4GZ3A

Crystal structure of human o-glcnac transferase with udp and a thioglycopeptide
Total Genus 279
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
279
sequence length
715
structure length
695
Chain Sequence
PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKHIYDNRIVLNGIDLKAFLDSLPDVKIVKNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/peptide
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 279
structure length 695
sequence length 715
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz3A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz3A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gz3A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gz3A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gz3A03
5LCWJ 4YI5A 2KCKA 2G9UA 3NAZA 4MICA 4MI9A 4M7PA 1FU7A 4CGVA 1Z62A 4U0UA 3UPVA 3AS5A 3OXLA 1GPAA 1H5UA 2FFRA 3ZCVA 3HBJA 3WADA 1V4VA 2IFUA 3NCHA 4FZRA 2GW1A 4G26A 1Y6GA 3CK9A 1C3JA 1FU4A 4RIEA 3OTGA 2BGUA 1Y8ZA 5D0QD 4KQ1A 3MEKA 3S28A 2FETA 2ACWA 3EDTB 3DDSA 3QWWA 1JG6A 2QZSA 4WUYA 3MV2B 2VSNA 2ACVA 1YGPA 4BTAA 3FROA 5D00A 4NQ0A 2PRJA 3URZA 3O3CA 3UYKA 5D0OD 3JYSA 4UQZA 3HBFA 4EJ2A 2X0EA 1KLXA 2C1ZA 2HYZA 3FWVA 3C48A 3LY9A 2OOEA 4I17A 5G05J 3ASFA 1NLMA 3G2IA 1XKXA 2F3SA 3LY8A 4XI0A 4YUAA 4N3BA 2IF4A 1PN3A 3AS8A 3T7DA 5LQDA 1KT0A 3LYAA 2ZB2A 3BD7A 3MSCA 4BTBA 4N9WA 1HLFA 1GPYA 3CK7A 2WTXA 1FA9A 5JTUA 3LKUA 2HR2A 2PQRA 3ASGA 4APOA 2G9VA 4REMA 4N3CA 1ZBPA 4KBQA 4CTOA 1KT1A 5A7DB 3LY7A 3BD8A 4UI9J 2PZIA 1JEJA 3U3WA 3SF4A 5ENZA 2C4MA 2Q6VA 3QOUA 3ZFWA 3GW4A 3OT5A 4MHOA 4UQXA 3VDMA 2VCEA 3LCAA 4GZ6A 4NRHB 4PQGA 4HOUA 3E3OA 3QKYA 2XA2A 4F96A 1A8IA 1ABBA 2F9FA 4WACA 2YQ8A 3RSZA 2P58C 3RSCA 4GPKA 1PSWA 3Q4AB 2IYAA 4HLNA 3Q3EA 2IEGA 1L7XA 1NZFA 1XL1A 2XA9A 1IIRA 2IW1A 5TMBA 3C4VA 3AS4A 2VGYA 1FTQA 2E2EA 4EKYA 3MBOA 3QDNA 3MT9A 2GPNA 2SKDA 3L7DA 3S7BA 1K08A 5EX3A 3FFLA 3SZ7A 2H1HA 3OY7A 4BQIA 1AHPA 1WAO1 5FT9A 2KS6A 1Y6FA 2VSYA 4QLBA 3CKCA 1NZNA 5HXAA 5CHEE 4ABNA 7GPBA 3MS2A 2QRQA 2GT1A 1IHGA 1NA3A 1WV1A 5EKQD 3CV0A 3MV3B 3ZN3A 3KD7A 3E4BA 2LSUA 2X6RA 4H7XA 1WUYA 2I6HA 3BD6A 5EX0A 2VYIA 4LEUA 2G9RA 3MTDA 4WNEA 3UYLA 1BX3A 3T3EA 2PYDA 2DBAA 3L01A 4CTNA 3TSAA 3Q3IA 5HQ8A 1QM5A 2XMPA 1Z6QA 3ZCSA 4KQMA 2GPBA 2FF4A 4YVOA 2SKCA 4GA2A 1SXPA 3R9AB 1L5WA 5KJLA 2C0MA 3T3DA 3PE3A 5LCWC 5FZRA 2AZDA 3NPAA 4HOQA 1Z6PA 3RO3A 2LSVA 2FF5A 3BDAA 2WPVA 3NP9A 1XV5A 1P2GA 1E4OA 5DIZA 4I9CA 3CEJA 3NF1A 3ASHA 4EKEA 1Y8MA 3MS7A 1ELRA 3PE4A 4G25A 3G2JA 3CUUA 2QLNA 4UQYA 3H4IA 3MRTA 3VUEA 4AIFA 2BGTA 4NESA 1C8LA 5IKOA 4G23A 3TG4A 3G2NA 5ARGA 4AMBA 1AXRA 3LPZA 2JJMA 3BCUA 3CUTA 3N71A 3Q47B 3DD1A 1SXQA 1GFZA 3CVNA 1NZDA 1RZVA 4F97A 2Y4TA 1PYGA 4BT9A 5G05C 1UQTA 5DLDA 1NA0A 4W9RA 2GEKA 3OKPA 1E96B 4EQFA 3T3IA 2XEVA 2VCHA 4HOTA 3ASDA 1FTYA 4G24A 2X6QA 2XPIA 3MTBA 3Q5MA 3ZPJA 1L5VA 3MT8A 4JHRA 4J8EA 2KATA 4JA9A 4KQ2A 3KS2A 8GPBA 4WNDA 3QWPA 2Y4UA 4WNGA 3Q49B 4LDPA 4MI3A 1FU8A 4ME2A 2QFCA 2XGSA 1L5RA 2F3PA 1QQEA 4RG9A 3DZCA 1OUVA 4UI9C 3TOVA 4JA7A 2ASVA 2R4TA 2QN3A 3S0JA 2PQ6A 1ZU2A 2AVPA 2FEZA 4M60A 1QZ2A 1PC2A 2FBNA 1F6DA 3T3HA 1M5RA 2YJNA 2QN7A 3CUWA 3RU0A 1A17A 1WM5A 4WNFA 1WUTA 4WADA 4IN3B 2O6LA 1IXYA 3SYRA 4CDRA 3VTYA 1IYGA 2VGXB 1P2BA 3C4QA 4U07A 1P4JA 2GPAA 1Z8DA 3QWVA 1UQUA 5IKPA 3CV3A 1K06A 4NEQA 2VG8A 3WAGA 3D0RA 2ATIA 3L79A 1KTIA 4RIHA 3S27A 3G2KA 3NC4A 1JIVA 3S2UA 3BCRA 1QKJA 2AV6A 2QLLA 5CCMA 3MRVA 5JJTA 4I2WA 2J9QA 1JIXA 3D1JA 4G2VA 4KXKB 2P6PA 3OKCA 2QN2A 1YA0A 3L7AA 4JL0A 2FO7A 2BISA 3OKAA 4AN4A 2X0FA 3AMVA 2HO1A 1P4GA 3IA7A 4FKZA 2LNIA 4W6QA 4EL0A 4GZ5A 2KC7A 4RELA 3WC4A 1RRVA 4RIGA 4X7RA 4RENA 2KCVA 2PYIA 3G2LA 1YA6A 4M83A 1WV0A 1W3BA 3Q3HA 4HOSA 3CVQA 4Y6CA 3QHPA 4HORA 4GCOA 5DXFA 2QN9A 3RIBA 2OFFA 4F3VA 2IYFA 5GPBA 3TAXA 1HH8A 3GYZA 4U04A 1L6IA 1P5QA 4I1AA 1ELWA 3IEGA 4B94A 1WW3A 1FS4A 3D0QA 4HWGA 3VUFA 3ZGQA 1F0KA 3S29A 5JJ7A 5JTTA 3CX4A 4U0SA 3L7BA 1GGNA 4RBNA 4J8FA 4GA1A 1JIUA 2VQ2A 1L5SA 2GJ4A 3FP3A 3EBOA 4I2ZA 3S7DA 2JLBA 4UI9K 5G04J 3RO2A 1EM6A 3CVLA 1EXVA 2QN1A 4GZ3A 5KJKA 5HI7A 2L6JA 2WQHA 2PQNA 2XGMA 2QRGA 4AMGA 4RIIA 2YHCA 4H7YA 1O6CA 3E3LA 2GM9A 4GPBA 3MS4A 3MQFA 1TJCA 4I9EA 2IEIA 4BQEA 5JJ6A 4AY5A 2IV7A 1XNFA 5M72A 3L7CA 3G2HA 3ZCPA 4YVQC 3MRXA 3GZ2A 4XI9A 5TVGA 3CUYA 4BQFA 9GPBA 1GZ5A 4AY6A 1L5QA 4MI6A 3COPA 3MA5A 1XOIA 1RZUA 5A6CA 2FI7A 4GYYA 1UZUA 2C9ZA 3U4TA 4J8DA 2XGOA 4N2QA 2QRHA 3CEHA 4Z5XA 5BNWA 5TMEA 3CEQA 3OXGA 3UUXA 4N2SA 2QN8A 2G9QA 4WHMA 2KCLA 3NP7A 2GEJA 4BWRA 1XC7A 1B89A 2UY1B 1B4DA 1VGVA 3VDNB 3EBPA 5DBKA 4X7PA 1WW2A 4U0ZA 4Y6WA 1C50A 3IAAA 1E1YA 2H1FA 4F9FA 1HXIA 1XL0A 1FC0A 4N5CA 2QLMA 2F3QA 4GYOA 3SYMA 2NC9A 4GA0A 4EL5A 3UQ3A 4N3AA 4MHSA 2R60A 4CGWA 1P4HA 5I45A 2UY1A 2QRMA 1LWOA 5BT1A 3WXXA 2V5FA 1P29A 3GUHA 5AYWD 3ESKA 1NOIA 2AW3A 3RT1A 4YI3A 2UWJG 3DDWA 2XCBA 1NVKA 3O48A 3RKVA 2C0LA 5CCLA 1GPBA 3BCSA 3CEMA 2XCCA 1JG7A 4G2TA 4G1TA 3VTXA 4AM9A 2C1XA 3NB0A 3K9IA 2JZCA 5DU2A 2PL2A 2PRIA 4RIFA 6GPBA 3PDNA 4N39A 2VGXA 1NOJA 5BW8C 4LEIA 1PNVA 5FJYA 5FZQA 3ZCQA 1LWNA 2R5SA 3RJVA 1FTWA 1FCHA 3CUVA 5KJNA 2MHKA 3TGOA 3HYMB 5C1DA 4GCNA 3E3NA 4GYWA 3GPBA 3MT7A 3OTIA 3ZHEB 2BFWA 4X7MA 3ZCRA 2C2LA 4BT8A 1NOKA 4J0UA 4YNDA 1J39A 3H4TA 5FTPA 4L22A 5KJMA 2R4UA 5TMDA 3OY2A 4MRAA 3MTAA 3QKWA 1C8KA 3CK8A 5FZSA 1GG8A 3ZCTA 3ZCUA 2AMVA 2IV3A 2R66A 4NC9A 3CKBA 4RG6A 3T5TA 4XIFA 3ZHEA 2XCUA 3BEOA 5D01A 4CTMA 2QRPA 3T3GA 3S7FA 5ARFA 2XA1A 3OTHA 2QNBA 4A1SA 2ECPA 3S7JA 2R68A 1P2DA 2X0DA 2ONDA 4KYOB 3HBMA 3GZ1A 3KAEA 3RHZA 1HZ4A 5G04C 3Q15A 2XCIA 3BEEA 2HY7A 3OXFA 2F3UA 4X6LA 3ULQA 3TG5A 2IUYA 3HBNA 4BFCA 4O6FA 3CVPA 2SKEA 2BUGA 2Q7FA 3MKRA
