4GZ3A

Crystal structure of human o-glcnac transferase with udp and a thioglycopeptide
Total Genus 279
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
279
sequence length
715
structure length
695
Chain Sequence
b'PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKHIYDNRIVLNGIDLKAFLDSLPDVKIVKNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
total genus 279
structure length 695
sequence length 715
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz3A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz3A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gz3A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gz3A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gz3A03
2QN3A 3HBFA 4M60A 4X7PA 3L7DA 2R4UA 4N2SA 3T3EA 2QRGA 3MS2A 4GPBA 5CCMA 3NB0A 4W6QA 2VSYA 5HXAA 3DD1A 4KQ1A 4J0UA 2PQNA 4JA9A 3ASFA 1K06A 4UQZA 2QRPA 5D0QD 4A1SA 3ZN3A 5D0OD 2VG8A 3UYLA 2VGYA 3VDNB 3QWPA 1SXPA 2VCEA 4HWGA 4GA2A 3TG5A 2ACWA 3NP9A 2JLBA 2GM9A 3LKUA 4GZ3A 1L5RA 4CTMA 4EQFA 5KJKA 3PE4A 2G9RA 3CV0A 3E3NA 1WW3A 3RU0A 3MTAA 5A7DB 5EKQD 1NZDA 2G9UA 2SKEA 2FF4A 3RO3A 1P5QA 2SKCA 3C4QA 3MTBA 1RRVA 3MV2B 4HLNA 4YI5A 3RSCA 3TAXA 5HQ8A 2PYIA 4AM9A 2V5FA 4HOTA 3QKYA 4KQMA 2YHCA 1J39A 1UQUA 2LSUA 1KT0A 1QKJA 2KC7A 1F6DA 2IEGA 3S7DA 3ASGA 4EJ2A 5FZSA 1FTYA 4AY6A 4AY5A 4RG6A 4I17A 2NC9A 3ZFWA 1Z6PA 2XCUA 2FF5A 2PL2A 1FC0A 2IYAA 3L7AA 1PYGA 2IUYA 4L22A 3S2UA 4YVOA 2VGXB 3VDMA 2Q6VA 1WAO1 4BQIA 2QNBA 4HORA 3H4TA 1ZBPA 2UY1B 1P4GA 3BDAA 3O3CA 5LQDA 2AZDA 3BCRA 2YQ8A 2WQHA 3EDTB 4MI9A 2QZSA 2WPVA 5FTPA 5AYWD 1C8LA 1IXYA 3PE3A 4N5CA 4J8EA 4H7XA 2F3PA 2JZCA 2F3QA 1KT1A 3MV3B 2PQRA 5BNWA 3FP3A 2KATA 3T3IA 1IHGA 4YNDA 2BFWA 2G9VA 3Q5MA 2PRIA 3E3OA 1Y6FA 4G2VA 2VGXA 3T3HA 3LCAA 1JG6A 3UQ3A 3WC4A 5EX3A 1YGPA 1E1YA 3OY2A 2X0EA 1Z6QA 4CDRA 2BGUA 3GZ1A 3H4IA 1ELWA 3TOVA 3CVPA 1FTQA 3QDNA 3T5TA 1ZU2A 5D00A 3ASDA 3NC4A 2KCVA 5JJTA 3FFLA 1HLFA 5BT1A 2QN9A 2ASVA 4REMA 2X0FA 7GPBA 3U4TA 1GPAA 1W3BA 2IEIA 3GYZA 1WV0A 2XGOA 2H1FA 5IKOA 2PZIA 1XKXA 5TMBA 1SXQA 4N3AA 2KCLA 3BCUA 4EL5A 4NQ0A 5IKPA 3MRXA 3D0RA 2GPNA 2FBNA 3CK9A 3RIBA 1NLMA 2GPAA 3CKBA 3OXLA 3RO2A 1WUTA 3NF1A 2MHKA 2Q7FA 3CVQA 5ARGA 4ME2A 3MT7A 4X6LA 4NRHB 5HI7A 3VTXA 2GJ4A 5KJMA 4J8FA 2YJNA 5ARFA 3CEMA 3BD8A 4XI0A 3DZCA 3BD7A 3E4BA 3EBOA 2H1HA 2IW1A 4RIHA 3GW4A 3HBMA 3AMVA 2XA2A 5DXFA 2QN7A 3MKRA 2O6LA 2X6QA 2GEKA 3KD7A 2QLNA 5LCWC 1C50A 4U0SA 1XC7A 2XPIA 3O48A 3Q49B 2BUGA 4N9WA 4G23A 3ZCPA 4G26A 1JIVA 2ZB2A 1EXVA 3S7FA 4BT9A 2PYDA 3T7DA 1NA0A 4AN4A 3WADA 2HY7A 1JG7A 3CEJA 1XOIA 2FO7A 2VYIA 3Q15A 1IYGA 2AW3A 1P2DA 5FZRA 2L6JA 1TJCA 4WADA 1NA3A 4APOA 3TG4A 4XI9A 4U04A 1L5QA 1VGVA 2GT1A 4F97A 2XCIA 2DBAA 2J9QA 4JHRA 1AXRA 2XCBA 4EL0A 2HO1A 2OOEA 5FZQA 3NAZA 3IA7A 4GYOA 3WAGA 4LDPA 1P4JA 3CKCA 2AV6A 2QN8A 1E4OA 3ZCSA 1FA9A 3S29A 4N39A 5DBKA 3UPVA 5ENZA 4GZ5A 3NPAA 1NZNA 2VCHA 4NESA 3CK8A 4I9CA 1B4DA 1GPBA 2BISA 5TVGA 3E3LA 3U3WA 1HZ4A 3ASHA 4JL0A 3R9AB 3LY7A 1PN3A 3CEHA 2ONDA 2XA9A 5JTUA 1GPYA 4KQ2A 4I1AA 3CVNA 1A17A 3S0JA 1KLXA 2C0MA 4N2QA 3L7CA 2GW1A 4WNFA 3G2IA 4FZRA 5KJNA 3GZ2A 3LY9A 2P6PA 1Z8DA 3MT9A 4BQFA 4QLBA 3S7BA 4W9RA 2QLLA 3QWWA 5LCWJ 4RBNA 3LYAA 3ZCQA 2G9QA 4RIFA 4G1TA 3OXGA 4AIFA 2FETA 5C1DA 3OY7A 1B89A 4PQGA 1QM5A 2UY1A 4KYOB 5DIZA 3VTYA 1AHPA 2VSNA 4GA1A 4IN3B 4UI9K 1GGNA 4MHSA 1GG8A 5TMDA 4WNEA 4M83A 3BEEA 5CHEE 4BQEA 4MRAA 3AS4A 4JA7A 1LWNA 2KCKA 3JYSA 2Y4UA 2ACVA 4U0ZA 2F3SA 2FI7A 2C4MA 3FWVA 3G2JA 2FFRA 4CGWA 2AMVA 1P29A 2QFCA 4XIFA 3MBOA 5DU2A 4LEIA 3Q3EA 4CTNA 4UQYA 3FROA 4GCNA 4UI9C 2BGTA 3CX4A 3HBJA 3CUVA 3IEGA 3N71A 2WTXA 4X7RA 1FU7A 5G05J 3UYKA 4HOQA 1BX3A 2LNIA 1PSWA 4WNDA 3G2LA 4J8DA 3S27A 1HXIA 2X0DA 5KJLA 1L7XA 1RZUA 4Y6WA 3G2KA 3HYMB 4WNGA 5CCLA 1P2GA 2R68A 3PDNA 1XV5A 3D0QA 3S28A 5I45A 2QN2A 1M5RA 1L5WA 3D1JA 5DLDA 3OKCA 1GFZA 5G04C 1QQEA 4GA0A 3SF4A 2QRQA 1NZFA 1F0KA 4H7YA 3UUXA 3OTGA 3CUYA 4YI3A 3ZCTA 1GZ5A 5TMEA 2GPBA 4WUYA 4RIGA 3CK7A 3DDWA 3TGOA 2R60A 1L5VA 1FCHA 4BTBA 4WHMA 1JEJA 2Y4TA 3ZCVA 2LSVA 1Y8ZA 3T3DA 2R4TA 4MI6A 1P4HA 4CTOA 4RIIA 1Y6GA 4X7MA 1Y8MA 2JJMA 3LPZA 3NP7A 3COPA 1K08A 3S7JA 2QRHA 2XCCA 4I9EA 1NVKA 2X6RA 3CVLA 3BEOA 3MEKA 1FS4A 1FU8A 1O6CA 4U07A 1FU4A 3DDSA 2HR2A 4BT8A 3QOUA 4UI9J 2QRMA 1L6IA 3ZGQA 3C48A 4YVQC 1IIRA 1JIXA 2SKDA 4MI3A 4BFCA 4I2WA 5JTTA 3VUEA 4GCOA 1ABBA 3MSCA 4N3BA 3WXXA 3RT1A 3AS8A 4F96A 2E2EA 2IYFA 3MRTA 1PC2A 5BW8C 3OKPA 4F3VA 1HH8A 4KXKB 3ULQA 2C0LA 1UQTA 2IV7A 5FJYA 5G05C 1L5SA 4UQXA 2KS6A 3BD6A 3L7BA 4ABNA 3RSZA 3LY8A 4B94A 1RZVA 3SZ7A 2F9FA 3URZA 1WV1A 1V4VA 5GPBA 3T3GA 2IV3A 3OTHA 4NEQA 2P58C 5G04J 3QHPA 5EX0A 1WM5A 3NCHA 3SYMA 3G2NA 3RHZA 1C3JA 1P2BA 4RIEA 3AS5A 1H5UA 4WACA 1NOJA 3CUTA 3EBPA 1WW2A 1YA0A 1NOIA 3CV3A 1XL0A 3ESKA 