4GZ6A

Crystal structure of human o-glcnac transferase with udp-5sglcnac
Total Genus 264
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
264
sequence length
716
structure length
700
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 264
structure length 700
sequence length 716
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz6A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz6A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gz6A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gz6A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gz6A03
2BGUA 5DBKA 3O3CA 3BD8A 1HLFA 5JJ7A 1C8LA 1RRVA 2F3SA 2XCUA 3CK8A 5AYWD 5JJ6A 5D0QD 1NVKA 1XL0A 3MRTA 3NCHA 1Z6QA 2ZB2A 3CK9A 1PYGA 4AN4A 3GZ2A 2GW1A 3G2LA 4Y6CA 1LWNA 1E4OA 3O48A 4X7PA 1ZU2A 3OXGA 5G05J 4GCOA 1KT1A 2VGXB 1IYGA 5DLDA 4JHRA 1GFZA 1QZ2A 3L01A 3MRVA 1P4GA 2ACWA 3H4IA 3MBOA 5LQDA 4F9FA 1A8IA 1ELRA 3CKBA 2JLBA 2H1HA 2GM9A 4XI9A 4HORA 3E3OA 1Z6PA 1JIUA 3ZPJA 3UPVA 1JIXA 2I6HA 2C0LA 3S7BA 2R60A 5EX3A 1RZVA 5CHEE 4BT8A 1QKJA 3CV3A 5IKPA 1XNFA 4KYOB 4N3BA 3L7AA 2KC7A 3T3GA 1L5QA 1Y8MA 4GPBA 3RT1A 2LNIA 2XCIA 4MI3A 3UUXA 5HI7A 3VDNB 1XKXA 3S28A 4MICA 5EKQD 3VTXA 2PQ6A 3ESKA 3MS2A 1WW2A 2VCHA 1Y6GA 4IN3B 2Q6VA 4YUAA 3VUFA 1WUYA 3BEEA 4NESA 3ASDA 1B4DA 5TVGA 4UI9K 1V4VA 1L5WA 1GPYA 3NAZA 1HZ4A 4KQ2A 3L7CA 4B94A 1RZUA 8GPBA 1NLMA 1GZ5A 1PN3A 2VQ2A 1NOKA 2OOEA 3C4QA 3DDSA 2LSVA 3K9IA 3ASGA 3S7JA 4X7MA 3URZA 4N2SA 3MA5A 4U04A 3OTGA 3D0QA 2GJ4A 2JZCA 1NA0A 4G23A 1P2BA 4BFCA 3NF1A 2FFRA 4RIEA 2R5SA 5KJMA 3CEHA 1P2GA 4LEUA 1PSWA 2BFWA 2P6PA 2C1XA 2SKEA 3ZHEB 2IYAA 3OY2A 2XA2A 5ARGA 3RO3A 5JTTA 2E2EA 1NZNA 3OKCA 2G9QA 1WUTA 1IIRA 3RO2A 1E1YA 1FU4A 3NC4A 2YJNA 3VDMA 4LEIA 1B89A 4WUYA 1P4JA 1P2DA 1AXRA 1AHPA 5G04J 3FFLA 2XGOA 1L6IA 4I17A 2FETA 1GPBA 4F96A 3OY7A 2XA1A 2GPBA 3TG4A 4FKZA 2QLMA 3LY7A 5D00A 3CEMA 1PNVA 5HXAA 2F3QA 4F3VA 3HBFA 3H4TA 3T3DA 3WXXA 2IEGA 2QRMA 2QN1A 4EJ2A 1K08A 3ZN3A 1C3JA 1SXQA 1Z62A 5ENZA 4QLBA 3E3LA 5G05C 5BNWA 4N3CA 2YQ8A 5HQ8A 2XCBA 1F6DA 4HLNA 3S27A 4AM9A 4WNDA 3E3NA 4HOUA 3BD6A 4GZ3A 4BQFA 4RIIA 3MV2B 4YVOA 3S7DA 2QRGA 4GA1A 2GT1A 5DIZA 2QRQA 4MI6A 4BTBA 3CEQA 3QKWA 3CUYA 5I45A 2VSNA 4AIFA 4HOSA 4W6QA 2VGXA 1FTQA 1L7XA 4N9WA 3RSZA 3PDNA 4CDRA 3LCAA 4WADA 5A7DB 5C1DA 3TGOA 1C50A 4U0SA 2AMVA 2XMPA 2C4MA 2QZSA 3L79A 3QWVA 4I2ZA 2C9ZA 2PYDA 4GZ6A 4J8DA 4APOA 4G26A 1L5RA 3ZCVA 3AS4A 3S0JA 4RENA 5KJLA 4GA2A 4GYYA 4GZ5A 4CTMA 5ARFA 1QQEA 4UQYA 2FI7A 3DDWA 3HBJA 5FJYA 2DBAA 2HYZA 4W9RA 3CEJA 3VTYA 2IFUA 2R66A 1FA9A 4WNEA 2FF4A 5DU2A 3SYMA 3IA7A 3PE3A 3QKYA 3G2IA 2QN2A 3T5TA 1ABBA 4U0UA 3AMVA 3D1JA 3ZGQA 2PL2A 3MEKA 4MHOA 5FT9A 3Q15A 3TOVA 1EXVA 3UYLA 1YA6A 4RIGA 3FP3A 3MT7A 1JEJA 3MS7A 4CGWA 2UY1A 2AV6A 4UQXA 4EKEA 1YGPA 5A6CA 3R9AB 4KQ1A 2UY1B 4UI9J 4YVQC 4BT9A 5JJTA 1UQUA 3CVLA 2BGTA 1FS4A 3HBNA 1XOIA 5LCWJ 2OFFA 2GPNA 4N3AA 3VUEA 5BW8C 2VSYA 1JG7A 2FO7A 5FZRA 3Q4AB 4BTAA 3E4BA 2KS6A 3D0RA 2ECPA 2F3PA 3OT5A 2PRIA 3QHPA 1XL1A 5FTPA 2L6JA 3MT9A 1C8KA 2KATA 4AY5A 1GPAA 4WACA 2F3UA 2VGYA 3ASHA 5G04C 2AVPA 3UYKA 4JA7A 4GA0A 1Z8DA 3DD1A 3CUUA 5EX0A 2Y4UA 2G9VA 2YHCA 1GG8A 3ZHEA 2QN3A 3WADA 1E96B 4BQEA 2PYIA 3SZ7A 5TMDA 4A1SA 4GYWA 1QM5A 1XC7A 3S2UA 2NC9A 3T3IA 2IV7A 2AZDA 2G9UA 3OKPA 1SXPA 4HOQA 2X6RA 3CVQA 4LDPA 4CTOA 3EBOA 2J9QA 1NOIA 1NZFA 3ULQA 9GPBA 1BX3A 2ACVA 2VCEA 2SKCA 4KXKB 3KAEA 2ATIA 4GCNA 1ELWA 3SYRA 4ABNA 3S7FA 4CGVA 1W3BA 2FF5A 3MSCA 2QLNA 1FU8A 5CCLA 3ZFWA 1L5SA 3OTHA 5D0OD 4KBQA 1P4HA 3MTAA 2X0DA 3SF4A 2WPVA 5IKOA 2XCCA 1HH8A 2XA9A 3RIBA 3FWVA 3KD7A 2GEKA 2ASVA 2LSUA 5TMEA 4NC9A 2X0FA 1JG6A 3GYZA 3COPA 2QLLA 1VGVA 3RHZA 5GPBA 5TMBA 4XIFA 4EQFA 3RSCA 4RELA 3RKVA 3Q47B 2AW3A 4JA9A 4ME2A 2X0EA 2JJMA 4MI9A 2QFCA 3G2HA 1M5RA 1KLXA 3CV0A 4M83A 4I2WA 4EL5A 4BQIA 4WNFA 3FROA 1IHGA 2GPAA 4KQMA 1UQTA 1Y8ZA 3G2NA 1L5VA 3QOUA 3BD7A 3CUVA 4Y6WA 3G2JA 3EBPA 4GPKA 5FZSA 2VG8A 1LWOA 4M60A 4X7RA 3QWWA 4G24A 4RIFA 5FZQA 1KTIA 4I9CA 4RBNA 3KS2A 4H7YA 3IEGA 2IUYA 1WW3A 3OTIA 3HBMA 1WAO1 2BUGA 2KCVA 4YNDA 3MV3B 3Q49B 4F97A 2IW1A 1P5QA 3CK7A 3U3WA 1NZDA 5BT1A 3Q3IA 3OXFA 4XI0A 2SKDA 2R4UA 4YI5A 2PZIA 4NRHB 2QRPA 4UI9C 4BWRA 3JYSA 3GUHA 4N2QA 1FTYA 4G1TA 4JL0A 3ZCSA 4U0ZA 2IEIA 2KCLA 5LCWC 2ONDA 2MHKA 3LY8A 4AY6A 2XGSA 2XPIA 1FU7A 1WM5A 4G25A 2QN9A 4REMA 3HYMB 3BCSA 3WAGA 5KJNA 3WC4A 4Z5XA 1A17A 4J0UA 4PQGA 1K06A 4I9EA 4HWGA 2C0MA 3ASFA 2IYFA 7GPBA 3NP9A 4AMGA 2FEZA 1P29A 2R4TA 4MRAA 3BCRA 2G9RA 2IF4A 3N71A 2R68A 4O6FA 3L7BA 4M7PA 3G2KA 4YI3A 1Y6FA 3TSAA 4H7XA 1FC0A 4X6LA 4EKYA 3T3HA 3QWPA 3T3EA 3Q3EA 2PRJA 3DZCA 3S29A 6GPBA 1FTWA 1IXYA 3MT8A 3Q3HA 3NP7A 1FCHA 3T7DA 3ZCRA 1J39A 3OKAA 3ZCQA 4NEQA 2C2LA 2XGMA 3CVPA 3CVNA 3C4VA 1ZBPA 3U4TA 2V5FA 4RIHA 3ZCUA 3ZCPA 3EDTB 1PC2A 3LY9A 1HXIA 1H5UA 2QN8A 2HO1A 3BEOA 3MKRA 3CX4A 4L22A 5D01A 2Q7FA 3PE4A 3GW4A 1EM6A 3Q5MA 1KT0A 3OXLA 1WV1A 2WTXA 3GPBA 3LPZA 1O6CA 3C48A 3QDNA 4GYOA 5KJKA 3TG5A 2GEJA 1YA0A 3MRXA 3NPAA 4N39A 1UZUA 3CUTA 2PQNA 3ZCTA 1NA3A 3NB0A 3MTBA 4FZRA 3LKUA 3RJVA 3AS8A 2X6QA 4MHSA 4WHMA 3MS4A 3BDAA 2VYIA 5JTUA 4G2TA 2PQRA 4UQZA 4N5CA 4CTNA 4HOTA 2Y4TA 3TAXA 2F9FA 4AMBA 2C1ZA 4U07A 4WNGA 2QRHA 1JIVA 4J8FA 3MQFA 3UQ3A 3L7DA 5CCMA 2BISA 4EL0A 3BCUA 3AS5A 3RU0A 1XV5A 4RG9A 1WV0A 1NOJA 4NQ0A 3MTDA 5M72A 3CUWA 2IV3A 2P58C 5DXFA 2HY7A 2WQHA 3LYAA 4G2VA 3CKCA 2UWJG 2KCKA 3IAAA 1TJCA 2XEVA 1F0KA 2O6LA 4J8EA 1OUVA 3GZ1A 2H1FA 2HR2A 4I1AA 1GGNA 2QNBA 2QN7A 4RG6A 2FBNA
