4GZ3A

Crystal structure of human o-glcnac transferase with udp and a thioglycopeptide
Total Genus 279
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
279
sequence length
715
structure length
695
Chain Sequence
PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKHIYDNRIVLNGIDLKAFLDSLPDVKIVKNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 279
structure length 695
sequence length 715
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz3A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz3A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gz3A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gz3A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gz3A03
3CEHA 2XPIA 4GCOA 1Z62A 2QN3A 2X0DA 1E4OA 2HO1A 3EBOA 3MS7A 1IXYA 3IAAA 4JA7A 2AMVA 3U4TA 3S2UA 2XCCA 2FFRA 5KJMA 3L01A 2O6LA 3BCSA 3RIBA 3L79A 3MT7A 2IFUA 3BCRA 4MHOA 4YVOA 2XCBA 2ASVA 3CUYA 2VCHA 3PDNA 2X0EA 4XI0A 1RZUA 1NLMA 3MTDA 2YJNA 4UI9K 3RSCA 4G25A 2XCUA 4FKZA 8GPBA 3NCHA 4U0ZA 2F3QA 4GCNA 1NA0A 3CV0A 3RT1A 2X6RA 2UWJG 4AM9A 4BTAA 4BQIA 5ARFA 1A8IA 3KS2A 3E3NA 2X0FA 3CKCA 4GYOA 2PYDA 2QZSA 1GPBA 4HOTA 3S0JA 4NC9A 2GM9A 3MV3B 1H5UA 4JA9A 3OY7A 4AN4A 4GA2A 3ZCSA 3ZCPA 1JIXA 3IEGA 4WADA 5FT9A 1J39A 5CCMA 4N3AA 3DDWA 3Q49B 9GPBA 5DU2A 4J8FA 4GPKA 5HI7A 2G9VA 4J8EA 1YA0A 3VDNB 1QKJA 2FO7A 5G05C 2IV7A 2OOEA 3H4IA 1L7XA 3ASDA 2F3UA 2QRQA 5FJYA 3VTXA 3TG4A 1XV5A 3T3IA 4ME2A 3QKWA 3CK9A 5HQ8A 1FU7A 4RG6A 2BFWA 3UQ3A 3S7DA 1WV0A 1PNVA 4G23A 4MI3A 3MT8A 4GYWA 4AY6A 4HOSA 3G2HA 1P2GA 3Q3EA 3MKRA 3TGOA 2G9RA 3WC4A 1L5WA 3TSAA 3QOUA 4LEIA 3BCUA 2KATA 5A7DB 3S7FA 3E4BA 5TVGA 2FEZA 2R4UA 3Q47B 4NESA 5D01A 3NC4A 4EL5A 1UQTA 2ATIA 3ZN3A 1NOKA 3VUEA 3RO3A 2Y4UA 1L6IA 2KS6A 3DZCA 2QN8A 1WV1A 1Z6QA 1F0KA 1P29A 1EXVA 1E1YA 2R5SA 4GZ3A 2YQ8A 3LKUA 3NPAA 3ZHEA 2R4TA 2QN9A 4BQFA 1E96B 4N3CA 3LY8A 3CVPA 4REMA 2ECPA 3T7DA 3WADA 4EQFA 3VDMA 4RG9A 3NF1A 4LEUA 4N2QA 2R68A 3L7BA 3FFLA 1PSWA 1P2BA 1P4JA 3UPVA 4RIIA 4N39A 4UI9J 2WTXA 3ZCVA 2ACWA 3QKYA 1XC7A 4I2WA 5FZQA 1OUVA 2PYIA 3TAXA 4AY5A 4WACA 1Y6FA 4X7MA 4YNDA 4I2ZA 3OXLA 2IF4A 4RIFA 3CK8A 4WNGA 2SKDA 2LNIA 5JTTA 3TOVA 3OY2A 1FCHA 3O48A 1ELRA 2XGSA 1K08A 3GUHA 4X7RA 3S29A 3WXXA 2Y4TA 4YI3A 4J8DA 3CVQA 4BFCA 3OXFA 3L7CA 5M72A 3L7AA 3OTHA 5BNWA 1L5QA 4U07A 2R60A 3MT9A 5G05J 1FA9A 4PQGA 4FZRA 1FS4A 4M7PA 2GPAA 5DLDA 1FU8A 4M60A 5FZSA 1KTIA 3MA5A 4WHMA 3GYZA 2IYFA 1PYGA 2FI7A 3U3WA 2C1XA 4RIEA 3CX4A 3C4VA 2LSVA 4RBNA 5A6CA 3FP3A 3K9IA 3GW4A 2BUGA 3G2NA 3QWVA 3RU0A 1QZ2A 2VSNA 3CUWA 1C3JA 3FROA 4I9CA 3KD7A 4MI9A 1XL1A 4H7XA 3T5TA 1L5SA 2GW1A 4U0SA 4BTBA 1Z8DA 2QN7A 4GPBA 3QWPA 4BT8A 1C50A 3G2IA 4HORA 1BX3A 2KCKA 3AS5A 2IUYA 4CTMA 5KJNA 4BWRA 4I1AA 5JJ7A 3VTYA 2OFFA 3ZHEB 3MS2A 4F97A 3MBOA 2GJ4A 1IHGA 2R66A 3NP7A 4GA0A 3Q3IA 4KYOB 3HBMA 7GPBA 1HZ4A 4G2TA 2SKEA 1AHPA 5JTUA 1SXPA 2IW1A 4U0UA 5LQDA 1ZBPA 2PRJA 3CEQA 2XA1A 1GPAA 3G2LA 4NEQA 3CVNA 1RRVA 3CUTA 2PZIA 4F3VA 3Q3HA 4B94A 3D0RA 2JJMA 4APOA 2QNBA 4WNEA 1FTQA 5TMBA 1NZDA 3ASFA 3CV3A 2XA2A 1XL0A 2GT1A 3BEOA 2GEKA 1TJCA 3AS4A 3PE4A 4Y6CA 3T3GA 1WM5A 2Q6VA 4KQMA 2QRHA 5LCWC 1QM5A 3IA7A 3R9AB 3ZFWA 5CCLA 2GEJA 3CEMA 3UYKA 2PL2A 3EBPA 3LY9A 5BW8C 1LWNA 3HYMB 2UY1A 2FETA 2QN2A 5DIZA 3BDAA 4W6QA 2AZDA 5EX3A 1GPYA 4L22A 2C0LA 2VGXB 3ZCUA 3WAGA 4H7YA 3ASGA 1XKXA 1ZU2A 3ZGQA 3COPA 3NP9A 1QQEA 5G04J 3OKAA 3SYMA 1L5RA 5DBKA 2YHCA 1KLXA 5TMEA 2NC9A 3G2JA 4G26A 4MI6A 2BISA 3O3CA 1HXIA 1RZVA 4CDRA 1HLFA 1AXRA 4EL0A 2QFCA 4RENA 1W3BA 4Z5XA 1JG7A 2J9QA 4A1SA 1WUTA 3QHPA 1KT1A 4GZ5A 3UYLA 4AMGA 2XEVA 2PQRA 3ULQA 3MV2B 2GPNA 4Y6WA 5BT1A 2BGUA 4CGWA 3BD6A 5D00A 4WNDA 4N3BA 2VGYA 4AMBA 6GPBA 3GZ2A 1WAO1 3MSCA 4WUYA 2JLBA 1L5VA 2C9ZA 3QDNA 4F9FA 4NQ0A 3MRTA 3SF4A 1C8KA 1GG8A 3VUFA 4N5CA 2BGTA 2QLNA 3LYAA 1P4HA 2C2LA 1YA6A 3E3OA 1WW2A 3G2KA 3SZ7A 2QRGA 1M5RA 4UI9C 4YUAA 4I9EA 2ZB2A 5EX0A 3MRXA 4J0UA 3AS8A 1JEJA 1GFZA 1P4GA 2XA9A 3T3DA 3EDTB 3LY7A 5FZRA 2H1FA 1XOIA 2L6JA 4AIFA 5KJKA 4BT9A 4RIGA 5D0OD 4EKYA 2F3SA 1IYGA 2AVPA 1PC2A 2MHKA 2IEIA 3URZA 1VGVA 4HWGA 1ELWA 2VYIA 2KCLA 1HH8A 4NRHB 1LWOA 4MHSA 3RHZA 4JL0A 2G9UA 1Y8MA 2AV6A 4EKEA 3Q15A 5JJTA 4GYYA 1WW3A 3RKVA 1NOIA 1YGPA 2F3PA 4CTNA 1IIRA 5AYWD 3S7BA 2IEGA 2KC7A 5JJ6A 1FU4A 2C1ZA 3GPBA 5I45A 3S7JA 4UQZA 5C1DA 3CUUA 1NVKA 2C0MA 5IKPA 3D0QA 5TMDA 2WQHA 2XGOA 1JIUA 4CGVA 2VQ2A 3ASHA 4IN3B 2HYZA 2QRMA 1Z6PA 2I6HA 1Y6GA 1A17A 5CHEE 3BEEA 2VGXA 1XNFA 2HY7A 3D1JA 3OKPA 2VSYA 3QWWA 2UY1B 2C4MA 3ZPJA 3MTBA 1NZFA 2AW3A 4WNFA 3CUVA 4KBQA 3OKCA 4F96A 4RIHA 1SXQA 1UZUA 3OTGA 1FTYA 3TG5A 4GZ6A 3C4QA 3MTAA 2Q7FA 3ZCTA 3CEJA 1F6DA 3NB0A 3T3HA 3GZ1A 3MQFA 4N9WA 1NA3A 4KQ1A 5KJLA 3ZCQA 2XMPA 3S27A 1K06A 1FTWA 4G2VA 2H1HA 3BD8A 4HOUA 3Q4AB 3LCAA 4G1TA 4M83A 4UQXA 4KXKB 5ENZA 3KAEA 1JG6A 2FF5A 1GZ5A 1EM6A 4KQ2A 3MS4A 2G9QA 2KCVA 2XCIA 4HOQA 2JZCA 2PQ6A 3CVLA 3Q5MA 4G24A 4XI9A 5GPBA 2QLMA 1GGNA 2QLLA 1FC0A 4EJ2A 3PE3A 3RSZA 5G04C 3CK7A 3NAZA 3DDSA 1B4DA 5DXFA 5ARGA 2QN1A 3ESKA 4YI5A 3H4TA 2FBNA 2PRIA 3BD7A 1P2DA 2F9FA 3RO2A 1WUYA 1ABBA 2WPVA 3C48A 2E2EA 3ZCRA 4ABNA 3OXGA 1JIVA 4X6LA 4X7PA 2V5FA 4O6FA 1B89A 4HLNA 3CKBA 3LPZA 3MEKA 3MRVA 3HBFA 4GA1A 2QRPA 3HBNA 1KT0A 2FF4A 1O6CA 5LCWJ 4YVQC 2PQNA 4I17A 1NZNA 1UQUA 5HXAA 3SYRA 4N2SA 4RELA 4QLBA 2IYAA 4W9RA 1C8LA 2VCEA 2P58C 4BQEA 2XGMA 1Y8ZA 5EKQD 3S28A 3T3EA 3UUXA 4MRAA 3E3LA 2ACVA 4JHRA 1V4VA 2HR2A 3N71A 3HBJA 4XIFA 2ONDA 1P5QA 1PN3A 3OTIA 3FWVA 4UQYA 1NOJA 5FTPA 4U04A 2X6QA 3JYSA 4CTOA 3AMVA 2VG8A 3L7DA 3DD1A 3OT5A 3RJVA 2SKCA 5D0QD 4LDPA 4MICA 2GPBA 5IKOA 2P6PA 2DBAA 2IV3A 2LSUA