1NOKA 2ATIA 4GPKA 3OXFA 4RELA 1JIUA 4F9FA 2I6HA 8GPBA 3Q47B 3G2HA 4BTAA 1KTIA 3RJVA 1WUYA 3Q3HA 4Y6CA 2XGMA 1QZ2A 4BWRA 1YA6A 4G2TA 4GZ6A 4HOUA 3ZCRA 4FKZA 4EKEA 2F3UA 2XGSA 4CGVA 1C8KA 3RKVA 4G25A 3ZHEB 2C1ZA 1LWOA 5D01A 3C4VA 4Z5XA 1PNVA 2QLMA 3OTIA 4O6FA 3OT5A 5A6CA 3MS7A 2C9ZA 4U0UA 3VUFA 2XMPA 3GUHA 3MQFA 3QKWA 4NC9A 4AMBA 3CEQA 6GPBA 3HBNA 4M7PA 2ECPA 4MHOA 3ZCUA 3MS4A 4GYWA 4RG9A 3K9IA 5JJ6A 2R66A 3MRVA 2QN1A 3OKAA 4N3CA 3L79A 4I2ZA 1FTWA 3L01A 2AVPA 3ZHEA 3TSAA 2PQ6A 3CUWA 3Q4AB 2XA1A 2XEVA 3MA5A 9GPBA 2OFFA 4MICA 3QWVA 4LEUA 4HOSA 5JJ7A 1EM6A 3SYRA 3Q3IA 4EKYA 3CUUA 4YUAA 2R5SA 1ELRA 2IF4A 2C2LA 2UWJG 4KBQA 4G24A 2FEZA 3GPBA 4AMGA 3IAAA 4GYYA 2PRJA 2IFUA 1Z62A 3BCSA 5M72A 5FT9A 1UZUA 3KS2A 2HYZA 2VQ2A 3KAEA 2GEJA 3ZPJA 1A8IA 1XL1A 2C1XA 3MTDA 4RENA 1E96B 1XNFA 3MT8A 1OUVA
chains in the Genus database with same CATH superfamily
3JQCA 2GN4A 3AG6A 1ETUA 3TLMA 2CXHA 1QRRA 3GC6A 2I7TA 1JU4A 4G5HA 4YDYA 2LO6A 4OOFA 2O4UX 3DBLB 2CSUA 2O2SA 2CVHA 1TIKA 4LNUB 1A7AA 4RFSB 3QEMA 3EQ2A 4BIMA 3WHKA 1VG9B 1EK6A 1NZDA 3H1BA 4NARA 3DSRA 4KUGA 2JAWA 3U7EB 4YGYA 4F6RA 4L0QA 1O03A 3UJNA 4LWOA 2Y9MB 1SZAA 2HK6A 5HJEA 1Q20A 4UBOA 4MI9A 3CKKA 3AYXB 5A4KA 2D13A 1KJ8A 4IMPA 4MUXA 3E5NA 4M9CA 4BCDA 4KQWA 3AY3A 4R0VA 4PX2A 5JU6A 1FLVA 3TLAA 4XSHA 3QFTA 1DKNA 1U7TA 2OCDA 2DBYA 2NSJA 2CSXA 4JP8A 2DPYA 4LDJA 1RR6A 1X4RA 1ZRMA 3MWDA 1LPNA 4IVPA 4RYLA 5ETJA 5B1AE 1UBOS 2IXGA 4JH0A 3AERB 4X3PA 4X44A 3DZJA 4ZYUA 3M82A 3VNSA 1G66A 2CKDA 5H68A 3WNQA 4RIHA 5G0TA 2PDAA 4F3CA 3TTXA 2XEXA 1UW4B 3V34A 3AHJA 4ZZ3A 5K2MA 3KX2A 3DZIA 2YJ4A 4BVKA 2FUG1 2QLJA 1NI3A 1EB9A 4LDZA 4F97A 3EDQA 4CCSA 1FS5A 3FNQA 1IJKA 2CDBA 2H48A 4G09A 2QN8A 3MTIA 5BQ3A 1T5BA 5L7YA 4C1NA 5GGYA 3LQKA 4ZI3A 1UXGA 5SZHB 1LS6A 1P4AA 2PG3A 2Q6KA 2P0EA 2NUPA 3Q9UA 3TRJA 3K31A 1HX8A 1FDWA 2FZVA 1B3RA 3GA7A 3ZCQA 2YWDA 3JZMA 3BTOA 5TXGA 2FETA 2BDEA 5L3QA 1XJ0A 3UAYA 2NYVA 1GNQA 5JSUA 2O0HA 3O74A 1TAUA 2YBDA 1JDZA 1X5BA 3MLEA 5BUCA 3VCXA 4HI8A 4IKOA 5FUQA 4YQYA 5CX1B 4RKEA 3IUSA 3TW6A 2D5BA 4HSGA 4OLFA 2QE7D 3OMXA 1ZIYA 4C4AA 3EZ9A 3K1YA 2C5BA 1A8PA 3KZNA 4ONEA 5FUVA 1KYTA 4JSTA 1EFHA 3R9XB 5AHWA 1DTSA 4RH1A 1JSRA 5JO9A 5ADHA 5KSPA 3CH4B 2ZCVA 4WI1A 5AVVA 5ALKA 4JBLA 3IKVA 4OAOA 3ESQA 2QY7A 3CVLA 5E0OA 4ZOBA 2HR2A 1XD2A 1UJBA 2BBTA 4V1CA 3L6RA 4AEZC 2C96A 1MC5A 4H7IA 3VUEA 1HFKA 1QIHA 1KHTA 1K8QA 1U7WA 4GKAA 4MRUA 4CHGA 2GEBA 3OESA 4ZV4A 1E4EB 1WW8A 1Y7TA 2EV9A 2KLBA 4H1HA 2IWHA 1V54E 2H4YA 4C0WA 1FT1A 1XZHA 5HKBA 3LBAA 5T5QA 5K0LA 3Q7EA 1NDQA 4WJKB 3WBKA 2Q3BA 3RJVA 3TLGA 1UKEA 4I3FA 4KE6A 3QITA 5EHQA 3BORA 2GPYA 1D5WA 1XTUA 4NG5A 4J16C 2WP8J 1DAMA 3ONFA 4G0YA 2ETAA 1C4OA 2VHQA 1GY8A 3HUTA 5C2YA 2PIDA 3I2GA 4UM7A 1V7PC 2A5LA 3LGAA 4KRXA 2FSIA 4TLBA 4CFYA 5CXSA 4ZHQA 3CUUA 1PAQA 4GBJA 1JFRA 1ELRA 3OETA 3TQHA 4LYGA 2I3DA 4F3YA 3QPCA 2OHIA 4OI0A 1L5MA 1NV8A 1CV2A 1Y4ZA 1LVHA 2OCIA 3O4GA 3ZBUA 2J4BA 3ZS8A 4PZLA 3CZ5A 4AKIA 2P5SA 5AW9A 3UMMA 4ZHQF 3QWPA 4F11A 2VCEA 3N2KB 4TYNA 3BEDA 1T1JA 4DYVA 5DWVA 5K0FA 5A7GA 2E4XA 3B5EA 1XZEA 4OJMX 2O1SA 4AN1A 1RYZA 2YHCA 2CXTA 1NJGA 2XS1A 1QKJA 3D3KA 1WKBA 1IEWA 2JA1A 1JCQA 2EEZA 3PGVA 5IJWA 5CLHA 4DDVA 4K9OA 4KG7A 2HREA 1WSDA 1R4MB 2W2KB 3ED5A 4F7AA 2WQHA 3IPRA 4F5EA 2HSJA 1DRVA 1AQIA 1P0FA 2WVAA 5LYJA 1S02A 2K5UA 2EG9A 3NT4A 1I1NA 1T34A 1ZJ4A 4TUUA 5GMOA 3GGSA 2CDCA 3EG5A 1F2VA 2ZTVA 3Q5DA 1VPVA 1KK3A 4EL5A 4RF2A 5H3CA 3WYDA 3BDVA 1NDHA 4RUKA 4UW9A 1B74A 1QU3A 1E2MA 4JOCA 2IXTA 2X8BA 4AL4A 5SZKB 1N2OA 3NTOA 2GHIA 4UM8B 2EP8A 4P3KA 2W7TA 1D2RA 4F4DA 4HQ6A 2WSLA 3OCYA 4PSDA 3EXG1 1YV9A 3PNTB 4IRMA 3FRHA 5SZIA 4KL8S 1RXCA 2Z6AA 4G26A 4C0LA 5CB6A 3KPWA 2G76A 3FTXA 1Z8NA 1CEEA 3B13A 2ZTSA 2P6UA 1Z2CA 1YXMA 3FB1A 4FWTA 2VP9A 2DSTA 3K9HA 1P4JA 5EMLA 4EQ6B 2BISA 1B4DA 3WK6A 1FEZA 2X7XA 4EHDA 2O7QA 4LJSA 3T9FA 2BSQA 1UMCB 1QP4A 1DIOB 3E27A 5GZ1A 1Z5SC 1DV2A 2JLUA 3UH1A 3NT5A 1UMBB 3LBHA 1G38A 5FJJA 3V4ZA 5KTSA 3J5QB 3NH6A 5IZCA 1V16B 1YRBA 3KYIB 2YC2C 2Q45A 4PS8A 4LYJA 4P0TA 3W77A 5AKGA 1SC3A 1YQGA 2REBA 3KTAB 5AXBA 1RRPA 1QFXA 2XUHA 5C18A 2RI0A 4J7UA 1Q1ZA 2WM3A 3FY4A 3TN7A 3UC5A 4HUTA 2ZREA 1N4PA 5CTJA 5BMVB 2J3KA 3OF5A 2W4QA 3DEPA 3WA7A 2YY7A 4H3VA 3TE7A 1KMNA 2FV8A 1SK8A 3EHDA 4W1PA 3DSTA 3OQBA 4C01A 4NXMB 4K28A 2TYSB 2V0PA 3SHQA 2FX5A 1MEJA 3Q7IA 2ONYA 3S7TA 4G0ZA 3N8HA 5AOBA 2RHRA 3TZCA 5CERB 1U8CB 2YQ4A 4L28A 3UTMA 1W59A 2X6JA 3TIGA 2CUZA 3AB7A 5KDDA 1D4AA 2BFDB 3T34A 2W90A 3LC7O 1LTXA 2BKGA 1K86A 3G3EA 4L27A 3RC2A 3CONA 4E2WA 3FH7A 3UT0A 5CDSA 1I7LA 2QU7A 2OY0A 5FRDA 5ANRB 3UI2A 3GUVA 3OEEA 3QPUA 3NMUF 3WOHA 2ZYRA 2VP5A 4JL6A 1FLDA 1DC8A 2NNLD 2NP7A 3C3PA 4RTJA 3USCS 3RT9A 4GZ6A 5FPTA 1R4ZA 2XMPA 3JQ9C 4B40A 4GM0A 2RI1A 3E9NA 1E2QA 1RI3A 3KC2A 2DGDA 3QWAA 4DLOA 2QR3A 