4GZ6A 3U26A 4IWNA 1UMKA 2ZRCA 2XHEA 4RADA 3MMSA 1SXJD 3JASA 1IYZA 1U3UA 4F4FA 1RMTA 3IO3A 5FL3A 2XB9A 3R0ZA 4P38A 1QHHA 2HR1A 2OLJA 3WFZA 4HNUA 4HQNA 3EXFA 1YH3A 4QUJA 1J7JA 2ZULA 5AN8A 3LQQA 1Z7WA 3LEWA 3T4EA 2M6LA 4MRVA 1E0JA 1ZINA 3APDA 1HEYA 1MABB 1YR9A 4WZBA 2CHZA 5BUZA 4CETA 2W9XA 2B5OA 3UN1A 2KX7A 4UE3S 2GF0A 5IZ4A 3BAFA 2WMOB 2A5DA 3OFSA 2Y69E 1LQUA 1THZA 3I83A 4FDAA 4RK7A 3SBSA 4AY2A 4WWHA 2GEBA 4NPHA 4FFBA 4N0PA 3BB1A 1U2EA 5TT1A 4E3WA 3UJBA 3ZV3A 1KRHA 3R8CA 3EVCA 3PUWA 2PPLA 1HNNA 4NR0A 4DLLA 4BNDB 1VI2A 2XNHA 4OQMA 4ESOA 5JZOA 3V8PA 3AEKB 3EWSA 1R0BA 3EK2A 4JJAA 4MX8A 1Z45A 5IT0A 1K5PA 4ZV7A 3AT1A 4PLHA 1ORRA 5CA1A 1C3LA 4OVVA 3OKCA 1ZUNA 1WV0A 1CEXA 2AOUA 1NX6A 1RWXA 2BPOA 2GD2A 1QV9A 2DZOA 3NB0A 1XDGA 4WJZA 1XB2A 4KUEA 2Z6VA 5ENZA 1WXQA 4QDXA 2O19A 3RDPA 3VPAA 1PL6A 1F8FA 3MT9A 1M2HA 1U2VG 1NVKA 3KPVA 2W2KA 4Y9SA 5DBHX 2FUG1 2BFBA 3D0QA 3F8WA 3O8LA 4RFVA 3OCUA 2XV1A 1KIAA 4KQHA 5FFNA 2DHDA 5CM2Z 4PSKA 2I6GA 4F7WA 2I54A 3UGQA 3TFOA 2A92A 1AQJA 3IBEA 1OYOA 3MCZA 2DUMA 2WTAA 1VCNA 2QX4A 1XT6A 1E7VA 3DT6A 3L16A 5D7NA 3RS5A 4R7LA 3KM0A 721PA 3MJSA 1EX6A 1WMAA 5HUJA 4NPCA 5FNVF 2EQ5A 4Z1OA 5CDFE 2ZSEA 3PHGA 2VQSA 5D8DA 4DGSA 3DYIA 4CIBA 2UKDA 3EASA 4XOIA 2JJ2D 4LISA 4BASA 3DDZX 1VMEA 4IGEA 4RGYA 3AHIA 4OUDB 3KKZA 1FNSA 2ECQA 3DZJA 4HAYA 5KJ6A 1W5FA 2PS9A 1OBVA 3HR7A 5C35A 5H7PA 3TNLA 3WNZA 1OJLA 2WPDA 3WAJA 4M8SA 4URVR 3HB7A 2AN1A 1D3AA 3T9AA 2JZOA 3U80A 4YO8A 1PUJA 3C1AA 3M0EA 5F76A 3ADBA 1JBKA 2VT6A 3IDAA 3FYCA 1F8GA 1D1QA 5K4GA 4PVDA 1T2UA 1HYGA 1M6EX 4C4YA 5BXQC 1Q12A 5K3FB 3EIQC 4U2CA 4X95A 4C0SA 1DDIA 2PDAA 3PSAA 4JJKA 4YRSA 1JEQA 5HQ3B 3JQFC 4PGAA 2N75A 1E3EA 1ZCFA 5D51S 2Q9UA 1N75A 2BMJA 2YWRA 4LI0A 5LBTA 3SBOA 4PVCA 3WZLA 1E6MA 2A9RA 4M98A 3SNXA 4KO4S 5B64A 2GCOB 4MS1A 4A6DA 1C3OA 4TXLA 5BWLA 3FUIA 5BV2P 4A1GA 3GA5A 2V7TA 4AWBA 3BE4A 5KMGB 3UXHA 2VFAA 4OBEA 1N2BA 4JHLA 1YI0A 3B6JA 4XB2A 1HO8A 1KDOA 4HQKA 1QGAA 1YR8A 2VT2A 5B1SA 3QWAA 4ZCSA 5AOBA 1K9VF 3KQTA 2DHRA 3MKQA 5ALGA 4LDAA 3UAGA 5ELXA 1TU4A 2GLTA 2ZLBA 3JWIA 1DNPA 4KVGA 4S1PA 4TROA 1NJFA 3WYGA 3KP1A 5CA1F 1VJ0A 4U04A 2E4XA 3LZ6A 2GZ3A 3CVUA 1X7GA 3LXMA 1HT1E 2AVNA 1HG5A 3C8DA 3CUKA 4B34A 3PDJA 3T61A 1O94D 4I5FA 2Y6VA 1HNXB 5KUTA 4EENA 1EXVA 1E6KA 3ABQB 1G20E 1RJEA 3U37A 1GA1A 5CBPA 3RTGA 2GYVA 3I53A 4UBJA 2BBTA 3CLVA 2WYUA 3TLZA 2JK1A 1ESZA 4JYZA 5IUKC 1FY2A 4GSKA 3RRNB 4DR2B 1ORDA 3LKBA 1P19A 1X0VA 4GBED 2CJYA 1UMBB 2V5UA 2NAFA 2ZXFA 3IAFA 5KYVA 1HFWA 3VISA 1N0RA 1G7CA 2GRMA 5KAMA 2DFKB 2GFQA 2HSDA 1PUXA 2QVZX 4IJ6A 2QXYA 2BDTA 3L46A 4UPEA 4HRNA 1KZYC 1A8HA 4ME6A 8GPBA 1F6DA 5L7TA 3TGWA 3D9LA 