chains in the Genus database with same CATH superfamily
1NUSA 4MKHA 4QDOA 3JQCA 3TLXA 1Z62A 5LZ2A 2BFAA 2WIDA 1TZBA 3I72A 3P9XA 3PFNA 1N2IA 3Q0EA 4MWSA 4UHBA 2HO1A 2HN9A 3H8WA 2L0IA 1XLTC 1QGOA 2TMYA 4I8DA 4G0MA 4HTAA 2QM8A 4MINA 1RXCA 3S2UA 4C88A 3IT3A 2CF6A 2A4ZA 4S12A 5CA1A 3KEZA 4Q4DA 5BN4A 5LXTA 3TLZA 2ZU6B 3A4IA 2P0AA 4JLDA 2BJVA 3FNEA 4UAUA 3S4YA 5CGQB 5CCEA 5KHOC 1GLVA 5CDSA 3BMOB 2X0EA 2J0UA 5K2OA 1XFAA 2XQJA 2P4UA 4LDNA 4X84A 2C58A 1Q19A 1KJIA 3K0SA 2LE0A 4UNPA 4CYMA 1WM1A 2R0QC 1AGYA 4YMWA 1I94B 2EIJE 4GGMX 1R3DA 2FSIA 3EIFA 2ZJ6A 3NCHA 4MRRA 3FOWA 4GMKA 2C2KA 3ENKA 1UZLA 3WIDA 4AM9A 1OBVA 1E2IA 2PXHA 1KE2A 4CLDA 1O5OA 3QWAA 1KDOA 1EDUA 3WYFA 1A8IA 1G98A 3IJRA 3EPKA 3MZLB 3NVAA 1YZFA 2PYDA 1LX6A 2C9MA 2SECE 3BMQA 4Q9AA 2ES4A 4GOND 4BWVA 4WINA 3IQDB 2VJNA 1BXRA 3L0BA 5ALEA 3AZOA 3E8SA 2X6HA 1SHKA 3DT8A 3GFPA 5TARA 1ZA1A 1O94D 1TKRA 3FJOA 3Q3JB 3RU3A 4B7UA 5K0TA 4D25A 3IEGA 4GB9A 1O8CA 4WADA 3MUEA 3BL8A 3KKLA 3HRIA 3TZCA 3V34A 4NPAA 2RHCA 4R31A 3U17A 2JF0A 4J8FA 1HXHA 1LPSA 2G4CA 2VP9A 1HX7A 1M2HA 3U61B 5HI7A 5AMXA 2ZPUA 4DF3A 5HWSA 1ZISA 2PE5A 2VJDA 4YCCA 3TKLA 4IFTA 1QVZA 4I4TF 1OT8A 1QH8B 5F9HA 3ORHA 2LWIA 1RABA 1OROA 1QZXA 4HPWA 4JZKA 1NJ6A 2C4VA 3LC7O 4RSMA 3RHSA 2Z4SA 3KKPA 1JMYA 1NVGA 3DW1X 2QTWB 2CLHB 3RB8A 1KRWA 3LQYA 4RG6A 3TR0A 1Y8QA 4WK2B 1J21A 5AI6A 4ZD6A 4LTNA 5JXIA 1R4NB 1Z7GA 5K3SA 4D92A 4BASA 5AI4A 3UI2A 4AY6A 3TG2A 4HOSA 4CLRA 4V1CI 1UPBA 3MKRA 4P3NA 1I4OA 4EJMA 3JYQA 1WBDA 4ZT4A 3TUJC 1QIMA 4F3TA 3EUVA 1RI1A 3E1SA 1L5ZA 5K0LA 1YR3A 3K8ZA 1YS2X 3TJRA 2AVNA 3TLGA 3L4KA 4WJKB 2V4HC 1XO1A 1LJUA 1YDMA 4JENA 4L5IA 1HDYA 2XQIA 4D8XA 4HNHA 1W93A 1GSAA 3LECA 1WV1A 1ISRA 3A58B 3IC5A 4L3OA 2XS1A 4DANA 2VAXA 5EZYF 3V80A 2I03A 1JE1A 2VJAA 1D04A 2ZRIA 1ECCA 2ZRDA 3QOYA 4WZAE 1GYQA 2CC2A 2XOKA 1CDOA 1RBMA 1SD5A 5D3KA 1CWUA 2OOSA 3HZRA 1PL7A 4AX8A 5DMXA 4GDFA 1D8EA 3QVJA 5H4HA 1ZVJA 2A0YA 4KPYA 5I5EA 1NV8A 2Y3AA 1ZOLA 3KB1A 2P9KG 1S4QA 2QP3A 4PAGA 2ZUUA 1TW3A 1U7WA 4B0OA 4PWYA 2I5PO 2BTEA 2EFCB 5A7GA 4ME6A 1YE3A 4C1NA 3LLSA 5EI5A 4PZ9A 1Z17A 1WXQA 2ZSDA 3R7DA 4BUCA 4XKCA 1E9CA 3C6QA 2WQ6A 3SHFA 1GEEA 1KAGA 3EULA 1EZ4A 4RQAA 5LMUB 4JCOA 4GTQA 3HA2A 4B6OA 1JXQA 3B52X 2FWRA 1WE2A 2J48A 3QW4B 4GPIB 5JEDA 2NVBA 1C7IA 1FXWF 1I5RA 1Z4IA 2QIPA 2VXBA 5FUXA 6NULA 2XZDA 3LPNA 5FYDA 4DMCA 5T41A 2V4ZA 4G3XA 3T94A 3KQWA 4TZ6A 1H1LB 1T2FA 3O48A 3FH0A 4AM8A 3W6NA 2EEPA 2JH9A 3WIEA 3FOZA 1B7GO 3IVXA 4JHKA 3VO8A 1IUPA 3CSFA 3L06A 4G0XA 4Y2PA 3GGGA 1VRVA 2Q6LA 3HVJA 1ZD1A 4UM9D 3S6JA 1N2SA 1C30A 1CTQA 3BZBA 3MT0A 4K40A 2QJWA 4NZPA 3RTAA 5B7PA 2DZNA 4MKTA 3HWWA 2WYVA 2P77A 5E3JA 5ICFA 4ZEXA 3RYIB 3MWDA 4CI0B 5DN6D 5JC8A 1N6OA 1PR4A 2PZLA 4HAWA 4WZAB 5C3UA 1KTIA 3PB3A 4PXYA 4FJ0A 2V0PA 4L74A 4UPVA 1KEWA 4OYSA 2PR7A 1IONA 3I4LA 4GXQA 2PBRA 4QOJA 3O9MA 4NJMA 2WJHA 2JJ1A 4DUPA 2PZKA 3VYSB 4LECA 3IT0A 3FCAA 4MGIR 5PGMA 4EVRA 1NNLA 2R7LA 2DHRA 3GJTA 3GW4A 2TRSB 3DZJA 4OXIA 4HDSA 4RC9A 2DRIA 3P9YA 2FTKE 2QR3A 3LQKA 4F6CA 1Y3CE 3A7DA 5MN6A 2NO4A 4IV5A 4PBTA 1FDRA 1E2FA 3L8YA 1JCQA 1RHRA 3E58A 4UHCA 5AYVA 3SIXA 4UZFA 4UJ5A 1TCBA 3ASYA 3IDQA 1M9NA 4AQYB 3ED5A 3TXNA 4Y9UA 2I2CA 3DBHB 1Q15A 3TRFA 3C3WA 2GW1A 3OURA 1NG1A 2F8LA 2QU8A 4I1UA 4QUHA 1VLHA 2GN8A 3UOGA 2AN4A 4ZK2A 2XXAA 2Q4EA 2X5KO 1K5DA 2HWUA 5DEOA 3U3ZA 3AS5A 4N5DA 2P1RA 3U3OA 2CY0A 3DM9B 4RTQA 5G41A 4HDRA 4JNKA 3SPXA 3PHHA 3RFUA 3GVCA 5B30A 1RBQA 1ULUA 4ZARA 2DK6A 3KL2A 2WLTA 5G0SA 3ABQB 1W76A 1AHPA 5DM70 4MW9A 3HABA 1ETUA 1NXTA 3CZRA 4ER6A 4RMIA 3RVRA 2Q4RA 3WNVA 1KJQA 3TL2A 1Q2ZA 1L5MA 3HB0A 3NV9A 1UBNA 4WNAB 4WRRA 5GOTA 4H17A 4WWNA 4YV7A 2GM4A 1J24A 1DAIA 1JDJA 4QBIA 2DUUA 2PEYA 2YKGA 3FFXA 4G56A 4IJMA 3SQNA 1TYAE 1AWCB 3Q8MA 1KSGA 3F6RA 1TIPA 2JDID 4JMPA 1SU4A 4NMXB 1NC1A 2EQBA 3B6EA 4JPSA 1P2VA 1XKTA 3GARA 4GLBA 4UTXA 3UT6A 4LCBA 4XWYA 1WM5A 1DOAA 3GNLA 4A55A 4KQMA 5E3HA 5AQ9A 4J0CA 3N0VA 3IBSA 4W6ZA 5EUBA 2X7XA 1FP7A 3AESB 5A02A 5KDLA 4ZU1X 5CCLA 1A27A 2BGJA 3EOBI 5HG0A 2ZI5A 1PFYA 2OCAA 2PL2A 4CKYA 1U9IC 2PRKA 1NF2A 3DOCA 4DHWA 3P1UA 2AW5A 1ZS9A 2YBEA 1C1DA 3KV3O 2E55A 4MTCA 1GPYA 1X19A 4LKRA 3IV7A 3G3EA 2FUCA 3N3BC 2CJPA 4BNDA 4WW0A 2NZJA 3GPLA 4C21A 4KXYA 2JA2A 4YGXB 1OQAA 1N8NA 1R12A 2Y1LA 4XTCS 5EUCA 4BEBA 1X9IA 3HACA 3IVAA 4NNOA 3ZN2A 4EZJA 1CUGA 2YWBA 2Y1EA 2QYTA 3OTNA 2GROB 2C5HA 2HAEA 2F8MA 3IURA 3H1FA 4AUEA 5DIFA 2AR7A 2YHCA 3UWOA 5DGIA 1C5KA 1SGWA 1E8YA 1AUQA 1PJ2A 2XEDA 3OPNA 4GI1A 4CV0A 5ETJA 1QBQA 4JP3A 4QNMA 5HF8A 1P9WA 3PXEA 1YZUA 3ILVA 1NLFA 1FLVA 2P6RA 5GVSA 2PH7A 1AXRA 1FX0B 4OXNA 2PZFA 2RAUA 1WMAA 