1UOPA 3CLHA 1YK1A 4CUZA 4MYHA 4MB0A 5IDWA 1JR3A 4F8EA 1VCMA 1DL5A 4G4JA 1NMSA 3MS2A 3E33A 1OAOC 5L4LA 2JLXA 5BV0A 3OZSA 3T5BA 2VQSA 1YCSB 4RPLA 3BMCB 1V39A 1RIFA 3RHTA 4YLEA 2WHQA 1HG1A 2ZWIA 4KLCA 1WXWA 3TLYA 4DSAA 4CHTA 4IP0A 4RY8A 2PYIA 4M1YA 5AJVB 1ADGA 1W2GA 4DYHA 2IC5A 4TS4A 4REQB 2VGXB 4C0AC 3UWDA 3K53A 2WG2A 4C2BA 2CDNA 2IXAA 1CRQA 5DMHA 3AO0B 1CK4A 3RKRA 5C5IA 3MV3B 1O87A 5FFFA 1C0LA 1UCFA 4R41A 2G9VA 4C3OB 1BOFA 1MH1A 4FEGA 4G5OA 3GD7A 2XKKA 1LS1A 3NATA 1E8NA 4BFSA 3P94A 1XCPA 3R7AA 4FDMA 1F9AA 5EIBE 1SXQA 4N3AA 4UUPA 4HVAA 4O4JB 1VIAA 4NPCA 1OU4A 1HTBA 1NJFA 5FWQA 4ECEA 3U64A 1TOAA 1PEYA 1Y7PA 4DOMA 3AIOA 5C4IA 3ZGNA 3NXKA 1W4ZA 2QB5A 3NCTA 3X1KA 2WMNA 4Z53A 1M0EA 4NEHB 3LKBA 1KPHA 2P9LG 5D6NA 3IA7A 4Z49A 4N8EA 1H3FA 5DBKA 4L8VA 1DG3A 2FMUA 2Q1XA 3GRCA 4A5OA 3T5VA 3FPKA 1ZZGA 2OWEA 4OGFA 4JUBA 3UJPA 4R83A 3LY9A 4O2AF 4ASUD 4C0JA 3FYCA 3F6RA 1LRJA 2R00A 5GJCA 3K1ZA 5JA4D 1U7IA 2X7JA 1B89A 1KL7A 1CY2A 1J2UA 3KQQA 1VFNA 2AT1A 3USZA 1W49A 3SC2B 2HXYA 4C0XA 2W8BA 2FJPA 1RI1A 3BD9A 5JWRA 3MJFA 1GG5A 1W0KD 4MPRA 4LK2A 3A7EA 1E3TA 2QL7A 3A2NA 2VXYA 4PRLA 5TRTA 1XD9A 1T10A 4HOQA 2IZOA 2OORA 4GTOA 1X1CA 3UWOA 1LPPA 1Z88A 1DJQA 2QI9F 1IOVA 2X0DA 5CUQA 4KMSA 2PMEA 1Z7EA 1E3JA 1GA1A 4TZ0A 3LDZA 2YQZA 1DC3A 3X1DA 1PJAA 3VZCA 1GTRA 4KIUA 1RWVA 1ZGBA 3H4MA 4N01A 1S7GA 4BPRA 2YXEA 2IIVA 3GH1A 4NJEB 5HQ3B 3DKIA 3G8CA 2I6UA 2X6RA 1FU8A 5H59A 3HABA 3PDUA 5CBOA 1PNTA 3PYLA 4UXIA 3MRTA 3QVXA 4Z4IA 4N5LA 1FBNA 1NNI1 3D3WA 4DHWA 2C2HA 2O0JA 3EMBA 3IPYA 3DZHA 3ZWNA 5J43A 3G8DA 1YQ9A 2IHKA 2X1HA 1BVRA 5JWOA 4QD3A 4DSNA 3LNTA 4NV1A 4JLWA 4AZWA 4UXHA 1PDWA 3FOWA 3RD5A 1B8OA 1BU9A 3GV0A 1PV2A 3G9ZA 2IHTA 3AY7A 3OM9A 2BM0A 4OG2A 3A26A 2P68A 2Q0SA 4YT8A 4BJ3A 1QP7A 5DNYB 2JGAA 5E7QA 3C2QA 3LQFA 2PX2A 5DHPA 3UWSA 5JYDA 4HUQA 4BMXA 5ILQA 5K8VA 1WMBA 3LSYA 4G24A 4EPXA 1KYXA 2IPNA 3IVAA 3T95A 2OLJA 1TZKA 5BSTA 1XL1A 4ZDKA 4QBGB 1U5BA 3J81k 1Z18A 3R41A 5FV4A 1GUBA 2PQMA 3EIOA 5BSKA 3PZ1A 3BIFA 1SXGA 2XH8A 4WEOA 4RZ2A 1FNBA 4AROA 1OC4A 2I1KA 3RV3A 1SUWA 2DZNA 2CE7A 2I2BA 4V0LA 4NYIR 1YFJA 3KAKA 4JWKA 5DLQC 4RE5A 4EO9A 1M0SA 1PFGA 4DXAA 3E61A 2H0QA 3C7KA 4ISBA 4BZWA 1TAQA 4J1SA 1UBLS 5AVZA 5FTPA 4J8EA 2PZ8A 5HFAA 2WF9A 3ADPA 2WMDA 1KK0A 3AR2A 3C3DA 4JVSA 2FEAA 1MX2A 3LCAA 5BP7A 1YGPA 4JJFA 2QTAA 2XKAA 3L77A 4V1CI 3B7GA 2AC2A 1ZVMA 1VXRA 3K6SA 5IDYA 4JITA 4K9PA 1KAQA 2C57A 2ZUCA 4RD0A 1E89A 2BDTA 2FKAA 4AZ0A 1ZOSA 3NJ4A 4RM2A 2QXUA 4LYYA 1XKXA 5KQGA 1VHDA 2ZM6B 3OE1A 4LUNU 1F3LA 4LVCA 3FJ1A 2ZLBA 4JI3B 3IP9A 5JLJA 2PGOA 2YYAA 5AENA 2YJNA 5ARFA 3FPAA 4F4CA 2YFKA 1FUEA 5FQ7A 1RQPA 1HH4A 3R74A 1H2TC 2X6QA 5KNCD 1TJNA 3R7BA 1T5HX 4M7RA 2Z3VA 5AI5A 4H7FA 1BCRB 5BPPA 5FZQA 3LS2A 2B6NA 4IICA 1UM9A 4AAYA 3GXBA 2Q9CA 2VVTA 1QS0B 3P5SA 3Q98A 1U3FA 621PA 2FAXA 4U9HS 2Z43A 4N2QA 4FTWA 4WNFA 5GV7A 1XKLA 3Q8MA 3WBBA 3UM2A 4YP5A 1DC7A 2XJ4A 1OA1A 3BM5A 4HAZA 1K6MA 1APBA 3HH8A 1T0JB 3DE4X 4EVIA 4YP1A 3F49S 5KWDA 1V5IA 1VHJA 1T2FA 1EVQA 1VI2A 4PQRA 2H17A 3G1TA 4I81A 4WZ6A 1HT2E 2WKPA 5LZ8A 2WXFA 2AFIA 3TSYA 3MIZA 1QXSA 3WNBA 2Y2VA 4IIHA 3FMPB 2X13A 2WIJA 1PLLA 2QL9A 1KOJA 3T0GA 3G2KA 2QXTA 4BNLA 2F0YA 3LT2A 2PD6A 1VHWA 3S81A 3MWGA 3VYUB 2KZTB 2QRQA 5BSFA 4R8SA 1UOQA 3OIUA 3CLRC 3ZDAA 4GR5A 1E9CA 2QM3A 3ZHXA 3QIAA 4Y2VA 4LSGA 3HYSA 1FS4A 2NXCA 1IBCA 1BGXT 4I2WA 2QNIA 2H0AA 5BWNA 2VUTA 1NUHA 3KOUA 1N7GA 4M1KA 4GMLA 1QIGA 2FWRA 1ISIA 3P20A 5G05C 2AL7A 3QBDA 1CJKC 2R6CA 3CHPA 4WLVA 3K35A 3ZOZA 3RBXA 3B48A 4TLEA 4DA6A 5AVRA 4E7OA 4BVLA 3GI1A 5F1PA 4EGFA 2OP1A 3WL3A 4EJMA 3I2KA 1Z37A 1A8SA 2WNSA 3KJFA 3DXYA 2J5XA 3PC4A 4AJJA 4H7JA 4HNGA 1TAHA 1DMSA 4ZREA 1JX6A 1SKBA 1FT2A 4LF9B 5IS2A 1LC3A 4BQRA 3MS4A 3RFVA 4NK4A 3I61A 1CQIA 2GUGA 3LUAA 3DD5A 5KYWA 3OZTA 1Y7LA 4X6YA 4J0CA 4MRVA 2O2ZA 2AC7A 1HX7A 1EUDB 4LNHA 3FLEA 4S2UA 1TLLA 2W6CX 2WD9A 2WM9B 4FN5A 1ZU5A 2O20A 4BVEA 4RQAA 2R65A 4JYBA 3ZBPA 3MUNA 2PS1A 3P0FA 2I1LA 1QU2A 4RLQA 4RSRA 4Z4GA 1I2CA 3DMHA 3RAPR 4UZEA 3TZLA 5LJIA 1WW3A 1ZMRA 1WB9A 4D9JA 3PR2B 1QCDA 2AS0A 3PQ6A 1ZH8A 5EQTA 3VNRA 3GFBA 2B99A 2JIQA 4BASA 3H0KA 4TTPA 3UHPA 3PWTA 1RBQA 2ZBDA 3ND6A 1XQYA 4JUDX 4QDUA 4ZT3A 3RC7A 3A9TA 4C48B 2Z58A 2AZDA 2GXUA 2PMFA 3T9AA 1T4MA 2GNOA 4XJVA 4ZO4A 3ZDFA 2EIXA 5IASA 1QIDA 1QE5A 1GTZA 3EVCA 2GA9A 4N0PA 3TPCA 3LX4A 2P9YA 1U11A 3IT1A 4RHYA 1EM8B 2CMHA 1RM3A 3S7ZA 3ZU5A 4DILA 3KYCB 1D6SA 2FPRA 3PEFA 3HCCA 7GPBA 1C9EA 2D59A 4J16A 1NP7A 1N7HA 4DXDA 3U66A 3BCUA 4H3KB 1SVMA 3IDSA 4G4SP 4A63B 4LCBA 3CWQA 2ZB7A 2C7PA 1FFEA 2JAPA 2HJHA 2E2WA 1GAEO 3AWDA 1WOMA 3M1YA 1ZVVA 1T1GA 3B1ZA 1CS0B 1GNLA 5IDQA 2ZANA 1JTEA 3ADKA 4QZVA 2AYYA 4JXKA 2O59A 2YASA 4M89A 1AKWA 1NQXA 3DWEX 3SU8A 4MGIR 2R79A 1E6KA 4Q24A 2OFWA 4I9HA 4IIJF 3L07A 3CMMA 4A15A 4M0PA 4QLOA 