chains in the Genus database with same CATH superfamily
4BO2A 1KFBB 2YRWA 2G9UA 4D4HA 5SYMA 1WSWA 1L4YA 2XB6A 3B5EA 5L3SB 5CIYA 3GBVA 3KEGA 5AHKA 2NZXA 1IM8A 3URZA 1IEVA 1CDZA 4JBWA 4AXHA 1NBOA 5E1MA 3T06B 2GYUA 4J49A 1JU4A 4HNAB 4B5LA 1E66A 4YACA 2CHFA 3ZW8A 2FLKA 3MVEA 3SVZA 2OQ2A 4J0EA 4QUAA 3N70A 4FONA 4ALIA 2OGZA 5H16A 4MHOA 3L1JA 2YNQA 4WA8A 4P5EA 4O8CA 1U0EA 1CQJB 4Q82A 3SIPA 5H59A 3QIVA 3AFMA 4XUCA 1J99A 4O02B 3D8SA 4OLAA 4CL8A 5KNHD 2ZYTX 3AUAA 3TSYA 3AHDA 3E4BA 2XCSB 1NE7A 1RCUA 1PVVA 4EHDA 2XUQA 4ABYA 3JRXA 3TLMA 2FX5A 3URMA 4MKFA 2XMPA 3ZHVA 5IANA 4H7FA 2CNWD 2E37A 3NUQA 3BGVA 1EBUA 5BMOA 4DM4A 1Z0JA 4TXHA 1WHTB 2FF5A 4JVSA 1LW6E 3PDJA 4CKEB 1W47A 4ZARA 3I01M 2Q5JA 2J4CA 5DXJA 2XB8A 5HJ7A 3NHKA 4R4JA 5C52B 3FLBA 1GU7A 3CVUA 1N3IA 5EC8A 5C46F 4I08A 4C3ZA 2PSEA 4I66A 1IRXA 1INZA 5EPUA 4DCTA 1DCKA 1MO6A 1Y3DE 1PJZA 1UH5A 2Y0DA 5DLDA 2GDZA 4PLTA 4Y9TA 2KE5A 1GPDG 5H82A 4MAAA 4ZAZA 4PN3A 1UEJA 3X2EA 3F6YA 3NOVA 1JCQA 3C3RA 5C7OO 2Q5FA 2H2AA 4KLRA 4QBIA 2G17A 4QICA 4B75A 2XYQA 4UVDA 3VOAA 3KYBA 4OHBA 1AQJA 1GRVA 4M0PA 3GRZA 3E4CA 1XBTA 1GTG1 1Z25A 3OZWA 1HKHA 4TMVA 3GEBA 1OYWA 4NEQA 4CN8A 4WZAA 3BL5A 4PR3A 3BAZA 4TTIA 1BD3A 4KXLA 4DMCA 4R51A 3UA4A 3VR0A 3LRTA 5CTAA 1FUIA 1NV8A 1ORDA 3DLTA 1IVNA 1P19A 3THXA 1W88B 4M0UA 4OFWA 4KR2A 3DEJA 3Q3HA 4DV6B 3ML8A 1U90A 2OCDA 1SC6A 5C0OE 1Z75A 3F96A 3TB6A 1LX7A 4AZ3B 2I2AA 3S29A 4RYLA 2HF8A 1PQPA 4AKTA 3WO0A 2PQ2A 3NVDA 1PDWA 2AOTB 1W93A 3G2HA 1DP4A 1T3LA 1EWRA 3LPMA 3GRUA 4M37A 4J8DA 2HEGA 2I6GA 3ONFA 1EQUA 5GWXA 1P5HA 5F3RA 4TXMA 4H7EA 3ETGA 1F14A 1KI2A 3L8GA 5IWAB 2QX4A 2O3TA 2P9ZA 2QTNA 3EZ6A 1LWOA 3V4OA 3L6AA 1IZ8A 1QQ6A 1SG0A 3V1YA 3T1YB 2PT6A 5HFNA 4BJ5A 2QT1A 4KQGA 2JAXA 3SD7A 3ZU6A 1ESDA 1CY8A 3UJ8A 5FL7D 1NSTA 1A88A 5KJNA 3FPHA 3GUVA 1B74A 5BMVB 3BILA 4K0RA 1M2WA 721PA 1W1UA 4F92B 1XA0A 4TYMA 3ZCUA 5EJIA 4ZV4A 3WJ2A 1AY0A 1VSBA 4LRZA 1L9KA 4OHCA 3AR8A 2WKSA 1RBYA 1TM2A 4DY4A 3CVVA 4YCNA 1JQBA 1MA0A 3TBKA 1JXQA 4EGSA 4LZPA 5JHAA 5J23A 2VAMA 4OBBA 4EDFA 3ZQ4A 3GT4A 4LYGA 1XEXB 3OTWA 1R18A 5DP2A 3RRMB 5LP0A 4H77A 4INOA 3G5UA 2EDCA 1CK4A 4NU8X 2WUEA 1O9HA 1S1MA 4GX5A 2PUCA 1BU5A 1Z0FA 3HB5X 1ULTA 3OTGA 5TR9A 1YIAA 3SXJA 3W77A 3ZYCA 3ZGVA 2VDMB 3RWOA 4JXTA 2MYPA 3T15A 1QJ4A 4NY1A 3ZIUA 4HUQB 2OEVA 3EU9A 3DWLG 3QTTA 1FRVA 1XQ1A 1X4RA 1JSCA 3SS7X 3LMKA 1CTQA 1LI5A 1TTQB 3DZBA 1P6QA 3PG5A 2ILVA 2XSZD 5G0TA 3RGWS 3G0IA 4KVFA 1PZNA 3A0UA 2WW8A 1DAOA 5DLQC 1HYBA 1YFKA 3B7BA 1SXJD 3H16A 4YRBA 1H3EA 2JDID 3GN2A 3WS7A 2CMDA 2VJMA 5F33A 1T0IA 3QZUA 2GERA 3AEXA 1M83A 5SYNA 5H02A 4HTFB 2BSXA 5HRCA 1S8AA 2HHJA 2Y67A 4JYMA 3HN6A 3ZV7A 2PRYA 1CY6A 2WSSD 4BFUA 1IQ0A 3I1YA 4MO2A 2QRQA 5U4QA 5CFNA 5BW6B 1PL0A 1H6OA 1T5BA 2XNJA 5HR5A 1QPBA 4IQ4A 2YIVX 2G7MC 3EMDA 4RPJA 4ARVA 3IOYA 1U65A 2NADA 4BRSA 2GRMA 2ZIFA 4HPJB 2O8NA 4A26A 5J4YA 4D0LB 1NNSA 4E6EA 1W96A 5LDGA 3ULKA 4IDBA 1YV9A 5DYGA 1MF7A 1YBAA 4EHNA 3CSDA 2PSFA 2OXRA 3OBIA 4L3OA 3UXHA 4JLVA 4F2HA 2VS1A 3RC1A 5TQ2B 5GP1A 1QH8B 1OYVA 2X4LA 2DTDA 3FNHA 1QLJA 1DJOA 3PPVA 4ERNA 4BIMA 1BI7B 1ZA2A 1T29A 1I3OA 4W5WA 3SQOA 2XCRB 2FEZA 2G0AA 3BWEA 1LPBB 2JIRA 4DLOA 3UMCA 3MJDA 4ENWA 4GPAA 4BWVA 4R1SA 1EXMA 4HI0E 3ZZUA 3AF0A 3MKQA 4KVOA 1C1DA 2P6PA 2I3AA 5DKFA 2F67A 4Q02A 3TQSA 3QQPA 4KE6A 1ZR4A 5ESRA 1CNEA 3KSZO 5LMUB 2A4KA 3BFPA 1GKIA 4W99A 2VDRB 4Y6CA 4C78A 4DXHA 4WCFA 3QWFA 4XWWA 3J81k 3B9QA 1JSXA 3EJWA 4RV4A 3HKDA 2DF8A 4UI9K 4PC3A 1A7AA 1TQ8A 4LMBA 1SVOA 2BGJA 1JWFA 2D59A 1XXHE 3IUJA 3AKZA 2H11A 1LV7A 2QL7A 4BQFA 2GJKA 3ENKA 1XRPA 4DPMA 1U31A 3GT3A 2IEJA 1A7UA 1JQAA 3N53A 4IUDS 3AH8A 5CYGA 5FBVB 3WQRA 2L9BA 3EGXA 1JPUA 4HAXA 4IZHA 2JI4A 2DQ4A 2ODWA 4LRQA 5DCYA 4YJHA 5GOTA 3BKXA 1JHMA 2FZEA 3LNTA 5CIWA 3DZIA 4HDNB 3C24A 1MQSA 4MCAA 4WCDA 4NIMA 1FMLA 1S2OA 5IC6A 3P45A 1E3WB 2M32A 2PUHA 5B2EA 3CWZA 1EIWA 2FG6C 3BSSA 2Y92A 5IMBA 1J39A 1TZCA 3OQHA 2PUJA 4XYEA 4JDUA 4XIFA 2Z0MA 2W6MA 1ZLYA 1KEUA 5D1NA 1LLQA 1CYEA 2QS9A 2WZBA 3QBVA 4YRZA 5K2MA 2YY6A 5B64A 2Z2KA 5K9ZA 1NF8A 2XNHA 4O6FA 2CNWA 3MOGA 2X8JB 4RNCA 1AKYA 5C35A 3IDAA 4KRYA 2B3DA 3WRYC 4PLPA 3M4ZA 1T8WA 5B3JA 3HWX1 3JVVA 3ROKA 4GOKA 1SCIA 3BMXA 3FPEA 2QXTA 1JQJC 4AX4A 1WZEA 2QQFA 1WZIA 4KMSA 2K2QB 2GUWA 2ZIGA 5LBUA 3LM8A 5BVHA 2Q27A 3N5CA 2ATEA 2QSJA 4LKRA 3L05A 1M1YE 5AOAA 1ESZA 2DT8A 4YV7A 2YDYA 4D9BA 2PZAA 1HG5A 1JHAA 2BFEB 4ZYXA 4ILIA 3N86A 2PJDA 4PAWA 2WXMA 1ABBA 5KX5F 1YSCA 1K3FA 4YAIA 2A9PA 2GPSA 3GHHA 1HX7A 3WYEA 4G0QA 2RC5A 2XKAA 2PSSA 2C5AA 4QGSA 1GT6A 1Z17A 3C8UA 2PUWA 2ODEA 