chains in the Genus database with same CATH superfamily
5FBVB 3NOOA 4YCDA 1HLFA 2ATVA 2MINA 4DLNA 1WSWA 1JILA 1HY3A 3E5HA 2Q3BA 1R12A 1UJ4A 1G7SA 1OVGA 2UZ3A 3SZ3A 2QZ9A 3DHWC 5JH7B 5IBRA 2ODEA 5E1BA 4B0OA 4P82A 1QX4A 1Q22A 2HREA 7REQB 2WP0A 2YKGA 2ZCVA 1Y89A 1Z6AA 3KJXA 3Q9NC 1XKXA 2IOLA 3QE4A 4TWAA 4GWLA 1RS0A 4JI5B 1P61B 1I2ZA 3OO1A 5REQA 1X9GA 4QREA 1PN3A 5JXGA 5LYJA 2AMLA 1V37A 1FX0A 4ZHSA 1CRPA 2TMDA 5H9VA 4R1OA 4RFSA 3U3MA 2EWMA 4Y7CA 5JH7F 1K8ZB 2CL0X 4WXHA 3NJ8A 5CRIA 2NIPA 4ZAYA 2FETA 2A7XA 5FADA 3U1BA 4RJIA 1OYWA 2ZRGA 1DQPA 2GAIA 2QXUA 3L6RA 2QS9A 4LC9A 5BT9A 4QDKA 1PT8A 4A8HA 1PJLA 2VZ0A 1I3OA 2RARA 1KA9H 1XQ9A 3PFHA 3QU9A 1RYDA 3UJBA 3R24A 4U7DA 1XI2A 5FIOA 4B48A 1JHUA 5JAOA 4ZZ0A 2PRSA 3RYCB 4B82A 2FPIA 2LWIA 3CT4A 2VFAA 3SC2B 3A14A 3JQ1A 1PQPA 2BFBA 4U3JB 2V03A 1WNTA 3EU5A 5TEVA 1E7QA 1LK7A 5LA6A 1TM5E 3RBAA 4XA8A 2VP6A 2HBQA 3PPWA 5HP4A 5DU2A 1CU1A 2I7VA 3L43A 4QLOA 1KFKB 3MT7A 3IXMA 2OQRA 3E2IA 2ZRQA 2AV6A 4CEHA 3H9EO 5AVOA 3K7EA 2CJXA 1N25A 1JDNA 2PUCA 2HM8A 4UFOA 1AGYA 3UZUA 1FNSA 2E89A 2KBXA 3I04A 4BTAA 3HJUA 1DZ3A 4UHBA 5KKCA 5EJ4A 3CUUA 3ZY3A 3W5UA 1XEXA 2X3FA 3WV4A 4LZOA 3B3JA 3T4XA 2Z04A 2JPDA 2ZRHA 4PSAA 1VFPA 4AL4A 2VDQB 1KSHA 1Z5OA 5JHBA 1PVVA 3D6FA 3M9LA 1EJ0A 4GUDA 3ZWYA 3AEKA 1T9ZA 1LW7A 3FYSA 3D4IA 1CUHA 4ZKDA 2V6GA 5IH7A 3NIFB 5K51A 1S0PA 3LQ1A 3UHJA 1RKQA 2ZYAA 1PJ8A 3PEFA 4XFJA 3GEEA 1KO7A 3EJNA 4EQFA 5JPIA 4UCFA 3H2HA 3J5PA 4LCBA 4EG4A 2ZANA 2D3TA 1HT1E 5A6VA 3KBBA 2XS8A 4GPKA 1JU4A 2PEZA 1LF5A 3CX7A 3I8SA 2JD0A 1Q0RA 3ISVA 3HP1A 4YO8A 1H23A 4NX2A 1WU7A 4CEIB 1N8TA 3ENWA 3ETJA 1BW9A 2G04A 4ZV9A 2X5NA 5TV2A 3SIXA 1IJKA 3GLIB 3R75A 4TUYB 3RANA 1QYMA 3WMGA 3I5AA 1ZAKA 3F3KA 4P4UA 4DNFA 4ZREA 1VL1A 4NJMA 1Y0BA 3P2EA 2Z6QA 4QO8A 4CL0A 1DO8A 4R68A 4LRYA 1OCCE 4BLPA 4G1EB 4RVNA 2SNIE 1QYCA 4F4IA 2NZXA 3EVZA 2HO1A 2HUPA 5ALQA 3EMBA 1M1YA 4R0NA 4L3VA 1XB2A 1YA0A 1IWOA 1JLLA 1AVTA 3RYFA 3GLIE 4TVOA 2YWJA 4TUYF 4L3OA 4OP2A 3SD7A 3GHYA 3PL1A 3ZWQA 4U2GA 3R7WA 1E2HA 1SUSA 5KJCA 5LZ2A 1S2OA 4IX9A 3ME5A 1P39A 3COZA 4KQ9A 1YFJA 2CF6A 3I5XA 1DAMA 5COQA 4EO7A 5CVUA 3NDPA 4GMHA 1AA9A 1SEVA 4E6EA 3FYUB 1ENOA 4N1AA 1I1OA 4DXAA 5G05J 2PIAA 4I8IA 1SOAA 3W6NA 2JFPA 4AD8A 5TGDA 4F9FA 3G2QA 2H07A 2HO4A 3ZVNA 3UPTA 4BVJA 3WNCA 4NCBA 3CQGB 5BR8B 4F6RB 5DCWA 1QKJA 3SZGA 3QZUA 2FEXA 4Z49A 4I1OA 3U64A 4DK5A 4O60A 3AIOA 4P7GA 4CM4A 1KYIA 1PNOA 4AG3A 1EB8A 3KV1A 1P60A 1AHNA 1UWLA 4OG2A 1JYEA 2P79A 1P2BA 3KYJB 3ABZA 2FFRA 4LEUA 2HM7A 1RRKA 3PQDA 1EGMB 1RYNA 4JC4A 1VPLA 4W5JA 2BCEA 4YIKA 3BFKA 3ZKJA 1JQBA 2CFCA 2ID7A 2VP9A 1ABFA 1NGSA 3C7TA 5JZ9A 3QV1A 3ZV4A 1GRCA 4RNCA 5J47A 2YWEA 4ID9A 2QPAA 5ALOA 4S1WA 3DMFA 2WAOA 3IKTA 4X3PA 3AX6A 1WQ4A 3GJXC 4ZT3A 4N0MA 3OFVA 1WJGA 1KVUA 4YFYA 3UMYA 5FFNA 4KV7A 4LZNA 5F73A 3TKAA 5HFJA 4YJGA 3UJHA 2H18A 4D1YA 3SJAA 5FQOA 2EFCB 4IDQA 1L7AA 1CSEE 1QG4A 2QOEA 3IHWA 1Y3IA 4WEQA 3N7AA 5LPNA 3S40A 5KEIA 4A6EA 4M3OA 5EGSA 5I4CA 2A5GA 3H7AA 3THYA 1LPBB 2J5RA 1GNSA 3R9AB 4Q9AA 4EWLA 1II8B 2JFZA 2Q7XA 1J0XO 4JL6A 5IT5A 3S44A 5DFAA 2FDCA 1VJDA 3IHLA 1VCMA 4A8PA 2V97A 2EP7A 4Z0HO 3ROEA 3UNXA 1AWCB 3DOCA 4ZIRB 4UTNA 3MERA 4MINA 3ACBA 2AI2A 3WYFA 4XX1A 4G0YA 4KI7A 3PLAE 4LHZA 4ALMA 3ASZA 3DD5A 2VCYA 3IR5A 1BMFA 4GI7A 4LF5B 3EVDA 2O2CA 4DYDA 1NRWA 3N8KA 2Z6AA 4GLBA 4FN5A 1FU8A 3C8ZA 3DO6A 3OHPA 4QNMA 2V8SE 4Y6SA 1Z35A 4OJTA 1XF9A 3WGMA 1R2QA 3I9OA 5JNUA 1ISIA 3FGPA 3RRBA 1CD5A 3RSCA 3Q47B 2JD2A 1IY9A 5FO0A 3RF7A 1NQAO 3D9LA 1BRTA 3J7TA 3T61A 2VSXA 4ACAA 4OH1A 4D81A 1R8QA 1KK2A 4KR9A 4EUHA 4O2RA 3E9QA 5BT1A 3SR3A 3I2IA 1V7PC 3T3NA 4K26A 3CRQA 4ARVA 3KL2A 1GFWA 3CLUC 1KQNA 3K8OE 5DGXA 5I3ZA 1L8XA 4JU9A 2HH9A 3FIUA 1G8FA 1PDVA 3RB8A 1NASA 2GPTA 4M9RA 3DM9B 2IYFA 4IH4A 3ZCXA 1D9XA 4LBWA 3HL4A 2ZR8A 1TEHA 2YHEA 4W82A 4MAAA 1CZUA 1GZ6A 5K8CA 3KTFA 2COUA 3DC7A 3KEFA 4WW0A 2X41A 1O97C 2BH9A 2D4AA 4WZBA 1E7VA 4JJKA 1EM6A 1MAAA 3V8PA 4WNIA 1D6JA 1FNBA 3TNJA 2VVTA 3RVRA 1P1BA 1U7OA 4G2TA 3REFA 1VBFA 4BP3A 1TMGE 4UUPA 2R9VA 4AS2A 4UKDA 4A55A 4YRMA 2R02A 1BWPA 3AM1A 2EINE 4MPRA 3N8NA 3OJWA 3UH0A 4ILKA 3EN0A 1QBKC 2WD7A 5CLLA 1PJZA 4U9HS 5JJ7A 3BD9A 2O14A 1PJ4A 3G2LA 4F1PA 1Q1ZA 1JCQA 4FZVA 4WCFC 4UE3S 3IERA 1XZCA 4BX2A 3MW8A 4CV0A 4B3SB 4J7WA 2P41A 3QLJA 3D9JA 5EIOA 2ZRNA 4N0EA 1KZPA 4Y2YA 4YMIA 2BEDA 1CKEA 2XWQA 4XSHA 4AP2A 1JEDA 4B74A 1FSZA 4E88A 1B4DA 1U1DA 2YJTD 5LXTA 1JIJA 4Y7DA 2V7QD 2C8JA 1G8YA 4CCWA 1Y8QA 1IOZA 4QRIA 1VDYA 1ZQ9A 5AVSA 4KE7A 3SYKA 3R3VA 2BMWA 1ZONA 5TVKA 2H2GA 4PNEA 4CKCA 1L6IA 2GWHA 1EXWA 1PX0A 1TTHA 4X8MA 1SXQA 2FEMA 4O4JB 5EIEA 2JEOA 3ROTA 5HQ8A 5FOQA 3PA6A 2A90A 3E81A 1U4NA 5KSPA 3ONEA 3DWLG 5JISA 3IJEB 4YV7A 