1K92A 1OGIA 3TRDA 1NAIA 4DI3A 1VRVA 2UXBB 4IO1A 1AHIA 3DAGA 3MPOA 2CBGA 1UBFA 2WWHA 2PH1A 2O2JA 2YWFA 5JHAA 1BE6A 4FLBA 2W37A 4XX0B 4ZV7A 4BWVA 1R9NA 2AJ8A 3R0VA 2HMYB 4GPIB 1NVEA 3WFJA 4BP1A 2PUEA 2BGIA 1X0XA 2J0SA 2EF0A 2MYNA 2NTEA 2C4MA 4Z9FA 1N78A 3ZDRA 1VE7A 4DLPA 1HRDA 4RH3A 1DXYA 4CCYA 3I32A 4O1IA 2ZIXB 5ENVA 3IDFA 1OV6A 4MITA 3VDXA 1ISPA 1CPYA 4TXLA 2YCBA 3MSXA 2GKOA 2JG3A 1E99A 1LFAA 2K7FA 2L9BA 4G8KA 2H7VA 3S28A 3ZI0A 2Y8EA 5F33A 2D2FA 2GPBA 5BSGA 5CT4A 1BW9B 3TGOA 3ML9A 4QJIA 5KHLB 2E37A 5HZHA 3BQ9A 2X4IA 1AZSC 1NY5A 2NO6A 5CRVA 3SGHA 4MA0A 4NACA 2BHSA 1W7AA 3BWMA 3FYDA 4ZVOA 5DYNA 3SZGA 1XAGA 3C48A 3GLUA 1Y1RA 4LUCA 4ZXFA 3KFXA 2E82A 4YP6A 5KAMA 1J2EA 5JSZB 4FFNA 2YXNA 3TU3B 1T8WA 4E22A 1PSDA 3REQA 3G2MA 4QC2A 2XVMA 3V2XA 4CF3A 5FQ8A 5KNDH 3EZXA 1NQOA 2B37A 4AKXB 3M81A 3SBXA 1HWYA 1JFFA 2YTZA 1BYUA 3KKPA 3I83A 3UAWA 2P9PG 4S2EA 3CGWA 3FWHA 2BEDA 3C4VA 3GFFA 1KBOA 2GN2A 4HF7A 2FA9A 3YASA 4I50A 3DCNA 1K0UA 5TQJA 1U2SA 4YDHB 3QU7A 1YDGA 3Q7FA 2PEZA 5JNTA 4UQOA 4LJRA 4Y2PA 1M8JA 1SVOA 4YAIA 1Z62A 4I50F 4TTSA 4FOPA 3ZPJA 5C51B 1UC5B 1GUYA 4Z9XA 3VLEA 4MIOA 3CRW1 4YUYA 3JYOA 4XWTA 1BN7A 1CG6A 3U4GA 1PUIA 3ZXXA 2BD0A 1AOXA 1K06A 1IQRA 2XTAA 4ANFA 1DAHA 2Z2KA 2FLVA 1YR6A 3SFYA 3TQRA 4PLVA 3JQDA 2EZ4A 3EBLA 1QF6A 3AUSA 2Q2QA 2GJKA 1VL8A 1EMDA 2G1AA 3PJDA 4Y0AA 1T2EA 2A90A 1L4MA 1WAO1 4ZCLA 4K6CA 1YB7A 2NTJA 2YV4A 3RIYA 2QL6A 2Y66A 1G2QA 1A4IA 2J5RA 3FFTA 1ZMTA 3KEQA 1YS9A 4J91A 4GC9A 1U8XX 1USGA 3O03A 4WT7A 1FJHA 2BFWA 3TWUA 5EJ4A 3HSYA 6REQB 4FIDA 1GO2A 3IR6A 1VZ3A 5EZ6B 3VGJA 1RYBA 1TQDA 3AF0A 2R8EA 4AUMA 4EPWA 3SY8A 4RY9A 3N2GB 3ZDBA 3AG3E 5FA8A 2QRVB 4ETWA 1HDGO 3SMQA 3K15A 1DIBA 1W36D 1W8IA 4JVOA 2YZ7A 3PUZA 3UTDA 3NIWA 1XNGA 4RWZA 1FW8A 3IMKA 2H65A 2J3EA 3W8NA 1O96B 3F73A 4TVBA 3C8DA 1Q11A 4OH1A 2W0SA 3DCJA 3HY3A 1KMIY 1Q22A 1OAOA 1PZXA 1MOZA 2VYIA 1MA0A 2GILA 4GEGA 5F76A 1NVDA 4FFLA 3T5DA 1G9XA 2PX5A 4A26A 2WPNA 1E4OA 2XE8A 4U2GA 3DL2A 3E34A 3KQUA 2GZMA 1H9CA 1O8BA 4IXMA 4EUEA 1S3SA 3W9FA 1QTRA 1E5DA 2CMFA 2IDJA 3PFNA 1Z33A 2JAHA 1U8YA 4GS5A 3PZDA 3NVKI 3EG9A 5DN6A 4BKPA 3I12A 4FA6A 2XUAA 1LNSA 2CC2A 1Y8RB 3DXMG 3MMPA 4INPA 3ZJ5A 4JOBA 3IXQA 3KR2A 3LDFA 3FSJX 4QPZA 3UK6A 2ORIA 5DYGA 5T4EA 1WZIA 3PEYA 4LHWA 3CUVA 1YCDA 4MR8B 2CK3A 2C9MA 5B58T 1KEUA 2H9AA 4H7HA 4ZIRA 2QSZA 2JFWA 1D0SA 3C8MA 5EFOA 4XFDA 3R3XA 2GAAA 4N7MA 2V8BA 1RFLA 1ATIA 1QHNA 4B8ZA 5IUJC 1WL8A 1S4QA 1B8NA 2B1RA 2XNJA 4Q7LA 4V0MA 5GVRA 2R4TA 1KZOA 4EYSA 3WHPA 2ORED 4OHBA 3QLEA 4CKYA 4P4NA 2E87A 4JLUA 1UJRA 1USWA 3HI6A 5EESA 3JVVA 4XUDA 2CVZA 3LNCA 3TWXA 2QZPA 1FTGA 4D0GA 1SVLA 1ENOA 1M1NA 3R3ZA 1ONOA 3CUTA 4FFBA 3RTEA 2W5UA 4UDNA 4XWAA 2EARA 2Q50A 1NFQA 3FX2A 3U9WA 5J1TB 4X71A 5K0EA 3UM9A 3P9KA 2FW0A 3T4PA 3N9IA 1LCIA 4YDRA 1VHLA 1X1DA 5EHZA 2OHXA 4EHKA 4EPZA 3U3JA 1G5PA 2O0MA 3OX3A 3QEJA 4BMDA 3OCUA 3KD3A 2RC5A 3F3MA 3PG5A 4AJ4A 2R1VA 3B7BA 4A2CA 1YMQA 4LE2A 4KXUA 1U4NA 1MX1A 3A1CA 3C3XA 3A05A 4RMGA 3B7SA 1LZKA 2V74B 5TQVA 2C7VA 1EWRA 1RC1A 3M9XA 4FLFA 5DVZA 4YJFA 1TU0A 3GPBA 3HCWA 1B7GO 4Z9BA 1RAAA 2ZBEA 4GP6A 3L7YA 1U7UA 4GVLA 4GLLA 1R6DA 1KFJB 1ZMXA 2X9QA 5DCWA 3W90A 1EVEA 2PVCA 1A2QA 1J70A 3I9OA 1KI4A 3GA5A 1HEYA 5ELLA 4JJ8A 4HEHA 3MC1A 1SCUA 2PYZA 4MXDA 1NBMA 2EQ5A 2OZPA 1U1CA 2XWJI 1KO4A 1NIJA 3I9KA 3H99A 2QQGA 4LZZA 2HT1A 2INGX 1FFYA 3DXFA 2H1SA 3RG8A 4KR9A 2H00A 4GOMD 1BNCA 5CBKA 2JARA 3EU9A 3T54A 5DTEA 3A3KA 3WWOA 3F5FA 4KR7A 2VCYA 4PCAA 1TT5A 1U2DA 3E3MA 3GR6A 3PPWA 4LC9A 4QQ8A 2XODA 1IY9A 2WFLA 2XD4A 1I2MA 1WF6A 2DM6A 2ZE6A 1KEWA 3R1IA 2XI4A 4X85A 3RSLA 4J90A 1M67A 4GI5A 3OEWA 5JAPA 2V6JA 2B7BA 1AXEA 1IXSB 4FHKA 1JMKC 2FN9A 4QHSA 5NLLA 2OUKA 1W5AA 3DPDA 2Q7FA 5EXXA 4IYRA 3WB0A 3A4MA 2YJ3A 1JHPA 1WBBA 1LPMA 3GVIA 2WWRA 4LRTB 4YMWA 1XMSA 2GEKA 1GSOA 4OHYA 4LQLA 3ZR4B 4CM1A 2F3RA 3B85A 3DTVB 2LIPA 5E4JA 3CLJA 1XDUA 2Q9AA 3PQ5A 2EKBA 3ETNA 4CMJA 2J85A 3HYLA 4X45A 3QVJA 1GU0A 4K9NA 5JXWA 5DLEA 1TJCA 2JRCA 4F92B 1YSCA 3G7SA 2CLHB 4BCBA 1CUYA 1OH7A 1D1QA 1WY5A 4MYCA 1TVMA 2PNNA 1RZ3A 1NZNA 2Z8YA 4NESA 4OJKA 1AP7A 4G6ZA 3ED1A 3LF1A 3SCZA 4OXKA 3ANSA 2CWDA 1PJCA 2UYYA 1VJ5A 2HBRA 2RBKA 2PM8A 3R9MA 2HA5A 3ZU3A 1SQMA 4OX9B 5BOVA 4PLTA 4RTKA 4W9RA 4B3GA 1LK5A 1KE1A 2QMHA 4ZU6X 1O6ZA 1JDBB 4RLSA 3GNQA 3R8XA 3ABOB 3TB6A 3O4JA 3RTGA 1SC4A 5L8VA 2VBFA 1M2WA 1ZONA 2QTHA 4U96D 4KC0A 5B3JC 3AEXA 2ZDHA 2VZLA 4EZIA 1DKQA 1QX4A 2Z3ZA 4FS8A 1LTQA 2LP4Y 4FYXA 3S27A 4OMFG 4BATA 3HYMB 3QELA 4FC6A 1V37A 4HI9A 3DO6A 1XV5A 2Y3IA 3EHRA 4PG4A 3LJKA 5AHXA 3UKDA 4EZJA 2O8BB 3E9RA 2N9UA 1DCTA 3NLLA 1JWAB 3E05A 4D26A 4YMSA 2V98A 1K08A 3OI7A 4FM9A 3GZJA 3BEOA 1V2HE 1O6CA 3D0KA 1EK2A 5FXMA 2R4QA 1VPEA 4YFVA 5REQB 1UN8A 4RF4A 5EIOA 2PL1A 3F98A 3KHUA 1IZYA 4AF8A 3F9RA 1XTTA 5L6LB 1JDPA 