4LHZA 4W7IA 2I4IA 3JQ0A 3FUJA 1W36C 4AVXA 4R9NA 3KAQA 5F5XA 2FFQA 2ZDQA 2CVQA 3EJWA 3PTAA 1OMOA 4CIDA 4ZV4A 4IMIB 5IAKA 3AEUA 3BWYA 4WNDA 3ORFA 4ISBA 1PK8A 1T43A 4DJ5X 5JADA 4OX9B 5LUAA 3TWSA 2YW9A 3CZ4A 4QYWA 1G291 5SY6A 3K9HA 3F90A 5I9TA 4EFMA 2RDMA 1IZ7A 1YI1A 3QDNA 2AYXA 2CXHA 4NATA 3ZXSA 1BCRB 3GCWA 3GMTA 1YR7A 1G5HA 2YYAA 1BKDR 3B3AA 3ORSA 5CX1A 5JD3A 5BVHA 3ADBA 4O2RA 1GG8A 3EVDA 4Y9SA 4MGYR 1K1BA 3GQBA 4E1VA 3LYAA 3AUTA 3WLTA 2C95A 3PNOA 2LCQA 5BUCA 2JGMA 2OGWA 3E53A 5JR3A 1C9DB 4GBJA 3A1CA 1P5JA 4XDHA 4ALJA 2YNQA 1Z2CA 1HDIA 4Q02A 4J0QA 4LDZA 2Z5GA 3IV0A 1ZNYA 2GFIA 1MFPA 4BQQA 1L7BA 4G5YA 5DWVA 1F06A 4C0XA 2Q2VA 4ND8B 1IYGA 1OFUX 2PFSA 2R11A 3MILA 3ORYA 3VVCA 3D6HA 2MHKA 1M2OA 4LYDA 1YC2A 3N76A 2I87A 1M2NA 2IV2X 3G88A 4KO1S 3G5UA 2I3BA 4AY3A 2KJZA 1FSZA 5DGTA 5HTOA 4UYKB 1FTSA 1OX4B 2PLNA 1PVVA 2G9UA 4JSRA 2BKGA 1SQSA 5A9SB 1E9RA 1XJ5A 1BFDA 3DQQA 2C2HA 5DNYB 1IOWA 1Z06A 4LYHA 4HAZA 4UREA 3ESRA 3INRA 1YZQA 3WWZA 2VPXA 3LQ4A 2VQEB 5J2TB 5AYWD 2GA8A 2IEGA 3DBRB 1D4OA 1TT5A 4ZFHA 2GSWA 3OPMA 2AJ8A 3TNDA 2AOTB 3ZWMA 4US2R 1L5JA 1AY0A 3WGHA 5KMGA 3QFCA 4HLLA 2PXAA 4Z3DA 1COWD 2V5QC 1QV9A 2L0XA 3I2GA 1I4EB 5DTEA 4LSZE 1VYVA 2YY7A 1E4YA 1H69A 3ZVRA 1RJFA 2QBYB 2VQ2A 4IN3B 3NALA 3R7WA 3ZG6A 1L4MA 5K3FA 4QZVA 1WTAA 1J8QA 2W00A 3ECCA 1SXJB 1R5JA 1YO6A 4H3KB 4X00A 1P9LA 5LBTA 3L7YA 2ZAGA 1T5SA 1RMTA 1MZCA 3OKPA 3VKGA 3LVQE 1UMCB 2EJVA 5AW2A 1GGJA 2E4WA 2Q3FA 3B6MA 1LVUA 3DS8A 1X1EA 1PFQA 1K4YA 2F17A 3GWGA 1U3FA 3ICVA 2FMUA 2I33A 2RH8A 2O3RA 2EAUA 4RZSA 4BTLA 1NDUA 4DLSA 2KQUA 4PPNA 2QL9A 3CUVA 2Q2WA 4C01A 1PYDA 3EEIA 4QIHA 2Z6QA 4EB0A 4CKWB 3CF0A 3TX2A 3SJCA 3MJVA 4UHJA 1ZIDA 4R01A 4DDKA 4ZI3A 2DSNA 3KUDA 2DT8A 1O9BA 3SD5A 3GZ1A 1YB1A 2C2GA 4KVAA 5JOQA 4N9WA 1HT0A 2GO1A 1S3IA 3KYDB 4GNKA 1CW2B 2PKXA 2Z8XA 3D4IA 4IGKA 3I42A 3ZCQA 2OGZA 4G9BA 1TLFA 3ZOZA 3AEKA 3TLAA 1S0UA 5LP0A 2EGUA 4C05A 2G6BA 3I3NA 5LDGA 4DIMA 3H1TA 4KW7A 4LG1A 1NBIA 5JLJA 5K45A 4I4CA 3KAEA 5LQRA 3AL0C 1L1FA 3ZGOA 1F2UB 2QTGA 1E2HA 4OLFA 1R10A 4GLFA 4I81A 4XQ0A 5J40A 5DXJA 5B1HA 1R4MA 2HBRA 2IZ1A 2WFZA 2AQIA 4YK7A 4BCDA 3K6RA 1Q84A 4DA9A 3ZD7A 1JDVA 4IXNA 3F6PA 3MCVA 2OP0A 5SYNA 4P7GA 1SVWA 3MX3A 3LQFA 4YRQA 2EYUA 4MYRA 4WMLA 3FW1A 5G1OA 2DR2A 4ZQGA 3N2KB 1EGVB 1XMJA 3V00A 3ZR4B 2RJOA 1CUVA 1CBUA 4XPIA 4YDEA 3RJZA 1A69A 3K6KA 1V1MB 2O2HA 4F5ZA 3DSUA 1HZZC 5CCDA 1I3LA 2WJYA 2XWJI 3ZTTA 4GLLA 4BRSA 4FD2A 4Q66C 4Y9RA 4RK4A 2K4NA 4J7XA 3VO2A 3VM6A 1B89A 1L1QA 2X7HA 3HNPA 2OYCA 1T91A 3DONA 3KR9A 3LLMA 3CR8A 4HLNA 9MHTA 2P9IG 4GL2A 2Y2UA 3N05A 3FHEA 3UFXA 5AM3A 5G40A 3IUJA 2JJQA 5EMLA 3OFSA 5TE9A 3OOYA 3REGA 3T5DA 3UK1A 3V7UA 4CKBA 2HDHA 2Z2ZA 3RC7A 1BX0A 3PENA 3W2TA 3O9VA 1T5OA 2XLCA 4MAAA 3ZE6A 1Q57A 4QEDA 1RI4A 4XB2A 4TL7A 3A28A 1RIIA 2IPLA 3I2JA 3UMJA 3MLAA 3TN7A 1X38A 5FPQA 1W36D 3T35A 2HSDA 5HDBB 1BVRA 1V26A 1GNTA 4W9RA 4ARAA 3H2GA 2XCTB 4KBGA 1EFVB 3KSDO 2ODTX 3RS5A 4YV0A 2KHZA 1G8HA 3KB6A 1K7SN 2Y1OA 5EKQD 3KQMA 3APFA 1DRKA 2CXRA 3Q1LA 4J1TC 5TLSA 4DX6D 2VJPA 3HRHA 4BNYA 3GLFB 2WM3A 3KWMA 2XUZA 1FDSA 3IBYA 3KM0A 3W78A 4AYTA 4CR8A 2CEAA 2JLSA 2QV7A 3OSUA 4FNGA 3ETCA 3T7EA 4L7TA 2D1RA 4FP9A 3QNMA 1I24A 3K0CC 4YJGA 1Z4KA 4LQ4A 4OGWA 4KODA 3AC0A 4K28A 4NX2A 3ROXA 3DD1A 4DUGA 2G5PA 3JW8A 1OH6A 2VDLB 1B74A 3FPBA 3QPAA 4PGAA 1HRKA 5BXQC 2YQ4A 5T57A 3VR1A 4DC9A 4YJGB 5JT1A 4NNPA 3Q2IA 2FN7A 3HSKA 3GPIA 4FVTA 4L51A 4P3XA 1H8HA 1HE5A 5A1JA 3NH6A 5JXGA 4ARSA 1TXGA 3VOBA 4F1KA 1T1IA 1XCBA 5C8DA 2ZI4A 4Y2VA 1P1BA 3BM5A 3BUSA 3CO5A 3N2KA 4HN4B 3EBOA 4M0LA 3SC2A 1P62B 2BKXA 1BDBA 2X8LA 2P9PG 3TZQA 4ASUD 5ABPA 4YAUA 4G84A 1IXYA 1H5NA 3AI3A 3L01A 3H1GA 3NM5A 4BGDA 5CDTA 1RYFA 3QJ5A 2YL2A 4UVHA 4FDAA 5DLPA 3IBEA 1UBJS 1N4DA 3GVXA 3MT7A 2K7ZA 3OQIB 4ZT2A 3QENA 4I5EA 2PA3A 3SD7A 1WF3A 2WXJA 4F93B 3B8EA 2FZCA 4RS3A 4PLVA 2PKQO 4S0ZA 4TMYA 1TR4A 4XUCA 1OXVA 1PJQA 4WXRA 4AMYA 5FWXB 1ZK2A 3WNBA 1QU3A 1HBJA 3UJ9A 4JR0A 1DG1G 2H5JA 2NXCA 1W75A 1W94A 4KRXA 1UK7A 4IRUB 1G8PA 4UDNA 1X8XA 1YS1X 1ZB1A 1U8CB 1TMOA 1Z4QA 3L6RA 3PC8C 2X6RA 3IAUA 4KQHA 1HYBA 1OX4A 2V58A 1QGZA 4FGKA 4Q4AB 4UAVA 4W1SA 5H16A 1H6KA 3WIOA 3WR5A 1O4WA 3MTIA 4EW2A 4M7WA 4IW3B 3W6OA 4HYYA 4MPPA 5ITZB 2C5SA 3P96A 5FQNA 2OCLA 2GM9A 5EHQA 4L15A 5KSWB 1FXSA 3O4HA 1BJRE 4KNVA 4BQSA 4M1ZA 4OBBA 1WMSA 1ZM7A 3NJ4A 1NY6A 2E6UX 2VF7A 1K7FB 4M88A 3TBHA 1AN0A 3OIWA 2V7XA 1Y4DE 4EB6A 5CCMA 3GLHB 1XMSA 1XU9A 4IJ6A 3IVMA 4DLRA 3B20A 5DU2A 2A5UA 2MU1A 2VT3A 6YASA 2PK3A 3CCFA 3LUPA 4ND3A 1LD3A 5FUVA 2OHGA 3C3AA 4LFCB 3Q79A 1IQ0A 2G8NA 1YA0A 3E8XA 1C9YA 3W8RA 1W85A 5FA8A 2R7AA 5ERYA 2C7OA 2G71A 3H17A 4D9EA 1EWKA 5IK2A 3ASDA 3WAJA 1VPLA 4WOCA 1JPVA 2BL4A 4XJXA 1PWZA 1IY8A 3K0AB 4QDJA 4XZ4A 3PRKE 4FBGA 3TQTA 1PR6A 1S02A 1UBLS 1PT9A 4RQTA 4CEIA 3ENWA 4U5QA 1CHNA 1X2BA 1W4RA 2I65A 2NO5A 4WKCA 1DQZA 4M0FA 1OYYA 2ZJ7A 4U2KA 5I47A 3QE2A 1LLUA 5G0WA 1K6JA 3DKPA 3W5UA 4JL8A 3PX7A 4X8QA 1U7XA 2Y0BA 4G1CA 1C7ZA 2VHEA 2D59A 2OHJA 4MRMB 2WVGA 2LV8A 3FKQA 4RZXA 5T3YA 3NM4A 3GIWA 4NYJQ 5FBVB 1QYWA 3KVYA 2A9OA 2P9UG 2I76A 3ZTWA 1M34B 1T9BA 1GL6A 3H5LA 