1FTQA 1SK9A 1SU8A 2Z57A 1ZZGA 2IDZA 3O1JC 3IUJA 4UDXX 3ER9A 1HC7A 4DQUA 4MZXA 1W48A 1O97D 1J7JA 2AEEA 1OJ7A 2ATCA 3W1VA 4H3SA 4B2YA 3PZ3A 1R5JA 4FFRA 4NMWA 2I71A 2P8JA 4IIFA 1QJCA 1U0TA 5E0OA 2CE7A 4UI9J 4Y0NA 3IKLA 2P62A 1C14A 3ZY6A 3DDHA 1T0IA 4EHKA 1RXUA 2XRMA 5CVJA 3ONVA 3OM8A 2OBLA 2QVGA 3GG9A 3R7AA 4UC0A 1UADA 4KKXB 4W6ZA 4XD7D 3V4LA 3I42A 2DLDA 3QXHA 3IBTA 2A7QA 3DV2A 4UMFA 5E1DA 3R7SA 3BTVA 4N01A 1EU1A 4D82A 3RAEC 4AVXA 1U3TA 1I7QB 3L6CA 3CRZA 3HLYA 1ONBA 1USWA 3EBOA 5EG5A 4NMLA 3MWEA 5LWQA 3ONNA 4U2BA 3WGQA 1E0AA 4QXPA 4DLXA 1N0HA 4ZFNA 4Y0VA 3ICCA 2C98A 2YJZA 4KAAA 5KYYA 5TMBA 1G291 4GX1A 5U4QA 4FGSA 3BMCA 1K0FA 3DL4A 4I9GA 2HGSA 3L7IA 3URMA 3EDCA 3FOZA 4DC0A 3LE8A 4GAEA 4L5YA 2OFOA 2OORC 4MCAA 4QG3A 5B1AE 2YY5A 2BF4A 1YZUA 4DSTA 5AKLA 1I6WA 1GSOA 4H15A 3QVKA 5AOXB 3T5GA 2CLKB 4JT8A 4DX7D 2D1FA 2RJOA 3PDCA 4XE0A 5H82A 5BWNA 3TZQA 4M1TA 2R8XA 3FBWA 2EIME 3PYMA 4OGKA 1J70A 2QZJA 1R8SA 2VJNA 1TKBA 1P29A 1D2CA 2ZI7A 1OFUX 2BKAA 4KIUA 4WAFA 1FC0A 4G8BA 1UP4A 4PHTA 5DDIP 3Q2OA 3MT8A 4AF7A 1PJ2A 4CT4B 2XDQA 2YHSA 1O4WA 1ESDA 4FP7A 1H22A 2DWCA 1UKCA 2XGMA 3F6YA 3K70C 2P0YA 4NZ9A 5LQKA 3JY6A 4G8LA 1J42A 2XTZA 3NPAA 2GVZC 3QNUA 4K8OA 3GO4A 1MFPA 3H16A 1UBMS 1O6FA 4A23A 1XZKA 1ZINA 3TLJA 2IIVA 4YMUA 3P1UA 1RAFA 4NE9A 5J08A 2OKCA 2BFCA 4WKBA 1TJCA 3W8EA 2JBAA 3FKJA 1NM5A 1Y3BE 2BTQA 3G7SA 2BM1A 1OE0A 1LVHA 1GWNA 2WWHA 2EFYA 3C5VA 5IJ0B 1G60A 2HSGA 2VAXA 4XE5A 3ONKA 3GBSA 1GPKA 2D8MA 1KJJA 3RVKA 4C3UA 3K2IA 5JLAA 4NAHA 1E94E 3L7YA 3BRWD 3DXYA 2H1OA 1O9GA 5B1DA 3NHWA 2PJRA 3TWTA 2C4HA 4G4JA 2IEJA 1OH7A 3ULEG 3PI7A 3OE1A 1OLUA 1JDBC 4D0RA 1U4SA 1VE6A 2XDAA 3OPVA 2PH5A 3WJ7A 2X1HA 3QIVA 5CBKA 2II6A 2QRVB 4AZ3B 1P0MA 2BPOA 1V4VA 4M9UA 1IRXA 4NEGA 2HZ7A 5JXHA 3EGVA 3E5RA 3LL4A 3PJFA 3Q6IA 5U4XA 3MBIA 3T4EA 4EPVA 2HWWA 3FPHA 1H0SA 3A06A 3V42A 1U0FA 4R9UC 3KOXA 3U16A 4HLLA 1RHUA 5EY5B 3TWXA 4S1PA 5D8DA 4Q1DA 2Q6TA 4R1UA 1UMCA 2ECKA 3SR4A 1KGSA 3SKVA 4UVHA 3PE6A 2CMHA 1VKNA 4FW8A 3L4JA 2G06A 4QTYA 4MW4A 3SIWA 4K9KA 3MWKA 5T3RA 3NHRA 4E51A 4J43A 3PJGA 3UJPA 1GNLA 4P5PA 2OZKA 1TECE 1X7DA 5IMBA 3KCNA 5K3CA 3ONFA 1WB4A 2DTDA 3MJHA 3N2EA 4J1TA 4H1TA 3EFHA 1MJ0A 4P0PB 5M04A 5SY9A 1E2NA 3CUEF 4JR1A 3O7MA 3IHVA 3OX4A 3C3AA 3EFOB 4IJWA 2CFOA 1GZVA 2YZMA 1JWLA 3K9GA 2A9RA 4L0DA 2BEUA 4Q39A 3AHCA 3CKKA 1V9LA 1SVSA 2OFXA 4GOMD 1ZBDA 1DT3A 4YA6A 4N41A 3C2QA 4FHEA 1YKGA 1GKIA 3FHCB 3PC7A 4MQ5A 3LECA 3W6OA 2UXCB 2RJ3A 3HDHA 3UT0A 1F4LA 2Z4TA 5JS2A 2NUAA 2JATA 4C0XA 1WPXA 3N86A 1WMBA 2HK7A 3OZTA 2O4UX 3AVYA 4XARA 4OLHA 2YVUA 3UWDA 3ND7A 1NUTA 1RJEA 3V7UA 4LNUD 3NFRA 3R3YA 5L4LA 1CZHA 3NC0C 1JSRA 1AZSC 4JYPA 1AJEA 2W2KB 5IKOA 5PGMA 3UMRA 4R7TA 2E5LB 2V45A 4F3CA 2ILTA 2ID8A 4YR9A 3BMXA 3FNQA 5G55A 3BQMB 2H3EA 2XEEA 3NGMA 2R6CA 3K6KA 1G2IA 4HEJA 1S8FA 1CUAA 3IESA 3PQ2A 4UNSA 3DAYA 4FCVA 1M2OA 3V8VA 3KKEA 3D0OA 4CHTA 3JYPA 1JHQA 4AJWA 3NHAA 3SI5A 1AO0A 3JQDA 4LVOA 4V39A 2VWGA 1RAEA 4ZQHA 4AROA 5G4KB 4AULA 3I61A 1JMKC 3WQBA 1KY4A 3NWJA 4YXWA 2XPIA 4II7A 2KZTA 5IKMA 5BYAA 5TC4A 1JHZA 2VDPB 4J0UA 3JQAA 1VSVA 5SZIA 4RTNA 1BH6A 1JT9A 2Q5CA 5LOVF 3SHOA 1IXRC 1XMXA 3CM0A 2ZI3A 3DMRA 2VTBB 2PRJA 2X0IA 3IIJA 1RM5A 1HL7A 1GQSA 2J0VA 4Z8YA 1OASA 3OD1A 3WB1A 2EQXA 5A04A 5HG0A 2B1QA 1NNLA 1OWNA 2WI8A 3N74A 3CX6A 3TZKA 2ANCA 2QRJA 4U63A 1ND5A 4AMBA 1W0JA 3DXXA 4KOAA 3T5CA 4QU5A 4LC1A 3WL5A 2OG1A 2IF2A 3ZE1B 1JJAA 3STTA 2WMDA 2RD2A 3OZEA 5DBKA 4RS3A 1OXTA 1YYHA 1C8LA 1RRVA 5DCUA 5AYWD 3HN7A 1K1BA 2P9UG 1D0SA 2ZB2A 3QVGA 3S3TA 4PN7A 1H3EA 1QZ2A 3N2GA 4NBVA 2WMNA 2PFGA 1MX3A 1EK5A 2QKYA 3B7UX 5HIIA 5H59A 4RHTA 5LMZA 1B76A 3MGBA 3NH6A 3HI6A 4WOBA 2DVMA 3GP3A 1W29A 3P71T 1CULC 2EWWA 4AYTA 1M83A 3EEQA 4MICA 3JRXA 2JCBA 1GD1O 3ZGOA 1G3RA 2D1RA 3I1JA 2YUIA 1WY6A 1V43A 3CIOA 1HORA 5FWYA 2V7BA 2JJ2A 2NXPA 4BQOA 2ZYTX 4J90A 2ICAA 4XDYA 2ZRKA 3D9HA 5JJKA 4FN4A 4I55F 1Q7CA 3UKUG 1P2GA 2VQ6A 4TV8A 5BV2P 4YJ3B 2P77A 2IYPA 2OXFA 1G8MA 1RI4A 4DNQA 1IIRA 3NC4A 4RADA 4TGLA 4JLMA 2YNMD 2ZXEA 5JWOA 3T5PA 2FMHA 3T1TA 2I4LA 5B2ZA 3LSYA 3TAHA 1WKCA 5EQJB 4ZO9A 2AFIB 4ISCA 4ZQBA 1TQDA 1U0LA 1ZLYA 1NVTA 3ZXSA 3DQQA 1Y37A 1QHNA 3MJ4A 4KLZA 4Z68A 4BNZA 3PFFA 3VZBA 2CXUA 1S1MA 3WLAA 3RQIA 4W6QA 3TE7A 1BROA 4PQEA 4MW9A 1I2CA 1L5FA 4YJ3F 2O0LA 1E3WA 2W2LA 2CLHB 3R44A 3LYUA 4DX1A 2XECA 2C3OA 4NCHA 5AI9A 2CUKA 3K9LA 4G5RA 5A2QA 4AVYA 1WF6A 2IPXA 2AFIE 4KQ1A 2BGTA 3NB2A 1IKND 4ZPXA 2FLVA 3CPSA 1PEYA 3FB1A 2O0MA 1W76A 2BZSA 4MPPA 2OGSA 4NJOA 3RRJA 4WACA 5CLHA 3B1JA 4CVNA 1GZUA 1U2SA 3NBQA 3I2YX 3QYPA 1E69A 2O2IA 4M7RA 5IKEA 4E03A 4EHFA 1FJXA 3ZGXA 2WU3A 1IZ8A 1O0BA 4IYPA 1LPSA 4DA7A 3H2IA 3BWVA 1QMPA 2FP4A 4AJNA 1KXJA 5IUKC 3WDKA 2QX6A 4LYGA 2XQFA 3FPBA 3CNHA 4WVFA 4BJHB 3UUGA 3M4ZA 2W43A 3LC1O 4GVLA 1PNRA 2GEKA 4RDIA 5JEDA 3L41A 3L77A 1JEEA 4GI2A 3M6AA 1A69A 4MRPA 2IPNA 4WWNA 4KMMA 4UTXA 2JJQA 1F8GA 1XIVA 4MV5A 4D9BA 1BFUA 3UICA 4UHEA 5CYFA 1SGWA 1UDCA 2GYWA 4LWZA 2IH5A 3VKHA 1WWKA 4FZ5A 2GBLC 3ZGNA 2YV3A 5FA8A 3VR6H 4L6CA 2ZSDA 3R9XB 3O38A 2VUSA 2OAQ1 1GYRA 3L8ZA 4NEHB 4NF2A 2WXNA 4RFVA 1L6RA 