2EBWA 3STYA 1QDUA 2IUUA 1G4AE 2V03A 4TMKA 1WP4A 1LUAA 4OP1A 3PL5A 1LF8A 5IARA 5ALUA 4GYKA 3L54A 2GKGA 4NZPA 1GA4A 2WD8A 3EVBA 5JAZA 4WLEA 4HD8A 1LY1A 2QMZA 4I2NA 2ZB4A 1YUMA 3BE5A 2PM7A 2O1EA 4YREA 3B3QA 4JC5A 4A6DA 2QVLA 4YT2A 1UJNA 1WJGA 2FWIA 3COSA 1OXMA 1J5EB 5ALRA 2E4UA 2PSDA 3N3AC 5CPFA 2QMYA 4KXMA 4KBQA 1EESA 2ARKA 3WLMA 4KWTA 1HE3A 3UGQA 3JD2A 1Z5UA 2TMDA 4I5IA 1KY2A 3DDHA 3UGJA 2C2MA 4ZZ2A 5AOXA 4NBLA 2ERXA 2FPLA 5IXSA 4G0PA 3M34A 1B3BA 4C05A 2PQNA 1Z68A 4WKBA 1GGKA 2WLSA 4RPJA 1USVA 4DANA 1SHZA 5F5NA 2OV4A 4KE9A 2KSQA 4FC8A 1C9DB 3AFNA 3GARA 2BI7A 2DOKA 4EWLA 1A71A 1GGFA 3FRJA 2C4UA 2KC7A 1P0PA 2ZSJA 4FFDA 1COWA 1XMQB 2JD0A 2JFYA 3ZFWA 1N8TA 4JYMA 2PL2A 1NW4A 2BKXA 4JY7A 3ORRA 3AW9A 3EXFA 1Q0ZA 3HI4A 2JJ2D 3BE6A 1X7YA 1IOZA 4IMJB 2QTZA 3PNYA 3MUOA 5JASA 4Q4JB 3QLVC 2P4UA 3Q78A 3RK4A 5LL6P 4F85A 2NO1A 2EQAA 3TG2A 1SXJC 1Q7EA 4IUBS 2VDWA 3ZNPA 2JBAB 3JQFC 2PRKA 4BRSA 3COYA 2QD5A 3B53X 3NBFA 4DKXA 2GXSA 2QDXA 3O8QB 3PNBA 4YY3B 5LJLA 1Q17A 1TZ2A 4ANXA 2W48A 1RWOA 3W8RA 3F5MA 2A58A 3FFWA 1G8YA 3DCYA 2C5FA 5BV1A 1NT4A 1SHLA 1TNYA 4N41A 1AKMA 3HL0A 4XB1A 2DETA 3T7TA 4MP8A 2XLCA 1NKTA 3PGMA 4D97A 4F2GA 1WNTA 1XGKA 2R6R1 4EAAA 2ISCA 3E9YA 2GFQA 1R27A 3J5PA 3MTGA 1V7ZA 1V1MB 4ITVA 4LXXA 2JIPA 2ZWOA 4RTPA 4OHCA 3L8FA 3CZ4A 3AGQA 4UYJA 2QVBA 2ETVA 3NIDB 4EL0A 1VBFA 2R6HA 3SBSA 3UIPC 4E1BA 2B9VA 1DE0A 3LDAA 3U37A 1XAJA 2EFJA 3ABZA 2FZEA 3C3KA 2Q07A 4HZUB 1BE8A 5AKIA 4LF8B 2PUAA 3DYIA 5E1MA 1L5KA 2JFNA 3D6MA 2VT6A 4NU0A 1X1AA 4RKFA 3MGKA 4NENA 4CEIA 3CVJA 1ZPDA 2BEUB 1GUDA 2WD7B 2FZLA 1OU0A 2CW5A 3WNCA 4KAJA 2G8NA 3IDQA 3A4YA 5L3VA 2XY4A 1L3CA 4BQNA 3P71T 4IN3B 3HLKA 2KPOA 1JDVA 3IVMA 3U6BA 3MYRA 4HAWA 3TBHA 1S2OA 1SHTX 1UBMS 2G5TA 4QPCA 5IWAB 5CHYA 1W35A 4BL5A 2A5EA 5AI0A 3E2IA 1B0UA 1S6YA 2OBXA 2ZJAA 3K8YA 3QTBA 3UMGA 1SCAA 3D9QX 2IF0A 4HXFB 2XVZA 1QTIA 1M6VA 5PGMA 4DE5A 2JFOA 4FINA 4FGZA 3EHMA 2Y05A 3O8OB 4MMYB 4K81B 1WPGA 2WT9A 1YD7A 5ADUS 4NS1A 1OGJA 4EOGA 1DAEA 5EJEA 4ZVRA 1NN0A 2LW7A 5B1IA 3VOTA 5GZ3A 2XOEA 4KHPB 3JXEA 2UVPA 1WDYA 5EIBC 1L6IA 3GRFA 3PFFA 4ARCA 2Z1DA 2JH9A 3C6XA 3GGGA 1BDMA 2BKKB 1R6AA 2XZLA 4TMXA 2KWIA 3SKVA 3GEPA 4U7WA 5KUTA 4CKWA 4TSKA 1ZAYA 3UJBA 4EMUA 3DXZA 4YJ3A 1WSAA 3ZWQA 4EI7A 2VJDA 4FYYA 3DONA 4KZKA 2BDUA 4BWRA 4M38A 4BFUA 3E9QA 2N46A 3G1WA 4PZPA 1TUBA 1ZQ9A 1CNEA 3ZY4A 4B6JA 4OATA 4MV6A 1KZ4A 4UHEA 4MYRA 3V97A 5B4UA 4KRFA 1NF9A 4YJ3F 4NNJA 3QV2A 1FLAA 3KIPA 2P1ZA 4J03A 1CB7A 2XUFA 2FFJA 4W5NA 4YCJA 4CPDA 2G40A 2GZHA 4EJSB 1VTKA 3H1PA 4X8MA 1ANKA 2JGJA 4FR2A 3UPTA 4KO8A 4WBNB 2ATVA 3DHNA 3C16C 3P2BA 2UYHA 4AJWA 1WSWA 2NT3A 2QG4A 5I8WA 4ZT7A 1KIAA 4IVNA 3HV0A 1E69A 3FB4A 1NMXA 2GRLA 4WY8A 1AMNA 2JGDB 4QKQA 5DTMA 1VIVA 3SR3A 3G2TA 2COUA 2G1PA 4QQIA 3SNKA 1G7RA 1THZA 2E5FA 4JBGA 3MK31 1MGPA 2HA3A 2O3RA 1X9GA 1Y3IA 1QHEA 3UOWA 4MCHA 2FEWB 4HQDA 4K9DA 4ZODA 5IBQA 2PU5A 3PPIA 2I7XA 2JFVA 3OF2A 5HM8A 4R3UC 4J3JA 5A3SA 3UFXB 3S7DA 5TF0A 1X0VA 3BTUA 3RRMA 5A23A 1G6HA 5CNIA 2SCUA 1P9LA 5EWJB 3UK0A 1MVOA 3TCXB 3TSCA 3D7KA 4V24A 2H1LA 5I6DA 2H59A 3S2YA 2IGBA 3GEHA 3T3IA 3I28A 1AGYA 2VIIA 2PRIA 2VZ8A 1Y5NA 4C9BA 3CZRA 5HIMA 2ECOA 1YR7A 1N52A 5KTPA 3T94A 2B0OE 2XQKA 1JEQB 2NU8A 4FQ7A 3UMJA 1RLTA 3OZAA 4HVCA 1YFZA 1J56A 2ON6A 2WZDA 2GF9A 2IONA 1SUAA 3ORQA 5EXTA 4KR3A 4FYMA 4DCSA 1R1DA 1M34E 1ZJZA 2H6FA 3KXKA 1QFJA 5JBQA 4GR9A 4EPYA 1V11B 4XGIA 3WRXC 3S8YA 5FBKA 2H1RA 4ER7A 1Z2PX 3C6BA 1RCTE 4E46A 1PHRA 4FILA 5EILA 3S7FA 4BSZB 2SBTA 2YZMA 2AW3A 3C98A 1Z6XA 2ZRKA 3VXKA 1G3QA 3FNHA 2C78A 3U7QA 3ROKA 3TJRA 5C32A 2VCHA 1Z63A 2KW5A 3W9YA 1O1YA 3PUKA 3VNAA 2ONDA 1RJGA 2VHCA 4IAOA 3MTEA 3T06B 4FZRA 3D7NA 3DHVA 3JQGA 3QNKA 3IKMB 1RCFA 1GUFA 3W5JA 3IELA 1TK2A 2BHTA 5H3LA 4DLBA 1I01A 3SF8B 3WGTA 3GROA 3I01M 4IUDS 1ZSNA 1L4LA 2ZIEA 3NTLA 2OESA 3R7WA 3KQKA 5J2TB 1MJGA 4MW7A 1DWPA 1T24A 5FWNA 1YBMA 5A5FA 4OEHA 3BBPA 4EZBA 1QJCA 2BW0A 1VHTA 1WZNA 4H35A 2PGDA 1PZMA 1R5NA 4OHUA 4ZT5A 1G8GA 1K4KA 4Q0MA 3FMVA 1BH6A 2R0QC 1I30A 2XITA 4KR2A 3EGOA 1CQJB 1N75A 4MI6A 1H6PA 1HFWA 1BS1A 1TMYA 3VPBA 3UM3A 2CFOA 1EJ0A 3AP2A 3ACBA 1F2UA 1HYGA 1T8PA 4KPUB 5HTOA 2JHGA 4RCZA 4HDNA 2C7QA 3IUPA 4CKBB 2IYFA 4JP1A 1HH8A 3ULQA 4ALLA 4QFCA 3PIDA 4GH5A 5GPBA 3LQQA 3NWBA 2FZGA 1Z6GA 2XMQA 3PNKA 3HJRA 2UZAA 1VXOA 2GYUA 5IT5A 5HVNA 4NCJA 1X7DA 3WGUA 2XMZA 2VJCA 1RKVA 4RD6A 2NYAA 4QDJA 4B79A 4NE7A 2Z8YM 4DDTA 4L8YA 1SK9A 3RSFA 2IY9A 1I14A 2CJFA 3QK0A 4QNRA 4DA8A 1JQLB 1O3YA 1AIPA 2HLNA 5IJ0B 1K3TA 4MHOA 4W1SA 3PP8A 3A4IA 2BEVA 4WFQA 1X70A 3MRVA 3ZHEA 1N34B 3P4UA 3SHOA 2ZI9A 2WK1A 2D1TA 1F1JA 1SVNA 3K5HA 4WX2B 1TNDA 4CIVA 3LF2A 1US8B 2XGJA 2J1LA 1KAMA 4A27A 3A4VA 2H4JA 1SU4A 4X9XA 1ZQ1A 3OZEA 4W6QA 2WXNA 1AK9A 3WYFA 3FA2A 3BGVA 2OG1A 2HGSA 1OJ7A 5AFSA 3O7MA 1O0BA 