4HNRA 5FT9A 1NW8A 2HCTA 4N76A 2XGJA 5A3RA 5AENA 2DECA 1Y8QA 4LJ5A 3M6FA 4NZYA 2IDZA 1CZLA 3IBSA 2QF7A 5DT9A 4KTTE 3QBDA 3FYHA 4TXRA 4BE7B 2R03A 4F1PA 3SFZA 3J81A 5BYKA 3UJ3X 4EMTA 5CB4F 4AV7A 5ABPA 1V1RA 3ICVA 3WYGA 3BT7A 1OU4A 4E5SA 2E4WA 1DL5A 2BDEA 1NQVA 5ARDA 5ILOA 5CGZA 3NBQA 4YRCA 1UPCA 4MS3B 5I7UA 1CUYA 2L69A 1CR0A 3FI0A 1U6KA 2E89A 2FWAA 1UT5A 4AMYA 4AM8A 4EYKA 2GZDA 1EDBA 4BRZA 2HHAA 4Q3LA 1DJQA 4MWEA 3RARA 4HXGA 4ETNA 3G6KA 2ERCA 2VKTA 1TYQG 4JYCA 4KYVA 1AH2A 4QOJA 4TS3A 4NE9A 2BHRA 5KVSA 4QUGA 4YQZA 1MQ8B 3U40A 4RIHA 5DFAA 5FL7A 1CUVA 1XGWA 5SZHB 4KXKB 3JXIA 5LZ5A 4W8OA 5K4AA 3FPLA 5H3LA 2E4AA 4GZ5A 2J4FA 1GTL1 3P0RA 4ZEMA 4RZ2A 2X42A 4CETA 2CMGA 3GJ3A 3DV0B 1USIA 1DVRA 2R85A 3CH7A 4F3VA 3R8FA 4IRUB 3GJRA 3ZTTA 1NQAO 5EP4A 3T7TA 4DQUA 2DAPA 1LPAB 2F62A 2C96A 2DE0X 1OAAA 2FPPB 2ZUEA 3L6OO 2ID9A 1CIPA 1SXHA 4C30A 4PLVA 5AOBA 2GRAA 1ZSNA 1NI3A 2ZU0C 3CUYA 4MI6A 2C31A 5AXAA 5AJLA 2FEXA 1T8TA 4Q1AA 2X5GA 5FRDA 5L7YA 1J0CA 2ZBUA 5BT9A 1ZRNA 4WWPA 4FE3A 3GLVA 2EJTA 2PL9A 5BSRA 3PC2A 1KEKA 1WW2A 1KAHA 1V4BA 5ERXA 3CLKA 2BEWB 3T5CA 1GCOA 1NY6A 2XSZA 2C9CA 1TW3A 3G0GA 4KUEA 3KYDA 1WU8A 3NT4A 1ECFA 2XCBA 1F5SA 5BSWA 1XJQA 5C3MA 2I4RA 3FUHA 1SXJA 3MNFA 3EIEA 1XMSA 2JDIA 5JT1A 2ZROA 2PRZA 3MLEA 3F5DA 3VZSA 1GM5A 2TRSB 3JWIA 4UDXX 1W36D 4Y2YA 3F8WA 5B12A 4L22A 5TMDA 2D54A 4C1BA 1UG3A 2ZS9A 1Y34E 1ZO8A 2WSSA 2ZYGA 4URUR 1C9MA 1WVGA 4HT3B 3NYIA 2GVZC 3L8ZA 2I1VB 5ALKA 3S7FA 1Z39A 1FQJA 3DT8A 1ETHA 3H2IA 3EE6A 4C7KA 3TTSA 4HDOB 3WMFA 5AK0A 5EY5B 2JVKA 1OBFO 4F8EA 1V54E 3T38A 3GGDA 3RAUA 3A06A 5HJ2A 3EX7C 2C88A 4R8VA 4KQ1A 1E9RA 1CUDA 4MJLA 1KJIA 3GCZA 1XGKA 2EG5A 1MLDA 1IN1A 3SZUA 3MWJA 1AKWA 4TV9F 3TM5A 1HTBA 1KEPA 3HZZA 5LQDA 3GFFA 4NYJR 1EJ0A 1RQXA 1EYHA 4APOA 3UKUG 3BK1A 4DLZA 1Q2ZA 2EYQA 4PQGA 1Y7LA 4JZYA 5IDWA 3UC5A 1WY6A 4DMMA 4KXUA 1VE1A 3UT5B 3EBLA 5KEIA 5H8WA 4WESB 5FA5A 4B31A 2G08A 1R3DA 1Z8NA 3BFJA 3CIAA 2IIPA 5I4CA 1FP4B 1XZ8A 2JS7A 5AKIA 1QF9A 3RAEC 3ZN3A 1ZQ9A 1PNTA 4E09A 3M5CA 1L8QA 4GNKA 5AJHA 3CF2A 3T3EA 2A67A 4DIEA 5FTLA 1ID1A 1FRFS 2CHWA 4FWIB 5BXOA 3LO5A 3B52X 4PLWA 1EM8A 3HDYA 3QBTA 5ESWA 1RPAA 1OCCE 1SULA 3TRIA 2POQX 2YUIA 2HRBA 4RL6A 3UO8B 4R8SA 4YQYA 1Z74A 1UBTS 4EY7A 2E21A 2D8AA 1DI0A 4LZZA 3KS9A 1U6IA 3LPZA 3SS8A 4GXTA 4OI2A 5AW3A 1VC2A 2OGUA 5AW6A 3RU3A 1E79D 3OZXA 1M2VA 2JRCA 5KU1A 3T3PB 1X7XA 1XAIA 2PUFA 4NICA 3PQ8A 3A04A 4B3SB 4OHFA 4A4DA 4MUFA 3OAWA 1CFZA 5JAQA 2I2WA 1DSSG 2BV3A 3HBAA 4B3MB 2PU7A 3B60A 1FFWA 2C59A 3V42A 1SUBA 3ENNA 3L7AA 1TGVA 3IQDB 4C0XA 1H2YA 2RH8A 1N2ZA 2NP7A 3M1LA 2CHVA 2FN4A 1DPGA 2DRIA 4S35A 1EJBA 2LUOA 3C5VA 5LSAA 2H6IA 4LNUB 2QLFA 2V65A 1P5FA 4MSUA 4IKOA 2VAPA 1QFZA 3MD0A 4JS0A 3UAYA 5DEOA 3N2ZB 3F6PA 1A04A 5FCDA 1C7FA 3SNHA 5CM8B 4ZFHA 2VJCA 4TXJA 3CLRD 3NKLA 1QAMA 3JALA 3P9SA 2AQ8A 2ODTX 2ZXUA 4MTCA 5ALXA 3MWFA 1U3CA 3LBFA 3RIHA 2MU1A 1OH5A 1DFHA 4I50F 4O1OA 5CBOA 4HS4A 2PM6A 4BO5A 3DBRB 5C8VA 3WA6A 4KDCA 1NXQA 3I6IA 2B4RO 3L5KA 1NFRA 3RTEA 3D6MA 2PWZA 3SJUA 5T7BA 1SUWA 1MO4A 3P9XA 4IH4A 1T4DA 2X3UA 1TCCA 1RJDA 3UFBA 3UJPA 1X1RA 2FA9A 2A9FA 2IL1A 4PO3X 4RSGA 4KODA 3I42A 3N3BC 2X6IA 4URVR 4KDEA 4WLFA 1S96A 4N41A 4Z0HO 5C37A 3NEPX 5FTPA 1ESEA 2FEWB 4LGMA 5A71A 3FPKA 4GTTA 1EYZA 1G2PA 3FWHA 5C8YA 3FNIA 3I4LA 3FW1A 1L5FA 1KVRA 2JB9A 4U4AA 3GVPA 2JCBA 4DE5A 3OECA 4RA6A 3OE5A 2PBFA 5TS2A 4MKIA 1WF3A 5J40A 2XLCA 1DQYA 2FKNA 4I1RA 1X74A 2RGDA 1I3LA 1ZPDA 2TS1A 3NBZC 2Q62A 5F1OA 3ZXUB 1KEZA 4YMIA 2Z4TA 4D3DA 4E15A 4ZP1A 3FNFA 1Z2AA 3PJGA 4M99A 1NU8A 2R3SA 3SDZA 3S28A 4NF2A 5C7IO 4FULA 3FMGA 4MITA 3GEMA 3DKPA 3H7IA 3IOBA 4DCMA 3SIRA 4I5FA 4NEHB 1N2BA 3JD0A 3TWRA 3EAQA 1CR6A 4JJKA 4KMMA 4OAOA 1I6MA 3PFFA 1ULSA 1FRQA 2GAAA 2EFDB 5JRJA 1QPZA 3JZIA 5AOXA 2V9ZA 5JI3E 1BRTA 1V1JA 1F4PA 3I72A 1XTBA 1RABA 2X3YA 1U6JA 5HZKA 4J03A 2WRZA 1AUQA 4IDNA 4RK5A 1HURA 1A2OA 1CRZA 1WCIA 1JHUA 1QB7A 4YCLA 1I2CA 3KALA 2MYNA 1QE3A 3QVGB 3OJEA 2D7CA 3AVQA 5K3FB 4PZZA 3FDJA 5EWJA 3QLVA 3RU9A 3QU5A 4CG1A 2B9VA 3D3WB 2NTVA 5F2KA 2UUOA 4MK4A 2ZYWX 1SVSA 5ENSD 3ZW9A 4MVJG 2R86A 4CT0A 4U7FA 2A0XA 2JI6A 3R0ZA 1Z6GA 1EUCB 3NBFA 1UAYA 4AJEA 5GJCA 2EERA 1WPGA 5DEIA 3TJPA 6LDHA 3AUFA 3G0DA 1SCKA 2RI1A 3O03A 4WJLA 3CLSC 1RXUA 1MPTA 2OORC 4BRWA 1CY2A 4KLAA 3FUFA 4K88A 4MGZR 1TIKA 2OTCA 5BUZA 4CM1A 4NBNA 1F3LA 3CJRA 3QE2A 2RJOA 4CDRA 1T3GA 3CV3A 1XSEA 4CQLB 2QRVB 4IEEA 5JQWA 4FLEA 4WNYA 4CT5A 2RBEA 3VTFA 4QL3A 3IHKA 1RKXA 1KIAA 3UT7A 1Z4JA 3NALA 2HMYB 4XOIA 4E2XA 3GRFA 3D6UA 2IQCA 1E9AA 2IC5A 2X1MA 3CHRA 2QOEA 4RTJA 3T7EA 2UKDA 3VPSA 3UB4A 3K15A 3CFYA 3D8RA 2YXLA 1SG6A 3D7NA 3WYCA 1M1NB 1WTAA 1G0OA 4UHEA 2KHZA 5ALPA 1WXGA 3TW6A 1EE2A 1A2QA 4DLVA 4R2IA 5JYDA 2PU5A 2A33A 4GYYA 4EGCB 4F53A 3V2HA 2Z6QA 1QDUA 2CLDX 5BR1A 2QVBA 3L06A 1Z4NA 5EP1A 5GY7A 4BQNA 5DM2A 3EBPA 1XZFA 3NH6A 2R8ZA 4ETIA 3MUOA 3BZUA 1I7PA 2B4KA 4EFMA 3KL2A 2NU8B 3ZS8A 5I9MA 4XM2A 3ICWA 1EFDN 2GM4A 2DX7A 2VPQA 1MORA 3II6X 3O91A 3G8CA 3AEQB 4IQ0A 1U0HC 1Y4DE 2ZCJA 1SAYA 3GZNB 2WVAA 2FE1A 1CJSA 1EIZA 2GASA 1J70A 2HK8A 5HHTA 1O57A 1ITZA 1JR4A 1NVXQ 1E2DA 5JJ5A 5LQRA 2ZXWE 