3EVNA 2L9BA 1Z36A 5E76A 2WKQA 3A4NA 3DRAA 4UU0A 2NNWB 3QPAA 2CFOA 4YIHA 2YC4C 5IABA 4MWEA 2RFAA 3GVCA 2DETA 1CG6A 2FUKA 4V2UA 3U44B 2WMNB 3STYA 1MIHA 4NOKA 4MI9A 3JSAA 4DLAA 5IJ0B 4LCEA 4IIFA 1N7JA 1FT2A 3AESB 3Q8XB 2DQSA 1GKLA 3CB2A 3NUZA 1QHGA 2GPWA 3T6KA 1N5OX 2FPSA 2Q7XA 1NVDA 2MSLA 4ILKA 1E2JA 3E82A 3L8MA 3FKQA 1QTRA 1DRKA 3I0ZA 2GZSA 1SG0A 3EVAA 3JVIA 3QQPA 2AL7A 2FEZA 2HXGA 1AH2A 3U1BA 4C5CA 1T3LA 3AVPA 4J0GA 2XHZA 2IYZA 3UM3A 1IN6A 4TLEA 1Z38A 4U7EB 3GLGE 1CUFA 1L6RA 2ORYA 3QX9A 2FVXA 3BT7A 5GONF 3U1VA 1IJFA 4KYOB 2GYWA 4RJTA 3JAKA 3P52A 3T1OA 3E05A 3ZW7A 4Q1FA 4P7BA 3UOAB 3WZMA 1RZ4A 4EPZA 2GA8A 2DULA 2ROQA 3LPDA 1LBTA 4Y6LA 4FUTA 2IXBA 1UOPA 4DFDA 1AF4A 2VYVD 4BNMA 2HLPA 5F12A 4ZC8A 2GEFA 1D2GA 1E5XA 4YUZA 5HWSA 1TEVA 1SA0A 2IYVA 4LF4B 3OCCA 4CFSA 1XHFA 2JABA 1M6YA 1E77A 1PEAA 2A7QA 1CQWA 3X2QE 2PWAA 1HH8A 3VNAA 4ZJUA 1A5ZA 5K03A 1YZ3A 2VYQA 4ANUA 3QFTA 3HXCA 1W88B 2DWCA 4WPGA 3NM4A 3L49A 5BOSA 3CEQA 1HDXA 4MGHA 1GKIA 3G0DA 4GX2A 1M72A 4AJJA 2JHFA 3LY7A 5EN5D 5AKKA 1J8QA 4PDXA 3D2CA 2F7SA 2ZIRA 2DM6A 2EG9A 1KVSA 2GLUA 1ZL0A 1HYQA 2Y1GA 3OEYA 3LBYA 4B43A 2QMEA 1BKYA 3K0AB 1X8JA 4I9FA 4DLQA 1NAHA 5DYWA 2YICA 5C2JB 3EW7A 4LF7B 2WAOA 3HB4X 1KEZA 4YMVA 5D1NA 1L5VA 1Y80A 4H4EA 5HHTA 1W76A 5CHYA 2IXGA 1GL3A 1JA9A 3O7WA 5FTLA 4B79A 2G76A 2PQ0A 1TU3A 4MVJP 4RK4A 5H3HA 5KNBA 4K9DA 2P4QA 2PL5A 3TM5A 3K9CA 3MF4A 1GGEA 1Q1GA 1Y3BE 3STVA 3W79A 4X64B 1P72A 4ACAA 1DTEA 3SSNA 4N3GA 5IULC 4RKQA 2H4JA 4MEJA 4KLAA 3KPWA 3CEJA 3PXXA 4QXRA 5EP4A 1G8AA 2VWPA 4L72A 3BFVA 3M9LA 3HSYA 4HWRA 1ZESA 2MSDB 1J8YF 3MJFA 5BQ3A 4E11A 3INNA 5KWJA 2OORA 3ZGOA 1RWOA 1T9CA 4WKBA 3F5QA 2H4ZA 1AXGA 4ETNA 4UM7A 2H5IA 2K5UA 3QEJA 2FRVA 4Q18A 1UZLA 1YFZA 3V8VA 3VM6A 1NWCA 5KKCA 3LRTA 2VP0A 5I7VA 3STTA 2YHBA 3PI7A 2QLJA 4Y6GB 3F5FA 5I7RA 4NOMA 1CZRA 2OBXA 2WJ6A 3UGTA 3CZ9A 4LDNA 2FR8A 4RLSA 5BSKA 5COAA 2OCYC 1MKYA 1JAYA 5CK4A 1L5QA 4MV8A 3SZGA 2HMYB 4Q9NA 1JNZB 3ZVRA 4EELA 2NTNA 4FN4A 1ZYUA 1RJGA 1Y1TA 5FRDA 5H8WA 3OFVA 2NNLD 1MNQA 4EQFA 1WXGA 3RTAA 3C3YA 3MWGA 1G5RA 3KQUA 3HYSA 4JMLA 3QITA 1N4DA 1N5DA 4H7FA 3HZOA 4TTQA 3AVXA 4NLLA 1P0PA 3HCPA 2MU1A 1V8OA 2X0DA 1UC8A 3PJEA 4JQOA 4R9SA 2PVPA 2Q1XA 4IFIA 1JHDA 3R7FA 1TLTA 4QGGA 3H2HA 4GSLA 1OI2A 4GIBA 4JI2B 2D2VA 4F7DA 4ND3A 1YS1X 1PJSA 1EUCB 4PZUA 2NU9B 2QV0A 2H9YA 1X7DA 2F8LA 1E0SA 4OHRA 13PKA 4U95D 2V5VA 2C03A 4HX9A 4LVUA 4HLNA 5AK3A 2KCLA 5CLQA 4BX0A 3WJAA 2B8WA 3LY8A 3ZEFA 3PGMA 3QPVA 4FNAA 4POOA 1CIJA 1AZTA 1QHHB 3BMXA 4JD5A 1EHCA 3EXFB 4NEHB 4B4VA 3QKRA 1E2EA 3S28A 1JU3A 4XE0A 1L4EA 1XZCA 4L74A 1N33B 4IGAA 1OFGA 2HQSA 2NO5A 3JUEA 4P7KA 4NU0A 4C22A 