1YE8A 2YWDA 4NESA 2H3HA 1SZAA 1E66A 3P2MA 4E6HA 1UQTA 2YRFA 3T06B 3QELB 2GBGA 4J7UA 2I1JA 3VUEA 4ZYLA 5I6DA 2QU7A 4RPHA 3VLFA 3AWIA 3S55A 2JASA 1IN4A 1DSSG 1L5HB 1PJSA 2CDBA 1QH1A 4FYXA 2XV1A 5F3RA 5A4JA 2DETA 4M2LA 4EBBA 1ADFA 2GRQB 5SV2A 2IXDA 3GRZA 1FSGA 3OTOB 1OH8A 1F7VA 3FHLA 4LOHA 2NU7B 4BNJA 1S0PA 1ZH0A 1DTEA 1WQ4A 2O3SA 2R8EA 1JEYB 1O54A 1XTQA 2EQ5A 4MWEA 5CPFA 4FEYA 3T7DA 4C6TA 2DQKA 3LW8A 5JANA 4OGKA 2CHXA 4N12A 3W2IA 4JU9A 3CN7A 3ZE0B 1TYQG 1I2BA 4IDNA 4I1MA 3EIEA 5FL3A 3UXMA 3GJYA 1Z4JA 2OFXA 3UPVA 3K2QA 5EJAA 5TXGA 4UI9J 5BOVA 2ACWA 2OHIA 3GCDA 3TO5A 1PLKA 3KALA 1M67A 1M73E 1YA8A 4RCYA 4KH0A 1X7WA 5IC4A 3OQMA 5FOSA 1IM2A 2X6KA 1M2GA 1OLOA 3I2FA 4XOIA 2WHYA 3WLLA 2GN6A 2ZIWB 3HU5A 1N4PA 3OXLA 3I6QA 4ZIRB 4GTOA 4KT6B 1DBIA 2LTAA 4QEKA 4ARVA 2ZBRA 1KETA 4RMHA 2WXLA 1HDZA 5FOQA 4UKDA 1QIFA 3UK7A 4KGDA 3GF4A 3V32A 4DV6B 4AULA 3H1PA 2C7VA 2Y4TA 4IWYA 5EP4A 4PPQA 4MW1A 1TZJA 1O1YA 1K1EA 3RVDA 1VI2A 1RHUA 4BOYA 2IH5A 3A4VA 2JCVA 1USUA 3VPXA 5BNWA 4PSCA 3K31A 4CM9A 5KOHB 4TV3A 3RJ9A 1TZKA 5A05A 3R8CA 3PQ5A 3T5BA 2XXJA 3ZJYA 2ODEA 1FS4A 4R84A 2XI4A 2Y6VA 3TOSA 2WVJA 5DLDA 5U9CA 1VSUA 4F86A 1OZ0A 3L40A 3CH5A 1DAHA 4WHMA 4QREA 2RKBA 4XWKA 3P7MA 2ILTA 5B3JC 3KEQA 4MQ4A 2D7CA 5AJZA 4OMCA 1JNZB 1EM8A 3TTYA 3NEPX 3ZDZB 2DWZA 2AJCA 2XUPA 1I2DA 2HU5A 3WWCA 5KVAA 1J1IA 4NURA 1CS0B 2IFTA 2OGSA 4Y6SA 1Y1PA 1XDUA 4I1PA 1K9VF 1W29A 3QWVA 1Q1EA 1DC4A 3TMAA 4PEVA 3AJIA 4KWEA 1ZJWA 2RHLA 1XCJA 2QKYA 5LZ5A 1NXSA 4IQ8A 1AD2A 1ABFA 2HREA 4ICIA 4MDHA 1RQPA 1U6JA 3T5TA 1L5YA 1UKVY 3PPVA 5A0FA 4CTOA 1YCHA 3EHDA 3K09A 2WF9A 2PGOA 4HQ6A 5EQJB 5K3AA 3KPUA 2AFIA 2BFPA 3ELBA 4KVFA 4Q6WA 1SVMA 3CZAA 2YJTD 1QC5B 4Y2UA 5JJ7A 3H83A 5KYUB 1U9ZA 2EXXA 3KLMX 3NYWA 4GX1A 1FSPA 1YDWA 3LIIA 3PEUA 5JYBA 2P65A 2QE7D 4KSBA 3UM2A 3EXHA 2QTLA 3M6VA 1QCZA 4QUJA 4RUKA 4CYMD 4D56A 2C3YA 3ICCA 1CJBA 3U81A 4DNOA 1X3SA 4B5KA 2EF0A 4IVPA 5LZ8A 4IDGA 5JV5A 1QP7A 1A98A 1RHMA 1ZIXA 1ADBA 2P90A 2ZOSA 5LQDA 3C97A 1ESCA 5J59A 1U11A 1PIWA 3BG1B 1CUYA 1V35A 2CXTA 2IA5A 2WOJA 3ENQA 1V48A 4R0MA 3THXA 4TXRA 5CLHA 2PGDA 3VZPA 1SCAA 3LCUA 2QZPA 3MWGA 1E2EA 4B94A 1OXMA 3H7AA 3GFOA 1QH9A 4Q3EA 4UUOA 3ABKE 2GBLA 2ZYWX 3N07A 3ZDDA 1Q17A 2CFUA 4CEHA 4TMFA 1GAWA 4B47A 3HS3A 1HC7A 4YDYA 2X2FA 1L4YA 4ABTA 1QTIA 2PVCA 4ENSA 1TOAA 1I0IA 1NVXQ 1ZSVA 4NR0A 2RGEA 4QFDA 3RW9A 1IB0A 2WMOA 1ILWA 2CMHA 4OU4A 3VZCA 4JXJA 2VP5A 2Z08A 5IDQA 3SC6A 1IBRA 2FWNA 2QVXX 3ZFWA 3A6JA 3DEZA 4BP8A 1YACA 3UTDA 3OCJA 2LP4Y 4PC2A 1Q21A 4DQXA 3UMVA 3HJBA 4UNRA 2Y1LE 1E5VA 3AF0A 1HA3A 1TAHA 3NT2A 4Z1MA 3MTEA 4P0PB 3B1VA 1GM5A 2WHXA 3A1NA 3K9QO 5AI8A 3TTVA 1UOQA 2HQRA 3K9NA 1F5NA 2IYYA 3TGWA 3BVPA 1N7JA 1ONPA 1EHYA 1EFLA 1H0HA 2H8GA 3NHRA 5G1PA 5BQXA 4YWJA 1RRGA 2CW5A 2I4MA 3TK1A 2X1HA 3QK0A 1JZSA 3SS7X 1OH7A 4UYKA 1ENZA 2ZE6A 3KVVA 1XTIA 4KOEC 5I7HA 5JROA 3CO0S 5DBKA 3HJTA 3X1ZA 3NYQA 3UWDA 3AG1E 1JV2B 2I2DA 4R3NA 2HRDA 3HR7A 4UZSA 4ZOAA 4C7OA 1PI3A 4UNIA 1IJFA 3BB4A 5KJ6A 1RZVA 4NI5A 3DZIA 2NNLD 4RWZA 4YFVA 2GKSA 1P1IA 1IY2A 1HYGA 2FWIA 1E5QA 4P5EA 2XVXA 1VE9A 4CIWA 4M0EA 4TTTS 4B4UA 4Z5XA 1ZL2A 1KYXA 1Q14A 4P31A 2GAJA 5CHEA 5HQ3A 5C7IO 1UOHA 4AY2A 3I4RB 2BEVA 1GGKA 1Z6ZA 2PKWA 4OQEA 1N3YA 2GPNA 2R4QA 3EBLA 4ZFNA 3B70A 2G72A 4B6EA 5JAQA 3J5QB 4KFTA 2V8SE 4ZI7B 3EHNA 2VGYA 1L7OA 1T8TA 1Q1QA 5DP2A 4GRDA 3DPDA 2F48A 4L9WA 4PSVA 3MSCA 2C42A 3SP1A 2XJ9A 4URZR 3C5RA 3W9BA 3RRMB 1I32A 3OHMA 4I7EA 2HO4A 3VQTA 4DPKA 2JLYA 4MUEA 4WOBA 4DCUA 1DOHA 2JRLA 2QIOA 1WBJB 3CH7A 4XRGA 1FNNA 1G2QA 2VAWA 5JBIA 2BGTA 3QLUA 4FEGA 2ZWPA 5BNTA 1U5CA 4NU6A 5EQFA 4MGZR 4RPIA 2F59A 5JJ5A 3BH7A 2WJ4A 4Z0TA 4ZAFA 1EB8A 5AKZA 4RNCA 4DV5B 3G8YA 2YY6A 2HUNA 3D6JA 5LU8A 2Y68A 2G6TA 3EVCA 2BHRA 1E1RA 2RGNC 4N0MA 3TBFA 2G67A 3SJBA 3VGPA 5KU7A 3HCCA 3NUGA 5KCMA 4IX1A 4QODA 5D84A 6PFKA 4JVSA 1Y1LA 4HWGA 1JYFA 4AJKA 4CEMA 1HGXA 1EUYA 3ZDAA 2WXMA 1JSCA 5D66A 3SDBA 1CRPA 4N76A 4OI1A 3RRUA 3MLBA 2IWHA 1V7ZA 4KIFA 2CYAA 4R05A 1UZMA 1EFTA 1X7ZB 1Y63A 3QFHA 4Q3NA 5FRDA 4CL0A 4RTLA 3NWEA 2C7PA 1UN8A 4Q39A 1BZYA 1UJNA 1D5CA 3G2OA 3EPLA 1WW3A 1JU4A 3Q6NA 1WDWB 5LXTF 3LGSA 2A1IA 4UUQA 1NVAA 2I7VA 1G5PA 4AKTA 1KZGB 3ME5A 4WD3A 5A0TA 3G2WA 4KIWA 4YJ2B 2OY0A 3S7JA 1QR2A 1R4NA 3OLCX 2JBHA 3ADDA 2NVUA 3CUUA 4ALNA 2F43B 4F85A 3SK0A 2H1SA 1U5AA 5TRTA 3ZVLA 2H4HA 3ZY3A 2Y1GA 1ZHHA 1G8JA 2QG6A 4GKAA 4MS3A 5LA6B 4CKEA 1CP2A 2Q3MA 3R3WA 4WXHA 3NWBA 1O0CA 1DQSA 4YDHB 1EWVA 1KIAA 2QRMA 3CNLA 1BGVA 1LQ2A 2NVUB 1N3BA 3DCNA 2J7PA 3HKBB 5CHEE 5LUBA 4BC0A 5ECYA 4BO0A 5M29A 1IVSA 4L4YA 1I5EA 5E9AA 4UFPA 2QTMA 3MGGA 3TAUA 1GXSB 5JC1A 3PT9A 3QARA 2Q4TA 3OE1A 1P9RA 2WYUA 4Z8XA 4FADA 1EKXA 3PKIA 1SOMA 1EFVA 3I8OA 2D1FA 1RC8A 5C81A 5PNTA 4BSXA 2VAVA 3VLEA 1RAFA 3LOQA 1JJIA 4AWBA 2V0NA 1V6SA 3RARA 2JIBA 3O38A 1SC9A 4DS3A 3WYDA 5M5BA 4TKLA 4E85A 5DMHA 4M1TA 2PZBA 2BRUA 1Z83A 2IHJA 2QVZX 1RXVA 4LX0A 4KGVA 4E08A 1RCFA 1BWRA 2C4TA 3SOZA 2DXIA 3DUFB 1XDDA 1Q1GA 3RD5A 3ZHSA 1O0SA 3GJRA 4C6HA 2I4RA 1W8IA 3S27A 1QHGA 3G1WA 4I9UA 3RS8A 1OC4A 1CJMA 2W22A 3Q7FA 3ONFA 3R3XA 3L0DA 4O4HA 4Y0VA 1DC7A 2H1VA 3E2MA 