2F43A 3RK4A 3SFTA 4G1UC 2OXCA 2WV9A 4CTMA 4LG1A 3F49S 3CLUD 3BTSA 3ZBQA 2ZBQA 2BMJA 1PEKE 2GN4A 4ZVRA 1GWNA 4R7TA 3E9DA 1I7SB 2AIRA 3PF8A 5CLQA 3MWLA 4JAVC 3BXPA 2OK7A 2KZTB 1Y8RA 3DVRX 4KRFA 3QHQA 2FFGA 3DXXA 1OB5A 3A11A 3N7TA 3RIXA 1UBOS 4YRRA 1N3BA 3UYKA 1JR3D 1QFYA 2XGGA 3ZU4A 3MT0A 3WLEA 5CYFA 5DDIP 5ITSA 5HEKA 2CJFA 1E79A 4FYWA 4H4EA 3L13A 2HM7A 3A3YA 4TQ9A 2MSCB 3PJDA 2QUKA 3QW4B 1TJ4A 5A5FA 2V7WA 4B2PA 1MIOB 4ZEXA 2QLTA 5TEWA 2YS6A 1CUSA 5HZGA 4KITB 2F9FA 3IP7A 3EPRA 1R4NA 1LUAA 4DUYB 3DE4X 2XZDA 3KTDA 3DO6A 4PM4A 3RU7A 1L5OA 4NP6A 2H1RA 4MWZA 1FTQA 3VZPA 3QKSA 4BO1A 2WMNA 1T3ZA 2WG0A 3FUJA 1APBA 2Z58A 4FCCA 3MPOA 1H94A 2ZIXA 1H4SA 5PGMA 1PTKA 1AHIA 4XDHA 1BXGA 2B6CA 2AOUB 4Q18A 4YUWA 4F1JA 2R11A 1CDOA 3LO8A 4EJMA 5JVDF 3RUAA 2IY9A 4IEIA 4MUAA 4XGIA 4MYTA 2Q2WA 1BWSA 4WAFA 4KFRA 1WG0A 3QPDA 4LE2A 3QF4B 1VB5A 4Q9KA 5BYJA 1R5OA 4G4GA 4DG8A 1JG2A 1OFTA 3LLCA 1IUKA 1CEQA 3ITEA 1HDOA 2K87A 3V9AA 4B46A 5J5AA 4RTLA 2C83A 1JV2B 5JC1A 2QQ5A 1AMUA 4FGSA 2WHYA 2AJ8A 1K2VN 1KGSA 1MV5A 4W6ZA 3FSJX 2W2LD 3FFXA 3QLUA 5DBFA 4YT5A 4F8YA 3R5XA 1OX4B 4EEKA 3M6XA 4Y9UA 1E9SA 3WLNA 1I7DA 3BYZA 5LD2B 1Y5LA 3S0JA 1EX6A 2AVPA 2YVKA 1GPWB 3Q98A 5HKLA 5E1BA 5K3SA 2C77A 3U66A 4DLWA 2BC9A 5IM4A 1NFFA 4CLRB 3P0JA 3THWA 3QKIA 3P9PA 3GGJA 1HNZB 2E1PA 2JLUA 3MELA 4PZAA 2XE4A 2C0PA 1D3AA 1L6IA 1FK8A 3DOFA 1H2VC 5AI4A 3VUFA 4DJTA 4PGHA 1RJGA 1ZGCA 5G02A 2YNMD 4DJJA 5ELMA 3VZCA 1TCAA 4HDSA 3LP5A 5JSHA 3WB0A 4C0HA 3P94A 2I1WA 4ZJZA 4EUFA 3G13A 1KMCA 5K3BA 2O2GA 4DW8A 1XN1A 4BX3A 4AL4A 2WXOA 3RSSA 1E63A 5TF0A 1SPBS 3BWYA 3CIOA 3JQAD 4GOXA 1MO2A 1B0UA 4NZOA 2RGRA 5DNYB 4WOBA 2ZAIA 1TJFA 1O0SA 3ZLBA 3C6YA 3T1TA 3PP8A 3R0QA 2DK6A 1JIJA 2JATA 1JTVA 1E3DA 4DLAA 4ECEA 3NKFA 3P0HA 3GUUA 3CT6A 1DBRA 3R9MA 5CA0B 1V11B 1DTSA 4LC0A 5GV8A 3WQBA 5A1TA 1ZUNB 4Z51A 2OPHA 4YJFB 5AQEA 2DZNA 4YJ2F 2DKNA 2QL6A 3HXPA 1ZRHA 1RWMA 1CE8A 3HB9A 3DMNA 3HN7A 3WDKA 1VHLA 1KF0A 4PZYA 5EE5B 2C2LA 1QZUA 2AR7A 3CINA 4B74A 1JDZA 2P78A 1QDEA 2IRWA 2QSUA 2GFQA 3W5DA 2CXQA 3E34A 4PWYA 3PEUB 4GR5A 1CUGA 5KTSA 3BHJA 4J7XA 4M1YA 5K0TA 3W9GA 3EUAA 3KZNA 4REQA 4KZ0A 2CLKB 5BW4A 1Z06A 2RGXA 3IVRA 3RKRA 3QVTA 4Q9JA 4MQ6A 1W4CA 3JD1A 2IODA 5FDFA 3CVPA 4KQXA 4OLFA 4M9XA 4PO8A 4AB1A 2QR5A 1V7ZA 3C45A 2C61A 2O8BA 1GYRA 5SZIA 3TSWA 4FZRA 1P1IA 2EBUA 1E1RD 4CN9A 2IOHA 3TXYA 4ND2A 3S2SA 2IYPA 4MPPA 2PRJA 3R7WB 3CHQA 3LHFA 1PWZA 4QDUA 3ZBTA 4OYSA 3GEDA 3SM3A 4Q1BA 3TZBA 5E2AA 1AUXA 1SVNA 5SICE 2EFHB 2BEUB 3AF1A 1YI8A 4U00A 1EP2B 4N3CA 3VDXA 4QUIA 4JUAA 5LC1A 5FPTA 1MZPA 2YL2A 1F5NA 4JI3B 4DCJA 1KETA 2Y1FA 3UM0A 4G8JA 1X8KA 3B8HA 1AOXA 3GQBA 3RWBA 2JGIA 3UGJA 3OX4A 4EABA 1LNSA 4HAIA 3BA6A 2RIPA 1TT5A 4D4KA 3F5MA 1OCEA 4FZJA 4EG8A 1V9SA 3W6ZA 4OHKA 4J4BA 1EB8A 1ABFA 1WA5A 3LCMA 4AJ9A 4DTIA 3M9LA 4WZBB 4KNWA 1NP7A 2PLFA 1R0BA 4MEJA 4L9SA 3PJRA 3DSVA 5BO5A 1PJSA 2CXRA 1XZMA 1ZDMA 2PYDA 1VMEA 3ZJTA 4OB6A 1K9VF 4KQMA 1QYDA 4G8CA 2XD9A 4CCYA 1FFXA 1QO7A 2GWRA 3PDHA 3IP6A 1MG0A 5AVRA 4FDTA 1T6BY 3H11B 1R6AA 1RXWA 2B8JA 4ENTA 3LQ4A 1V0JA 3X1KA 4E2ZA 1T9GR 3CH5A 1RPJA 4LXYA 2V8SE 1VGRA 1QG0A 3HFSA 3KOXA 3AM1A 5CT5A 2CUKA 5C4MA 2RH9B 3L07A 1OWNA 3CPJB 2AUTA 1BQ4A 3B3GA 2D0PB 3N75A 4FMDB 2XMDA 1Q91A 1GFSA 1XCPA 2DULA 4F4DA 3SG0A 3SMQA 2AXVA 3AESA 1DC6A 1ZKMA 1ISFA 3K0CA 2ATXA 4ITVA 2ZWVA 2J08A 3P96A 3LSTA 4E11A 1SCUB 4ZHBA 2D0IA 2MWMA 1LLDA 1JIIA 1B3BA 1IRIA 4XZ4A 1WQ4A 1HQKA 1E64A 3K70B 3NDBB 3SNKA 3EHMA 4BP8A 1CVLA 3S5JA 4YDQA 1MHQA 3ZVLA 1ZZGA 1DLIA 2WIAA 4RBNA 1MJ5A 4W5RA 1LTQA 3CVLA 4GO1A 2VP0A 2BKEA 1E3EA 4FPXA 3KZCA 1P9OA 2A5JA 2JHPA 4R8RA 5DNUA 1EFCA 3V8RA 4XD7D 1O1TA 1I0IA 3PFCA 4HYYA 1HZJA 5IN4A 5L8VA 3DFMA 1G21E 2WINI 3B48A 1Z29A 3CT4A 4CR6A 3ZVKA 4E5DA 1I2MA 2CV2A 3EN0A 1JR3A 2UY1B 4ARUA 3F67A 3ZLTA 2IYTA 2CL6X 1G291 1Y33E 5DI3A 2Z9CA 2BJWA 1XL0A 5A05A 1VZ2A 4DEXA 4CM5A 1YMPA 4R2LA 3EXIA 3UAOA 1ZJ4A 2OWEA 3KD2A 4DRXE 4MJ7A 4G2TA 4XGNA 4BKRA 1K75A 2ENWA 3OM0A 3A7EA 3LGAA 5IDXA 1Q92A 1YVPA 1U8TA 4IGFA 3KOUA 5JD6A 1KI1A 4RGVA 2XENA 3QX8A 2P5UA 4FFLA 4WLUA 4FC6A 2ETCA 3ZWOA 4MV1A 1CS0B 4OJTA 4IHQA 4N0DA 1NXXA 3RUIA 2NU9B 3FJOA 3I5AA 4CIBA 1A8QA 1VDZA 1DKRA 1REQB 4DIKA 4A6DA 1E1QD 2Y0PA 4GNRA 3TWXA 4MKGA 4FHCA 5EHZA 1P2DA 4W82A 5K3CA 4PBSA 3UM1A 4PQRA 3TG5A 3NHJA 4OHWA 3VI3B 4RWZA 4MI9A 3SWWA 2DC1A 4AJJA 5FA6A 2JCSA 3X1DA 1H4QA 3ID6C 3RTGA 3RS5A 4K9NA 2O0MA 4RVOA 1VBNA 4EYGA 2QSZA 2BKAA 1N94A 4PRZA 3DDSA 4ZU3A 4FYYA 3STYA 3B2QA 3JYSA 4I7EA 5A3VA 4I1IA 3GA0A 4CMBA 2IU6A 4REOA 4AN0A 2W2LA 4BGVA 4L72A 3VLEA 3OPMA 2IWHA 4IAOA 1TEVA 2IX3A 1ZGJA 3LVRE 3C3EA 2J9FA 3ENVA 1IMJA 4RY2A 4G8BA 3GJ0A 4WXHA 2F8LA 4LY9A 3KR1A 3C8MA 4FYHA 3PZ1A 5LJLA 2GDJA 3BFVA 1C9JA 5ALLA 4F4IA 4I6GA 1ILWA 3C3PA 1Q19A 1THMA 1MR3F 4R01A 4AZWA 4Y1EA 1RE1A 4P1ZA 1K6IA 4FEEA 5JALA 1Z0SA 4KI0A 4AS1A 1FYDA 4XX1A 2NPFA 4KDRA 1G5PA 1WSBA 1EVEA 3KD7A 2H4ZA 3O1JC 2IONA 3GZ4A 2BHNA 3H1BA 4MRUA 4OLJA 4EX6A 1NXOA 3EVEA 2OD9A 5LLDA 3FUTA 3GUCA 3SBDA 3H0KA 3P71T 2YNMA 1RLMA 2C0MA 2I1LA 5LCXA 1Y8AA 2AZDA 2FCAA 5IY5E 1JJVA 5E6RA 1H9AA 3W8FA 3UT4A 5FQNA 2VH1A 2CZCA 