1OW3B 2VT7A 1L2TA 2BFAA 1MC8A 2QQEA 4WZBB 3IMKA 2UY1A 1K66A 1H22A 1USIA 1YRBA 4KFTA 4FX2A 3FPEA 2WXKA 4FT2A 3L5OA 3LPNA 1DG3A 3WKCA 4GEKA 1J97A 4FFBB 4IIJA 5B3LA 1NVAA 1Z5WA 4D4IA 2B83A 5K2OA 2IFTA 5AD1A 2JAOA 2ZDQA 2N42A 3NKLA 4OEHA 2W9JA 2QUHA 2L6JA 4RA9A 4LEIA 4W8OA 2PUAA 4G1UC 1GNQA 1NPTO 1XG5A 3OKFA 2Q7FA 1T8PA 3LVQE 2ADOA 4CMKA 3W6UA 5CA1B 1ZUNB 1PYOA 4U8HA 2AOUB 3T9EA 2PU7A 4TSRA 1MOZA 4N0MA 3A6PC 3WAGA 3GJ5A 5KSYA 5KJFA 4O3FA 4CR6A 2F8XK 4RD2A 1GTG1 3UJ7A 3OZRA 3WGIA 2WFZA 3O3CA 2BV3A 2OK8A 4KIGA 5K9ZA 3LOUA 4DCTA 4LW8A 5I7FA 2W2KB 2IF2A 2BI4A 3NI2A 2BFBB 3AF2A 2JBHA 4LGCA 4ZFNA 1PQUA 1Q16A 1VTKA 3O92A 3ZWQA 1WL8A 4I4LA 1UJJA 2QVYX 3CJRA 1MAUA 3QELA 1ISJA 3PG5A 3W4KA 3W8DA 3K31A 4HN9A 5GY7A 3HWWA 1L9XA 1X0XA 1XZQA 2XKJE 3ML8A 3B3QA 1KFEB 4C21A 2CXHA 2C5BA 5BPPA 2QMOA 4U39A 1TQ6A 3EZXA 4FFNA 1UDRA 1NFQA 2JJ8A 4DDHA 1T2FA 4AKEA 4M4SA 5FIOA 3NHPA 4BFWA 5LP1A 1LU9A 1T9BA 1DQZA 1TF5A 4HWTA 2AGVA 1WY7A 1IEXA 2CCGA 2YYZA 2FFJA 1O6FA 1JSXA 3UIOC 4ZZ1A 2VAVA 3JQPA 2HU5A 1OHHD 1MOSA 3K53A 2Q5QA 1ZH2A 2ZSHA 3EXIA 3G8DA 4M9ZA 3NDBB 4P4UA 3GP3A 4RMNA 3ROGA 2VHXA 2IGTA 3K9HA 4GYKA 3K94A 2IJGX 1DOHA 2H57A 1G0NA 1FFBA 1ZHFA 3RC7A 1E9SA 4QRIA 1U4NA 1JEQB 2YZ7A 5ENNA 2CFZA 1BHSA 2ACEA 4MW7A 3OZFA 5DX0A 4ZOAA 4D57A 3C3DA 4U7WA 5DGIA 3WMEA 1Z0UA 2ZUBA 4FZ5A 1UINA 2QNRA 3WLNA 4J8FA 4MS1B 5I8WA 1C3OB 1F2VA 1WB9A 5ULLA 2JFGA 1XD8A 5EQJB 3Q6NA 2BGLA 2QG9A 4F7AA 4R1MA 1BHQ1 2H2WA 2OHFA 4UWGA 4IIJF 1U2SA 2P1ZA 2GM5A 3JQ9C 2HPZA 4F1PA 4ZEOA 1AZLA 4GFDA 4JKYA 1FTYA 1O5IA 2ETBA 3BL5A 2QP4A 4REQA 3GXBA 3HNOA 2EJVA 1Z7EA 1M8JA 3CUUA 3U13A 3MKQB 1YZGA 1G21E 3O26A 3L1KA 2Y1WA 2FPMA 5ARCA 1EGHA 1YR2A 3WKDA 4YCNA 3L8GA 3TIXB 3IIKA 3PC4A 4NE7A 2BEDA 3DE2X 3VR5A 3F9RA 2ZSBA 1UBLS 4A27A 2VI5A 4M49A 1RYNA 2AZMA 2IYTA 4CIAA 1BU8A 4LK2A 4A15A 4KQCA 2Y1XA 2ZUEA 1M76A 4U2EA 1XCLA 2C4VA 2W2LD 5KKNB 5CBPB 3S2IA 2W22A 3GFOA 5JCOA 3A1UA 2GZRA 2IUFA 3COSA 3LOPA 5EHQA 2PA0A 1B0UA 1N9AA 3KSUA 3L1UA 1XTRA 4OHVA 1WUJS 1ND6A 3DDCA 4NK4A 1N0QA 3U60B 4LYDA 4DNPA 4O1OA 1FS4A 4CE6A 3EVZA 1A7AA 3R0JA 3OZCA 5FT9A 2L17A 2C4WA 3FIJA 3ASNE 2WYOA 4S2EA 1ZM9A 3P1UA 2BAGA 4NCXA 1CB7A 1MEOA 2FJPA 3RTEA 2REOA 1MJ5A 5TRTA 4RY9A 4GVXA 1MPTA 2DCPA 3EIUA 5JAHA 4HN2A 4EITA 2QZZA 4DJJA 3K0FA 1T2NA 4QBIA 4JA0A 3TCXB 2DT5A 3PE6A 2Y1DA 3PX7A 2WA2A 2FN3A 1HLGA 2O1EA 2ODAA 2JEZA 3QPWA 3INGA 4RMGA 3QWPA 3I5PA 2J67A 1GTJ1 2JIMA 2X7JA 2DJIA 1B4DA 3RVKA 3VYSB 1XPOA 3HVJA 2QTRA 3CF4G 3TFQA 2RAVA 1AMOA 3Q72A 5SZJA 1EXMA 5JJCA 3B78A 2EFHB 5JZVA 5DTIA 4C0QC 5ILQA 2FW1A 1N2CE 1ZUIA 3IESA 2H2AA 1A7UA 2ZJAA 3INRA 4KJZA 4HH4A 3ZWVA 1MG5A 4BLTA 2VL7A 