4J3FA 4QYXA 4JI1B 1TEHA 5JS7A 1JG6A 1UP4A 2G9QA 4P7BA 4TQGA 1R5NA 4HOQA 5AVTA 1OXSC 4DX1A 2B61A 4W9NC 1XYVA 4LBWA 1PLJA 5ITZF 3FVRA 4U7FA 1VC2A 5GPBA 1C3OB 5BSKA 3BXFA 1PK7A 3MCWA 1QX3A 3FH5A 1WHSB 2ZBEA 3ETJA 3OWHA 3NBQA 4L57A 3CK7A 1MV5A 5AK0A 5ALHA 1FW6A 5K99A 3CU5A 4WGGA 2BFBB 2QN1A 1QAQA 3I6ZA 5CURA 2DHEA 5FTLA 3NUZA 3U4DA 1D1SA 1PJTA 2QVBA 2OG1A 3H6GA 3AKDA 3M6WA 4B46A 2KX7A 3ORQA 3A3OA 4ZVLA 1OXXK 1NL3A 4EGCB 2PH3A 1WUHS 4DX7D 1G0NA 4D02A 3P27A 3ROZA 4OYYA 3OZRA 3OLXA 2J3KA 5JUWA 2WLSA 3E9MA 4DY4A 1WHTB 4FCTA 3EHRA 1JEOA 4FYKA 4NCHA 2QRPA 1I1NA 2IEYA 5LSAA 1ZGHA 3R3VA 1E79D 3E5MA 1QHEA 1V37A 2R44A 2WMOB 2P2CA 2PMWB 5EFOA 2EIKE 1PY1A 4IF6A 5DO9A 4I17A 1PV1A 1NKSA 1JEAA 1IHYA 1LI5A 1ND5A 2FX2A 4HRLA 5C5CA 1DEKA 3HU2A 2RGYA 4RKFA 1U9JA 1SHZA 1RYYA 4S24A 1KI8A 3HXBA 3QXXA 3ZXUB 4L8FA 4MUYA 5HKBA 3WOVA 3BHNA 1VBMA 2DHDA 5ES3A 2AOVA 2CNLA 1R0LA 2XNDD 5BV0A 1YAJA 1V4VA 1Z35A 1H2WA 1UDXA 3R3YA 4YJ2F 5CR9A 5C80A 3FOFC 3FEXA 1NVDA 3OFKA 1PN3A 2A84A 3OTIA 5BXUA 1FX1A 2C88A 1N54A 1YI0A 2N47A 3D6TB 4YMSA 3L82A 1XYYA 4FFDA 3FNRA 2CWWA 3JYSA 4FCWA 2ZZNA 4EPZA 1HKHA 2CXOA 3A9TA 4CLEA 4PDXA 3WK8A 2A59A 3KE9A 3VU1A 4BIMA 4DNXA 2PS1A 2C0QA 3R5TA 4XD7A 3V46A 3D4OA 3ROMA 3DTTA 4YLEA 1G3IA 2PUEA 1VBFA 5T8IA 3T7IA 2V6IA 1M7GA 2FX3A 4RD0A 4FB4A 5J2TA 1DJMA 2QI9F 3HZZA 4OKSA 4EF4A 4KMSA 3OOJA 4AUKA 3IAAA 5JJCA 4MVJF 4BV2A 5ECDA 1DAFA 1W0JD 1AUXA 2HC9A 3JALB 3RIBA 3N28A 4JJEA 3TNFA 3JQ6A 4YVOA 1GAQA 1KHHA 1NFFA 3CUKA 3FHCB 3PC6A 5CM8B 1NTOA 3RNLA 3VZSA 5BMVA 2EJBA 1XE3A 3IAS6 1Z16A 9LDBA 4FKBA 4R9SA 4EG4A 1L9KA 1MJGM 2XODA 3D81A 5LJIA 3IKTA 2IEZA 2WZCA 2VPQA 2ZGDA 3JQEA 1SZDA 4A63B 4KO2S 1LXCA 3IP9A 2OZEA 2FFJA 4B4DA 1PBNA 4AJ9A 3ZQUA 5K0EA 3HKEB 4E2FA 3QKIA 1SNYA 1SKAA 3V2GA 3ZJ4A 3IP6A 2BBOA 3CV0A 3O1LA 4WDRA 4BDTA 4V1CA 2R6R1 1XEAA 3D9MA 3N8KA 3UWSA 5J4KA 1UG3A 1W4CA 2HHCA 3JQFA 5IN5A 3VJKA 3VSDA 3CM0A 2PCJA 1NU8A 3QAQA 2NV0A 3FPEA 2QZSA 2HK6A 3IRUA 3KLOA 4DBZA 4F46A 1VFNA 5HZGA 2G04A 4JCCA 3AR2A 4X85A 2YOFA 3UPTA 2SCUA 5HMMA 5AT1A 1F2TA 5H7PA 1UDWA 2WOOA 5DH9A 2XZOA 1UWCA 2RARA 1XTKA 3QA3E 2QD2A 3GJXC 3JASA 2AKYA 5ILQA 1MB9A 3KOUA 3L1HA 4CW7A 3E0QA 3F1LA 2NTNA 3R9KA 4A1GA 1WULS 2OHXA 1OBOA 1CUEA 2PD3A 2Q50A 3EG9A 2QVYX 3ZCXA 4JNCA 4DQLA 4HUTA 4XR4A 5F7XA 2QMEA 2QR5A 5EJGA 5HA5A 3WGJA 5IYZB 2QI9C 3A9VA 3STXA 5IKXA 4BBPA 1EUQA 4C76A 2L69A 4OMUA 5B6JA 1F1JA 5EILA 4P4SB 1WO8A 3MELA 3A6EA 5CRIA 1L5KA 2QTNA 1AZTA 1M2VB 4RDCA 1FX0A 3UMRA 2AJDA 3K9LA 3THXB 4Q3OA 4JWTA 1T9ZA 3SFTA 4BATA 4XLZA 2Q8QA 5DYTA 2HNBA 4ZCLA 1VE5A 3UZUA 2QN6A 4QRIA 4L4SA 5EE9A 2OT3B 2PLWA 3G49A 3HN6A 3JQRA 3NASA 4MUKA 2G06A 5B2FA 2Z2XA 3EQ6A 4ZO4A 2H2HA 2ECQA 4AD8A 4C29A 2RKKA 4QATA 4DYVA 2ZI7A 1JPNA 1JVSA 4HCJA 2OBFA 2DHCA 1QRRA 3CGGA 1SXHA 4TSFD 1JALA 1YQXA 821PA 2JI9A 3CLRD 3GT0A 5FNVB 2EJWA 4AI6A 3UATA 2DT5A 2IOFK 1C0IA 4JODA 4Q3BA 1CF4A 5I9LA 5FTWA 2L0TB 4MVWA 3L3BA 1MRSA 4V39A 1NOKA 1VL6A 1N5MA 4WAFA 5ESXA 4BL5A 1IN5A 1L6IA 2MR5A 1L4BA 2O8BB 1FNBA 3A32A 1L9XA 3K16A 1U0FA 1ULAA 1VSTA 1U1IA 1BG6A 1Z6QA 4LJ6A 4N7RA 3KOXA 1RQXA 3EVEA 4ZVNA 1LPPA 4MULA 1JQ5A 3RVKA 3TWRA 3GDOA 2JATA 4B2YA 1MOQA 2QTZA 4ZAYA 4FGLA 2I3AA 3IQEA 2R7MA 4FK8A 4NCXA 3GEBA 2GAAA 2NT3A 2NP7A 1A8HA 1F4VA 2EINE 3E32A 2D74A 1DHTA 1IOZA 2ECPA 2O4CA 4EQFA 1C3LA 1CNFA 3OBBA 4FX2A 1QBKC 3RU9A 2I8CA 1HZZA 1RP7A 3PBKA 3QF4A 2AE2A 2R68A 2HWYA 3G17A 4BJ5A 2FUEA 2C31A 3I9JA 4AQDA 1Q0ZA 4LRYA 3TJZA 1GO2A 5DCYA 5SYMA 1RFLA 1W0CA 4NG5A 4X8OA 1E2GA 5REQA 3I9FA 2IZ6A 4I2WA 1HY3A 3KTDA 3R0QA 2W8BA 1SHJA 2AX4A 4FXOA 2JJ1D 4MYCA 2FSPA 3PE6A 4TM8A 5E7IA 4HDNA 1QS0B 1Y6FA 1R9GA 2GCEA 4EKDA 4YNDA 3CZPA 1U0LA 4DVJA 2SKDA 2IXGA 2G88A 3ICWA 4AJLA 4ZIRA 3SAJA 1OWLA 4ATGA 1X1AA 5B7NA 3P0RA 3OIDA 3W5HA 1JLRA 2P4HX 1RQRA 4M22A 3ZY6A 3EFHA 5EPUA 2REBA 2AWOA 5BPHA 5CXUA 5E9QA 1P7CA 1CQWA 2A57A 1NNI1 3FUHA 2FMKA 4BWYA 3UJAA 2REOA 3EEQA 3G2MA 1U90A 3MYRA 4MWCA 3V3KA 1Q12A 2X6IA 3GNSA 3OEEA 4RPCA 4ILIA 4NH4A 4QJ4A 2YR0A 1E63A 4XLLA 1J22A 3RK6A 3U3WA 2EHJA 3J5PA 5JPDA 1LD8A 2I6TA 4G09A 2MYNA 3NTVA 4HRAA 3WMRA 3SU8A 4DG8A 1F8FA 5F52A 4FC6A 4O3FA 3ML8A 3GW8A 5COBA 1H9CA 5TT0A 3ZEIA 1JHQA 5F64A 3DFMA 1KQGA 2P0EA 4WOKA 2IHBA 3SXJA 3SLKA 3RYHA 3KKOA 4AECA 2ETCA 3I5MA 1NIPA 3HDQA 4CKCB 1QG0A 4L8YA 4DR3B 1JR3D 1ST2A 3ANMA 1U8TA 5E7QA 5CP8A 3C45A 4QX6A 1Z2AA 5DI3A 5F3DA 3X1MA 4B5LA 1V2HE 2PKRA 1CUZA 3O0TA 4H7HA 4O4LA 4UAJA 4WA7A 2YMPA 2IOQA 5A4DA 2QTVA 4JYCA 2KCKA 4EVIA 5JJIA 1B41A 2GRMA 1L7AA 4BTVA 5CAEA 3NHBA 3UM1A 3JZDA 5KTKA 5CRVA 1IM5A 3MBOA 1Q5PA 1Y6ZA 3VNQA 1IK4A 2H6EA 3AWDA 2OE2A 3IHKA 3SHWA 2GEVA 1RNLA 3NKVA 3WRVA 5K01A 5D7NA 5GQSA 3V2HA 3DE2X 5FBKA 1TT5B 3ASOE 1XRSB 1GUFA 1DTWB 4FMPA 5LP6B 4W8OA 3CEQA 3H6HA 1CEXA 4K1XA 5IBPA 1A1SA 4KO4S 1914A 3AJEA 2JAUA 2YN2A 1T8YA 4ITRC 3DZDA 4UHDA 4WV3A 3WGGA 2X15A 3PCRB 5ALUA 1JUDA 1K9SA 3LL7A 1MU0A 1W4BA 2WZQA 1Y7IA 1L5OA 2PX2A 3HJNA 4HYQA 3IOEA 4B17A 2C7QA 2HIAA 2ODPA 1YZGA 3K1ZA 5G0VA 1J5XA 1K6MA 2JI8A 4TWJA 2GCIA 1AKRA 2KI5A 1W0JA 3C70A 3QUQA 5EZYB 3WL7A 3I3OA 1Z5ZA 5HUHA 2IK8A 4EY7A 2QEQA 1TJCA 