1RAGA 1X8LA 4UBOA 2O2GA 3HEBA 4IHJA 5FL3A 3CR3C 2LXLA 2C0MA 4M38A 1YJQA 1L3CA 1WEKA 4JLBA 4MQ6A 2GZRA 2VDVE 4N5HX 2PTGA 1YUBA 4OJQA 4U2KA 1N5RA 3W7AA 1QCCA 2QD2A 4IIJF 1Q20A 5G0VA 1A4RA 1WVGA 1W8IA 1W7AA 4MR7A 3OQ1A 3IHYA 2EBHX 2VJQA 2PAFA 1JI3A 1FLVA 3C3CA 2PKCA 3QARA 4X41A 2XXJA 4BIMA 2PSHA 2Y4TA 3CLVA 4DY4A 3CLJA 1KZ1A 1GG5A 3NUQA 4J8FA 2PDAA 2BKLA 2EW2A 5FBKA 1QC5A 5ALHA 1FVXA 4FJZA 3LCRA 3SQOA 3TFOA 1CC1S 5HKBA 4RZSA 2J3QA 1NPDA 3HDTA 1JAXA 2VTVA 4FOLA 4Y2VA 3BGSA 2D0DA 3TRDA 2BDEA 5ED0A 3T35A 1UMBA 2H1HA 3WI7A 5KTNA 1U3CA 4WK2B 4Q34A 1KR2A 3FCSB 5K20A 2FSVC 1TT5A 2KC7A 3FM9A 5CRVA 2LPMA 3VO1A 1BEZA 3DXFA 3ZYCA 1YE3A 3EJWA 1KFJB 1H5NA 2EIHA 5ENSD 1A95A 3SHWA 3KVOA 2NVUB 4FW9A 3VHLB 1UBSB 3JALA 5M5BA 3AERB 1T9GR 3GGGA 4XX0B 3DLTA 4DSNA 4U7JA 2H54A 4F4UA 2Y77A 2BKUA 5TR9A 1ZVJA 3IAFA 3NYQA 4MGYR 5ENZA 1QFZA 3TVDA 4XKBA 1MJGM 1P4JA 4P7FA 3CEAA 3VYSB 1WAMA 4MKZA 1M10A 2AFHB 1CIPA 2B36A 2ZYHA 3PENA 5CLJA 4Q93A 1HEIA 3NBXX 3RTAA 4O0MA 1XMJA 5DNDA 4MVJM 1NW8A 1Z62A 4Y2TA 5ITZB 1R50A 1KJ9A 1QGDA 4FYWA 4D4LA 2PGNA 5H83A 3CRNA 1HNXB 3GEHA 1RM0A 4O1IA 3SOPA 1P3JA 4XJXA 4D6PA 1C1YA 1D7OA 3VPGA 2B34A 3KHSA 4LOIA 2OHHA 3QWVA 1K92A 2YXDA 5FI3A 1N7JA 2OPBA 5BSMA 2B0JA 2O3UA 4EY4A 5F2OA 1G8HA 1QIMA 4KPYA 2AFHE 4DARA 3MTIA 5AW0A 4OBEA 2PQ0A 4MB0A 5TF4A 5AW5A 3SKXA 3UYLA 5BW4A 4WBNA 2QEQA 3ZXYA 1YGPA 1XTIA 5DTMA 1OXVA 2D3WA 4QXMA 4WNYA 1US8A 4GR9A 1UT5A 3TGWA 4BPRA 1TJFA 3TRFA 4OQ4A 1MO4A 3P2JA 2VJCA 4D41A 3S2UA 5LP6B 3U4GA 4HX9A 1Q1GA 4O59O 1UOHA 4H59A 1Z08A 4UM5A 5AHXA 5DH9A 4HNTA 3GFPA 4PZDA 3CW8X 4QAQA 4N48A 5C37A 4J1QA 3SF4A 1FDVA 4ZAFA 1U7ZA 5ERYA 4L7QA 5FUBA 3KB6A 3GFOA 3GLRA 1SN7A 3R77A 2JLVA 5LZ9A 2QW8A 3F97A 5DLPA 2FJ0A 1RLIA 4RKQA 4EYGA 1NVWQ 4LNHA 1PW7A 1WCV1 4X1YB 4QKQA 4O2BB 1KQOA 4RSYA 1JAYA 3SNHA 1RAHA 3CF4A 2YHAA 3GUHA 3RVJA 4G5GA 1FTYA 3MTEA 2ZJOA 4CLDA 3FUHA 2D2IA 2H9IA 1U2TA 1GA4A 4F7AA 4WFJA 2H0RA 3ZLVA 2IXDA 4BU0A 3AP1A 4OQPA 5SV2A 1RFLA 1P5RA 1AZLA 1FUKA 3VSAA 2GRNB 1JJIA 3D2LA 4LDNA 1EK6A 1RHJA 4HAYA 2NLOA 5B5SA 5EKTA 5HEKA 4L0QA 1M2GA 3O82A 5EE5B 4P4LA 1PG2A 4AZ0A 1RE0A 2GILA 3T7JA 4ZYVA 1VSUA 3QY0A 4NH4A 3U48A 3AT1A 4J0CA 2R2LA 1FYEA 1FP1D 1TAUA 3VYTB 4X91A 3PHHA 3U0VA 3BWMA 4UQPA 4BRZA 1IMOA 2G3YA 3R5JA 4Q1CA 4PGGA 4XVHA 2VPYA 1TAHA 3TWVA 4MQFA 3L7DA 4LYEA 4D10C 2HU5A 1JG3A 3ZDDA 2LAIA 4BTLA 2RDMA 3UWOA 2R7KA 2JS7A 4WWPA 4NBLA 4EX7A 4LUNU 5EWJB 1KYVA 1DC3A 2OQIA 2JFXA 4PVDA 4WK4B 2IY9A 4EA8A 2W8BA 4R2JA 1H1TA 3TJZA 3VNVA 1DVRA 1Z33A 1ZAYA 4WXPA 4BAUA 5KNCD 3D8SA 2EBFX 4GMLA 3MAJA 1ZWKA 4ZZ2A 2MJLA 2XCIA 4N7MA 4UU1A 2IUFA 5K0GA 3CJRA 3OQOA 2AIRA 2PJUA 1HI9A 4CDMA 2IU1A 2PX2A 1JHRA 3MVEA 5SICE 3GGSA 2J41A 2Z43A 3GT4A 3O73A 3WMFA 3UXMA 1G3IA 5HRAA 1M6VB 3WMEA 2V7PA 3ZWWA 3R41A 3W7BA 5KYXB 4I50A 1P6UA 5CFRA 5ENTD 3V7WA 3QNWA 5BQPA 4NDAA 5B58T 5HDQA 1WCWA 3E53A 3CR8A 4OHYA 2IEGA 3O8BA 4YCAA 2H11A 4AC9A 2RHHA 2FZLA 2PZGA 3SHQA 2PXCA 3SY2A 2BKGA 2H6GA 3R74A 4X71A 4PH4B 5KNGA 1T9KA 2REXB 2W0MA 3PUHA 4QSMA 4A2CA 1Q2ZA 4QOHA 4GRAA 3MIZA 4Q4AA 4GS5A 2CFSA 2GNPA 2C84A 3ADBA 2RC6A 4HDAA 1JE1A 1SZJG 2C7RA 2HB6A 1FMLA 3DW3X 4QM6A 5L95A 4OUDB 5B3JC 1MV5A 2ZTVA 3QXXA 4MKIA 1OV4A 3AGPA 1U8UA 2HBRA 3RHSA 4RL4A 3AIMA 3V1NA 4CF5A 1D1QA 2MOWA 4JI6B 3CVLA 3ECCA 1NQ5A 3OPYB 2QYTA 4ITRC 3V6MA 2XE8A 2AQHA 2LKCA 3GFBA 3DBOB 1IZ7A 2VAVA 3A4YA 4IJUA 2EBUA 3T9EA 4EPTA 5I5EA 1SCJA 2ADMA 2H9YA 4BQNA 1J8VA 3A4VA 3SEAA 4OXRA 4HOQA 1A8PA 2C3MA 4GDMA 1R00A 2HQRA 2XYGA 1VG1A 3IIKA 3AAAC 3CHQA 1Y4UA 2E21A 1FSFA 2BI7A 3KXIA 2WWVD 2ZGDA 3RC2A 1Y3HA 2X5OA 3ICVA 1E8OA 1T5DX 2EZ4A 4F2WA 3AG5A 4MDFA 4F38A 2VNJA 3DOHA 4LWOA 4FYJA 2WTBA 4B47A 1QWOA 3F5FA 4DCNA 1RSZA 1N6OA 3O93A 2GZMA 4YREA 3OIDA 3AHDA 4ZI7A 5C1BA 3P26A 6YASA 4EA7A 3QGMA 1N5IA 4QDUA 2M2IA 3HGQA 1EFRD 1SW6A 1X7XA 4RF2A 1M33A 1SHLA 4FA6A 1YT5A 5FI1B 2YQZA 1TCBA 3E4CA 1VL6A 1RZRA 3W5DA 3QJYA 3T7CA 4K5BA 1M0TA 4E5DA 3B5EA 5T8KA 3BJEA 2NMVA 2GN2A 1H2YA 2M6SA 5FULA 3RR2A 3DZJA 1SZCA 5JU6A 4DXDA 2G72A 5EP1A 3H75A 5ADVA 3A1EA 2C92A 5EWLB 3L0YA 3HYNA 2R68A 3BILA 4OX9B 1OFTA 1VIVA 3RJTA 5F9MA 3NDJA 1OIVA 5ANLA 2ZSAA 2A88A 1GGVA 1VXOA 3AGQA 2D2XA 4OHCA 3NRBA 2P9ZA 3A36A 5IM5A 4J3NA 2YVKA 5ADUS 2YC4C 2A33A 3GLTA 2G28A 5BYBA 4OL0A 2I1LA 4UFPA 4TL7A 3HHMA 2FR8A 2XYQA 1NRIA 3DEYX 1R4MA 1ZWLA 2FFGA 4I9NA 1IQ0A 4DV0B 3VTKA 4YK7A 1N4DA 2NU7A 2JAUA 4H6VA 1N1DA 2OD2A 4C88A 5AD1A 2O6LA 4GX5A 2NU8A 3MEQA 2HMUA 5C2YA 3ORFA 4PX5A 3D31A 4NCAA 3WWZA 1RP1A 1NMEA 2ZIRA 4H0FA 2YIVX 2NSHA 4YQZA 4E7PA 1LI4A 4LF7B 3NJRA 4FNGA 4WTOA 3B7SA 2VF7A 3ADDA 1ZZEA 1H3NA 3KE8A 1E4EB 3AJDA 3AI1A 4DV4B 1M1NB 4AJOA 2E6KA 1UK9A 3UJAA 3BXHA 1KY2A 3Q79A 2X6FA 5CT8A 2A1TR 4K1XA 4KRFA 4RMIA 1UJ5A 1TZJA 2WHXA 3FTWA 4L08A 5B37A 1OAOC 1TJ3A 4IFBA 3QKRA 2H63A 1D0VA 4HNSA 1W73A 2OOEA 3RVSA 4X7MA 2Z58A 3URZA 2AQKA 4JMPA 2DBRA 1T9GS 5CAEA 1O2DA 1V1RA 1TDJA 2IXBA 3LUJA 4MV0A 1DBQA 1JFVA 2A59A 4B34A 3Q4GA 5IC6A 2ZYVX 5BVGB 3GLFB 5EUBA 1BG6A 1KEWA 3ZY2A 3HPQA 2Y4OA 3GX1A 1EEXB 2BWJA 1MC8A 2F2TA 1NW4A 1Q0LA 3EPLA 4EUNA 5CT6A 4OAPA 1HYBA 5DGHA 