3SGHA 3WLFA 4D9JA 5JS2A 1T34A 2X5NA 1ZW6A 5EDSA 4P83A 5IM5A 2JIQA 3TEJA 4GP6A 2XUDA 1UJMA 4YVFA 5J5AA 3BM5A 2V7WA 4EFKA 2AJDA 4U0ZA 1Y4AE 4BECA 2XS8A 2XAAA 3DFUA 3ITEA 3JAKB 5DX1A 4P3NA 5LQJA 1E89A 4ZXPA 2FUNB 1K1AA 2WR8A 5ALDA 2QRKA 1AHPA 4FDVA 4PNZA 3U62A 2Q9AA 3A32A 1NW9B 2R2AA 4DV0B 3Q5DA 3QPCA 3HMKA 4Q9DA 5K4AA 1JDVA 3FROA 3AHFA 2Q3DA 3L8FA 3F46A 1L6IA 2EJTA 2V9PA 4PCUA 1QPZA 4YJHA 2EQAA 4N5NA 4HS4A 2DZDA 4IUDS 1IZ0A 2H0QA 3GLKA 1ZIYA 3Q5MA 2JFPA 4OL0A 4D74A 4TTIA 2P9KG 5JS8A 1IPEA 3F5DA 3PQ4A 3FDFA 4FJYA 4IDHA 1Z5SC 4UBMA 4D98A 1SA0B 4WLVA 3B5EA 1EXWA 1GXSA 4KX5A 3GZ1A 3AS5A 2X2EA 1ISIA 3DO6A 2XPCA 3CFYA 3LW7A 4S1NA 1SWWA 1YZNA 4V0ME 4YRLA 3C5HA 3COWA 4IJQA 2R6CA 5LJLA 4DR1B 2LW7A 2EL7A 4R84A 5TEWA 1NQXA 2XMGA 3N6RA 5BOSB 1C14A 2IXTA 3BJIC 2Q0XA 1LBQA 4QG3A 2Q5OA 3PFGA 3RH0A 4F11A 3GFQA 5J2UA 4JYAB 4P4SA 2HU8A 4TKZA 1H0KA 2X9LA 3AJEA 2W83A 4MDYA 1NONA 4IV0A 1RRCA 3IOBA 3LX4A 4MKZA 1U7ZA 3N2IA 2FN8A 3TG4A 1AS0A 4AX4A 4D43A 2X2FA 4ZU3A 4L8VA 4Y6RA 4DTCA 4PZPA 3ML9A 1IL0A 2X1VA 3D3JA 2I2XB 1K98A 2VRCA 1YE5A 3AF1A 1GNTA 4L2YA 4FMPA 3W6OA 4YAWA 3F6SA 3TX2A 4EBAA 1SHZA 1ML3A 3QMVA 3LL7A 4X44A 1QO0D 1AGRA 3HLYA 4Z53A 5JE8A 2AFHE 3RSLA 3UM0A 2D00A 2R6DA 2RARA 3WO0A 2PMWB 1U7HA 5PNTA 1QFMA 3YASA 1SPBS 2H5JA 4RZQA 1D5CA 3UJ6A 3WTCA 1TUGA 1CYDA 3C8MA 4MUMA 1XEAA 2QTVA 1RBYA 3AUFA 5K0JA 4B94A 3M6UA 3DW3X 3MTQA 2RE8A 3IBCA 4RZXA 1W2HA 1LNQA 3LNCA 5JUWA 3TLKA 3MZ0A 1K8XB 3R3HA 2R8OA 3D1VA 2VNIA 3P0RA 4KVOA 3WL6A 2V0PA 3HFSA 4EG0A 4DLZA 1Y3IA 4PQFA 1YDFA 3MJCA 1SKAA 4TQ9A 4COKA 1JUQA 3Q9LA 4HDRA 3CF2A 1G6HA 5I9LA 4XM0A 1C0LA 1W4RA 3VKGA 2R00C 4LSZE 3L8EA 4M38A 3K35A 2Q0QA 4RF2A 3Q9UA 1ZOSA 2EGUA 4BFLA 2OWDA 1T1JA 1NMXA 3K8YA 1PWYE 2NYRA 3U3DA 5T3UA 3NBYC 3B7TA 4GWGA 3BD6A 4K5AB 4J2HA 3QTLA 1GA6A 1IBMB 3TQHA 1DTWA 4ECAA 1I36A 3JQAD 4DQKA 3JR7A 3S99A 3QGMA 2O8CA 4JEIA 2D74A 3ZXPA 4BLPA 2AXVA 4A8JC 3KZKA 2Y2UA 1H6OA 3SXPA 1CK4A 4YBRA 2M6SA 4M83A 1V1MA 3B7UX 2C9YA 1XDUA 2IYFA 3THWA 3WE7A 4GCOA 5FF9A 3V6LA 3C7AA 1PHRA 1ABFA 4G5SA 2APJA 2R8EA 9MHTA 3K9IA 1U8CB 3B2EA 4Q7EA 4XEUA 1UWCA 4UREA 2WAMA 4IYPA 4K05A 4RXUA 4DZRA 2BGKA 3ROXA 1YQEA 3WXMA 621PA 3SBTB 3LWBA 1UIMA 4RY2A 1UN9A 1INZA 1TYCA 3LHKA 1FFEA 4X5OA 1HG2A 5KQRA 5KDOA 4JI0B 1APBA 2H63A 1DEHA 3FYUA 4EI2A 5FQ6A 1M8GA 2QUKA 3K1TA 3I9MA 5J2UF 4JSTA 1SZJG 2R66A 3V31A 4UEQA 4V1CA 4ZA2A 3WQQA 2C58A 3QKRB 4M7PA 3H4VA 5DCYA 2I1VB 5ENTD 1Z4IA 4IXMA 2NUPA 2JPDA 3V4VB 2CNNA 4KUHA 1PIWA 1BTOA 2WAAA 1UR5A 1R12A 4OGFA 1HDIA 4IGFA 3K4QA 2UY1B 2HV8A 4ZMSA 3GT7A 3K0EA 1JHPA 1KEEA 5BSVA 4UWHA 3SWWA 3DAYA 3MD9A 4RH3A 3UJ3X 3DO5A 5A3QA 4IIJB 3RTDA 