1GTG1 3GUYA 2CHQA 5FWXB 3GJZA 1J24A 3KYDA 3EK2A 4V3IA 1CUCA 2XLBA 3H5LA 4RQUA 5I51A 4O2AA 5I3CA 1XEWX 5JZBA 5KTYA 2WC1A 4I08A 1A9YA 4J0KA 1RNLA 5JCJD 1ZC3A 221PA 3MB5A 3H6GA 1XDDA 2MRIA 2LAIA 1VMKA 5JPCA 2EEPA 1CY4A 3F4BA 1Q0HA 3ZYZA 2DYSE 5A6SB 5KJ1A 4MGKR 1Z3XA 1BXZA 2F43A 1H2XA 4GQBA 1BHO1 4CG3A 4TT3D 4QXMA 4KP7A 1RXEA 5IYZB 3H4VA 4IHKA 5F9MA 5LMZA 2DP4E 4CKCB 1NSTA 3HKBA 1H4TA 1H8ED 5HEKA 4MQFB 5FHRA 1I6WA 5FTNA 3O92A 5F4ZA 1II8A 4CV2A 2BJVA 5A0VA 3I64A 1ZRNA 3IMGA 1YZKA 2GPAA 1U28C 4E33A 2XDQA 4ECAA 1M1YE 2O50A 2CYCA 3LKVA 1QH9A 3HB5X 5KNHD 3TWTA 3OPVA 2IU1A 3GFRA 4QA9A 2Z6QA 1N2CB 5M04A 1RWWA 4NI5A 5DBOA 3VPDA 4BNYA 3L6CA 5E0KB 4J2OA 1KJZA 5I7AA 1MHTA 4G5SA 5M34A 1Z47A 4ALKA 1NAHA 1Z3IX 1U5CA 1Q44A 4D4MA 4D9FA 5J59A 3DFKA 3OU7A 3WLSA 4GR4A 3AVTA 4E85A 4R5HA 3Q79A 4WKCA 1QRTA 3R0ZA 4ILGA 1YS4A 3NTQA 2VZEA 1BN6A 4RDIA 5IT0A 1E2DA 1R37A 2QTBA 5JI3E 5AJYA 3D9JA 1RT9A 3J7AC 1A17A 3S0JA 2QTMA 2ERYA 2FMIA 1B76A 5H82A 821PA 1FPQA 4ZYLA 1OB5A 1E2IA 1E1KA 1VI5A 4O2BF 2J32A 3T7JA 2PKRA 2IYNA 4J1TC 2ZBVA 2HQ1A 2F8TA 3ICQB 2YXLA 2WLTA 1S89A 4L5CA 1YFKA 3FPSA 2C5HA 3FSGD 4COKA 2P9HA 3T5XA 2VT3A 3WSTA 2FFHA 2ZBUA 4WDRA 3C45A 3TTUA 5E1DA 2EBHX 1KR2A 2IHNA 1DQZA 2HSDA 1N11A 3V4LA 1D8DA 3GU3A 1IY8A 4N3GA 5AQ1A 5D5QA 3HK2A 2FUG6 1E64A 3H5RA 2DY1A 3VR5A 2P0AA 1NQWA 1GFWA 4HXGA 4DMMA 1JEJA 5B2ZA 3KALA 1XCGB 4IDNA 5IVHA 2QAGB 2IYQA 1T1RA 4YLGA 2VTKA 3RS0A 2IYTA 2WWTA 2BFCA 4LE0A 3SSMA 3A11A 4UQXA 2BCEA 1W44A 3NX4A 4ZRDA 4UPVA 1QLWA 4PTYA 5CDFA 3OURA 4RESA 4LZPA 2IEDA 3QX7A 2H54A 5JNWA 1D0VA 4TQ9A 5IK2A 1ZIPA 4JBNA 4EEZA 2JK0A 1RE1A 2QV7A 2X3UA 5FA6A 2HF8A 2EHJA 1P1KA 4RNCA 2QR2A 1GR1A 4KMRA 4QFDA 3UM0A 1LJ8A 2XE4A 1S3IA 3CEQA 4LS3A 2Y69E 1OTHA 4M7PA 4W5QA 5DTJA 5DX0A 4F72A 2VT7A 1ARZA 1GTSA 2HU8A 5DIFA 4A8JB 3O2NA 4MICA 4Q1EA 4G65A 3RAGA 4FBGA 1PJ3A 1PJ2A 2BTOA 4KGXA 4ER3A 3ZXYA 2FY8A 3HC7A 3MJSA 4CL2A 5GONB 1P9OA 2CLOB 3Q15C 2WSSD 2NWQA 1JZSA 1SXPA 5LB2A 3G0GA 2XQGA 4NU8X 2D8MA 3AZOA 2AOTB 2QUKA 2BSAA 3OT1B 4YTEA 4TV9A 3LMKA 3R44A 1Z29A 4HPWA 4CCAA 4XQCA 4QVKA 3CLSC 3RJ5A 2ICAA 3L4KA 3RPEA 8OHMA 4A0QA 4TV9F 3BCRA 2QIPA 2YZGA 3LLUA 5I9MA 4HB5A 1914A 4ZDJA 2VSXE 3FP3A 1N8NA 4OGGA 4URYR 5BUSA 3UMSA 2IH4A 1YMPA 3UQ3A 1KH1A 2Q1TA 1XMJA 2PZBA 4WZZA 6CHYA 3OHMA 4ERNA 1P73A 4B4OA 5L9AA 4QYWA 5DHQA 2NPFA 5K6TA 3U3ZA 3COVA 5HGXA 3VH1A 2I8CA 1SKYB 5DYIA 5ECYA 4Q3OA 5EWLB 4KB5A 1OTYA 3WISA 4QYSA 3FWKA 5IKMA 2RH4A 2GERA 3VR4A 3ZXPA 3K4QA 1C1DA 3CRRA 5SY4A 4IGKA 4I4TA 3TI7A 1NJ5A 3IKOB 4PBTA 3C6KA 1XIVA 4LF6B 1WUHS 3PLRA 3MKRA 4IJ5A 1E0JA 2G83A 3FUUA 4CZ2D 5BN5B 4HG2A 4S3MA 3VPSA 4LYDA 4RW0A 1TK9A 4BAGA 2VH2A 2DFPA 4I4TF 4UTXA 1DUIA 2RHJA 1RQLA 4AY4A 5CLFA 1XFAA 4TYMA 4M1OA 3ASZA 4FONA 5F9HA 2G70A 3A2MA 5ENZA 4LFAB 2EKPA 3OAWA 4EO4A 3WGGA 2K2WA 5K6RA 1SOWA 1UPXA 2OMEA 3OU6A 1YQQA 1RMQA 1QCYA 3C6QA 4LZNA 2BKVA 4K0RA 4I1YA 3QLVA 4RA9B 2IQCA 4CFZA 4UMDA 1UXOA 2AFVA 1SXJA 2JDID 3KQLA 4QM6A 1EB8A 5CIWA 3JQFA 5MDHA 3FZYA 2GLUA 1E5TA 3LXRA 3OCZA 4I1OA 4ARZA 4TLLB 2PXHA 3ERCA 4ETIA 5E1OA 4RVCA 4O4LB 1QQEA 3RIHA 1W52X 4BPBA 4HJXA 4L23A 3CK7A 2PH5A 4HDRA 2FWJA 1LNQA 3WYNA 1EFRA 1JQDA 5E2BA 3F6QA 1NBHA 4X20B 2Q5CA 3FETA 3OIFA 1ZX1A 3HKCA 2RHOA 4L4SA 1VKHA 3H75A 4G0WA 2LVBA 5SYMA 3AH8A 1FIUA 5E75A 1WB4A 2YRXA 5CM9C 3ORYA 2ID9A 2KLHA 1YL5A 4P98A 2B8TA 4YALA 1AKNA 5KVQA 2ZAOA 2AMYA 1YA0A 4ISCA 3KZKA 1R00A 3EH2A 1W85B 1OFHA 1S0UA 3NRBA 3W3AA 1CEYA 1GDHA 1FS6A 3LLCA 2H1VA 1IXKA 2WXPA 3ZBQA 5GTDA 4LZOA 5I7EA 2VYFA 3ESCA 2IS4A 4BJ5A 1ZRSA 1S5PA 2QTGA 4UWGA 5BOSB 3MN1A 4CM6A 3OLWA 2HD4A 4IOMA 2ZSIA 2ZAIA 1Z4OA 2HIGA 1PX0A 4D02A 1WCIA 1SU6A 4TOIA 3EUVA 1YRHA 3HDQA 1JB1A 1JR6A 3MAAC 3UEOA 1Y34E 3KB6A 3K9GA 5H70A 3HXLA 2GEFA 3HG0D 1MJGM 4LC1A 4R9NA 1NXPA 5FT9A 1DKLA 1KKMA 4IIJA 1OROA 3P0JA 5U9CA 3DDCA 4JELA 2WDPA 2VJMA 4DQXA 1I2ZA 5BYKA 3HFJA 2IZ7A 5HIIA 4MS3A 1PLJA 2ZBRA 3QKYA 5AQ9A 3FG9A 4AXBA 5FQ4A 3IR5A 3MJWA 3ZNOA 1LD8A 5DNWA 2Z30A 3ISVA 3C70A 3AF4A 3KJNA 4UHKA 3BIXA 3CNOA 5IJ9A 2D2XA 2VOJA 2LCIA 3CRZA 2HRRA 3DZ8A 2X0JA 3GEIA 4Y6RA 1KKUA 3T7SA 2VP6A 3PHIA 1ZISA 2J7PA 1JEOA 1EX9A 4ZQCB 5BN3B 1Z6QA 1E2EA 2VI5A 3E4DA 2ZI4A 3KJQA 4G97A 4DCGA 3QDNA 1UDBA 3OQVA 3M6AA 1L1FA 3IMCA 4BX2A 3RYIA 3AHIA 2C2GA 3F8SA 2PTGA 3OM0A 1PFQA 1L5FA 3T1TA 5KVAA 1I4LD 3T7IA 4DRZA 4O3MA 1KYVA 4ML3A 4JLSA 3PF8A 3CRNA 3ELBA 3QE2A 5JD6A 2QP9X 4DXHA 3UCXA 1MB9A 5T41A 1K7CA 3TNYA 1ORWA 1C41A 3FF1A 5AM4A 2ETCA 2X38A 3KO8A 2PGJA 1HYQA 2JHFA 5F3WB 1VRCA 2PM6A 3QXSA 3LCUA 4UTZA 1ZD4A 3S44A 5FEMA 1C8VB 2X3YA 3O5AA 3DJFA 4ZRMA 1PQWA 4K03A 5DP1A 1AQYA 4RD2A 1C9YA 1NI5A 4TL9A 3PYMA 1ZP6A 3HVHA 2VDOB 4DRXE 1GPNA 1K7EB 2X2FA 2FZ4A 3IQFA 2NUTB 4UOQA 2HIMA 3O4HA 4YJGA 1AKTA 4BYMA 4PY2A 3HO8A 4PQGA 4L3WA 4DWWA 5BRNA 