2I7XA 3OX3A 4V02A 3UCFA 1R15A 3AR6A 3DYIA 5SZKB 2Q6VA 2YV3A 4UQLA 3VPHA 5M34A 4EYGA 1HORA 4FGWA 4EY8A 3VVLA 3O7WA 2VTBA 1QGUA 2EQXA 1MP0A 2F9MA 5ENSD 1XAJA 2YQ5A 1QM5A 5DBGA 3ZGNA 1M0EA 5FA5A 2ZSFA 2HM8A 2QD3A 3AFGA 4NICA 2GEJA 1J0CA 2XTNA 4WLOA 1O58A 4DV1B 2GEUA 3TRIA 3IA2A 3TWWA 2GR9A 4KDCA 1A7KA 1VECA 2YN0A 3B48A 3GI1A 3SZ3A 3EU9A 1MD9A 1RD4A 2V6FA 4M89A 5HNKA 2POQX 3C43A 3L8DA 2XIQA 1C2YA 4M6WB 2WG2A 5G4KB 2AS0A 1MIHA 1FSFA 3QLUC 5FBLB 5FX2A 4QASA 2R00C 1XKXA 1NMYA 3EIWA 1L5NA 4RTOA 4GZLA 1E2JA 3BN3A 4A1FA 5GZ6A 3COPA 4QFVA 1KMNA 4YJ3B 4HUQB 1G60A 1GVNB 3MWLA 4KQFA 2OAQ1 5JNSA 4NXNB 2ET6A 1H66A 4H4CA 3IFSA 5KPDA 2OGUA 3G2JA 5F3WB 1TQHA 4HNSA 8ATCA 5AQAA 3GRVA 1X6VA 3LQ1A 1DBPA 4TUMA 2NW6A 3HCBA 3L93A 3ZDQA 3BXZA 2JGRA 4I2VA 4QSMA 3TTXA 1YK0A 4E09A 2IPAB 2JKZA 2VQDA 4EG0A 3R6DA 5IT9A 3ER6A 4TWIA 1W3BA 2ZJ0A 4EO9A 3WIBA 2G08A 5LN1A 2FJEB 1P91A 1PFUA 4TMZA 1UEJA 2XEVA 3FFAA 3HA5A 3FCEA 3R3HA 4RLHA 3IEMA 4P80A 4BCCA 5CG1A 3KZNA 5E6SB 4KQCA 4PYIA 2HU2A 5EXEA 3WMXA 5B2EA 2CFCA 3D9NA 1DWPA 3ESYA 1M8KA 4APFA 1FPPA 2GPYA 1QMOE 1P9NA 3E9QA 5THQA 3G5MA 4O60A 5JWOA 5IN4A 1Y6RA 2Y9PB 3O8BA 2C9ZA 4ERXA 1FRZA 3B7BA 1YDGA 3BUAA 2GPSA 2IP2A 3NDRA 4KN8A 3UY4A 4MVJD 4CMAA 1DIAA 5H1YA 3CBQA 5DBIA 3Q6IA 5IUKC 2FEMA 1PGOA 5EZQA 3O5AA 4B73A 4OAPA 1CB7A 4OKNA 3GPDG 3JVEA 2O8NA 5EWLB 1DT5A 5GJVC 3AO0B 4TTRA 3WMWA 4CEJA 1T0BA 1FS6A 4TUYB 2PL9A 4YMUA 3DF7A 4URWR 1NW7A 1SWWA 1HT1E 3BE5A 1O1SA 4FFWA 3RHTA 4C7VA 1C3XA 3M8KA 5BNFA 1XZMA 4D74A 3DDOA 3WHPA 5LBIA 2FQWA 1TGYA 4EKYA 3WYAA 3P2IA 3ONVA 1W5AA 1N9GB 4HQ0A 2AK3A 2W70A 5CB4F 2RGGA 5EA2A 1OXUA 4CM3A 1XVVA 1S3GA 2J0UB 4K5CA 4GLJA 5G53C 3CKYA 4RHEA 4YDWA 3L8GA 5EKXA 5AOXA 5C8YB 3TFOA 1QRDA 2VAPA 1CEQA 1D2MA 4DDVA 1Y8MA 1Y1SA 2C2OA 1XRJA 4Z1MD 4PRYA 3EG5A 2WJZB 5KWDA 3KR2A 3FFBA 4BAZA 1XWIA 4II2A 2WMNA 4CLOA 3FSJX 3PF8A 5DI3B 3UGQA 5AW3A 4Q9LA 3TDKA 2OXIA 4PS1A 5CYPA 1FU4A 5IJ0B 1PD0A 4GXTA 4O2AA 3TU3B 4UQZA 2XPYA 4OHVA 5C5EA 1UW4B 3TW8A 1BD4A 5JMWA 3JXJA 1KZ9A 3SZUA 4QBTA 3T5GA 3R8XA 3WWEA 1RKVA 2X2OA 3V8NA 3KEAA 2YMMA 5K8IA 4HDRB 1NTRA 1O4VA 2I1QA 3BG0B 3OT1B 1JW9B 2B1RA 2BFDB 1ZXXA 2DY1A 4DT1B 1B0UA 3KZMA 5BSWA 5K0GA 1UBFA 1GRVA 3EXEB 1Z56C 1XNFA 1KMQA 5I7AA 1GAEO 4NCNA 2NPFA 1AZLA 2B0OE 2PUFA 3VAZA 4RV5A 3QWIA 4ALMA 4K0KB 4N5LA 1Z74A 2GJ8A 1KO5A 4NBRA 1I7NA 3QYJA 4QNRA 3VSBA 3KPJA 4HQFA 2BCJQ 1JFSA 3ZE2B 1QE0A 4HYTA 4FGUA 2VHYA 3PDIA 1KY2A 3E3MA 3SFYA 4NZOA 2D7DA 1UZUA 4ZEOA 1JPJA 4LN1A 3LWZA 1VB5A 2COUA 1E2UA 2A4MA 4IMPA 3VR6A 1SQGA 1Q16A 3CE9A 1QSGA 3CCCA 3RK4A 3RVBA 4KLNA 3W9UA 1QMGA 4Z4FA 1CLUA 2QAGB 4BLSA 5ELXA 3PRJA 3N2GA 2QMYA 3TINA 1A9TA 3T3HA 4JB8P 1R8YA 3G2QA 1U0TA 3CVUA 5FB3A 4NY1A 5FUBA 3R24A 4Q34A 1YMVA 5BV7A 1ZVQA 1NWHA 2HZBA 1HI9A 4MCIA 1IM8A 4Q9JA 4KXFB 2BHLA 4XVUA 4L0QA 4MEAA 4MYDA 3NZEA 4EJSC 2HDWA 4HVCA 4G5OA 3NAQA 1W46A 4AIRA 4K9KA 3H86A 4U02A 4ZCPA 2FJPA 4X44A 4FEAA 4U95D 1KK3A 1E1RD 3K30A 4OQMA 2ID4A 4PM4A 4C0SA 4FW9A 4GO1A 1J25A 1MG5A 3L1KA 3NHWA 1YR6A 1G8YA 2YTZA 4TXQA 2B6CA 1SURA 3F9CA 3MW8A 4GBED 4LJ5A 5JSUA 1P2SA 4L9AA 1U0EA 1Z75A 2DUMA 3C1AA 5KQLA 3QK7A 3KTOA 2EW2A 3OETA 3OZCA 5DWQA 3TW8B 1ZUD1 1B00A 3QHQA 2GWHA 3ESKA 1EFUA 1Z0JA 3WKEA 5CB8A 3HJHA 3K0FA 3CXRA 2YWRA 3N8GA 3QKTA 3PFBA 2ZJOA 5EKSA 1OI4A 1BAPA 4EKIA 4B0ZA 3RKSA 1GW6A 1QIJA 2Q21A 4HPJB 1ZMXA 3FDZB 4IIJB 1RLTA 5KDDA 1T9HA 2QD1A 5CDFA 1NJ8A 3BULA 4NWIA 4JLUA 1IJKA 1ABEA 5IAAA 3HGMA 4BX0A 5B57C 1H2HA 4Q12A 1VA5A 4AF6A 4FULA 1GOTA 2H51A 3FVQA 3MIZA 4L5AA 4D4KA 2WKSA 5B4UA 2AEMA 1IZYA 1RQLA 1TIBA 2OWEA 1J0XO 2I91A 5BXOA 2I9PA 2V65A 3TVTA 3ZU5A 4QLBA 1I3NA 1SQFA 4RELA 3FTQA 4A15A 2J49A 1RJEA 2FB9A 4CM4A 3O1JC 4XGIA 3TW0A 4ETMA 3IDAA 1G19A 4WY5A 4IO0A 3TLGB 4E51A 2VP0A 4P0QB 3BSFA 1ZHFA 2ZUEA 3ESQA 4YRBA 3GDFA 1FFGA 1X9HA 3DLIA 3FI9A 1P72A 3K73O 4F2DA 4ZHQA 2IXEA 3G23A 2ZPAA 4DEVA 3QSYA 3DJFA 4Q9KA 3TLYA 3B7TA 3L04A 3IBGA 3DNPA 1Z34A 1ZGBA 4XIFA 1G0OA 3HBJA 3WZMA 4AKSA 4C6TB 2B1IA 1DOZA 2Q1XA 5ERGB 3SC3A 4PHTA 4DUGD 5I4BA 1U9YA 2X6QA 3UXHA 5CDGA 1QCCA 3AMVA 2HL6A 3GJ7A 2WIGA 2V8OA 4NG4A 4B48A 1L7PA 3HU1A 1HF8A 1ZD5A 1Z0FA 4KQIA 4UBNA 3TQRA 3EAQA 3M3PA 6CHYA 2A0KA 5IFLA 1G8AA 4LXYA 3GFBA 4HADA 4G65A 1KWGA 3R7FA 1ZRNA 3CA8A 4LERA 3LL4A 2HA3A 3CEHA 3IJEB 2OB2A 1FFBA 3HYNA 4MAMA 5C8VA 1VTKA 3QVSA 4RW0A 1E4OA 4G07A 4TT3D 1YQWA 1L7MA 1N25A 4XSGA 5J43A 5KOHA 2B20A 2FR8C 1WETA 2AMVA 5ENQD 3EYAA 2FFRA 4M3OA 5AJDA 3QJGA 5B3AA 1P8AA 5DBFA 1PL0A 3GDWA 2G28A 1SUAA 5U4QA 3DMDA 3K0KA 2VJ8A 5FBHA 1W8DA 3AR8A 4MHOA 4DXHA 5AOCA 3INNA 4D8YA 2DAPA 5T4YA 4ZI7A 2YWEA 5AW6A 4R8KA 1Q74A 5F98A 3Q5EA 3SBXA 2FCRA 3DC7A 4KSCA 5KZMB 1NVVQ 1JQJC 3FMIA 4OUDB 4FMCF 4O0LA 4GZDA 4DI3A 1PF7E 2ZCUA 4CDGA 3JYPA 1CRQA 5A9TA 1USWA 3PNLB 3L54A 2GZMA 1JKFA 1G3QA 2POCA 5BPPA 3N2YA 4JKYA 1ML3A 2OVBA 1KNQA 4U2BA 1XMQB 2EARA 4JJKA 4AROA 1QFZA 3PNYA 1IUNA 5ED4A 4LVUA 4MS1A 3A3KA 1BSVA 1GKUB 2QG4A 2D00A 3R5HA 3EGOA 3LG2A 2O1EA 4LUCA 4BLVA 1BWQA 4MXDA 4G8LA 3B6JA 3KTFA 4YFYA 4QPJC 4HDSB 1E64A 2VC2B 2Q9UA 4F5EA 2QX4A 5FT9A 1Z4NA 1JHDA 1J39A 3DPYA 3KEGA 4RFLA 3JD1A 