4MIYA 2YKGA 1C7RA 1TQ2A 3JWGA 5EMLA 4MAFA 1Q7GA 2QQ5A 4RA9B 3FGNA 2I8LA 3GAZA 3LZCA 2COKA 1DAOA 1JX6A 1NVTA 5ARBA 1ZGHA 3O93A 3UV3A 1R3UA 3UKDA 4HLQB 1OBFO 4K40A 1LI4A 3K70B 3OE1A 4ZGBA 2OENG 3QX3A 5SZIA 2QLFA 1YA0A 4P29A 1E7MA 3IOYA 2FEOA 4D5EA 2CFCA 1AVTA 3K1YA 1JNYA 3WL8A 1YQ9A 4C4ZA 5ALFA 4H9GA 2HSEA 2JJYA 4YHBA 3EARA 3C6YA 1UBKS 3GHHA 1P2BA 3R7SA 1O97C 3ENKA 3WHKA 4IX9A 2DFVA 1LPPA 1X1TA 5CDTA 2V6MA 2E4UA 2IIVA 3B53X 3L1IA 1DXOA 2QS9A 2BZSA 1I7SB 1UJKA 1RQXA 2HZBA 5CDHA 4DYVA 2X7XA 2HMSA 4OLHA 4MR9A 1H85A 3ZCVA 1PSDA 5I3CA 1NN5A 1G8HA 3PT5A 3QELB 5KJMA 1PQWA 2Q6TA 3BTSA 1Z5OA 1RRPA 1X4RA 1J07A 5FWQA 3GAAA 1IKND 3WSTA 4BVGA 3HEMA 4US2R 5F3WB 2Z43A 4K9PA 4U2BA 3C5RA 4IV8A 5BUSA 2H65A 5JCZA 1UJBA 3V2UA 2WABA 5AK4A 3C3CA 4Q9HA 5EIWA 2PANA 3IV9A 1WDYA 3O90A 1J8VA 1SKYB 2OUIA 4DUYB 5CEJA 5I8PA 4F3TA 3MILA 1DU4A 1I1HA 3DEOA 4UFNA 5ISMA 4I8IA 3H11A 1SELA 1QQTA 4XFDA 3JATA 4V38A 1A9PA 3IV6A 3IKLA 3PXUA 2IUYA 3GIDA 4DLPA 4GOJA 2EJCA 4TWJA 1IM5A 4JP5A 4OATA 3HDGA 2WHRA 2PRIA 4IG9A 4N6OA 3EXIB 4PN3A 2X4DA 4RMHA 3ORSA 1RXUA 1JYSA 5CG1A 5DGXA 4IVRA 1HLFA 3H1BA 4L02A 4NZ9A 1VGQA 2XH8A 2YCLA 3ZV6A 3GMIA 4AIFA 3RUEA 3MAAC 1Y6JA 1XZJA 3I76A 4ESEA 4P58A 5DHUA 1N5RA 2PGXA 3W0LB 5BR8B 2FMTA 4L0QA 3IHTA 1G4AE 4F0JA 3ZNPA 1L4NA 1L5YA 4KO8A 4QC2A 2KBEA 4QXQA 3TR0A 2EKQA 1O0SA 5HFAA 3A9UA 2XDYA 3T5MA 1WAO1 2HRZA 3AR5A 3ECCA 1MUUA 3FPLA 3RG2A 1NMEA 5J5CA 4ZMBA 2ZRHA 2GPJA 3ORQA 3THYA 5FADA 4DLNA 4JEHA 3GP8A 2XTNA 1FSFA 4REQB 3DOUA 5DXFA 5A7HA 4WRRA 2YR0A 1IEWA 5FTNA 2EKDA 3RVJA 2D62A 4INZA 3ZJUA 4XKCA 4NU6A 4A0RA 4PZZA 5FL7A 4RLQA 1QGZA 2OCCE 3N3AC 2CFRA 2AJLI 1WRBA 3JRXA 4MOWA 4MICA 4RL4A 1H5NA 5K0CA 4K7JA 1JQLB 2FPWA 1TTQB 4ZCMA 3IOCA 4DLKA 1NVBA 1YZYA 3A3YA 5AW4A 3V97A 1ZM7A 3ICOA 3GAMA 5K05A 3P5BA 3PZ3A 1P17A 3EJWA 1WKCA 1HDEA 1AHNA 2Y1FA 4DMLA 5DCUA 2WMYA 1PG0A 1RTTA 4H7HA 2OV4A 5CXQA 1X3LA 4E07A 2ZE6A 3WSVA 3ZLUA 4TKVA 1EFPA 4AF8A 3KHKA 1PG2A 1CE8A 1TX4B 1GUAA 2XQVA 3R6LA 2MYOA 5JSUA 1U2TA 3WXXA 2D2EA 4BCCA 3SK0A 2EQXA 3A9WA 3CLUC 4WGFA 2HE0A 5BNIA 3M6XA 4LV6A 4WNFA 2C8KA 1JE0A 2ON6A 1XZNA 2ZZKA 4DLTA 3CNEA 1AV6A 3U6BA 1F1BA 4NU5A 3JQEA 2XTAA 4NQRA 3K0FB 5ITVA 2P3OA 4EHJA 5KTYA 3C16C 2XGSA 5BNFA 3M2TA 2WXPA 3H5LA 1RWKA 2WNHA 3GRPA 3PEYA 5CFNA 2FFBA 1P7ZA 3HA7A 1C0EA 2X8WA 4QBFA 2IVFA 2WY2D 2PMCA 1WB5A 4B7ZA 4MJLA 5AQBA 2XA9A 1UC9A 3OTHA 2ZIUB 1QYXA 4YYEA 3P9XA 4U07A 1CFJA 2G5PA 3OHPA 5HF5A 3V30A 3D8SA 1PZMA 3VXKA 2OMKA 4OHWA 2O5EA 1U1EA 5AJDA 4EY5A 2IC5A 3I1FA 5GZ3A 2R6ZA 3D2LA 4B3BA 1IQRA 1FUEA 2ZJ3A 3L7AA 4YH1A 4YVQC 2GSWA 3OZUA 2PUEA 2NOAA 1KEVA 1IDOA 2BEKA 3BZBA 3V3TA 4EB3A 5DSXA 