2IOHA 1VTKA 4LF9B 3PDJA 4O0LA 3DR3A 4XTRA 5HBRA 3ESDA 4V2UA 3ZN2A 2XRFA 1OHHD 2FH5B 3A6KA 5DXJA 2R1VA 1TTQB 4QTUB 3ZIAD 5A7DB 1TM3E 5EXEA 3VZCA 1U02A 2IYVA 1DCFA 3DGFC 1RAAA 1M8FA 3KXPA 4FYVA 5HF6A 3B9BA 3GLFE 3PJEA 3WSWA 3RAFC 4DMUB 4E1BA 3T1HB 1FA9A 4NS1A 3I1YA 2B20A 4G0NA 3B6MA 4WKOA 1JA9A 1V7QA 4DRZA 5FBHA 4PNHA 2NO7A 3TPZA 3F6QA 1H4VB 1P9WA 3WBFA 1XPOA 1NXXA 3STHA 1SWVA 2GNOA 4BMNA 1ETUA 2WUVA 1YO6A 3RNLA 1CZNA 4OAOA 1BC5A 1PYOA 1XT6A 4G01B 1N4RA 1E2EA 3D2AA 1P4RA 3G5UA 1Y42X 4U7EB 3WADA 2QQGA 3MYYA 4DAEA 1II0A 4H0NA 2VUUA 3KOUA 5I9LA 3Q9LA 3IBYA 3GEBA 1BEUB 1OLXA 3H1AA 2CL6X 1NJ1A 1TE2A 2R6ZA 1W3BA 3K09C 4DA9A 2WTUA 3QI2A 3AL3A 2YNQA 4OLJA 4MJ3A 2BKKB 2XA9A 2D74A 3WISA 1VPVA 1KJWA 4OHOA 2H7CA 1W4RA 2QORA 1IYZA 3G1WA 1T4DA 3FCYA 5IVDA 3MUOA 2CXXA 4W5TA 3PQ4A 5CD1A 4HP8A 4XJSA 1U7HA 2Q1YA 1KTIA 5IUJC 3VDXA 3C8DA 5HUJA 3ONLA 2J9XB 5F77A 1URPA 3DFMA 2AJDA 2IXTA 1N2CA 2V7VA 4IUDS 4HAOA 5BN1A 5BSUA 3RWBA 3DV9A 4WOCA 1AKEA 2NU6A 2O8BA 4D6XA 3H18A 3WC4A 2HYIC 4TS1A 4LK2A 1TT7A 2JGFA 2A14A 4ESOA 3NVAA 1LQUA 1RHQA 3Q7TA 1DWOA 1EUZA 3N71A 5H5JA 4MUMA 3M34A 2A6PA 4RCZA 4HLEA 1EYZA 1JYSA 2CKDA 4FSDA 4R6XA 2A0WA 2WSYB 2BE7A 1DFHA 2HR1A 4B8AA 4DJAA 1CK4A 3TLMA 2I4TA 2A5JA 3JVIA 4DR5B 3QK7A 2PZLA 3D3WA 5AO9A 4OQMA 3DBVO 3OOJA 3PEVB 2O20A 3LP8A 3LXMA 4JD5A 2OHGA 4UHKA 5AKKA 1RQ2A 2C7VA 2XVAA 2Q41A 3K0SA 4FFVA 5CBOA 3LAWA 1JJVA 3SEQA 3N8HA 1HF8A 4DLAA 3K4QA 4BZPA 4R6WA 1U1GA 1GFSA 1JPVA 1RIFA 1Z4NA 4LWQA 3DC2A 5IANA 4OSEA 2Q07A 1W6UA 2VGEA 3IIEA 5L3QB 5D3MB 4W8GA 1XL0A 1NHWA 5JT1A 2NYVA 4CMEC 1FIUA 2PUEA 1VE1A 2ZI4A 5KQLA 4WA8A 4PPQA 1H2WA 1Z4IA 3U9LA 4U0KA 1B8OA 2NSLA 3CWCA 1WY5A 3VPXA 1HYQA 2AEJA 4M1QA 4JP3A 4Z7OB 2GK7A 1KIMA 1JIXA 4A15A 3KP1A 1YC2A 1EVEA 5EAIA 2FX3A 1J2YA 3AHEA 1X77A 3FEXA 2ZZMA 2PSFA 1UPBA 4HYTA 1KI6B 3LJ3A 5DHRA 4X66B 4DLTA 4TXQA 3L7CA 1G5PA 2IXGA 4YMVA 1D8DA 4J4BA 2WG2A 3O8OB 2CYAA 4BEWA 4ID3A 1CPYA 1M5TA 4E5KA 2O1SA 3L8CA 2UAGA 2VDLB 4ZDKA 2ISQA 4LQ4A 1QIIA 3CURA 5JTTA 3S8MA 3ZXIA 4URUR 4UBMA 1M76A 5KC8A 3HKEB 4C7OA 2HL6A 3KUCA 3GXOA 1U2GC 4N9QA 2W6ID 4E21A 1AQYA 3AIKA 1MNQA 1P1CA 1EX9A 1R8XA 4JVLA 2GT1A 3QKIA 1TMOA 4IIUA 4LQLA 3HZZA 5JNRA 4ADSG 2HOQA 3RHFA 5ICGA 2JB9A 5AW7A 3GOHA 3D3EA 2IIBA 1XTUA 2JI9A 5T4EA 3E22A 4D26A 3PF8A 1M67A 4XM1A 2XCLA 2CEKA 1RKVA 1YZKA 4FUTA 3K0EA 2HSWA 4YRIA 1TZ2A 5E6SA 2CVHA 1NN0A 4NBWA 1YA6A 4YT5A 1MHPA 4CJXA 3T3PB 3PFKA 4YP1A 2REQB 3GNQA 2CD9A 5D5PA 5F1KA 2IEZA 2G9NA 2YRFA 4E70A 4NU5A 5ESDA 2KATA 2CDCA 5DM4A 4LOLA 4GVXA 1IZ0A 2FEOA 1GCGA 1D6MA 2AF4C 4BKQA 4WLVA 4D8WA 2J67A 3FU5A 1UEIA 4NZZA 1Z6GA 4C30A 4PSUA 5JDIA 1V5IA 1UC5B 1ZUWA 2ZXWE 3WKEA 3NZUA 4HQ0A 1YTLA 4BATA 4B4WA 3EXEA 3IDAA 2VSOA 4PYJA 5KJ1A 3LUCA 1HH8A 4UM7A 2Q3LA 5CDGA 4M0DA 1JTEA 3OM9A 1FLDA 3PUYA 1G4HA 3ZHVA 3RKVA 1EDZA 5JJCA 1S70B 1NVBA 3F7NA 4EL5A 3TNFA 3T9BA 2APJA 3LKDA 5BRJA 3A6FA 3H2KA 1SVIA 1NW5A 4DILA 3FUTA 1YIAA 3CXRA 4DW8A 2IUYA 4KB5A 3PFNA 4DZRA 4MJ7A 3L1JA 3P0FA 1DARA 4U4AA 3IX7A 4AS3A 2O48X 1NPTO 4P3YA 3BA6A 4GWKA 1GPUA 3ML9A 2VXYA 2A1UB 2C8VA 3UM3A 2OY0A 4DI3A 2OMEA 1R27A 3FDZA 2XBLA 3AFHA 1PJ3A 3KPVA 3L22A 2PD6A 5AM1A 3EIXA 4HZUB 1XN1A 4YI3A 2PSJA 4I6GA 1LH0A 1W85A 4DA6A 1YOVA 4Y8VA 5AM0A 3KUXA 4REOA 4H0CA 3AVQA 1XZMA 4EB3A 2C0QA 3PEEA 4W9MC 1DG3A 5GPBA 1LTQA 5K8UA 1NT2A 5LZ7A 5JCOA 3P5BA 2VH2A 3BWYA 3G7NA 3HJBA 3BDAA 1H6KA 1HL3A 2IDJA 3B20A 5AVQA 1JIVA 4CM8A 4BNNA 1WNFA 1IB6A 4PC3A 2G09A 3UV6A 3CLUD 4YRNA 1A7KA 2GPSA 3RADC 1PF7E 4KFRA 1DKRA 4TXRA 3ENKA 2WWTA 3ZNPA 2JFGA 1X5BA 2IVZA 2BFEA 3WHIA 1T1JA 3N75A 1TTPB 3R40A 3QVMA 5CDFA 4REQB 3HXEA 4KQGA 5IVHA 3HCCA 2IHVA 1RPJA 2QM7A 2V3VA 1IQPA 1A0OA 1RZVA 5A02A 1TNBA 4JR0A 3C3PA 3RU9A 2VHVA 1E3EA 3AJEA 5EMJA 3AVOA 2V3WA 2HU7A 3PJRA 3SC6A 3PVLA 2Q6VA 1DJLA 2NADA 4JP8A 4O4JF 2Q9UA 3BH0A 1NQWA 3L4BA 2H4FA 2OAEA 2VQ2A 3GRYA 2H57A 1J49A 3EIJA 4DIBA 4N8EA 3QE0A 2WPNA 3JASA 5EE1A 4ZO4A 2YYAA 2W4MA 4M87A 4X20B 3O4RA 1SIWA 2A0XA 3ILSA 3OCYA 3L6UA 3U60B 5CT9A 4DDKA 5JQGA 4EI2A 1BI8B 2VZLA 3VI4B 3PLRA 2PUWA 4H7DA 2WXIA 3LBFA 5HS6A 4G0VA 1XLVA 4QICA 1W5EA 3PGLA 5IEBA 2VF8A 3FLEA 1NVUQ 2IVFA 1DAHA 1S96A 3ROPA 1ORRA 2WUEA 4WXMA 1WCIA 3H1PA 1ZVVA 3WGJA 3PGMA 3UUWA 2DK6A 1HURA 4UNQA 1NW6A 3G5TA 2CF5A 3VR2A 4CMCA 3VR5H 3VNAA 1Q12A 4Q9IA 4JBXA 3FRJA 1Z6ZA 1SHUX 2R8BA 2K87A 4BLWA 2CBXA 4PCLA 2P9TA 5HS0A 3J81A 4D4IA 1ILEA 3BGDA 4JJZA 1VCIA 1T5HX 4U95D 2PRIA 2QA5A 2P0AA 4ZDIA 5CA1B 3GR6A 4WCFB 2PWBA 2CUTA 2WU4A 4IZ6A 5ER9A 3UXEA 2P9YA 4C5BA 1WD5A 5CXXA 3KOZA 1X3LA 3KNZA 2H48A 3ZD8A 3QLUA 4GOND 1EINA 1W19A 2VCEA 2PZ8A 4DR2B 3H5TA 3DLCA 3LRXA 1F2UB 1TQHA 3PQCA 4Q9KA 3W5VA 1TCAA 1XXLA 3AVVA 3VOTA 2GEFA 4TL9A 1XGWA 3OZGA 1EUYA 2O8DB 4DDUA 3KHKA 1W9MA 1GL9B 5IWCA 2QLLA 3RREA 5KYTA 2A0FA 1FZQA 5KOYA 3R6WA 3W5CA 4G8DA 1GT91 4EHAA 1FFAA 1PK7A 4B71A 1QHSA 4FJYA 2CFRA 3EGDB 1JAZA 3TU3B 4KR0A 2A3RA 1V16A 1U7DA 3TUZC 1FPMA 4F72A 3CEPB 4F56A 4PV7A 3EGXB 3I8OA 1NZDA 1TUBA 4Q21A 1SUIA 3H0KA 1MDFA 2AMJA 4IIXA 5ANRA 4BBZA 5JFGA 3SSMA 1NXSA 5F64A 4RLYA 1NNUA 1J2RA 4Z5XA 3CF4G 4Q4HB 1YJ5A 