5JNSA 5AUPB 1TVKA 1PCXA 2ODTX 4WZBA 3KZXA 3DWLG 4B3SB 3PD0A 2GTPA 2D62A 4M1TA 1KXZA 1HA3A 4KXVA 5KWSA 2D0DA 1WDKA 3F8TA 3DNPA 1OLSB 3EIFA 2Z2XA 3A1FA 3H9EO 5ELMA 2YV5A 1C7JA 1ZJ6A 1Y9EA 5DLDA 2FH5B 1N3IA 3FH5A 2QY9A 4GA0A 4APFA 1B42A 4W1QA 3F5SA 2XMGA 5TMEA 4UZFA 2YWRA 5AM5A 1I51A 2R60A 1ZK0A 1FCHA 2EWMA 3AUUA 1E2GA 3DMNA 4RZHA 4I1MA 3QEBZ 4LAFA 3LE8A 3OQIB 4MR7A 5AJTA 3WRXA 4JJIA 1DRKA 3P4YA 5FPYA 4FLHA 3PXGA 4KPFC 4OK6A 1JMYA 1O1TA 5T6BA 1V3QE 1TTHA 3DE5X 5CG2A 1DWQA 2Y1LE 1D03A 4MAMA 3IIKA 2A4ZA 4RELA 5A9SB 4MMZB 5ITSA 1YVRA 3A3PA 1RW4A 2C88A 1N5LA 6ADHA 2VJYA 4Z1MA 2IY0C 4AQDA 5JAMA 1AK2A 3UBTA 2Z4RA 1Q3TA 1I7DA 2W2TA 4L5IA 3CYFA 1R50A 2FN4A 1HDYA 2CBXA 4YJHA 3GYGA 5CVTA 1UOHA 1KSHA 3RS7A 3JQ9A 5LCXA 5AVSA 4PN7A 4Q4HA 3A32A 4KV7A 3UXEA 4HFJA 2XT6A 5FI3A 3Q88A 3GT7A 2NSYA 1S8AA 3WKBA 3S2IA 4ZAZA 4D79A 4AFNA 2NSDA 1ESEA 3ASFA 2ORVA 1XZGA 3V1MA 4NMHA 1NUSA 3BWVA 4EP1A 3WMFA 1TEZA 1P0MA 4NG4A 2W6ID 1NT2A 3IV7A 4KE8A 4KQCA 3L0BA 3WVNA 2CXUA 3CVOA 4QQNA 3I1JA 1RLOA 4YX9A 2AEEA 1BVYF 3IBYA 3UQYS 1KS2A 3AVOA 1KT0A 3PGJA 4J29A 3F6CA 3K0CC 2PSHA 3EGXA 3Q85A 5EE1A 4S0XA 2EJBA 1U8FO 4LY0A 4BQIA 5DEIA 2JGFA 1FFBA 1IPHA 3ESXA 3MFYA 4NABA 1JLKA 4B47A 1PKEA 4C04A 4TVSA 1W94A 4BLRA 1T8SA 1SZJG 2NT4A 4XVHA 4V0SA 1JGTA 1CLEA 1I1OA 2I65A 4QFBA 4UVDA 4I2VA 1L7AA 4RHXA 1WOYA 4LNBA 4GL2A 3D8UA 1R0BA 2I2XB 4DT1A 3RUDA 1ZU2A 5D3QA 3P52A 3NC4A 1HMYA 5BORA 4KN8A 4YLYA 1L7BA 2HMVA 1FDOA 4QEDA 1SVXA 4BO0A 4C07A 1L7QA 1IM5A 4L8WB 1QGED 3PCXA 2IQIA 2HR1A 2R25B 3MPUA 4OXXA 1I5RA 3THYB 1XJQA 4RVOA 3LVFO 3PTAA 4MP3A 4LX0A 4W4TA 1F3OA 1DB3A 4HH3C 4I1IA 4GTRA 2PKQO 3M83A 2XZTA 5TQ2B 1HGXA 3IQIX 1TN8A 5K3DA 2PKWA 3H8VA 2JF0A 3WZ2A 4O60A 3WWCA 4FNOA 2XPIA 2YNQA 4KRGA 4F0JA 2AWOA 4AS1A 3IPXA 1SCJA 1L5NA 4J0EA 1NWCA 4ACAA 2A1UA 5FBZA 1I6LA 3FKSA 3MZLB 5T6MA 2HM8A 4D57A 2I03A 2ZRFA 2YHAA 2IXEA 1EFLA 4LY9A 2VDKB 4RABA 3VU8A 2OVFA 3CVXA 1HZ4A 2C2KA 1YJCA 3OQMA 2WKQA 3TEJA 1O95C 2O1XA 1JKMA 1UFOA 4Z1OA 2I7DA 4I9GA 3NC0C 3AUJB 3WL8A 3CLTD 2IOSA 2PKCA 4S12A 3P9IA 1F0YA 3BMQB 2X19A 4NMWA 4EB0A 2GWHA 1TM7E 3ECCA 5CHEE 4R51A 5BWMA 5CT9A 5EMKA 2HSZA 2FI7A 3UV3A 4E30A 4PX5A 4Y9DA 3WXBA 3AHHA 4BO2A 1I9CA 4MVJD 1VBNA 4YMGA 3AI7A 1TO1E 2ZXWE 3ITWA 4HXIA 4B6GA 3G2LA 3B36A 1U63A 1UAGA 4HN9A 1RHQA 5EIWA 1JDJA 4KWHA 4LV6A 4OFXA 2WJAA 5HKKA 1I7PA 3GQBA 3F74A 2NQ2C 4XX5A 1U28A 1G18A 1YIAA 2FPGA 2OZVA 4UCWA 2RJNA 2DWZA 5L7TA 3B20A 3FTEA 3Q7RA 5JZ9A 2GOYA 1G3UA 5DHRA 4QSMA 4PICA 3X3HA 1ZXXA 1SQ5A 2AE1A 1CP3A 3AHFA 4YACA 3KCNA 2NXJA 4TWJA 1RI4A 1W1WA 3ZJ4A 1P9WA 3NZUA 3QUSA 5KVVA 4QO8A 1C3LA 5JTTA 1OR8A 3KSAC 1Q7TA 1H0RA 4M1MA 3GJ3A 5ECDA 3D64A 1YUBA 3FTSA 1XRRA 1ABFA 2B3DA 4FT2A 2R97A 3BD6A 5FQ6A 4LIPD 4DMLA 1RZVA 2BI8A 1VL1A 2RCNA 2J4DA 4D74A 1W1IA 1T5SA 4OXQA 2OBNA 1BX1A 4UUQA 4JODA 1Y3BE 4YWJA 3BG5A 1IN5A 1PFYA 3CXUA 3I01A 4IVQA 4JIMA 4P80A 3KT6A 1SIUA 5KEIA 2YOFA 1K5PA 1OXBB 4LWPA 1O6BA 2I2OA 4U8HA 1E6UA 1PUXA 1LQ2A 4FZVA 2FRXA 3JV7A 3G9QA 1JF8A 3F96A 2CLDX 4J1TA 3F47A 2WWWA 4FKMA 3UENA 4C0BA 4UBJA 2L17A 2JL1A 2RIPA 4M4SA 1L9KA 4O1OA 2OZEA 2P27A 2JFBA 3NVDA 4ND1A 3NWPA 1U04A 4NE9A 4IV8A 3CRMA 4QYTA 4R1TA 3U16A 4HBZA 1UR5A 1TO6A 1U65A 1QQ7A 5AI9A 2C29D 5KNLA 1K9VF 5BSEA 1L5GB 2ZJZA 4JZKA 4UQZA 3OJWA 1Z6AA 4LJ6A 5DNEA 3V4PB 1HE2A 2IYEA 3D9OA 2XVYA 2VF4X 4ENWA 1Z56C 2OBMA 4P53A 3FTWA 5J23A 5DI3A 3T5PA 3DEZA 4ZYYA 8ATCA 3SJ7A 1TDJA 4UVHA 3JWGA 3DV0B 2FF5A 1U7PA 3L7AA 4L22A 1ECPA 3AR4A 3DZBA 3NTVA 4RM3A 4YCDA 2NTYC 1AG9A 4PPNA 1FDIA 2HWWA 4LHSA 5CMWA 2HIHA 2VWGA 2RI6A 2O8CA 1K27A 3V4SA 3VR6H 1G8PA 4FGLA 1PJQA 1KU0A 1P1HA 3DOUA 3G7NA 1CQWA 2A9KA 2QVZX 1BSVA 2OCXA 5HF9A 5EJ6A 4XYEA 1OX4B 4GTPA 4ND2A 4E0BA 3DMTC 2GWRA 1ZCFA 3LVRE 1E94E 4CQLA 5A2GA 1ZMBA 2D2IA 3GA0A 3A4TA 2X9NA 2F8YA 4LPKA 3CSDA 2Q1WA 3RLFA 2DHEA 3KD7A 1NVMB 5THXA 2AJLI 2BTQB 1MJ5A 4KLAA 1XNHA 4OQEA 2AW5A 2P9KG 3LCMA 2G09A 2L69A 2VRCD 2XNDD 3Q15A 3MT0A 1M5UA 4PCVA 1H66A 2ZJ4A 2WF6A 4KZCA 2AVNA 2QSJA 1T43A 1YB6A 1HXHA 1TA9A 4EB8A 1PR3A 3N39C 3KYJB 3Q1LA 5LA6F 3TRHA 1C1XA 2X5TA 4CF4A 1JE1A 1TF2A 3WGVA 3ASHA 3QFCA 4BRWA 5JSYA 1HFAA 2ZZKA 4DSOA 2Q5OA 4QL3A 3IILA 5AOAA 1QFYA 3ZWXA 3SY2A 2AUNA 4GI3A 2UZ0A 2IA5A 3WB1A 2QS9A 5ALPA 3AI1A 3JYNA 5KYYA 1K8XB 3QC1A 5G3ZA 4MVXA 3F46A 1G7TA 3EPPA 1Q84A 1N5OX 2G1UA 1V5GA 1FFXB 1HZJA 4IRUB 3STWA 4ESHA 4XIFA 3UUWA 5F7JA 3PGXA 4LI3X 2IDMA 2AB0A 3LFHA 4MA4A 4D3SA 4O2RA 1Q1NA 4E5UA 5IABA 4E6HA 5B2EA 1MC4A 5B1BE 1T9KA 2WG1A 3PQ2A 5BQOA 2PZFA 1AUXA 1EYZA 5JMPA 4ALIA 1U8UA 2QUJA 3BIJA 4MKHA 3NOVA 4ER0A 3LU1A 4I9FA 4AK9A 5E6UB 4RIGA 5AESA 3KKZA 3LWZA 2D0IA 5HBRA 3NXSA 4NMMA 5FI0B 3PNVA 4D9KA 3IHVA 3D4BA 1OI7A 3MWLA 3LPZA 1W36B 1IZ9A 2ZJ8A 3MEKA 3DYBA 4DHEA 2GBPA 4W5JA 1X74A 3WB2A 2VJQA 2P8SA 1QC5B 1C9NA 