3IEKA 1XAIA 2CNLA 1ZA2A 4JKOA 1YAJA 3EOZA 4K9MA 1GD1O 4E5NA 2SCUA 4TV9A 2D1QA 3ZZ1A 4NJMA 4GGOA 4J91A 1YL5A 3F49S 3TW4A 2GFIA 3UMMA 1E8YA 2EGGA 4HI0E 2ZDGA 5B7QA 2WXOA 4E94A 1EFCA 4M9SA 4OHMA 3D8BA 4LRSB 3VU8A 3PT9A 2JLYA 4MKHA 3Q8WA 3VR3D 3X43A 3PC7A 1ANKA 1GTZA 4OG2A 4G89A 4DR5B 4IMJB 3ZV7A 2CVHA 4N7JA 4P8RA 3WRYA 1KK0A 3DR3A 2JKYA 3CLHA 4X6XA 4UUBA 2IKSA 3BHNA 2A58A 1Q1QA 2B2CA 4R9NA 3QX7A 9LDTA 3ZVVA 2ZU6A 2X5TA 3VJLA 4YJHB 1T9GR 4D0RA 3GD7A 1DGQA 5E0KB 2WYHA 3O94A 3M3DA 2NSJA 2R4TA 4Z54A 4C6TA 2XKBA 4X8QA 5IVKA 4GPAA 4HAVA 5AJXA 1OCCE 1ZVMA 1K5GA 1IB0A 1GXSB 3JXJA 3VUEA 3NZUA 3I5YA 3MGKA 3HCAA 2FJ0A 3UUGA 3R0XA 3C3OA 5EAIA 2XUIA 4ZQBA 1PX0A 4MRMA 5EFOA 2RKWA 4BQNA 1S1CA 1XNQB 4CLRA 1GZDA 4BO4A 3DVRX 4J49A 1GYRA 2R87A 3G8YA 1AQIA 2CNKA 5DYNA 1RFGE 3O74A 1CS4C 2ZSJA 1LF0A 4CZ2A 5AKZA 1QUFA 2WK1A 4DEVA 3EB9A 5J2UB 2QN2A 2I2BA 3BWMA 3KSQA 4P4SB 4UEJA 4QHTA 1N4SA 1EUYA 3C70A 4KQ9A 4AKXB 2RSLA 5BWNA 2YVKA 2HQ1A 2VS1A 1JYEA 2LZ0A 2V55B 4Y7DA 4CGZA 4PHGA 4HRMB 1DCFA 3BWEA 2NSHA 1Z0KA 4MP6A 3IHYA 5A2QA 2V7GA 4QOIA 1TMYA 5DNYB 1C9YA 2FQWA 3ZKWA 1PL8A 5HE9A 2K4NA 5DTMA 1B7GO 1V48A 4Z0TA 5HIAA 5HA5A 1A7JA 2QN8A 1JG7A 3A1TA 3GVHA 4PICA 4R6WA 2ZPAA 3IVXA 5A3SA 1Z26A 3SN6A 3Q2OA 2WRZA 4RVGA 3WKBA 4UVGA 2GBCA 3OHSX 3O1IC 2Z83A 4EZEA 4CF5A 2QTVB 3C98A 1S8FA 3OF5A 1II8A 3FH7A 3HCDA 1OAAA 4JBHA 3WYDA 2AXUA 1JR3D 1E2LA 1DKMA 3HU1A 4NWIA 4C0EA 4KWEA 2G28A 3L84A 4QREA 3OZDA 1NZFA 3CG0A 4F2HA 3E4DA 4E14A 4HD8A 4PPNA 3W9GA 1FZQA 3ZOZA 2Q6KA 4HLUA 3H9UA 2DWZA 1M2VA 4Q3EA 5JCJA 1SA4A 3EDCA 1W5BA 1M7GA 4OAVB 4TV9F 4E03A 4RHXA 4ZVTA 2CMHA 2L0XA 2IEAA 3DC2A 1E7SA 1B15A 1BAPA 4IEIA 4ZO6A 4HDRB 4JI7B 5JO0A 1Y8ZA 1ECGA 2OXIA 4QGFA 2EKLA 3MCVA 3E9YA 4NH0A 1YK0A 1FQOA 3LMKA 2HT1A 1UT5A 3B7PA 3SD5A 4W9NC 2ZUDA 5JG7A 3NEYA 4NCIA 4UW9A 3OE7A 1R88A 1P33A 3RFTA 2O6LA 3SE7A 1RBQA 1UZNA 3KYCA 2WHEA 5KEIA 4GMXA 2HR2A 1DTWB 3TL6A 2JAXA 4M7RA 3FFBA 4PANA 4Z9BA 4CM8A 3UPDA 2O8CB 3ZYLA 3P9CA 2YV4A 4I1UA 1W73A 2AXNA 4I14A 4FHZA 5CLLA 2YL2A 1ZNWA 4ZK6A 3ZWBA 1GGKA 4WIAA 1RRGA 1SHJA 1B93A 1V1MB 2QG4A 3THWB 2PAFA 5DE3A 4EIWA 1X19A 1OH5A 4DQUA 1FJGB 5DJ5A 4NZNA 4FR5A 2HMUA 1DMSA 2V7EA 5DHAA 1LEHA 2WU1A 1ORHA 4KKVA 1L3CA 2CSUA 3MEQA 5HM8A 4WZ6A 1EWRA 2F8MA 4WVFA 1GAJA 4Z6KA 5EMNA 1LK7A 2YY5A 4NBKA 1N2HA 1R1DA 2Q1YA 4G24A 3W2GA 3Q2IA 4IDOA 3RHFA 3DBVO 4TYMA 1JCRA 1B74A 2G63A 4NMHA 3FYUB 1KC1A 1KKMA 3WJ2A 1XTZA 4GZDA 3R5HA 1DBWA 2H0RA 2IVZA 2ALJA 4I1MA 4UU1A 4A92A 1PT9A 3EW9A 4V1CB 3MB8A 2E5LB 1AKTA 1MB0A 4A2WA 1TDJA 5KJCA 2R1ZA 3RBVA 4DSUA 2QPTA 3F1KA 4F12A 2NUPB 5H9VA 1L1FA 3LQRA 3EAFA 4ZPXA 3NWJA 1IM8A 2VP9A 2WBLC 