3CJQA 2CNNA 3C87A 2MDTA 1ORIA 3JQAA 1NTRA 1PYGA 1KWKA 1JKIA 2LDBA 2H6GA 2FVYA 5E95A 4DZRA 4LV8B 2H29A 4RQIA 3A4NA 2PD3A 4G97A 4OBEA 2HSJA 1KWGA 1O9GA 1UDWA 5E8JA 4B2YA 3LWBA 1BOOA 2GZ1A 4ANWA 2DBVO 2NNWB 2CXHA 3E7FA 3EAGA 4U07A 3H18A 5GQSA 4OYHA 4ITRC 3VZDA 1NBHA 3JATA 2OKGA 3U3DA 4WZAE 2AKAB 3PS6A 4I4TB 2QJFA 4B44A 3OT1A 2WC1A 1R12A 5C81A 1F8FA 5HZHA 3AERB 1Q0QA 1OBCA 4GE0A 3WFIA 4V2IA 4WY8A 1MAAA 4W63A 1EG2A 2RB4A 4CI9A 4FI3C 3MQ2A 5JH7F 5DRYA 3FA2A 1ENYA 4YALA 3SGHA 3DKRA 1ZOPA 2YQ5A 1ZA1A 5GMOA 5HCIA 2WTEA 2XQ0A 4HGZA 4YRIA 4N47A 4BLQA 2D2FA 2J0VA 3OTNA 1F7UA 1XRJA 2Z4RA 3P1UA 3W2GA 5A6CA 4BJ3A 4LERA 1E1RA 2YZGA 4AULA 2RFAA 3O3NB 1U2DC 4BC0A 1GNTA 3NGMA 1RWPA 2POCA 4U2EA 3IAAA 1P2UA 1E1YA 3GLFA 4AQYB 1SUDA 2O7NA 2NC9A 4UHDA 3RUPA 2J5QA 1WMFA 3U61B 1KJYA 2DPLA 4MR7A 4TVBA 3EPJA 2BZGA 4IFIA 1P7ZA 1FZQA 1QOZA 2YINA 1Z2NX 3FYUA 4JYAB 4O25A 4TSKA 4ZKEA 4TRQA 2DFDA 1KQ3A 3KNZA 3V3LA 1GO2A 1T8SA 2JI8A 2PGAA 1WXHA 2X0IA 4L3WA 2G04A 1JWGA 1J1ZA 2BFWA 4N40A 1SVUA 2X77A 4CF3A 3WIDA 2XUOA 2V96A 4IGKA 1RHMA 3T9CA 4CM8B 2XPZA 3U44B 2XA1A 1DAPA 2ZYIA 1QE0A 1RCTE 4FNGA 5B3AA 3H1GA 1RYZA 4BXOA 3GFVA 1PT5A 2SKEA 2Q7FA 2C7PA 4G65A 4JC5A 3OOHA 2VHVA 4M4SA 3CHSA 1AQNA 2XZTG 4BKPA 2WM8A 4RX1A 1TB4A 5HUJA 3LUPA 3EIFA 3HNOA 1GTSA 3F6RA 4WJKB 5ITWA 2UZAA 3LA8A 1DOZA 3ACBA 2JGAA 3EOZA 3ZU3A 3PI7A 9ATCA 4X61A 3JQ9C 4R7GA 4D9GA 3R9XB 2YJGA 1YZTA 4LBYA 3DMFA 3RR2A 5AJWA 2G9ZA 3PVZA 4NQRA 4EFLA 3X43A 1U2ZA 1JFSA 2JLXA 3AR7A 3KEAA 4X94A 4REMA 1KT1A 2P9TA 5HFAA 3VC3A 1ZAKA 4GRIA 3UXYA 1YZ3A 3HCWA 5EZYB 4L2YA 1TKBA 4EKDA 3H9GA 4IHJF 1BH6A 1GNLA 1Q3HA 2PJZA 1PSWA 2Z6VA 5MN6A 1W87A 2GZ3A 2OFPA 3NBMA 4TRMA 2GSDA 5LOVA 4P0PB 2GPNA 4MQFB 3LHSA 4IKPA 2MCFA 3K6SA 2NX2A 3SO8A 4N0MA 4W5TA 3E7WA 2Y6UA 4I3FA 2QB5A 4ZOQI 1O6FA 3PSAA 3KYCA 4HAYA 1KDYA 3OI7A 1DDGA 5ALZA 2Y4OA 3CSTA 4BN4A 3OQJA 1WNFA 2WMDA 4LYJA 3ZHBA 3UK7A 1NW9B 4JOSA 4CODB 4JITA 1EBFA 2Q99A 4Y1GA 2FWBA 1KNXA 5KC8A 1YCHA 3DPSA 3W1VA 2I1QA 2I80A 3KC2A 3LBHA 2WJPA 3MQ4A 4D3SA 4XD7A 4XX0B 3B89A 1WAMA 5G53C 4S0ZA 3IEXA 3WL3A 4IDQA 3FEXA 2VHXA 3PXBA 3KSDO 2ZWMA 1JDTA 3N2KB 1TUBA 1T9DA 5BR7A 1IU9A 4MYUA 1GU1A 1QG6A 3SC6A 1XCBA 4HLUC 5EQDA 1N0RA 1XZIA 5CA1F 4YAOA 4UFPA 1OXMA 1NC3A 5JLAA 3MUFA 1BI8B 3FPAA 5EZQA 1JLLA 3WGOA 4WDRA 1A17A 2OGSA 3Q2IA 1E9VA 5I7HA 3MOSA 3SF8A 2PAFA 4K9MA 3HFJA 4GRDA 1F60A 1TYZA 2XRZA 2KW5A 3HXCA 4LY6A 5KZMB 2AUNA 1Y1RA 1BHSA 3E7XA 2LNIA 5AOVA 2WYOA 3LWDA 3M89A 1BX1A 4JLNA 4F1KA 1HE2A 3NNNA 4LV5B 4U6NA 1KHHA 3ISJA 1RTKA 3EQ6A 4C3OB 5JAPA 3AHGA 4UM7A 3ZGQA 1E1QA 1VCMA 2OLJA 5E3IA 4PS1A 2IEAA 4C22A 3QRWA 1Z4KA 3A1DA 5L95A 3BWXA 3VPXA 2EP7A 1O6CA 1YDGA 5A2QA 2VRBA 4QEKA 1RW2A 3UT8A 4J2HA 4FS3A 2PX4A 1AKVA 1BE0A 4MQMA 1PGJA 4FGWA 1BMTA 4TVKA 1TEXA 4D9HA 1CD5A 1B4DA 3SFXA 1V1MA 4QPJC 2AX4A 4FKBA 5HDBB 3IHWA 1T35A 2E55A 1HXIA 3KKKA 5CDYA 1RZRD 5JSFA 1QGUB 3H9EO 3B9BA 5BW8A 4F7WA 3H2BA 4OGWA 4WNCA 5JBNA 5TS3A 2PL1A 4A3VA 4QJ5A 1PR0A 2VYFA 2X8LA 1CNFA 4H7KA 3HA3A 3MTQA 4F8JA 2XUAA 4EPYA 1ZICA 5HF6A 5IZCC 4UNIA 3RYHA 1R16A 1SA0B 1DQRA 4GWGA 2PZLA 3WFZA 4D81A 3IEVA 3EHQA 3I9FA 3C8ZA 2PL5A 4AQDA 2RD0A 5JBQA 2B2XA 3EODA 3NWPA 2IV2X 3E9MA 3A0RB 2YS7A 4GEKA 2BWJA 2I0FA 4HDRB 2XJ9A 4ESHA 3SC2A 1TO2E 4D57A 1JPLA 3TS1A 3WE7A 3ORRA 1R9MA 3D8NA 2JKYA 2VYND 3OPQA 1M73E 3MFYA 1HC7A 4D8UA 2FXVA 3WRWA 4DDWA 3C1UA 3IKJA 4PINA 1A5EA 3EF1A 1TVKA 1JEEA 1Y8ZA 3A1VA 1JG6A 1W5TA 3ANXA 2ETAA 2DU8A 3LLUA 2WI8A 2OL4A 3RHSA 3A1FA 4UQZA 5K4GA 3CZQA 4M8IA 1JMYA 3AUYA 1NVUQ 1DDIA 2QA5A 1YQTA 2NSZA 1YZQA 1FQOA 3MCVA 2ZB2A 2HA4A 3QPVA 1KZ6A 1U1DA 4PPFA 1ZBDA 1DC7A 5AM4A 3GVHA 3S2EA 4HN9A 5AJUA 1O96B 2D3TA 3UAVA 2KB0A 4PZDA 2GJ8A 3P9YA 3NWBA 4TTTS 3HUEA 1YE8A 2JBWA 4QARA 1NC1A 2QSYA 2CYBA 5FQ6A 1KP3A 3MINB 3K9NA 3ADKA 1T9AA 2YV4A 2BGKA 1QHHA 3PNSA 2ZWOA 5G0WA 3K8OE 4DVJA 2D1FA 5HP4A 3I5XA 4R7ZA 1UDCA 4HH3C 5DCLA 1E8OA 2FOIA 5CVDA 4JA0A 4MJXA 4ZAYA 4KC0A 3AU4A 5EJ6A 4R5HA 1AKEA 5FR1A 4J8YA 2VJBA 3LXXA 3CW2A 3TL3A 5DULA 2YASA 4C4PA 2IITA 2X5XA 1KZ1A 3M4XA 3H4VA 4Y1RB 4HNSA 1PFVA 2LBPA 1SQMA 4ILEA 1ZY2A 2PM7A 5G1NA 2XVMA 4C6TA 4NVRA 3M6LA 4LHSA 4RK0A 2HE0A 1XV5A 2E4UA 5ALRA 5DWDA 1JX6A 4CM9D 3T9DA 1EHCA 1VXRA 2Y0BG 2Z3WA 4IDDA 2Q9AA 2FQ1A 3CHPA 3FH5A 3FPBA 4KQIA 3HC7A 1GQFA 1TIPA 1UMCA 4Y6LA 1I6KA 1JZTA 3H5WA 2BFNA 4ZJYA 2FJ0A 2OB2A 5ULLA 4WERA 3BMQA 4AY4A 2JIQA 2NXPA 1S3GA 5L3ZA 4DV7B 1VA5A 3WL4A 3WG9A 1RRFA 2B7BA 1KIMA 3JQBC 1N9GB 2J49A 2J0EA 4QNRA 4GB9A 2BKUA 1C7ZA 4UCXA 2J33A 3W1WA 4GM0A 4HRAA 5ICMA 1R4MB 3HCCA 2DHEA 1EH5A 1JQEA 2KM4A 5LMNB 2OE2A 1JIXA 3PHBE 2VJPA 1S89A 4HF7A 3TK1A 4AJNA 2ZK7A 4OAUC 2D6FA 4JT4A 4GCOA 1SOMA 5EWMA 2OFFA 1HH8A 5FPSA 1RVV1 4L27A 3ZHTA 3LZCA 2AT1A 1E7QA 5FPYA 1ZIXA 2XVXA 1EB9A 3IYLW 3V1LA 5LA6F 3EIUA 4DLKA 4BEBA 4BV9A 4XCVA 1NMXA 1NP3A 2C2WA 3HHEA 4OFXA 1JYFA 3UT6A 1SNYA 5LP6F 1NIPA 1X1DA 5HG0A 4C0BA 5KJCA 3LC7O 5SY9A 4N2QA 3OO0A 3GPLA 2CJPA 1G3UA 2NVUA 1N8NA 5FBHA 3AVPA 3EHEA 4HAWA 4AUEA 3BMOA 3PQEA 4H0FA 1X1BA 4G0ZA 4CIDA 1K2WA 4CGYA 1Q1NA 2KM1A 4PPGA 1RMYA 4KOAA 1EBBA 3A4IA 2IF0A 4B79A 5B6PA 3D02A 4XWYA 