3LUKA 5CT4A 1KERA 3C1TA 4KQJA 2B1IA 2YVAA 1VPDA 3QUAA 2G1AA 3R7DA 3K0CC 4JKIA 4RZUA 5KINB 3DSUA 3D3MA 3QH4A 3CCFA 1UDXA 4IIDA 4NE2A 1PGNA 2C9YA 4ND4A 1YK0A 2W93A 3H9CA 1U3VA 2QJWA 3CUTA 1M7HA 3OFSA 3PGA1 1UN9A 5KOIA 1ORIA 4QTXA 5BURA 4ARAA 3L8MA 2P2LA 3WWDA 4E5MA 3JQ9A 2B78A 5J5AA 1ULBA 5KQSA 5F9HA 1J5PA 3IBSA 1GQYA 3H0CA 4LV8B 4BMDA 2DFNA 2PCLA 3PEYA 3LM8A 5B58C 3T5BA 4EJMA 4IO1A 1U9IC 1DX4A 5DN6A 2OV3A 4BO2A 3PHIA 4QXRA 1BAPA 1Y1PA 2OT3B 5HCIA 1IBRA 1PL0A 4TXPA 1YZTA 4MH0R 4EB0A 4GTMA 4EW3A 1JW9B 2BKEA 1TYDE 1YULA 2EXXA 2JAXA 2FG7C 3WLLA 3F6SA 3ADOA 1F14A 3PQFA 1FYFA 2DECA 4RA9B 3K70D 3IO3A 3NTRA 2HZBA 4N3BA 1RRGA 2EZ8A 1AUQA 3B2EA 3CR7A 1RXVA 1SR8A 3H5VA 1ORDA 4BNTA 5C35A 3WQRA 1BPOA 1FMTA 2IYUA 4Q96A 1W6RA 3QEMA 4F86A 4H6PA 2IKSA 1ZU5A 2XB6A 2C5BA 1W30A 3ZU6A 5KNBA 4HNUA 1ICEA 4KPUB 2GCEA 3IV7A 4RJTA 2BUAA 4LWPA 4GTVA 1V4NA 4U9UA 1WG8A 5EQTA 1TU4A 2V7WA 5ALYA 4M89A 4O02B 4RPKA 1T9DA 5FPHA 4HGZA 1EDUA 4KIWA 4A5OA 2OBXA 3GROA 4EO4A 5JR3A 1N52A 3Q72A 5ERGB 4MWTA 4M7OA 2C4VA 2NSJA 4F5ZA 4EJ2A 1WQ3A 3ZN3A 1RVDA 2YZGA 1L8LA 2ZU0C 4P84A 3SN6A 3EW7A 5H3HA 3WS7A 3A9WA 2ENUA 4I1YA 1WHSA 2WWYA 4WL0A 3K70B 1H1DA 3NDBB 1V3TA 3ESYA 4Y9SA 4WK0B 3TW8B 5G2OA 1PZEA 4JT9A 2ZTSA 2TSYB 4MJXA 2WU0A 1EGAA 2ZJ6A 3WGIA 3NBUA 1LI7A 1U8CB 4IZOA 4GX0A 2DVWA 4J03A 1OFGA 1OW3B 4PGFA 1MRSA 2YQ5A 2E1PA 4CODB 1L2TA 5MGNA 3AKZA 1HTTA 4CM9A 1L8QA 1R66A 3HB4X 1YZNA 2VUIB 3H2GA 4AY3A 2YINC 2QJFA 4EKEA 4KVMA 5EIAA 4FDLA 4PYOA 4BECA 2FX5A 2BRUC 2CLSA 4HNVA 4N3AA 2ZI5A 3JCZA 4CI9A 4LXQA 1U9JA 4BNJA 3QHAA 1H8EA 4LNUB 2G9VA 2XE7A 2CNKA 5D5QA 4FNOA 1E9DA 5JZOA 3ROGA 1DGQA 4CMJA 3ECAA 3MMXA 3F9CA 4M0KA 3GVIA 5AI8A 5IZ4A 3IO5A 4KXKB 4EJSA 3UXHA 2P2GA 1QHIA 1JDBB 2QT9A 1N9GB 1UDWA 2Y1OA 1E9RA 1L5SA 2DMRA 1AX9A 4F5EA 5JS1A 2VJLA 2ECOA 4LJ5A 4ARBA 5ELXA 3W9YA 2XF2A 4LBZA 3MD0A 4EZLA 1S4QA 3FOBA 3CW2A 4GDFA 1DTSA 2ID4A 1K63A 4JA9A 3FTSA 3T34A 2C4UA 3O8LA 2IK8A 2WYHA 5TPZA 2IFTA 3R3ZA 1Y8ZA 2FEWB 1LDGA 1ORHA 5FZSA 1MG0A 2BHRA 5EIDA 3KS2A 4IOLA 5I7RA 4ZOLA 5IJAA 2FO1E 2YYYA 4OMFG 2C2KA 4EI8A 5LLTA 3SI7A 2UVQA 4Z7JA 5FBLB 3VZDA 2J9ZB 1D2AA 1QCZA 2P6UA 4XZ4A 3C7CB 3EXHC 3BPSA 2VTDA 1FUUA 3D4NA 2CWDA 1KI3A 2IOQA 4I66A 2P4QA 1H2BA 2V7TA 4B6GA 2IBTA 3NP7A 3SSOA 4CG1A 3GRRA 5LP1A 2EQ5A 4YLYA 3OQNA 1DHTA 5KPJA 2V5FA 1IBCA 1DX6A 2VF2A 3O2SB 3DLAA 1WA5A 3G2UA 1G21A 3VZPA 1N2JA 2XZOA 3BN3A 1GUFA 3WDMA 2AN1A 1K6JA 3OQMA 1QTQA 3M33A 2IBSA 1DG1G 1VECA 1GY8A 5H02A 4ZO6A 1XN4A 2J6CA 1IN6A 5E95A 1I4EB 1P1RA 1HG1A 4CLHA 2QNBA 3O4JA 3GLQA 4F92B 4LUCA 1PU2A 3UG7A 1ZM7A 4H35A 2CNDA 3LDUA 3W77A 2GW1A 1QP4A 1UOQA 4K5AB 721PA 3U56A 2VGXB 2ZJ8A 3K8YA 2RFLA 3E23A 4XPIA 5KX5A 4YMHA 5BOVA 1GM5A 4BVAA 1HE1C 3U9WA 1VYUA 1ZIXA 2YC2C 1KE2A 1ZESA 4RJ2A 3B9PA 3ESKA 1NA5A 4BOYA 3FULA 1G55A 4E0BA 1SXIA 3BSSA 1R88A 3AP2A 2C2BA 4WGGA 3I23A 2OM2A 4XASA 2DZOA 4KRXA 2VP2A 3VQTA 1F5NA 2PSDA 3H86A 4JLVA 5BV7A 4W5OA 2HJWA 5EP3A 2JIPA 2PGOA 3ZU5A 1WL8A 3WLHA 1N8SA 4FWBA 4V1CA 2PA0A 1IN1A 1IATA 4ZVRA 1EJ6A 5ALJA 5J2TA 3AIIA 2LBPA 4WGFA 1UN8A 3T06B 3FH0A 2GUWA 5E4TA 4MGZR 5A5EA 1EB9A 4A7PA 3BRCA 3HBFA 2R1TB 2AN9A 1KYYA 3PQEA 1YXMA 3R9MA 4N5QA 3HXBA 4FDAA 4NK4A 2GD0A 4XUCA 4QDJA 3PHBE 5L6MB 5J4VA 4S04A 4X1IA 5DE3A 3O4VA 3OIWA 1Q2UA 1VB3A 2SCUB 3JPWA 4YDWA 1CQJB 3DBLB 3SK1A 1ORWA 4TYNA 1JIQA 2EARA 4APOA 3RQSA 5I7UA 1BTOA 3EEBA 3AWIA 3WRWA 4BWFB 1VKJA 2B9VA 2PIDA 2DR3A 2A0KA 4NRDA 1MW9X 4RTQA 2BD0A 1A2KC 4HAWA 1ZIPA 2QVBA 4TLDA 5CEDB 4S0ZA 3UA3A 3TR0A 2GZ3A 2X42A 4YRPA 4L8YA 3SP1A 1BQ3A 4PG5A 3OC6A 1L4GA 2HPZA 5G04C 1XCJA 4U6NA 2AWIA 2A5LA 1B0ZA 4KYTA 4PX9A 2QY6A 2W0SA 3JYOA 1HDXA 3UJ7A 4CTOA 1T4CB 3ULQA 2FWAA 4BRSA 3OBIA 2A5DA 2OGUA 4GP6A 4Z9XA 1A4IA 3PD7A 2E85A 4Y18A 2FSPA 3KAQA 2XF8A 2IT1A 1Y9AA 1MO3A 1N6PA 4HLQB 3KO8A 4JITA 1CR1A 4ND3A 1YR9A 1GL6A 4ROSA 1FSSA 3DMHA 4AZSA 4BNKA 2E5FA 1OX4B 4Q3BA 1DIHA 1UBFA 3LJNA 2FMTA 2E82A 3ZVLA 1GFIA 4XDHA 1KL7A 3QE9Y 4Z4HA 3AKDA 5L3SA 3N5KA 1R9NA 1DOAA 1DG9A 2SKDA 3GQBB 1CY7A 1TF5A 3AY7A 1WBJB 3I8XA 1DKUA 4YTEA 4XKCA 3EJ6A 5IASA 1M8JA 3VH3A 2O8CA 1KAHA 3EMKA 5KQPA 1OFVA 1Q0TA 2XAAA 3H2ZA 2NUTA 3TYXA 1LLUA 4YJ2B 3W3ZB 4UDYX 1VG8A 1O87A 2X4IA 1GQFA 5ALDA 1YU6A 2GD1O 3D43A 4AZWA 1GKUB 1FFWA 2F8MA 4HRLA 5KWDA 3Q3HA 2FW9A 1X8KA 3MB8A 1Q16A 3NALA 5IT9A 3FTCA 4L22A 5H81A 5HIJA 2Q27A 1Q0UA 1A97A 4OI0A 3RJVA 2BTDA 4BNVA 2UZ1B 4PX2A 4Y9DA 5HKKD 4IQGA 4I9UA 3CVWA 1JUQA 4JLWA 4WNGA 2DIWA 1APBA 4EJ0A 4Y6PA 3WGUA 1CE8B 3KEGA 2ZROA 2GTHA 5BSFA 4WI1A 4YJ2F 2W2QA 3H2JA 2R6AA 1DFIA 1ODSA 4LZPA 1FDUA 2QLBA 2H1FA 4PPNA 1MABA 4RG6A 3U17A 4E32A 3QPVA 3W5HA 3QUBA 3ED1A 1FTGA 2WJ4A 1YONA 2YVLA 2JJ8A 2PSSA 2VT2A 4GP9A 2ANBA 2HT6A 1BCSB 1AKWA 2ZBGA 5FRDA 2XQJA 1MQSA 4D44A 1N4SA 4D9CA 1SA5A 1L7OA 3SVZA 5A03A 1MJGA 4AXHA 4GRDA 4ENQA 3JAMA 3CZAA 1IHXA 2JLYA 1EDEA 1Y8MA 5JHHB 4U39A 3H04A 5KSWB 2Z4RA 4YLGA 4PLCA 2XHZA 3FN4A 4YNBA 4MVJA 2J9FA 4GI1A 4OQXA 3S81A 4QECA 3M3DA 5ITZF 5I8ZA 4N82A 3B5IA 4MWZA 5CXUA 4CQLA 4WXRA 2GJ4A 5F4BA 4HEA6 1FVFA 2R5SA 2M98A 2PJDA 4KFCA 4XWYA 421PA 3MKQA 2RH8A 5CVTA 2HEIA 