2BFMA 2IZOA 2NWQA 1UMCA 3KJIA 5BMVA 2RHCA 1RWWA 1QPGA 3VZDA 1KEEB 1WXEA 3LHFA 5LDGA 4D9FA 3LC7O 2VQ3A 2XYPA 2VJAA 4PZLA 1ZGAA 1HE3A 3W90A 2RD0A 1VPEA 1NHWA 3DPDA 1TCUA 4I0WB 1QHEA 5AIAA 2NYJA 5JH7A 4WAUA 4Z9YA 1VMDA 2AYXA 4EQZA 2AI2A 4KVFA 3DMRA 2EKZA 3D9JA 5BV0A 2I6TA 2GJAA 2PKXA 5AQAA 4FFMA 2X6QA 2OG1A 3OI7A 2ZYVX 4B3XA 3IDQA 4YLGA 3RABA 1ZUHA 5BYBA 3DHEA 1QGDA 1ZJ5A 1WUYA 4FZRA 1NJ1A 3AI3A 4BP8A 2HWKA 4A2QA 4XCQA 1JH8A 3C3JA 3CV0A 2PR7A 3IC5A 1JH9A 1MV5A 2DZNA 3CBGA 2Z5GA 3S2SA 4DCGA 2YV5A 3RWMB 5BORA 1MXFA 1U3CA 1JLKA 1QIJA 1V6AA 4R1PA 5J4LA 5JTUA 4ZZIA 3IP9A 3GAFA 1UAYA 4S1WA 5A06A 3CHQA 3EA4A 5CU7A 3PRJA 4FHFA 4DUGD 2F48A 4HOTA 3UHOA 3WGYA 4OHFA 4RAQA 5LN1A 4HPJB 2QRVA 1P60A 2JEYA 3EFOA 1JJAA 2HEIA 3C1UA 1U0FA 2WJJA 4R68A 2FETA 1SG9A 3OQJA 1RRVA 2W2TA 4XJSA 4LWZA 4MR9B 1W59A 3CURA 1QYCA 4IOMA 4RXMA 2WJZB 3CLSD 2NX2A 5DN6A 1IG3A 3QU5A 3I4RB 2XT6A 2IEYA 3ETLA 1N32B 2JAHA 1XZFA 1M73E 1ZN7A 1L7EA 4MR8A 3LCJA 4NULA 3I2JA 2FN4A 3RPEA 4Y0AA 1YK1A 2Z5VA 3EZFA 4HNGA 4HX5A 3OCJA 2OMEA 1XRSB 4PU0A 3G2NA 3H11B 4OYHA 3JATB 2DQYA 1O1YA 4AB1A 2AMJA 4OBWA 2A9FA 2NIPA 4CMHA 3D8NA 2X6TA 1ZCBA 1COWD 3PHBE 4BEWA 4EGFA 1EE1A 3QMMA 3MBIA 5K6AA 1K7FB 2B8TA 4LOAA 5FV7A 5DBEX 4LTMA 3NONA 1KXZA 4QIHA 4HUQA 5KJEA 1ST3A 2RKKA 4BVFA 1IUKA 2HO4A 4RTRA 2XCLA 3ZN3A 3EG5A 1GHTA 2ZW9A 4R8SA 3SZ7A 3IA2A 2GPTA 3CTPA 1ZMTA 4WFIA 4CIDA 3ER8A 2GEJA 4N3CA 2FO1E 5E0OA 3FYHA 2QNIA 1RI3A 1V4BA 2QJFA 2FWRA 1EG7A 4G5YA 2VEDA 3RLFA 1VMAA 5BMVF 1M2EA 4ZVLA 4QGAA 3PC6A 4EYSA 1CUGA 4RC9A 3I42A 1C1YA 2IYSA 4LNUD 1Z34A 5SV2A 1DC8A 1T3HA 4N47A 1VYHA 1KHTA 1LWOA 1UDXA 3G8CA 1TW2A 3THYB 2OZPA 2P79A 1NQOA 4R83A 2GEVA 4RG9A 3CXRA 2VHTA 1L1EA 4EG5A 2VPIA 2QTTA 1R8SA 4JL6A 1NN3A 1E7QA 3OBBA 1914A 4S04A 3AFNA 3KZCA 4FFPA 3U31A 1JXQA 1RXSA 1U0RA 5GMOA 2DH6A 4P4TA 1OB2A 3NZSA 1MAHA 4N01A 3PNKA 4ALLA 2BM0A 4E5VA 5BSFA 1SD1A 1I0ZA 4MUKA 2WXMA 3ZW9A 4N12A 2C82A 3AUJB 4A8HA 1V8PA 1TLLA 2ZTMA 1XAJA 4E46A 4N5IX 1YRHA 2W90A 4JHJA 3IURA 2AEMA 1YDMA 4QL3A 4BBPA 4NI5A 2BEWA 1S7GA 4LTDA 5AI5A 3WRXC 4KXLA 5CLJA 3B7WA 5CFQA 4TKVB 1EFPB 4O59O 1GPAA 3X1ZA 1C8VB 2CFTA 1CE8B 4TKLA 1Q0TA 3GVPA 1JW9B 4LDRA 3S70A 2QL5A 3TZQA 2RJ3A 3MA5A 1CUDA 1N9KA 3WMWA 1ZNYA 2PJDA 5KC8A 4BRSA 5LX8A 1TTPB 1K7XB 3N9IA 1R3DA 1XL1A 2XJ4A 3OO0A 3GBVA 1D7OA 1N2JA 1N6KA 4ROTA 2WNIA 1XXLA 3SJUA 4BX3A 3OP1A 1CZLA 5LQSA 1T6YA 2JLCA 1JHUA 3H3XA 2OHIA 2FRDC 3EVBA 4ALJA 1YF3A 1J8DA 2CV2A 3B52X 4HFGA 3IQXA 2QU8A 3B2QA 3CU5A 2W70A 2VNHA 1J22A 1ITZA 2DXIA 1ZC3A 1CEQA 3FUHA 1I2DA 4ACBA 4N7MA 1P7VA 3TQSA 2FI1A 1VHLA 2OILA 4HJRA 4PS0A 1NR7A 1KQNA 5TGZA 3LT5A 3A14A 3ISTA 5M34A 