4DGQA 1IFXA 2BEDA 5A02A 2OWDA 4GQAA 3TBHA 3PFKA 2OXEA 1SXJE 4URYR 3OQ6A 5HX7A 3JD2A 1E3IA 2FW9A 4JBYA 5B1DA 3EGVA 4JYZA 3TF5A 5L7TA 2P1RA 5JASA 3ZDDA 1Q0SA 4BB9A 4UUMA 2CF6A 5AP9A 5MFZA 1CUFA 4FB5A 1XTTA 1T6ZA 1FFYA 3TW8B 2NGRA 5K01A 4QXMA 5BN3A 1R8JA 5CMYA 4DV2B 4FGUA 1OIVA 1RKBA 2VDPB 4L23A 3F8TA 4C5CA 1QC5A 4FBGA 2XUKA 4QFBA 3IJEB 3MWGA 1NAHA 3U1VA 3CB2A 3AHJA 5THXA 3UJNA 5CDFA 2BMFA 2C4VA 1XMVA 4NL4H 3IMCA 3EDTB 2QHXA 1VYHA 1GARA 5F7OA 1G1AA 2PIAA 5F2NA 4MB0A 2B94A 1KMHA 2GD6A 5L4LA 1BWRA 2B8WA 3FHOA 5KWVA 1FP1D 3QBEA 2PUTA 3JVIA 3CWCA 3KQLA 3X2FA 4NBRA 5KWIA 2HZBA 4ODIA 2IHUA 1SKYB 1BW9A 2FMXA 4O4JF 1OXBB 1EFTA 3FWYA 4LRUA 2ZZNA 3PXCX 2BN4A 4PFSA 4E2WA 3KJXA 1WDMA 3ABSB 4EJSB 3IE0A 3N0WA 3QKRA 3NNDA 1RPZA 1ODIA 1RQNA 5FYQA 1NMYA 1GZUA 2BFMA 1O77A 4JJ4A 1PNOA 4NCIA 1WVMA 4D0NA 1N6HA 5GVSA 4DQXA 2ZDQA 2CDRA 1AK1A 3G68A 1RBMA 1WPRA 1BCSA 4J1TA 3PDCA 4BDSA 2PQ0A 4DSNA 2F90A 2YV2A 4K40A 3WLQA 1QCZA 3AHCA 5DTMA 4YVOA 1D8TA 2DUJA 3IOCA 5AKEA 4HKTA 1AB5A 1QUEA 3G2MA 5KWEA 1DQSA 2X6FA 4ARAA 4EI2A 2Z2XA 3Q73A 5EE1A 2PK3A 4AS2A 5F78A 1E5QA 1Y4ZA 4YGXB 3AY3A 1UAGA 2AK3A 3GJTA 3RTCA 1AA6A 3I3OA 4TKLA 4CFZA 4FSDA 3DTVD 4FEGA 1GUFA 1UBKS 1YVEI 2PXCA 5JV5A 1C2YA 2G88A 3BWMA 1RZRA 1UKCA 3Q49B 3U4IA 2ZEJA 5FJJA 5TV2A 2VF7A 4ZCPA 2J07A 2EILE 4JLSA 5CLFA 2Q3MA 1W4BA 4P4SA 3ZDCA 3MTGA 3AI7A 1O94D 1T0PA 4G0WA 2FZ5A 3TSOA 5FBQB 1BGWA 3WKAA 2QEQA 2YWCA 2P91A 3EVBA 3TKAA 4IYJA 3DDCA 3I61A 3W90A 4JI5B 3IPXA 5K3EA 1Q57A 2J5KA 1DC5A 3B6EA 4GQIA 1UBNA 4YRGA 4K6CA 2NOAA 3PHJA 2IXTA 3FUDA 2Q1TA 2HTFA 3OCVA 2PRKA 1Q0HA 1W49A 3ZCXA 5EQFA 1W85A 4QPPA 2F8XK 2OBNA 3JAWA 1GV1A 3NVAA 3TCXB 4HLQB 1A69A 2JLSA 4PG8A 4EBAA 2VYNA 2Q21A 1XNFA 4L3VA 3P4UA 4FW8A 2AWIA 3FUVA 4KL8S 2ODAA 3TECE 5EHQA 3HP4A 3I1JA 4LWPA 1B6GA 1Q7GA 3SSAA 1KSHA 3K1AB 2X9LA 3KV3O 5IH3A 4BX9A 1CB0A 1K7SN 4RK6A 2PG3A 4LQCA 1LSJA 5JDCA 2G63A 4RD6A 2CNKA 3CRVA 3GUHA 4JLAA 4JJZA 3BXHA 5C34B 3DUFB 2V7XA 5CCLA 4YUXA 4BPBA 4HZIA 1SQ6A 4R31A 3WFJA 1O6GA 5TT1A 4HB5A 5ICEA 1YS7A 4L28A 4YRDA 1YVUA 3PLAE 3UK0A 3FAKA 2KBEA 4QU9A 4XB2A 4ALMA 2KSQA 1FYFA 3R6LA 4JVMA 3EWSA 4RXTA 3D31A 1E6EA 4RC9A 4ZI7F 2MTBA 1GT91 5DCWA 4KFSA 3CY6A 2AHOA 2EQBA 3BD9A 5FWXB 3H1FA 4B7ZA 4XIJA 1UXGA 1GW6A 4DV5B 1HWYA 2CLIB 3T5BA 4Q1FA 3UF0A 1E9CA 1D9XA 2G5GX 3MGAA 4YCBA 2CHGA 3N1UA 2WMOB 4CM9A 2QPLA 2NYJA 2VHYA 4RMHA 4A0SA 4X95A 3W2HA 1IN8A 4QBGB 4JLJA 2DUUA 3AR6A 1L7AA 1H0SA 4LJSA 3OIVA 4K2AA 1LDEA 1EE1A 5AW1A 5CT6A 2L82A 1C14A 5ITZB 1KFJB 4HGQA 5CFZA 3PBKA 1KEEA 2XEEA 3CK7A 3FPGA 1G8AA 3FBTA 3CBQA 5D6NA 2F8MA 2C5GA 3QOWA 2Q3FA 3SXUB 5FB3A 3ML9A 1C4WA 3PCRB 5G55A 4HOUA 4QG7A 4DARA 2PKXA 4V0MA 2AZTA 1DKUA 2HWUA 2E18A 2O7QA 4URZR 4PBTA 1IHYA 1CPYA 3Q79A 2QAGA 3R3YA 5D3KA 2XYGA 3W5SA 3Q8LA 2PLRA 2OENG 4US0R 4B89A 3EIOA 3RJ9A 1OFHA 3D5QA 4CKBA 3UFXA 3ZDRA 3FCOA 5K0FA 1T1JA 3OCUA 1FT2A 5EMLA 3DYIA 4MPTA 2QY7A 2ZSFA 1Q1AA 4BNDA 2CL5A 2YY7A 2WDPA 3N2GB 3U0BA 1AP7A 2W0MA 3CRZA 3L82A 1L7DA 3VUEA 1RAFA 4O2AB 1CETA 3QMPA 3WTCA 4AIFA 5J9FA 3RF6A 2G83A 1J21A 2X9NA 1J0BA 5ARGA 4M53A 1DCQA 2NVWA 3W5CA 1VCHA 1KZHA 1VJ1A 1Z45A 3E61A 1LS1A 2X0JA 2YJ6A 4FZVA 5CH5A 1N7HA 3UQZA 1GNVA 4TVSA 4D6YA 3G2QA 2GF0A 4ZRNA 1GCIA 1E8WA 3FPCA 5FLEX 4B3XA 3DAFA 1HOXA 1VLJA 4BVHA 3BJZA 1F48A 2OSVA 5A4AA 4EA9A 1XUOA 1SXGA 2JGJA 1OHHD 4OKSA 1OXVA 1OYOA 4PNHA 3OMLA 2FPGB 2LTAA 5T4YA 2C4WA 2QIPA 1SUPA 1N2OA 4FQ5A 1YZVA 2UYYA 2BVNA 5AW7A 1YA0A 2H65A 2P9FA 4MGKR 1GPLA 5C5IA 5L4NA 3IE2A 4EF6A 3U7IA 2AL7A 5AK6A 5LD2C 3E9RA 1H6BA 3A26A 4DG5A 4EITA 2BCJQ 9LDTA 4LN1A 2FHPA 5B53A 4B94A 4C7OB 4QUEA 4DK5A 3KKOA 2PJUA 2PVPA 4DY6A 2EINE 3D2LA 4JUIA 3K05A 1S2IA 3GD5A 1FTSA 1G8SA 1Z18A 5CVTA 2C4UA 4G9GA 4RIIA 2VJOA 2AFIA 2WD7B 5JFGA 2J9YB 4KO1S 3NETA 1OQAA 1GZ4A 1NWHA 4TMZA 4HEQA 1OXKB 5B58C 3R0XA 1UDAA 1TA0A 2C9ZA 3WGTA 2QRHA 3B1KA 3IILA 4L9WA 4M2LA 4G5HA 4MW9A 2GEJA 4EZJA 3ZTYA 2CC2A 3MN1A 4U9IS 1NBMD 1IJBA 2AMJA 3R3UA 1N5JA 1KEVA 2FJBB 1G3IA 1N4PA 1WEHA 3BX1A 4LZNA 4TL7A 3RRJA 1ZNYA 3BJEA 1WABA 1ZEJA 4CMAA 2J6HA 4LAFA 3VKGA 3WGIA 2PZ8A 2NACA 4ZEVA 4BCCA 3NB0A 4HBGA 1YOBA 2O20A 3I6MA 2J3QA 1KY2A 4ZIRB 1I1QB 1VSUA 4A27A 4ZYVA 2V3VA 4EG6A 1OCRE 3P9RA 1KZOA 1XZDA 1GPMA 3OTIA 2HEIA 2PZJA 1G9TA 5IJZA 4GFDA 1UKBA 3VKHA 3R7BA 3OMXA 3V1MA 5ENTD 3LX6A 3BBPA 4KPEC 1M0WA 1UJ2A 5JUWA 3I9LA 3TQTA 3G59A 5JJIA 4FYPA 1I51A 2AWOA 2E0IA 2G1JA 2UV8A 4I4LA 3Q15A 2G72A 1IXKA 1CC1S 2PVSA 4BU0A 4BO0A 2XITA 1ECLA 1FBTA 4M7RA 3UINC 3CLTD 3JARB 1CJBA 4FIZA 3RQIA 4HFJA 3T3NA 1DRKA 1KYQA 1A72A 4EARA 2IFUA 2GW1A 1I0ZA 3NM4A 1MC5A 4WLNA 2PD6A 2EHDA 2RG8A 4BNXA 2QZ4A 1HYQA 4N3BA 1ZMRA 4ZT3A 3DTVA 3IPYA 4QA9A 3EQ2A 1QX4A 3HO6A 1RYBA 1R8YA 3WISA 3ZLUA 4P92A 5AOCA 4K3VA 3IE1A 2ZS7A 3AJDA 1Q84A 1GA6A 4ZV9A 4K6MA 5C4GB 4NBTA 2ZUBA 3O8LA 2VPXA 1SM4A 1UJ4A 3VOSA 1MX5A 4NMMA 2ZRJA 1O94A 3COZA 3RADC 4Q93A 2XA9A 3KQHA 1IIRA 3EK2A 1UFRA 4Q7QA 3O47A 2AJTA 3LGXA 2HQSA 4HH4A 1M34A 2GPTA 4IUCS 2AJDA 2K7ZA 4QOEA 4D26A 1NZNA 4NBVA 2P7HA 4B0PA 3SQVA 1L3CA 2CMHA 2X40A 2AD1A 3TFQA 2KMLA 1SQ5A 4EOGA 3L8CA 3NATA 1GRNA 3LZ6A 3FKSD 1HQCA 5BQPA 