5KZMB 5EQFA 2CJWA 1VJRA 4AJ2A 2O7NA 4CIAA 2ZWPA 4UHFA 1QGOA 3EEYA 1DS6A 1LNZA 3Q2IA 1MZPA 7MHTA 4YAWA 1EVYA 3QU5A 2FUG6 3UT5B 3KIPA 4GPEA 3PZRA 3IPAA 2PTHA 3W8RA 1FMFA 1YRAA 1QOPB 3FLBA 4HFJA 5ALZA 1L7DA 3K0AA 3PZDA 3TL3A 2P6RA 1UPUA 2IY0C 1OT8A 1FJGB 5EQDA 4Q7KA 3HB1A 3EIUA 2H5IA 1NURA 1A5SB 3IOYA 1HT2E 4LHWA 5LP6F 1OPXA 4GA2A 5B1IA 4PYRA 4QQIA 3H5WA 3LHSA 3RIYA 2WJAA 2B61A 1F1BA 2WJ3A 3L9TA 5JMOA 4LFAB 1RD4A 3QPUA 4YJHB 3ET5A 4KXUA 1OH6A 3PRYA 3M1IA 5H4HA 4AY5A 4C6HA 3U44A 3PHJA 4ANFA 5HQTA 1IBKB 3JWPA 3GHHA 2MDTA 2OSVA 3O91A 1KFEB 3C4JA 1XDZA 1LK5A 1R0RE 4O2BF 5JMWA 2NPFA 2FPGA 4MVWA 2XKAA 3DP9A 3F8TA 1P7VA 3EY4A 2A5UA 3GJTA 1Z6XA 2ORVA 3FTYA 3M6MD 2RAFA 5E6RB 2IU6A 9ATCA 1QYDA 4FSXA 2F59A 4EUFA 3L08A 2VNHA 4DDWA 1U5BB 5KTSA 3RIBA 1DJNA 1NVXQ 5I48A 4DLKA 3L8GA 2ZYIA 3M5CA 4MROA 4QSHA 2Z5VA 2P1RA 4RGVA 2VPZA 1UKYA 4L1KA 4UUCA 1U5AA 4OHRA 4JYZA 3OT4A 2EC5A 1EFVB 4HWKA 2Y76A 4LERA 2H5EA 4HG2A 1XZPA 3HCFA 4JC8A 5C7YA 2V7XA 2B7CA 4C4SA 1KC1A 1KYTA 1L4EA 1KO4A 1CG6A 1THGA 1ZOIA 3DZFA 4F3NA 4TLLB 1QR2A 2QN9A 1E60A 3DE2X 4E31A 3GUZA 4NYIR 4UYJB 3P27A 4HO1X 2AHRA 5KJFA 3BDIA 1AK1A 4XOUA 3SFZA 2R4TA 5TQ0B 1BIFA 2RH9B 1G8JA 4RHXA 2I7XA 2P69A 3UKDA 1VI6A 1ZVKA 4U96D 2F64A 4C3OB 3DVQX 3KTOA 1SUAA 1EP1B 3AO0B 2OGWA 1NA3A 1O1RA 1BS1A 2HIMA 1G5TA 1V8FA 1ZOOA 3LRTA 4OFWA 2PQRA 2VPWA 1VJTA 3TE6A 2DUWA 4QWMA 4JP2A 3FNRA 2RGCA 3K9HA 2AUTA 3BH7A 4K87A 3DV0B 4QJ5A 1OC2A 3LQQA 2KCKA 4XW2A 2QIOA 3DXKG 1A9RA 1JB1A 3GN2A 4FLBA 5AUPB 1LSJA 3IDOA 1RYYA 2WXQA 3VJRA 4C0KA 5DIFA 3UANA 3KG2A 5JV5A 2D7JA 4XI9A 4EBBA 1XLTA 3EH2A 1ISPA 2BUCA 3E3MA 3G2WA 4QOEA 4ZCTA 1CRZA 3OMLA 4MI3A 2PD3A 1QSGA 5B1EA 1EX1A 1MAVA 3C1UA 1RNLA 1Z06A 1U8TA 3GGDA 4EY6A 5BSTA 2YY6A 2LSVA 3RRXA 1VSQA 4MP3A 1TJ5A 2JAPA 1YRQA 3O0DA 2FWPA 2WKWA 2J4FA 1DO2A 3L0DA 4I1VA 2BEJA 4MJLA 1UMKA 4ZCLA 2ETBA 2DHQA 2EJVA 3P45A 4RVFA 2G5GX 2H16A 2VZEA 3QITA 2XCBA 1KPSB 1QFJA 1ZA1A 5KOJA 4IDPA 4IV0A 3F90A 1VE9A 2HRBA 1T43A 4ZJUA 1EDDA 5L7YA 4NFLA 1JECA 5HCUA 3DFZA 4OGGA 5HS4A 2CYBA 2ZIWB 1PZGA 5JYCA 4MWOA 2G08A 5DM1A 5DM0A 4G26A 5DP2A 4WLOA 1TMYA 5I7SA 4GZ5A 5DCYA 4CTMA 1UK8A 2DF8A 2ZIGA 3CEJA 2R66A 2JDIA 4MCJA 3TD2A 3IA7A 1BS2A 2P4HX 5JAPA 4DAOA 5HKLA 4YUZA 3MS7A 1G6KA 2QAJA 4IJVA 4KXLA 3ODPA 3ZQKA 3PI6A 2CMKA 4PPYA 2BUBA 3AW8A 1E1QA 5EYPA 4MUKA 2E4AA 4HDSB 1U8ZA 5ALNA 3TX6A 2QK4A 1ZHFA 2H08A 5DSXA 1JBEA 1XWWA 4M8IA 1UM9B 4NBSA 2CZCA 1YL6A 4I4TB 2GX6A 1I7PA 1PL7A 5GJVC 2Y1KA 4OB7A 2IPOA 2ZRBA 3MSCA 4FYIA 2CLIB 4F9EA 3A9UA 2C5HA 1ZD1A 2ZUUA 2IYSA 4C0MA 4B4DA 4DR4B 5F1YA 1TQ6A 1LPMA 4ZEXA 5HUHA 4DWOA 1HMPA 2G76A 2Y1DA 1G7RA 3CY6A 3GVPA 4QPDA 1I32A 4X7RA 1GTMA 4IRXA 4RIFA 4C78A 4OX9Y 1HV8A 1H9AA 2FRVA 3VM6A 3HWX1 5JASA 4ALIA 3AC0A 4X93A 2V74B 2DEUA 4I4TF 5LQNA 4L51A 1P17A 4C4YA 1OCEA 4PSCA 2I3ZA 3ZDQA 2XLCA 3JTEA 1RLMA 1QZZA 1R18A 3VPSA 4TX1A 3F6CA 1DTWB 3NOXA 3TLKA 2WVAA 3KSBC 1OGIA 4HSGA 3P0EA 2QYJA 3DZ8A 1HZJA 2CHVA 2PUVA 4HCJA 5IZCA 1QB7A 4G89A 3WLMA 3DHYA 2C04A 3ZIUA 2CL7X 3CKLA 3W8DA 2W6NA 3QVUA 2MT9A 1N8KA 4WECA 1SC6A 1MC4A 4KLAA 4UHHA 1XZHA 3CBGA 2H2DA 3OXLA 1G4UR 3QOFA 3NM4A 2YVQA 3E03A 1IBMB 2HF9A 4BVEA 1KVQA 1W5AA 2XYPA 2VYIA 3BKXA 1F8FA 4RD6A 3JWJA 1LS1A 4B89A 3KSZO 2PBRA 1P73A 1QB8A 3U4QB 1KJQA 4RV9A 3UV3A 5CFNA 4LYJA 2RFAA 4KT6B 1SUBA 4G2VA 3ZNNA 2YCBA 1N11A 3TLYA 1H94A 2VPQA 1MFZA 1EJ2A 3CA8A 3W2FA 2VQ3A 3QX9A 2QNIA 2M6KA 3PXBA 5JXWA 3KZNA 2O8FA 5E9QA 5D84A 3NC1C 1NBMD 3QUQA 3F78A 1VIMA 4XLTA 3T3GA 5DYIA 3KQOA 4GSKA 4LYFA 5GGXA 3IUQA 5BN5A 3CWQA 1JDJA 4MCIA 3E35A 1N3IA 3HA2A 4FWTA 3OJCA 5K3AA 5BR1A 4B94A 3PFBA 2G6BA 4HNHA 2F3TA 3AEQA 5CT5A 2BEWA 3ICOA 1R5NA 1BN7A 5A3JA 1A4UA 4FFMA 5JQWA 2PEYA 1PGPA 4WZAB 4DBLC 1QIJA 4GR5A 3LYLA 3IV9A 3EIFA 4BZXA 1ICIA 3DHVA 5CXQA 2IZ6A 2CJPA 5E6UA 4YMLA 1KWKA 2RGGA 1QU2A 1VYHA 3VR4A 4CPDA 1PT6A 3MLBA 1YKFA 1Z8HA 3DA8A 5BOSA 2WWWA 1HG5A 3PZBA 3ZW9A 1WUKS 2GBIA 4DX5D 3S7ZA 1ZITA 1TMKA 5JSQA 1LNQA 2ZG6A 1Z4LA 1JT2A 4M9CA 1CTQA 1UDRA 5JD4A 3DMPA 5GTDA 4G1VA 4MMYB 3IT3A 4N9WA 1G98A 5CTJA 2BHSA 4MR9B 5F5LA 3APFA 3FUDA 4F9TA 1ISFA 4WZAE 5H7XA 1L5RA 2VPPA 5KTMA 3DVRX 4DUZB 5JCPA 4CGYA 1QQ5A 2JAWA 4KQFA 1Z2NX 4XLZA 2GEUA 2O0KA 2YFKA 3HCNA 3UB4A 4A3VA 1KZGB 1H8HD 4P1ZA 4R05A 1TEZA 5KWJA 4A8JA 5BWLA 3KZVA 1JL3A 3VNRA 1YDHA 2BBWA 3ZWDA 1KI9A 3D0RA 2EKLA 3NYRA 2WZDA 1NBME 1JMYA 3UJ8A 3QNKA 3EXG1 5BMVA 2VXBA 5B53A 4MKFA 3SFVA 1N2EA 3MGGA 1T29A 3BZBA 5FI5A 4BNYA 5CIQA 3K35A 3MINB 4HGOA 1W1IA 1Z4PX 1PFWA 2Q4EA 5F2EA 2FOLA 2BMDA 4JZYA 3OTHA 2HU8A 3DE3X 2P0EA 1IWBB 3LXUX 4NURA 5LUBA 3COPA 4MDEA 3O1HB 2VK8A 5HJEA 3C3QA 2E3JA 4YRAA 5J5VA 1ZNXA 3QIAA 1EESA 3ET4A 2HXGA 4GL2A 4V3CA 1DIRA 5CYOA 1VMIA 5CX4A 4AUMA 3PU6A 1XD2A 3DL7A 5FLKA 4RW0A 5EZ5A 3CF2A 1FXSA 3EIOA 1U2VG 2B8EA 3M4NA 1Y8AA 3PNKA 1JQLB 4JC5A 4D4KA 3X1WA 1QHHB 2XE4A 3AQ4A 5JD3A 5FD8A 1R6UA 3BSWA 4NNPA 4HWGA 2C88A 4EENA 3NIDB 4KWIA 3T9AA 3P2YA 3TRKA 4YJFB 5E7JA 4OJNA 1X7WB 1TQ4A 3D7KA 1B0UA 3G79A 1JE0A 1T6NA 2NXJA 3V30A 4PXAA 1RBZA 4MQEA 3UENA 1P72A 1AH2A 4FIDA 4MEAA 3BJRA 5CGQB 3ZE0B 3SFXA 1BWRA 3MS4A 