5JAUA 3BT3A 4GM1A 1QYWA 2HRBA 5C4IA 3B6IA 3U4DA 3GH3A 5C8ZA 5EIBE 3A37A 4KR9A 2VN8A 1PL7A 4FHGA 2GWRA 4G85A 1I24A 5KTKA 2SCUB 4TV9B 5JDIC 4L8WB 3JASB 4IDGA 1QIHA 4NJMB 5EQTA 2ZIXA 4PX9A 4F2PA 2D4AA 4W6QA 5DOZA 3ZIAA 3DWFA 1MZPA 2QSUA 4JWKA 3O5AA 3RRFA 3SR4A 3GNQA 4URHA 2FFHA 2BI7A 3CJQA 3RS8A 3SYNA 3MPOA 4AN4A 4DA7A 1Y6GA 3RROA 3V4ZA 2WU0A 1IB6A 2ZIWB 1J7KA 1Y4UA 1J5EB 4LHEA 1T6BY 5A6SA 3A2NA 5H59A 1E18A 2W0SA 3UQYS 4YMTA 4ZOEA 3EUEA 2Q7DA 1NPDA 5TX7A 3AZPA 1SIOA 5CXSA 4BO1A 1ZGZA 2ZU6B 1T29A 3IS3A 3MC1A 3SHTA 2RFLA 1KXJA 2I2FA 2JLAA 1KO8A 5BR7A 2XQKA 5EJFA 2HO5A 2Z5LA 2YHSA 1E1MA 2MHCA 4C6TB 1UT8A 5IKXA 4AJPA 1LUAA 2I4RA 2W2XA 4GTVA 4NRHB 1W75A 5J1SB 2GCIA 3UMJA 1VJTA 4LRUA 5CB4A 4EHIA 1C7JA 1D2RA 1I2MA 2IPLA 1ZRNA 5AHWA 3C3RA 1I3OA 5KQGA 1KY2A 3RUAA 3FTPA 4MRMB 4QQFA 4HRYA 3PZ2A 4CLRB 3L40A 3UHFA 3DHVA 3RU7A 1UPAA 4M9QA 5K20A 2XNSA 2PGAA 4TRNA 3PZDA 2CHQA 3TKAA 5LCXA 2G7MC 4Y3UA 1SVWA 2HDOA 3M6LA 4K5QA 1FLNA 3I6QA 3ODPA 4KHPB 3IV7A 5T4YA 3BK1A 1HR0B 1GGMA 3GELA 4CLDA 3E7FA 2VBGA 2BM1A 1TKRA 4QXOA 5IXJA 3NXKA 3DD5A 3OICA 3NP9A 2JIZA 2Q2WA 1P4GA 2G0AA 2WVIA 4X6UA 2XW6A 4DV2B 3H3JA 3Q3HA 1WXIA 3ABLE 3I5XA 1QZ3A 2NZXA 3AV0B 1AN9A 5KNLA 3A70A 2R60A 3B85A 3ZKWB 4WSOA 1B8PA 3A1FA 2XUHA 1WSBA 3A6EA 5CK5A 1RE0A 2QPAA 1XVLA 4NE9A 2A5JA 1ARZA 4MQ6A 2JBAA 1SFRA 4COOA 1G55A 1IATA 1JIUA 4BMXA 2C2HA 3TG8A 5LLSA 1CZHA 4JXTA 4JBXA 2X5HA 5A71A 4CTJA 1CUZA 4NMLA 3PYLA 2WLSA 1F4LA 5K0LA 3NDIA 3O9VA 1L5NA 4FSDA 4CV1A 4ZARA 2Q41A 1II8B 1GRQA 5ADVA 5JJBA 2V3VA 2H31A 4UPDA 4NPAA 2QWXA 5DVZA 5B37A 3WAKA 1JDUA 5EIFA 3ZK9A 3EH2A 3RRXA 4JC8A 4BKOA 2J8SD 4WQMA 1G16A 1YB4A 3EOAI 3TBHA 3O8NA 2PZGA 3QRWA 4RSRA 1P6UA 5JAZA 1M2VB 1ACJA 5EKSA 1WLSA 5IAEA 2GB4A 1MX4A 1RU3A 2ZR0A 1H9AA 1Z7YA 5LR6A 3RBZA 3NH6A 2Y8EA 3L04A 2XDQA 2V6JA 4BB5A 1VIMA 4Y6PA 5IVIA 1F8UA 2CMFA 2QL6A 1L5LA 5BXOA 2PNNA 3EPHA 2PZLA 4OIMA 1A72A 4AJNA 1BKDR 5EMJA 3NKFA 3FNFA 3T8MA 3SIPA 5KTOA 4QVIA 3VJRA 3RUFA 2E6KA 3EFHA 5FR2A 4JB3A 4FXPA 3KYCB 3A28A 1KGDA 2V0NA 2P0EA 5AENA 1WX1A 4URFA 3E9DA 1XEWY 2IHYA 2IYUA 4DPMA 3IUSA 4G67A 4G2NA 4IDDA 4FBLA 2I6SA 5KQLA 3ASUA 3G2LA 1O0BA 5DLQC 2NV6A 3WYNA 3QKTA 3QPBA 1U90A 4PE5B 1V4VA 1PVOA 2ILVA 2SHKA 2JH8A 5T5QA 2C4TA 4HAXA 3JYOA 3DOHA 5JSHA 1EGVB 4KG7A 1J2UA 3IXLA 5CB4F 1DUVG 1N95A 4GR9A 4GLOA 1MDFA 1JEEA 3I73A 3HS3A 2X40A 2YIVX 4AN0A 5F1KA 5ED0A 4WLFA 2O7QA 4R5HA 1UBTS 3F5MA 4U4AA 3I04A 4I1YA 2PG3A 3I39X 1N25A 4BJHB 3PCXA 2A9VA 2PZFA 1H9BA 1T36A 2QN6A 4HNHA 2A4MA 2NADA 4LKOA 5JXGA 3ZY3A 1SURA 4WZBE 5EKDA 1RYEA 1NVXQ 1V47A 1HNWB 1KAQA 4BY9E 2PAAA 3UPTA 1CYEA 2R59A 2PSHA 2XEXA 2AJCA 5ALXA 4BMDA