1TZMA 5HK8A 3DPIA 5JQGB 3TWVA 4IIFA 5KYXB 2HW8A 2V0GA 3DOUA 2PX8A 1NQXA 1HT1E 4EKEA 4WW0A 4NCNA 2X14A 4LWQA 5TF4A 4R9UC 1V3QE 1RLJA 1DRJA 2HBRA 4IIJF 5JO9A 3G85A 2PX0A 2IPOA 2IEDA 4LNBA 5J4HA 4H60A 3N6XA 2O0KA 4R2XA 4N18A 2HCRA 4UEWA 3TW0A 1I4EB 3ETNA 4ZHQF 4BKUA 4UM8B 2O8CA 4XKBA 4UAGA 2LCIA 4IZOA 1HE8A 5AKLA 5KWSA 2X5OA 1MC1A 1M9NA 1L8AA 3CUWA 3RU0A 1DV1A 4PZEA 1OLUA 1HTTA 2G09A 2VGXB 2FX3A 4RWEA 5J1SB 1XU7A 5EHNA 3BMCA 1M6YA 3MRVA 3QK7A 3N8NA 1DOHA 1C9EA 2OZLA 1V2GA 4MVJI 3DLCA 3ZOZA 1I2ZA 3KQSA 5CD1A 2CD7A 2P6NA 4RF4A 2QUAA 1UBCA 5F23A 1RFGE 3F71A 3EIWA 4HQNA 1I24A 3WMWA 4H1HA 3GQVA 2XNSA 3KX2A 1E2UA 5DHUA 4OQYA 4YDRA 5K3OA 4UWHA 4PS0A 1ENPA 1SHJA 3FOFC 3AM5A 4G6ZA 3GL9A 4MKRA 2AYYA 3AINA 4QGAA 1V6AA 3U3OA 2P4SA 3K70C 1HDXA 3AFOA 3W8DA 2X41A 5CUQA 4RVDA 2V7TA 1PWHA 4LXIA 4I2NA 4TWJA 2Y0EA 5EWLA 1KC1A 3B1ZA 1DC8A 1UBUS 4I9NA 2C57A 1GUYA 1GSIA 3MGGA 3L77A 1SU7A 3ZV4A 1OWPA 1J06A 3TD6A 4N5CA 3COVA 3FOWA 3ZI0A 1E7MA 2R0QC 4ZOLB 4XEIG 1FF9A 1SHLA 1EFRD 2IOYA 3VH3A 2BOVA 4DCOA 1M2NA 4R54A 4A15A 1NMQA 4MRPA 3FH0A 5CIQA 1L7VC 1N4SA 3HY6A 1Q44A 1UXHA 4UHCA 1YJBA 5L53A 2EQAA 4RLHA 1KZ4A 4DWWA 1OA0A 2C2GA 3OPNA 4ZCLA 3BGIA 2PSJA 2A5FA 2IZ5A 3ZJYA 3FHLA 1XCLA 2EJWA 3DL7A 4ZREA 4CWAA 3R0JA 2GQ0A 1PU2A 1WZUA 1GPKA 4JP8A 1KQNA 1FMTA 3KKLA 4ZAWA 3FYSA 4L0CA 2QGZA 6REQB 2HIHA 4B3IA 3N07A 5BOSB 2HWYA 1H19A 3KLMX 2FV8A 5AVXA 2I9PA 1Y1QA 1O7JA 4A3TA 2FFAA 2FHSA 4I81A 2KQUA 3UPUA 2C3YA 2CHUA 3FN4A 2GBLA 2AW6A 5J2TF 4X24A 2P2SA 1IHPA 5C2JB 3AL0C 1ELOA 3MWDB 3I2FA 4Y0VA 4ED9A 1NP6A 3KQNA 4YCDA 2WVGA 3A9VA 3COSA 2WU1A 1MEJA 2GM3A 4N5QA 2XD4A 4V03A 1K7EB 3D3EA 1TKRA 1XO1A 5AKJA 3ZNGA 2WWRA 4LOIA 4BMXA 3BEDA 2QX8A 5DHRA 1GCUA 1FX0B 5IBPA 1S7CA 1OAOC 3MAAC 1MYOA 4MOWA 1E1NA 1OHHA 4DV3B 1E1CB 1FVOA 1VMDA 3L8DA 4GICA 3TKLA 1NZFA 3OZTA 4M7WA 5B3KA 2AW5A 1IY1A 3P26A 5LXTB 3NZSA 3X1XA 1T5HX 2JASA 4URWR 2DHCA 3QXSA 1J9GA 3PRJA 2AJBA 2FTKE 1JG1A 4D4LA 4LJLA 4AJKA 4CLDA 2OV1A 4OGLA 2DGDA 1NQOA 4ZK6A 1ZM4A 1LDGA 3ZY5A 1VBKA 5F4BA 5IW8A 1IY0A 3AUXA 1ND6A 4ZKDA 1H69A 3T3DA 2EAUA 4NENB 4UDOA 4K28A 4W9NC 4MH0R 3HSSA 2UUPA 2XF8A 4S1PA 5IBQA 4YAJA 2QL5A 3DB1A 2JD0A 3IQHX 3G2NA 3QUAA 1DXHA 1TKCA 4ZN6A 2JBAB 2QZ9A 1NZDA 2PGJA 4Q15A 4BWYA 3FHTA 4CKCB 1ILEA 1NBMA 5DN6D 2O8EB 4P2BA 4F1WA 3D8HA 2IPXA 1QTNA 4BNGA 2EW1A 5DNEA 4EBFA 2P9IG 3SR3A 5GIPE 4IFBA 4CU2A 2PQ6A 1YBVA 4X9XA 1IHOA 4UNSA 2D5LA 1I9GA 3L02A 3R6TA 4BN5A 4UCWA 4KSYA 2ZDGA 2I2FA 1EK6A 4HWTA 3ISMC 3RFUA 2GZAA 1GXSB 4AD8A 3RJ5A 5H5JA 2VUHB 3B3QA 4YYZA 4I43A 2IOFK 3QC1A 5T3YA 1Q0TA 4P7JA 3L4EA 1EXDA 5G4LA 1O87A 1YA6A 4B93B 5ES3A 2PH7A 1IVYA 3PJFA 2IYYA 4IDHA 1QIIA 1QFSA 4NACA 4OUDA 4PF1A 4X8QA 1ULHA 3C74A 3LBIA 1X87A 2A9VA 3O8RA 1K7CA 4QHSA 3DJFA 5COBA 5CXSA 2IEIA 2W8BB 5K45A 1R8SA 3CR7A 3GZ2A 1OLSB 3GDWA 3WK8A 1LK7A 5U4XA 2UZ4A 4DREA 4FMBB 4DT1B 2NUPB 1Z08A 2DB3A 4MUMA 1I0LA 3UUXA 5A3QA 3ADBA 4RNDB 3WLIA 3VA7A 2UYOA 4WKOA 3B3JA 4XTCS 3HN2A 1GKLA 5AI9A 3RTBA 3H2HA 1M6EX 4UYKA 2RGCA 2V5UA 1BNCA 1SRQA 1E5VA 3IMKA 2YIMA 4OSEA 3MGBA 1XQYA 4E7OA 2PV7A 1VYVA 4DRYA 1CR1A 1OH7A 4U63A 2W2QA 2AZXA 3D8BA 2WQ6A 4OJNA 3EWIA 3OUUA 3R5KA 4RIFA 5EJ2A 4UTPA 3SQLA 3K31A 2MSDB 1FRZA 5KYYB 3S6JA 3H83A 1N92A 3PYLA 2NXWA 1NVTA 5FI0B 4UTRA 3CN9A 4H7PA 4CMGA 1L8OA 2WE8A 3UJCA 2IU1A 4MVJD 2XKJE 5DP1A 1JQDA 1VPLA 1W44A 2Z2IA 3T5TA 5KYUB 1G3NB 2V7GA 4BJ1A 1LJUA 3H17A 1L3BA 1O54A 3GG2A 3CRQA 3FKSA 2RI6A 4KGXA 1KO1A 1L5GB 3RK6A 3PIDA 2ZJ5A 1GSHA 4BS9A 1XZKA 3ANMA 2A9OA 3WADA 2G25A 4MW1A 4HUTA 1TTHA 5CX4A 2H5EA 2UVQA 4HRXA 1OLXB 4FMPA 1BHO1 1G16A 4HK4A 1CDEA 3TE6A 3AJ9A 4LHEA 1T4GA 4FOPA 4HWRA 5C5DA 4Z1MD 2ZUWA 3LCJA 4JIGA 3SKXA 2ZSDA 1IHUA 1XVLA 3GBSA 4NCJA 4MVJH 3GLQA 4AYTA 1WP9A 1Y4SA 4U7GA 1S5PA 1Z6ZA 1X94A 1Z33A 2PZKA 5CAEA 3ESQA 4WWOA 3LS2A 4CG2A 1LTHR 5F5XA 1X70A 1J24A 3FUUA 1FXUA 2AXPA 3WNCA 3HYRA 3GOHA 2GO1A 5HJ5A 3OC6A 3QXHA 1UJ6A 2ILRA 4JGIA 3HKBA 3ETDA 4LX0A 4KO2S 2NUAA 2MRIA 4FYXA 4JMPA 5HXAA 3WTBA 4RHTA 3RSFA 3PWZA 3GDOA 1AX9A 1XZLA 5C4IA 2IZ0A 3KZOA 1WUYA 2CNBA 5TVKA 1LXCA 3KPWA 3HU1A 3EXFA 4KXXA 1EFHA 3CCBA 4PQEA 4HFNA 1DEXA 3UCFA 1IAQA 4HN2A 3RYFA 2SKCA 2CKDA 1Y5IA 2HU5A 2HFKA 3I37X 2BL4A 5EGSA 3WL5A 1AQIA 5CX1B 1KH2A 4UD6A 2QYJA 2H0RA 3CEJA 2YY5A 1O9BA 5IJXA 3Q72A 3F46A 5J58A 3E32A 1Q0RA 2H0AA 2O8DB 2ZSAA 1VL1A 1NA0A 4PPYA 2CG2A 2QTVA 1C8BA 2DHQA 1V9LA 4U3JB 2FJAB 2C07A 4UM9B 5EUCA 4ME2A 1YJ8A 5H3CA 1EFRA 2BMDA 3K4QA 2G76A 3T7IA 4D97A 1QGOA 1C0LA 1C81A 3TQOA 3CUSA 4TZKA 3W8NA 4V0SA 4KPUB 1O5IA 1R64A 2RHOA 5KO2A 1LCIA 2GJSA 1U8UA 3LKVA 3WLHA 3L41A 1YHZA 4V2UA 3QXXA 4AN4A 3SCZA 3LYHA 1DAEA 3V2IA 3FHEA 3OICA 4IIVA 5KYKA 2AOVA 4DC1A 3A31A 2DZDA 4QOIA 2XUJA 1FS4A 4GI2A 1YQQA 2LPMA 3LUBA 4LYEA 1JIUA 1EM6A 1OTHA 4HNTA 1Z5PA 4B71A 2Y69E 4YAKA 4OD0A 3B13B 4HFMA 3R7NA 2L6JA 4WAUA 4ZT2A 2UVPB 4GVLA 2PUGA 2LR0A 4GDFA 3MTJA 5TGTA 1E3MA 1IWOA 4B6PA 2HADA 2H06A 3FVRA 3MRXA 3WA7A 1D0VA 4BTEA 4P0TA 4BEVA 3PH0C 1EEHA 4NURA 4PYOA 1P2TA 5AM0A 3P1JA 4G4JA 4RQTA 5FNVB 3KLPX 1NPYA 1RLIA 2WKWA 3D3QA 3OZGA 4L5BA 4A5SA 2IYSA 5T4BA 3INRA 3NHYA 1YHYA 4Q24A 