2PUJA 2FLVA 3LU1A 3WLHA 3RK0A 5KNGA 3KQPA 1U3VA 4FX5A 4BGIA 4RZ2A 4HNGA 4OB6A 3DKIA 3DTVB 4XCQA 2D4AA 2YXLA 3AHDA 4NQRA 3AR3A 3RSHA 3H4IA 1BO6A 1Z15A 1BJTA 2GO7A 1R8QA 2R9VA 1L7XA 1YUNA 2W2TA 3EDYA 4QVIA 3U4MA 3HI4A 3I5XA 2FW8A 1G7RA 3FETA 4EEZA 1DV2A 2O14A 2GLTA 5K3FB 5HQ8A 5JZMA 3AIMA 1XF1A 2PMCA 4E5SA 1OC2A 1U7ZA 2J41A 4EA6A 2VQ6A 3PH0C 2B4TO 3PHLA 1XTJA 4L5CA 3AHHA 4S04A 3QU2A 3DD5A 2AOTA 3SIWA 3WTBA 2CNKA 1QX4A 2R8PA 3MMZA 3HUUA 1M7BA 5TQJA 1KYIA 4C3UA 1I1QB 4DIEA 1P75A 3B3GA 1QU2A 2EP7A 2ZIVB 3G8CA 3T9FA 3THOA 3WC4A 1OIVA 3IUBA 4YUVA 1FLNA 1YV9A 3C1OA 1SFRA 2BUCA 2RB5A 3R7SA 4X97A 4EATA 1NN1A 3VOAA 2PT5A 3GZNB 1NJSA 2HJGA 3NX4A 2IHZA 1ZMBA 2GB4A 2R6HA 4R5MA 4GVXA 2E5WA 1Q1ZA 1XELA 2VQ3A 5EIOA 2KS6A 2NSJA 3DGFC 4CKCA 4P33A 5LR6A 1IEQA 1NVMB 5FOXA 4GZ3A 1AKWA 4FDLA 5E4JA 5AM4A 4TN1A 1K0FA 1M6VA 1LRLA 5BQ5A 1Z36A 3M82A 3LTNC 3ZHEA 2CNBA 3BXPA 3GJ4A 4AK9A 3B1KA 5JZ9A 4QM7A 4YONB 2EKLA 3QFFA 1V0JA 3LY8A 4HGYA 4IVNA 5COQA 4MQLA 1EUDA 2QMZA 2Z30A 2G83A 2H2GA 3FYUB 3HNRA 2ZSAA 3LO8A 3LQ2A 4MZDA 3JYOA 4W5HA 1N0WA 2RSFA 1ZONA 3F2VA 3G85A 3ILYA 3DLAA 5IYZA 4LF6B 1YA4A 5KWVA 1EXDA 4GOKA 5J23A 4NDAA 4F45A 4W5RA 4OQ4A 5ICGA 3PV0A 3UV6A 3S81A 3FTEA 1TM1E 2HSEA 3B36A 3B85A 4EQ6B 3K32A 3LUHA 3ELWA 1GADO 1TCVA 5F73A 3JQ7A 3N1UA 1OV6A 3DBIA 4PANA 4HEQA 4QQIA 5EP2A 4URHA 5KJEA 4QGHA 4EH1A 4AKEA 1P74A 1U0NA 2PHZA 5ES4B 2E87A 2R8OA 1K08A 3MD9A 1CF2O 2C9DA 1BN6A 4IKEA 3Q3CA 4BLPA 4DMHA 3EZ6A 5A4MS 4QC2A 3ADCA 1E9DA 4J8PA 3K6SA 3KUCA 4FE3A 2HXGA 4G67A 1BD8A 2E7ZA 3L7CA 4OAQA 3RS3A 1LI7A 1E8MA 3L7AA 3Q8KA 1G9TA 1E3SA 3VR5A 1XTPA 3D6VA 3GDGA 3WLNA 3ZD8A 2IUFA 2V3CC 4EZLA 3KB8A 5THXA 3V4PB 3QVVA 4LC0A 3NTOA 3DZFA 3STWA 3OEWA 4GKKB 2I6SA 5FBQB 5CA0F 2O3JA 3I9NA 3P26A 1L6RA 2Q5CA 1O6GA 5BMVB 1MNAA 1NN5A 1C7QA 5B6PA 1KEEA 1WJGA 3A1FA 3RC2A 3PNTB 1M5TA 9ATCA 2LSVA 2ZU6A 1P6XA 3RV3A 1OXJA 4TSKA 4WZ6A 5GONF 3K70B 2JBWA 3DVSX 3K3PA 5ERXA 2BGKA 5BWCA 4S05A 5D6OA 2P67A 1JEQB 4CPDA 1FP4A 2VDPB 3ANNA 3NHJA 3OZUA 4HMOA 2VR1A 3K9WA 3NVKI 1YRHA 4QPZA 1Q6YA 2AOUA 2YCLA 4AC9A 2BFCB 4ZAGA 1USKA 4GZMA 1H2FA 3VR4A 3F5DA 4DG5A 1IH8A 3W2GA 5JFTA 1C1DB 2F0YA 1U2PA 5HSGA 4BFUA 5KNDD 1T9AA 3GGJA 2BTDA 2HBYA 3KNZA 3KVNA 4FFRA 3R40A 2DWPA 1IMJA 3WV4A 2IUYA 2OBBA 2O3UA 2ZJBA 1E94E 3AUJB 3VTYA 2J9ZB 1SZJG 2IX9A 4JVMA 2V45A 2DECA 2Q99A 4ZHBA 3H0CA 4LDJA 1EIZA 3K9CA 4WN9A 3SBDA 3WJAA 3KTAA 1R6BX 2B8JA 3D5QA 4XWWA 4NOMA 5HRYA 2BHNA 3ECSA 1FT2A 1C81A 3D8TA 2I8LA 2FJUA 2HRRA 3C3YA 1VCOA 3CTPA 1WMBA 4LHVA 5L3QB 4RLFA 3G2LA 1MTZA 3OOWA 4ZQIA 4YACA 3JZAA 3L07A 1T35A 1QNFA 2FV8A 3CUTA 4K6GA 2PX8A 1UP6A 3G0OA 3H2JA 1WOMA 4U9IS 3WLOA 3EIOA 4E5NA 2YW2A 3IVGA 4D9NA 3FDZA 4XB1A 3QEMB 4INAA 1NE7A 3TW6A 3WP1B 4EPVA 4RDHA 2CUTA 5BSUA 4U8GA 2B8WA 5B7GA 1QYCA 1Y7PA 4N5NA 2GK3A 2CLDX 1IN8A 5IP5A 4JOBA 4LC1A 1GGMA 3PE4A 4Y6CA 4MCHA 3AI2A 4OHRA 4C89A 1D03A 1N8SA 2CBXA 4ZDJA 2BM8A 3FIJA 2XDAA 4KX5A 4YIHA 3P0EA 4LNUB 4TL6A 2PGXA 4GW3A 1X86B 2GZAA 3ZGXA 3GFGA 2JABA 1TZMA 1CR4A 4M1SA 4ZANA 3WWDA 1NT2A 1HTWA 3A10A 3A6GA 4DL9A 5AKHA 1E1DA 5EEGA 2QYJA 3SLRA 5L7TA 5AQ1A 5EX3A 4C2TA 2ENWA 2HUPA 2AMFA 3UANA 1L8AA 5H5JA 1QFXA 4EZKA 2AFRA 4D9MA 1U2EA 1E7SA 5ITSA 3THWB 1N6NA 1SKYE 4HB4A 4ROTA 3TR6A 2O5RA 4NDNE 2KYRA 2B7CA 2X1LA 4XUGB 4AB1A 4PRLA 4JDUA 3BIWA 4L6IA 3A3PA 1H9AA 1PRYA 3B9BA 3LP6A 5JCZA 3O9ZA 2E2WA 2WSMA 3FRJA 4J0GA 2WD9A 4IGEA 4LZAA 3WGOA 4K2HA 4F2HA 1XHEA 4RTKA 1XWFA 3WRYA 4BKQA 5I5GA 5KTSA 1KDTA 1R18A 5DHRA 2PLAA 5EE5B 1ZK3A 1CZOA 3ZRHA 3NBAA 3WIVA 5JZVA 1FNSA 4KZKA 1H0AA 2BDEA 3QMVA 4O5AA 1WUTA 1RI5A 3TWTA 3CUEF 2WSBA 5CFQA 3D2AA 5K8UA 1O9HA 2B4QA 4RACA 1QUFA 4MS4A 1JI0A 1S89A 5CGZA 2P3LA 3M6FA 1H4QA 3NOOA 4X1OA 4HP8A 5D00A 2ROQA 5TJ9A 2EIXA 1YQTA 1HE1C 1QIIA 1UF9A 2QJFA 3AT1A 1D6MA 4INZA 5EE1A 4GTVA 1RAGA 2EV9A 4GC5A 4AMBA 4DT1A 4BX3A 4MI1A 4Z9YA 2XD4A 4HI0E 4RJ2A 1E3DA 2YWXA 2QBYA 1Z5GA 5AH0A 4JT2A 4ARBA 1RXYA 1RM4A 4DLNA 1Q2UA 4BNZA 2GRUA 4BFVA 1NXOA 2FHPA 2VLBA 1G9XA 4YRZA 4AUNA 2ZTUA 4BQFA 1YA6A 3E3OA 3SHQA 3AM1A 3FUDA 1OFGA 3AV3A 3BIXA 1T0HB 1PGQA 2EBFX 2UYOA 4YUAA 4XFJA 3QXHA 4FSHA 4LXHA 2EGGA 4C0EA 1P3JA 4Z51A 2PUBA 3OC0A 3QXCA 2V1XA 1FZTA 4KWCA 5HJEA 1WEKA 3H5RA 3ITNA 1V2GA 2J8SD 4QRDA 2AEEA 2WWFA 1FF9A 3CRNA 1NI1A 1EA5A 3BCHA 4KXQA 4FNAA 4WL0A 1L4UA 4YHBA 2XZTA 4RIGA 2B5WA 1IBSA 1GGHA 4RY2A 1X3LA 4U1RA 4WE3A 3F3YA 4AZSA 1YL5A 2HLHA 3H5OA 2WB4A 3AJDA 4A91A 4F5DA 1KVUA 1IPHA 3WXBA 4F8JA 3UQYS 2HXYA 2CLIB 5L40A 3WNQA 4WK4B 1GNVA 1I36A 4IFEA 1K1AA 3IPLA 1P6QA 2YJGA 2OM6A 4FHCA 4AMZA 1CIVA 4DDTA 5A06A 2CNDA 2AYZA 4Q19A 2B9VA 3AH8A 1SUIA 4JQCA 4Z3KA 2K7FA 1YJBA 3I61A 1EE2A 3V1TC 3RFCA 2ZISA 1ZQ9A 1UBSB 4GYYA 4QXOA 1AHHA 2Z5FA 3TE6A 4I8IA 1GUYA 4PG6A 5EL0A 3HEAA 4URVR 1Z7WA 1K8QA 3NXSA 1IUKA 3DEIA 3X3HA 2D0DA 4A23A 1I3OA 1P4AA 3GPBA 3MJFA 2FWBA 4RK5A 4G9EA 5IZCC 3SF0A 3TNYA 1YR2A 1BU8A 5IHPA 5L4SA 2GOYA 4CQLA 4IXTA 4HRMB 1RZ4A 1OI2A 2NAPA 3WE7A 5LKRA 2X5NA 1IHXA 2QTTA 2ZS9A 5HX7A 3HCAA 4LBZA 2WF8A 5JCJD 2R7NA 2VJMA 1XZPA 2P3SA 1NNSA 3CMCO 5CJJA 3T52A 1WQ1R 2PLRA 1DAGA 3IIIA 2BHTA 3K9GA 4CIXA 1HTTA 