3RROA 2OWEA 4I19A 4D8UA 4J91A 3RPEA 3UTDA 3DONA 1QRDA 1SELA 2IWRA 2X5HA 5B4VA 4BFYA 1EFAA 2VT7A 1XELA 5C81A 3DTVD 2QP9X 4GOKA 3QBVA 1X7YA 2F43A 3GDFA 3CH7A 1UIRA 3Q87B 3CVVA 3R1IA 3NEAA 3Q1KA 1W0JD 3BAZA 1T91A 4DMMA 3F6PA 3LRPA 1E6WA 3CK9A 1PGJA 2K2WA 1R6DA 2CHZA 2HMSA 1A7JA 1Z0UA 5F7JA 3TSYA 5LZ4A 1YVDA 3VC2A 2QHXA 4EY3A 2RI0A 3TTVA 3IAS6 4QATA 2IY7A 1YS4A 1SXJA 2WD8A 2ERXA 4XWTA 1C3XA 5EGNA 4FB5A 2IPLA 2WKQA 3IAEA 4V02A 3LKBA 3ZEIA 3NNSA 1T3SA 3HIZA 1JG1A 3P4XA 3FPLA 1WSDA 1KI4A 3VXKA 5CDYA 1X70A 4JN6B 1N0VC 2OQVA 5G53C 2G9QA 3I0ZA 1YMVA 4DCSA 2BLLA 4NYIQ 4TTTS 1AKNA 2QM8A 4ZO7A 5C8YA 1Y7TA 3RSEG 3CHSA 1QQ7A 2QN1A 1EA5A 1IJBA 2Z8XA 4C7XA 3HYLA 1TYEB 5AHWA 4QLBA 4GC5A 2LVBA 4BY9E 5IM4A 3UI2A 1QBQA 5DGCA 4PO1A 1XK7A 2GGSA 1T0UA 4LCEA 3VH4A 4UDOA 1CHDA 5JO0A 3A9TA 4DX6D 2JGRA 3ZYMA 3EX7C 3FFAA 3QVXA 3KKPA 5BQ5A 4KK4A 3QF4A 2I1KA 1CIVA 4Y9UA 1Z26A 2F17A 3HL0A 2AXZA 2OE2A 4PYMA 3A32A 2JH9A 5KSOA 5K3FA 2RK6A 4TWJA 3FH5A 3CLHA 5E3JA 1E2MA 1NMZA 3H0EA 3O3NB 4S2UA 2ZT7A 1L0BA 1K27A 1EXVA 4HRYA 2VYVD 1HRDA 2AOUB 1QX3A 3DE6X 1R0BA 1IY1A 1LRJA 2IGTA 4CDNA 2PG3A 1KC3A 4CQNA 4M1MA 3AFNA 4DPRA 3FFXA 3A6ZA 4OMUA 1C1DA 2OCDA 1XCGB 2IV7A 3MILA 1Y3CE 4JI2B 1ADJA 2OCYC 4OYHA 3JVVA 1GYPA 1D09A 2W5UA 3N87A 1DEOA 5CA0B 4JX8A 3RS0A 2IDMA 5EFOA 3FMPB 2X0DA 3AHGA 3IEVA 1ECLA 4KGVA 2BFFA 3M83A 2J5QA 2ADOA 1AO3A 3DBHB 1I14A 3STXA 3UAWA 4O4IA 2ONZA 4Z0TA 2UYQA 3B3GA 3HFRA 5J3JA 1ISMA 3RHZA 5DM70 1LK0A 3HU5A 3W1WA 1I9CA 1KRXA 3BUAA 2MRIA 4PRLA 3G13A 4U8HA 4PZCA 4WLUA 2DQSA 2ALJA 2OBBA 1MO6A 3DOUA 4K9PA 2DETA 2GF9A 1CY6A 1RYMA 4AKGA 5EVJA 5FZQA 2YHUA 3RRNB 2Z9DA 3WO1A 3U4DA 1YMUA 1SA0B 3NWBA 3OXFA 4HS9A 1ECJA 3PF9A 4HC4A 4RANA 3EA5A 1FRZA 1JHAA 3FYCA 2ETAA 2XAUA 3GWZA 5CA0F 1BHSA 2VDMB 3HVJA 5ES4B 1KDPA 4G0UA 5C1IA 1KFCB 4ZTZB 2GROB 2A1TS 5EE9A 2E4WA 4DCCA 1PSDA 2WUFA 3DXZA 4ONEA 3C6YA 1E1RA 4X6LA 3IBFA 4B76A 1XZIA 3OAAD 2G9ZA 3VBEA 2Q0HA 2Q6IA 2C0PA 4FP9A 4CIBA 1SIUA 1R4NB 3PXCX 1YZYA 2HIHA 3GMIA 4F8JA 4ZCSA 4N8DA 5HM8A 3V1KA 1O6CA 2OD9A 5D3ZA 1A4XA 1XHLA 4QYIA 4BMPB 3WKDA 5K0TA 4IRUB 4MHSA 4R3WA 2QG9A 4L2IB 5F3WB 1U4OA 5FBRB 5E7QA 5KTKA 3RF6A 1KK3A 2BMEA 4MYSA 3KS9A 2DFKB 1UKZA 4R3NA 2QSZA 3U7RA 5DXFA 2WQHA 3HKBA 1MH1A 3HDYA 4ZQCB 1KEEA 3BMNA 2NPOA 1Y1KE 1OBHA 1AXGA 2VNIA 3M6WA 4IKPA 1MCZA 2RHDA 2ERYA 4EO9A 1M2NA 4KSYA 2W6JD 3I12A 4P98A 3H4IA 2R79A 4N0PA 1HDRA 1GUBA 2ODNA 1GLNA 4ND8A 3IVGA 4BUCA 3OJEA 5ILQA 4QPNA 2FZGA 1GRVA 4UUOA 4RGQA 1CUEA 5E38A 4DR7B 4GTOA 2WOJA 4ISBA 2NZ8A 4RNDB 3IQIX 4EBAG 4KH0A 4HJRA 1JDSA 4WKPA 2FJDB 4OIFA 3K0KA 3NRCA 1IDN1 4L5BA 5JO9A 2RMKA 4JBWA 1T4MA 1XAGA 3S68A 3EHEA 3WLJA 4MVJG 2W00A 5THKA 1SEPA 3TBFA 2MSKA 3TEMA 1S8OA 2L0IA 2POCA 3FFLA 2B7BA 4I17A 4UATA 2LW7A 3SGLA 4CT0A 5AI6A 4Q4CA 4HH1A 1JTFA 1CERA 3NHLA 4Q9LA 3S1SA 2WFAA 1ZA2A 4OH7A 3G0BA 3L18A 2QV0A 1LA2A 1V5FA 4IV8A 4IF4A 1NJFA 2VDOB 1SBZA 3MV2B 1CHNA 4MQMA 4L5JA 2AC7A 3H13A 6Q21A 3CUYA 3BH6A 3N2KB 5HZHA 2IITA 3Q11A 5CA1F 3G5AA 3LX6A 1T13A 1VYVA 1JP7A 2ZETA 1WTAA 4ALKA 2ZSHA 2ZRJA 1TU3A 3DKKA 5BYKA 3EUAA 3HB0A 4H2DA 5FQ8A 3PX3A 3K73O 3Q6NA 3L0SA 2ONJA 2E87A 2P6OA 1G3QA 1GR0A 4K5QA 2NX2A 4K6CA 1JZQA 2WHRA 4DYVA 4YVQC 3JQ0A 1NY5A 1AIPA 4YQEA 1WUHS 5I9IA 3QMPA 4WVLA 4GM0A 1QIFA 3FTZA 1BVHA 5HIMA 2ZRDA 4D3FA 1UBGA 4UU0A 4BZZA 1ULHA 5TNXA 4B1FA 3HJHA 4UEJA 2PYIA 3ESZA 3K1ZA 1J06A 2XQKA 4EQ6B 1V11B 3IQEA 3DG9A 1NF3A 1WZNA 1CNEA 3SYLA 1T4GA 5CM8B 5IAAA 4PU0A 1PVOA 2ZUBA 4NACA 3JYNA 5CCLA 2CGEA 3H3JA 2YZ2A 4HTFA 2ILRA 3N6RA 1VKRA 1A2BA 3O83A 4EG3A 1K5DA 2JIZA 1I7NA 1Y6RA 4BLUA 2F8LA 1SFRA 1W44A 3RIEA 1WXGA 1N7GA 3BB4A 4M60A 1YRYE 2DCPA 1CUCA 3PWKA 2Y1LE 3FG9A 2E2WA 2BFAA 3D9PA 4KFTA 2F9MA 4G1TA 4IVPA 3DW1X 3DOJA 3HJNA 1GNVA 1V6CA 3TNLA 4RQBA 1Z5SC 3LP5A 1RWXA 2WFLB 5A7HA 3QM1A 3PQ5A 4PTZA 3RRYA 3B53X 4YRQA 3J80A 4JLJA 4FEAA 4ZAGA 4PQGA 1IHOA 2BVNA 1K06A 1JQDA 1NATA 1OCOE 3IODA 3G0CA 2UU9B 3KAKA 1CRWG 1U0NA 2JFHA 1UK7A 1K86A 4E2YA 4XWGA 1NF2A 4UD2A 1OZGA 3T7DA 4HAZA 2P78A 2BF0X 2XB9A 1Z5UA 3V1YA 2FMXA 2WXJA 2OHJA 2YASA 4JUDX 2CBGA 3QDNA 1JAHA 2JBWA 2NOAA 1R0WA 2FFHA 4PONA 2A84A 1QK3A 3IUPA 5E4FA 4Y67A 4FONA 1LU9A 4TQUS 4CR8A 3JAKA 5KBAA 4EW1A 2I0FA 4B09A 2O8EB 2BFDB 2ET6A 4QFMA 5TGZA 3MJWA 3DMDA 2CN1A 2VWQA 4TMZA 5F98A 3TDKA 5GM1A 1CJVC 1XA3A 1R8JA 2ZB8A 3HGTA 1ZMBA 1EGHA 1LX6A 1JFSA 1C4WA 3GRKA 5LDDC 2P68A 2FKNA 1KMIY 1IPHA 1IFXA 3ONDA 3IAM6 4ALNA 5EMKA 4WFIA 2GZAA 2CZQA 4OQFA 2QY9A 5CLIA 2C5FA 1CRLA 1CNMA 4DKXA 5JVDB 4OQLA 2YHIB 4X8OA 1EHYA 2DHCA 1ZGGA 4AKSA 3OESA 5ESWA 3WOVA 5DHTA 4KHPB 2MOKA 2CSXA 3H2YA 4R8SA 1QIGA 1I7LA 4EABA 2ZDQA 5GMOA 5DW3A 4ZT4A 4FUQA 3A2KA 1RZUA 4JBGA 1RQ7A 5ECWA 2WYVA 5IAGA 1RXSA 3D0QA 2JLRA 4KQEA 4ARIA 4PFJA 1ADGA 1ULAA 1Y8RB 3SQLA 1U2PA 4YH1A 2GPYA 1E0SA 3D6UA 2EQBA 4ZANA 1CJKC 1AXRA 5A4MS 4INJA 5JVDF 1Z4QA 2Z2JA 2LCQA 5I7OA 2OO3A 3HRKA 1QGED 3RCBA 3G88A 1FRVA 3KQNA 4AN1A 1I6LA 3ZYLA 4AMVA 2J8ZA 5T8KC 3VLDA 2NO6A 4ZA2A 2B3TA 4GMXA 4P86A 5FTKA 4HKTA 4L85A 1GXSA 4MO9A 4HZIA 4X8QA 2ZIFA 2X40A 4FYHA 5K4HA 5GJCA 3LBYA 1YQWA 2PYDA 1RKUA 1T8RA