1H2UA 1UMDA 1UFKA 3AJRA 2R5WA 1VKHA 4KZCA 5K7SA 2JVIA 4BQRA 4EW3A 3GLFE 3EPPA 1OAKA 1XZPA 5LZ4A 5E4JA 3KPUA 3RT1A 2WF9A 1U9IA 2BHSA 3AF5A 3DSRA 2C20A 2YMLA 3KHSA 4OB8A 3REOA 4GOLD 3VVCA 3I5MA 2ONZA 2H48A 3JYHA 5EIBD 3T4EA 2V7UA 1XDUA 2O1XA 1KDRA 4RS4A 4PHCA 1YA4A 1N6KA 3JQ1A 1KE2A 4A92A 4ZDIA 2H1VA 4DX2A 3CO5A 1A7JA 1A2BA 5HWSA 2BTQA 3TWUA 2E85A 5G40A 2FRDA 1AZTA 4HWPA 3WWCA 2HMUA 3STHA 2BUAA 3OOSA 4PZCA 1XTZA 3OTQA 3HACA 2ZQZA 4HATA 4IMJB 4HRVA 4QULA 4E51A 1GL7A 5KTTA 2L0TB 4AQ7A 4A8JC 3EDQA 3TLJA 1MABA 2EL7A 3QELA 4AKEA 1K1BA 4ARCA 1B8OA 4BP3A 2PV0A 3N76A 3L7MA 4LJAA 2F9LA 1W59A 2X38A 3C2QA 1OFUX 4QOGA 4LYFA 3PDIB 3TIXB 2Q0SA 5A2GA 2LXLA 3ZDBA 2WF6A 5EXDA 4R05A 1YRBA 1XEFA 4TV8F 2AI3A 3JPWA 4YRJA 4DMLA 2VTVA 4FHFA 4EY5A 2AD5A 2P6RA 2I2XB 3H0CA 5DN6A 4RVBA 3K8YA 2J5XA 2ZTMA 4NOMA 4X6XA 5BT8A 1AKNA 3L4BA 3BD8A 4GX2A 3G9UA 4XLZA 3PZ4A 4L08A 3IHTA 2Q2QA 4UQXA 4Q7MB 4NNPA 4QATA 3QGMA 4APFA 3KDSE 1QXSA 5DRTA 2BFBB 4AU1A 3LP8A 3B38A 1GSAA 2P9HA 4Y2RA 1AHNA 3VJMA 7ABPA 2QVZX 3WV4A 1GG2A 5BQ3A 1DX6A 1V8OA 1WV1A 3MV3B 3I6BA 3TLZA 1JCRA 2FN3A 1OIXA 1LVGA 3MM4A 3IEUA 3R40A 3EZFA 1YDFA 1DWOA 4ZCIA 2PA0A 2XWPA 1VKNA 4P8RA 1FDRA 3D9QX 4CMEA 3QSYA 3HEAA 4ICIA 1DG1G 1ZN2A 1N2CA 1DJNA 4X8HA 2I76A 4WCVA 2ETBA 1DJPA 1UXJA 5ESDA 2X76A 4CL3A 1TE2A 1K4KA 3IAS1 3ZDFA 3OQIA 3PT5A 2XLBA 5DNVA 3LVQE 2HRRA 5LYJB 1TJPB 2NUTB 3VYWA 3O2NA 3STWA 3SC4A 2HLHA 1K6XA 2C8KA 1OYYA 4L5YA 4MRVA 5CRIA 5ALOA 4MRRA 1PZHA 3MT8A 3K2BA 4E07A 1GGFA 1EZ1A 1TEZA 3PZ2A 1L5RA 2RG7A 4EZKA 1RBZA 3WLAA 5HCUA 1QSGA 5JSUA 1ZMBA 4Q1DA 1EJ6A 4UVGA 2RK3A 3QPCA 3OIGA 2QW1A 2JJYA 2GJAA 3RSQA 4MAFA 4A8JB 3WJ1A 1BTOA 5CMWA 3LHKA 1VDYA 4WBXC 5EEHA 2JIDA 3WP1B 3HZHA 2AZMA 3PUXA 4TKUA 1RYEA 2HJHA 4MVJA 3QHPA 5KNGA 1AGPA 4DJ5X 2XQKA 4XLTA 2ZI7A 1WIWA 1ST3A 4MWCA 3C1AA 5KDDA 3HJRA 5DVZA 1RQPA 5KX5A 2GBGA 4LIPD 1YR3A 1G3MA 3LIPA 2EX4A 3E53A 3JQCA 5BQXA 1ZBQA 1K27A 4XI9A 3MA5A 2IX9A 4MUXA 4M1ZA 4ZHSA 3LSYA 1RXVA 1U7OA 3NOOA 4A91A 2ZRHA 4JY7A 2G9QA 5JANA 2ZLBA 4C9BA 2QD1A 4HO1X 3T0IA 1Y3CE 5B7QA 4Z1MA 4RJTA 5JCXA 1U5AA 4KNYA 1RYMA 5IS2A 2MOWA 3FTFA 4FT4A 4PAOA 5CB4A 2R60A 5IVIA 1FFHA 2ZIVB 2PT9A 4C4AA 3S5UA 2HIMA 3VR4D 4DR5B 5AVKA 1DIAA 4EB0A 1MW8X 4JDPA 2CFZA 3ZDQA 2XCCA 5FBLB 5EP3A 4ZZ3A 1Q83A 3CWQA 4WOPA 1M2JA 4P3KA 3KVRA 5ADWA 3J80A 2ISCA 2WABA 4D4GA 2A1TS 2H0QA 3WLRA 8ADHA 1XD2A 1J5XA 3TSCA 2J6CA 1VECA 1E2HA 3ZY3A 4PNZA 4RVCA 1UEXC 5JMTA 2GCOA 3ZY6A 1UFOA 3MHTA 1TLLA 4ZAGA 1PS9A 3GGGA 3PTZA 3AV3A 2R84A 1OA1A 1QIMA 4OM7A 4LECA 4X6LA 2GPJA 5JNLA 2BFCA 1P4AA 3E9ZA 1CY1A 4GGMX 4YI5A 3UBMA 5E3HA 3ZWVA 3PS9A 3OXLA 2X8AA 3EOBI 4F2WA 1W8DA 1YZHA 4JOQA 2HXSA 2R8PA 1GNQA 3BRQA 4DR2B 2O7VA 4RLQA 2EG9A 2FUG1 4QYIB 1WDWB 4LE1A 2FJUA 2Q45A 1NXWA 2YBEA 3STVA 3K09C 4EJ2A 5HRYA 1CR2A 2M1XA 4NJEB 3PRYA 3H8JA 4HXYA 4JEUA 1TUIA 4XI0A 3RBXA 1N4DA 2Z43A 4YRQA 3HHPA 2R7NA 1TJYA 3LT0A 4J7AA 1MGPA 2F1IA 1RRMA 1EVJA 1Z82A 4LTDA 5IHXA 1IE3A 1F0PA 1C3OB 3D4OA 2I6FA 1X86B 2FOLA 4LJ6A 4GL2A 1EINA 1Y80A 5BRAA 1K8KG 3DBHB 5JS8A 2Z3ZA 3QDNA 3LL4A 1O89A 3O93A 2HKIA 4R84A 3NBNB 2VF8A 3JD4A 3DQQA 5KQPA 3DAHA 3LDGA 2F37A 3VOBA 4DIOA 5AJXA 4PCVA 1DRWA 1GKUB 2FPIA 1IXSB 2WQZA 3LS8A 2V8OA 4EJSC 4NABA 5G4KA 2P8JA 3HRIA 3FFAA 4YJ3F 4JP3A 4Q0MA 2VDLB 5JPDA 1OUMA 2J7PD 4AZTA 2M6RA 5H9VA 3FHCB 3OWOA 2PLWA 3QMVA 2H1OA 4Z7OB 3U37A 1DRUA 1FNNA 3FOEC 1PI3A 1JWBB 4BLSA 1X9IA 3EGWA 2H4XA 2WWYA 4K9LA 2EFGA 4IL5A 5IYZF 3PL5A 4MS4A 4B6JA 1TCUA 3W9UA 3HXBA 3DD1A 1Y4AE 2OOSA 3GYXB 3MCTA 2Z1NA 4Q37A 3IRUA 1AXGA 4A5OA 3KB2A 4C5AA 3PCTA 1FDVA 3F2IA 5KBAA 1QAQA 1EDOA 1XHEA 1DQNA 3S81A 5IAEA 4GZLA 5D5PA 2B1QA 2BMEA 5GVRA 1OI7A 2GPYA 1EJ2A 3EW7A 1T0UA 2JHGA 4H7HA 3EF3A 1EWVA 4M54A 3TFWA 1SHTX 3MWYW 1KK3A 3TGPA 3RV3A 5A62A 3R6WA 1QIEA 4I1YA 5D3ZA 4BFZA 4TV9A 4DIFA 4NV3A 3IP5A 1PZXA 1NN5A 3OKAA 3NDRA 4OOEA 1IY9A 4GYJA 4CHTA 2Q29A 2VHUA 4MQLA 3P9CA 2XX3A 1CY7A 1GGKA 4F3TA 1ESMA 2ZSJA 3T3MB 4MPJA 1AT1A 3KPVA 1D5CA 4U2GA 4OJMX 4EAQA 3R3VA 3CE6A 1GGNA 3HCBA 4EMSA 1W6UA 4QO8A 3VMMA 5EJ7A 2XOKD 1GL3A 1KDOA 2WQHA 3O9ZA 1K5GA 1SK9A 4CVNA 1HUQA 3HCDA 4LJ9A 4JUCA 3K94A 4G86A 4EQ6A 5F2EA 1IBCA 1N5LA 2QX6A 2YHUA 1NBEA 2XGOA 1VXOA 3EFOA 3WKBA 1XAGA 2CBZA 1CRWG 4CCSA 4GHWA 4NEGA 5JO0A 4HNUA 5G2NA 3KJEA 4K9DA 2B21A 3SJAA 3SC3A 2H17A 4JJGA 5AAOA 4MQEA 4PSAA 1IDOA 2OR3A 3UMJA 4BE4A 3PX7A 4E4TA 1PJ3A 2DTXA 2CNDA 3WLFA 5DTIA 4AI6A 4WEQA 2CEAA 3GRPA 1GNRA 3LKZA 1JG7A 4XFJA 4A8PA 4RF3A 1IK6A 3DVAB 3I8SA 5AHOA 3ROEA 2CLEB 3LXMA 4BNUA 1E4YA 4RJIA 5ALFA 4YV2A 4GLLA 1QWOA 4NC9A 1G42A 3M83A 4LDRA 4YDWA 3OE4A 1XTUA 4OY3A 1CWUA 1KR5A 3C15C 1AJEA 4GZCA 4PX2A 5K6AA 3S2IA 2IEBA 4X20A 2EDAA 1T2DA 2B35A 4TSRA 4C5BA 2AG5A 2E4YA 2PGIA 4GKKB 2L18A 3CTMA 4KHPB 3R76A 4MS1B 5CDFE 1S8NA 2C95A 4CNQA 4KWEA 2PUVA 5A6SB 4Y6PA 1EFUA 1N33B 2GLUA 1RRGA 2VLIA 2QYUA 4IV8A 3R4CA 1CRPA 5K2OA 4DLNA 1UZAA 2VJAA 1DRVA 4O5OA 1GZHB 3S2GA 2P2NA 2H5LA 3Q9UC 4N9WA 5KC9A 3L9TA 2NU7A 1DMRA 1DT5A 2P6UA 2HPVA 3DG9A 3IKVA 3M2PA 4YHBA 4NFHA 4DJAA 3UENA 1RSZA 2H54A 3D9JA 4HI9A 1IOWA 1U8CB 2B8NA 1N1GA 2GHQA 4C0WA 1ZINA 3CNQS 1U8AA