5K3DA 1EK1A 5JNUA 4PGFA 3EHMA 3GLHE 2XIJA 4TTIA 4UU0A 4RYLA 3WAKA 3TVDA 3MQ2A 3QQPA 3MMSA 3MWJA 1JHOA 1W96A 1I5OA 2MT9A 2Q3DA 4RJLA 2BZ1A 2OXFA 1LPAB 1SKQA 4F71A 5HKKA 1E3TA 3GLKA 4F4HA 4BP1A 4U6QA 4DTCA 1M2EA 1JKXA 2L82A 4RIHA 5AOVA 1YE5A 2SNIE 1QGUB 1SXQA 4N8EA 3KQKA 2RAVA 4KKXB 5DOZA 1Z5SC 4MMYB 3TLCA 3UIEA 1GDTA 4RFVA 1Y34E 2YXEA 2ZB8A 3GY0A 3WYEA 3I4FA 4YCDA 3RJTA 3RPEA 4MDEA 1US8A 2GNOA 4UYJA 4G1BA 5IF3A 2AQHA 1DXYA 4EFKA 2XQ0A 4X8HA 3UUFA 4COOA 4OQDA 2X8WA 3QBJA 5E1OA 1MX4A 3LGAA 2OG2A 2QG9A 5KYWB 4RPJA 1ZVVA 4C20A 2BWJA 1NDHA 1U2RA 3E3AA 3GJ0A 2JVKA 3CF6R 4R6WA 4NOLA 2J0EA 4BV8A 2A33A 2BFNA 3DMGA 3WFIA 3TRHA 2BF0X 1JQKA 2GDZA 2Q45A 4ZT6A 4D9IA 2C07A 1HG1A 3BMNA 1BDHA 3A0RB 3FYUA 1TC2A 1GRQA 2FMFA 2QP4A 3WNDA 1RKBA 4IJQA 1TA4A 4UD2A 2PSFA 3IOCA 3T15A 3W3AH 4O6VA 2HTFA 2X4DA 3ILSA 4WUTA 2WJ3A 1GGNA 2YINC 2M63A 2AUTA 2ZUTA 1Z33A 5EVJA 5JAZA 1GKIA 4DCVA 2VUSA 3C3CA 1JFRA 1GRCA 1Z08A 2YC2C 1TCAA 4O4JF 3DBLA 4D5GA 5KQRA 1MX3A 4ROSA 4JI6B 4K5BA 1N6LA 2C3UA 5DGXA 5KPJA 1RXEA 1BXKA 5KTYA 4QQFA 1OW3B 3DAHA 3UNXA 4B85A 5EDSA 1ESEA 3KT0A 5FPYA 3G9XA 3B1XA 3DWFA 3MM4A 2MSEB 1J5EB 4X0EA 2XBMA 3APCA 2ZJFA 4WFQA 1MORA 1IXSB 4H7IA 2C99A 3LNTA 2GK6A 3D59A 3SEFA 5AXCA 3LSTA 4F3YA 2WYWA 3GCZA 1HFKA 2VDJA 1FFXB 2B2CA 1GTMA 1LJ8A 2DFLA 2HWXA 3A1DA 3JD4A 4GG1A 1NLZA 3ZK7A 5LP6A 1XZDA 4XZ3A 4RD4A 3AEZA 2RKWA 1D5WA 1QUEA 3C5WP 3K2IA 4XGRA 4ZWNA 2AXUA 2CFZA 3DE1X 2IC5A 4XM1A 3TD9A 3TXYA 2BF7A 3NHZA 5AVWA 3BS4A 4JBGA 3IUPA 1N36B 3SYRA 1DUIA 1G4AE 4ZQCB 2B34A 3G79A 1EU1A 5CA0A 5IHXA 3ZXIA 4MS1B 5DT2A 2QGNA 4I6EA 1VLQA 1F3LA 3Q98A 5JA4D 4DYDA 1GUDA 2H11A 1IAQA 1Q3KA 4AIIA 2C2ZA 2C83A 1NZJA 1W25A 1N2BA 2DLNA 3HEBA 4R1OA 2MSNA 2PKEA 4IULA 1T1GA 2OMEA 3WYBA 4AXHA 3ZPXA 4C7OB 3ZDCA 3MFQA 4KO8A 4ZVKA 2QR2A 4MHTA 4Z4EA 1B42A 1SEVA 2HLDA 5JU6A 4E6EA 2FFGA 4JX9A 4X66B 3BWMA 4L5BA 3HI6A 1KDZA 3S3TA 3OQJA 2GNPA 3OWOA 2XRZA 4JUCA 3THYB 3TSCA 2SICE 3EOZA 1X7XA 1EFPB 2GCOA 4PINA 3MMPA 1ZCAA 2P6PA 2OA0A 4EZBA 3UKJA 3S2EA 1BI7B 2OCCE 1QF9A 3LBNA 3F7TA 5E75A 2E5FA 4G0UA 1K8ZB 4QARA 2XPIA 2H1LA 5EZ5A 1MJ0A 1Z0SA 1OF1A 3UO8B 1JCRA 1IQPA 3WLMA 2ID7A 1X13A 2PGLA 2VCYA 4NVRA 4BJ3A 4QT4A 3PT5A 3DVAB 5J4HA 2VF2A 3U48A 1OFIA 5KIAA 1URPA 1K5PA 3P4YA 3QPVA 3BE4A 4WECA 4DV0B 4OU5A 3SSNA 1ZYUA 3RAJA 2WHEA 3V33A 3UK2A 5JCXA 5CA0B 2HQSA 1ZMRA 2V55B 2BKUA 2BFEA 4DQDA 1B8OA 1BRMA 1EX1A 1Y9AA 2H18A 3I04M 4RXUA 4HZIA 4E1BA 5ICSA 3RAUA 1XQ9A 3AEUB 4L6AA 1SIOA 1EFRD 5AK6A 4EI2A 4EWLA 3VAAA 1C0LA 3PIRA 2O59A 2XQKA 2PSHA 4TMWA 3FUFA 1G6Q1 1A95A 2JAXA 4YLYA 3OD1A 2GCGA 4UU1A 5ILOA 1XVLA 2ABWA 2CCJA 2XWSA 4WCFC 3KAKA 2UXBB 2OYSA 1JN0A 3KU4A 3EGDA 4H4EA 3RIMA 3TSZA 3D9LA 1FQOA 3M9WA 4JLOA 3SXPA 1ZOIA 5ENDA 3S2YA 1TNBA 1OYOA 2XY4A 2Z3WA 4H7DA 1E6KA 1G2OA 1V5EA 1VL0A 4YCJA 2W6ZA 1PJAA 4MQUA 4AS1A 4KFRA 3UCXA 5AVRA 2JFUA 5FQ8A 3BFKA 1AU9A 1H2ZA 5K3BA 4MTLA 3SYTA 2WXKA 3ROTA 1CZUA 3CR3A 2FEWB 2XR1A 4JT9A 5KYUA 5C52B 3FHJA 1G21B 1U7IA 4N3AA 3Q49B 1DQYA 2D5AA 2Q6KA 2P35A 1XMIA 2H5LA 3R5KA 2IOLA 4LHEA 4RF3A 4GPKA 2P9LG 2LCFA 1SVXA 1PZXA 4FCVA 4BNDB 5BSHA 3FRIA 5AVYA 3IIEA 2D3WA 1CF9A 1GKKA 2XJ4A 1GR0A 2NGRA 1XXHA 3LZCA 4LQDA 4Q5IA 5FPTA 3UJDA 5CPBA 1CUXA 1V16B 1GSIA 2VZEA 3EMBA 3N2ZB 4Q6BA 3FCOA 4WPGA 1PLLA 3MUNA 4HWSA 1KR5A 1JH8A 1YKSA 3NTLA 4YT5A 3SHTA 1S3FA 2WF6A 4DARA 3O1IC 2HK9A 1X1DA 4JC4A 4N5QA 5KNDA 4ME2A 1FUIA 3G9TA 1RWMA 4KYIB 5AVOA 3G7UA 1PTJC 3MGCA 3Q0IA 4OQYA 4PYRA 3WGIA 2N75A 3J7TA 3S7DA 2DE0X 4DJDC 5JVDF 3CJTA 3ASVA 3EZGA 4BFRA 3RUEA 5EE3A 4POOA 5KREA 2OORA 4JVLA 4WEQA 5JLAA 5F33A 1O6ZA 2FEOA 1XXLA 1ZVMA 4CTJA 3ABSB 1GDHA 3Q9NC 1U1EA 2P5SA 2P9SG 1XEFA 2AEFA 13PKA 2H2FA 2VYNA 3BJRA 3CNOA 4K9PA 3IKMB 1O96B 1VIDA 4N82A 3Q12A 2IHVA 4IJWA 1AA6A 4CKXA 1SKMA 1C9NA 2PSEA 3KJNA 1YVPA 1T13A 2FU5C 1CY0A 3FD8A 4ER3A 1EGHA 3PITA 4V2IA 2VZ9A 3NDBB 1LC3A 5I7VA 3WRYC 1FL9A 3E9NA 5FLYA 2QN8A 1OV4A 2GZDA 5KVCA 2XCSB 1CNEA 4M1MA 3HTXA 2Z2KA 4R1NA 4QU9A 3RC3A 2YQ8A 3RHFA 1FLDA 3F8SA 3ZY5A 2DCUA 2Y0PA 1YOVB 1I6LA 4QHYA 2R4TA 3VU3A 4W9MC 2I55A 2ZRKA 3HRKA 3RSGA 1KKLA 2ZRQA 3O73A 3Q7TA 5IAGA 1HYEA 1II0A 2FPGA 4S1TA 1NF8A 1DELA 3ZV7A 3IR5A 4NOKA 2WQ7A 4CFYA 8OHMA 1CE8A 5DI9A 1LPOA 4IJUA 5DNUA 4C0QC 3QKRB 1E90A 3VDMA 1W2HA 3I0NA 4OXRA 1KH2A 1NI5A 2WWRA 1ND6A 3UOAB 2AJLI 4C9BA 5ED0A 1PW7A 3AB8A 3DZ8A 1ZESA 1MFZA 3DWEX 4DLXA 2BI7A 4G2NA 4LYJA 3AG5A 3SSAA 4J8YA 3DWLG 3QKYA 1IE3A 2AZMA 3H5WA 4M21A 3IKVA 2D0PB 3WNCA 2ACEA 4NE9A 1P9OA 4KBFA 3TTSA 3SK1A 2ZI6A 1MDBA 3FHOA 4HHEA 3KYCB 4ZVQA 2LNIA 1U94A 1T4CA 2I2BA 2W6JD 3HCWA 4KIUA 1TUEA 1QYDA 4X1IA 5JTTA 2CV1A 1J2RA 3S29A 2GJ9A 3ZYLA 5CEFA 3A8TA 3T9KA 3F7NA 2IOHA 2JJYA 1C3EA 1A4RA 4XARA 3ZGVA 1DCKA 3OTHA 1NW6A 4B1FA 3PHGA 1H2EA 5EIXA 4FZ3A 3HMQA 2QUZA 1I2CA 4ZYWA 4E15A 2GPAA 3EQZA 2ZRAA 1FU8A 1YMUA 1EVZA 4OO3A 2APJA 4S2EA 1S2OA 1KEPA 3LOPA 5TT1A 2GQ0A 2ZR7A 1J9ZA 5F12A 4DCSA 3DVQX 3PHBE 2VFAA 4A8JB 3GEPA 5KYGA 3FH7A 5ANRB 4CE6A 1WXGA 3I04A 4DJFC 1WHTA 4E33A 1JKJB 4LZOA 4XCXA 5B4VA 2PKCA 3SMVA 4KXWA 2BTQB 2XNJA 2Q2NA 4DM3A 1ZUWA 2ZS7A 3SC2B 3UXEA 2YBDA 5CYFA 5JQGB