5T4FA 5EZYA 4FVTA 1I33A 2CJWB 1MW9X 3ELYA 4CXMA 4F3KA 1QK3A 1NX6A 3V8VA 3M0EA 4B94A 2H1IA 1DT5A 3MD9A 1MJHA 3A4LA 4EFMA 4B2PA 2X0IA 5MFZA 3L0IB 4R2IA 3DEFA 1VLLA 3UJ7A 5EZYF 2X1VA 1KDZA 5DFAA 2I6HA 5F21A 4HEA1 1GXSB 4JASB 3OLCX 2I4NA 5FR1A 5ALWA 5K8LA 1NN1A 2K6GA 1HLPA 1O54A 4UBKA 4K40A 3NYIA 3EUEA 4QU9A 2QLMA 3OTOB 3CXRA 3OOYA 1YBHA 4PPQA 1QF9A 4C87A 2WIFA 2X8LA 4J1NA 1IQPA 4E08A 1JQ5A 5EIAA 4ZOQI 1F2TA 4CT4A 1N54A 4O4HA 3C3RA 3LW8A 4L0DA 4BJ6A 3E35A 3KWFA 1DARA 1WZ2A 2VSOE 2HJSA 2GEUA 4E03A 2CUNA 5M72A 2ZYVX 4MW4A 3T5AA 3IHWA 4X7PA 1VDYA 3U3MA 4BEJA 2HDHA 3HFRA 2A59A 1B0AA 3KR9A 4O4HF 3IOEA 4AO8A 3MG9A 2YMPA 3FVVA 3OA2A 1WABA 3BWYA 2OEPA 3GFSA 4P22A 1F0NA 3KQHA 2Q5IA 2M63A 4A4DA 1SZ9A 5CXQA 3WLLA 1GT91 1QHFA 1GVHA 3DAYA 4K0KB 1FTYA 2CJYA 3HB0A 4G1FA 3G2QA 3RV4A 3EQ7A 4JCCA 5ISMA 2QZAA 1QGAA 2BM8A 5LQDA 3G59A 4HGOA 4DF3A 4RJJA 3WX0A 2D1YA 1M2GA 5SV2A 1HDIA 3O8NA 3MCTA 1V55E 5ED4A 4EZKA 5LMNB 3LDUA 3LLSA 3PC3A 3FHCB 1OT5A 4XWWA 3OQOA 4YNDA 1C81A 4Q9LA 1O5IA 3BGDA 3AEQB 4XJXA 5AI4A 3BJRA 4C5AA 3IIIA 2I2FA 3RAJA 4RADA 4UBNA 2OCCE 1KMMA 4U0KA 2X6TA 2EFYA 4TWZA 1YQEA 5I4KA 1V4NA 3CKMA 2FEMA 3R20A 2WXQA 2I55A 1WKCA 4B6OA 2HF2A 4DLVA 1E7YA 2KM1A 4GMDA 1YL6A 5BN4A 2P9BA 1I6MA 1NXOA 4OYRA 3QMWA 4I6GA 1MENA 4LRXA 5A4DA 1L5HB 5ITZF 1WXHA 1F8XA 1J23A 3MD0A 4ND8B 1CTQA 2I6GA 2PPVA 1XZ8A 4I43A 5P21A 3TCNA 4YV7A 4P3NA 1U80A 3EMDA 4II3A 1T35A 4IIYA 4I19A 1MH9A 4TM7A 4F53A 1W2HA 3BFKA 3LAWA 4NBVA 4NDZA 4QSHA 4GZ5A 4OP3A 4GAEA 3WL7A 3CEHA 1TEXA 3JQ8A 4RZ3A 2WKSA 2O19A 3H8SA 2GSWA 4I4LA 3VMFA 3K9FC 1CR6A 4JYCA 4XEIG 2PUTA 3IB3A 3KZMA 2ZJ5A 4H15A 4D5GA 3EPHA 3KKEA 2Q6TA 2IPXA 1Q0RA 5TMDA 3FWPA 3C5HA 1MO3A 3P1JA 3T12A 3AEZA 3L93A 3OSUA 5IXYA 1P29A 1W73A 5HE8A 1SUFA 3AP1A 3FOZA 1BXGA 3C41J 2J41A 3BFPA 4WNDA 3BXOA 3USES 4GKVA 5D51S 3RI3A 4URVR 3D0QA 2H7XA 1YR2A 3GGCA 5LZ2A 4RO0A 4LJ7A 4M8NE 1QH8B 5A0FA 3SD5A 1UT6A 4PLZA 2YOGA 1E60A 1SRQA 4EVRA 1DBIA 3WLTA 4ZALA 4AX8A 3NP7A 3OCJA 1NHWA 1X3LA 2XD9A 4W63A 1YBFA 1Q5PA 1NUQA 3M3PA 3SDSA 4DDHA 4PAWA 2FJBB 1EXMA 4X1IB 3D6UA 4L07A 4EY8A 3ER9A 3PEUB 5AVQA 2C8JA 4WSOA 3HXDA 1RBYA 2H6GA 3SGLA 2H4XA 1MT0A 1ADFA 5CEJA 4DCJA 5I4BA 1MRSA 2FFAA 4NOJA 2WOOA 4K9QA 3NQPA 4GPKA 2B4KA 4ZOEA 2HIAA 4JI2B 4Y18A 4Q66C 4ZOLA 4YHBA 3EIJA 2VHJA 3E1KA 3PT9A 3IDZA 5JAIA 1EHIA 4N5MA 1IBMB 1CUAA 2ABWA 1K4YA 1QIEA 2GJAA 1E2FA 2AW6A 3H86A 3MGAA 3O26A 3PNSA 4U7JA 5EZ5A 3JQRA 3EW9A 3HA5A 4PLWA 4ZOLF 4EB6A 5KMGA 2QN1A 1A9XA 2HHLA 2FG5A 3N0RA 1RYYA 2OFFA 4MOWA 3LBNA 4L95C 1KDTA 1HM5A 1YA4A 3HWX1 1XF1A 4CFSA 5EXDA 3V1TC 4JU8A 3JXIA 4KQFA 4U2BA 4GTVA 2EL7A 1XVAA 4NS4A 3LKZA 2Q5LA 2NU9A 1QFMA 2I1QA 2ONCA 2XJ9A 1RQ7A 4S1WA 3T4UA 2KBEA 3K0FB 1XTJA 1Z7GA 1LTHR 3NM6B 3VU9A 4ZJYA 3ZWCA 2YVLA 2A86A 3DV9A 3MTJA 4F21A 3HYRA 3CPJB 3CV0A 3UXYA 3F3YA 1ULAA 4PLPA 2OCAA 5A7DB 3MTBA 2SKEA 4HLNA 3H1EA 3MV2B 1DQPA 5EP3A 1P1JA 4EKNB 3OZXA 4MI1A 2B35A 4I17A 2M9MA 3LDHA 3E84A 3C3EA 3NV7A 2FPWA 3HCDA 3HO1A 1DIHA 3FNFA 2XGGA 4TL8A 4Q9IA 2VQFB 3TECE 3WGJA 2JBHA 3WK5A 4NURA 3TL6A 3TX2A 5JYCA 3EAFA 4MIYA 1TJFA 2E7ZA 5CVDA 2PGIA 2UVQA 4B6QA 4EF4A 5GQSA 1P74A 3ZVLA 4GSYA 2W71A 5E6SA 1D07A 3PI6A 4IS2A 4BFVA 1GAJA 3FPFA 4A2WA 1JVBA 4ZZ0A 4JB8P 1G4HA 2BGWA 3MRXA 2Z2YA 1FSGA 3LPMA 4IDPA 3TL2A 1NLMA 4NHEA 5CA0B 2QM8A 2JLRA 3H5IA 4WA8A 2OV3A 4ENRA 2XZTG 3CVQA 2MMGA 5HMLA 4DDWA 5M7EA 1O9GA 1G8MA 3EXAA 2QYHA 1I36A 2HE0A 2ECFA 4KREA 3NOQA 1U0LA 4PQEA 3DDOA 2BP7A 4UAGA 3DFIA 1OWMA 2RMKA 5H83A 2V7WA 3DPYA 4F9TA 1FYVA 3RREA 5TGTA 3GK3A 3IO3A 4URKA 1QG6A 4AP5A 4MVCA 2OD2A 4FMDB 1HLGA 4DMCA 3HP1A 3NKLA 1FA9A 4JIGA 1MFPA 1K7YA 1OIVA 3I5UA 2YHEA 4TUMA 2WVIA 1EE2A 4PC7A 3G0IA 4JL0A 1C9JA 1PN3A 2Q8NA 1DAKA 3E9EA 1H8HD 1OPRA 3DL0A 3K0CA 2CHGA 3ZKAA 2ZAYA 4BQFA 2PCLA 5LUBA 2YBEA 5H8WA 3SLGA 5A1JA 3LH5A 3TPZA 3TFWA 3WLOA 1P1BA 3EGDB 1FXSA 3HG7A 1PBNA 1PJTA 2ZCJA 1E18A 2FF7A 4IJ6A 4ARIA 3EMVA 5LP1A 4GU5A 1XGWA 4IO0A 2WSBA 4HTAA 3NV9A 4KNVA 2FEOA 2GROB 3RGWS 3BUSA 1OKKD 4PYOA 2QN2A 5T3RA 3P7MA 3BCHA 3L1HA 3OTGA 3R7LA 3OIYA 3ZCTA 4BNVA 3G5LA 4UCQA 3W78A 3DQQA 5DM0A 1FVOA 4KNYA 2Q49A 4UOEA 4KN6A 4M8KA 5ED0A 1D2NA 3RDPA 4V0KA 3T7EA 3L43A 3TBKA 2XWBF 2CHEA 4UDXX 3DPIA 1MRZA 4XKBA 1XUOA 1KZYC 4CQJA 1H6OA 2KJZA 1ISJA 2ZYTX 1UC8A 3H11A 3B82A 4DAOA 4L51A 5CH5A 3JRWA 1RJFA 1HTTA 3CBQA 4LPSA 3KQYA 1XQXA 3PDHA 2XDYA 1PIWA 4P4LA 3UJDA 3V8RA 3UMYA 3R76A 1HEIA 4X97A 3AM1A 4PSUA 4WACA 4R2KA 4B7UA 3KV1A 4DGQA 1PJLA 5DRYA 4A2PA 1JG4A 1MX6A 1WKVA 5GZ6A 3JTEA 2XB4A 2OAQ1 2QGZA 4FHGA 4GE3A 1HG2A 4HAUA 3A06A 1O95A 1YHNA 2RGEA 2F3UA 3CG0A 2B94A 5FTLA 5K0BA 4ES6A 4U0UA 1E6EA 1NHGA 4L2IB 3CH7A 5CEDB 2FPIB 4O4IB 1VBMA 3L16A 4J75A 4S1TA 2B83A 4WOCA 1SCIA 2M6LA 1QHYA 3MA5A 1AZLA 4IV0A 4EG3A 3EA5A 2AYZA 4OSOA 2DPMA 4QM7A 1IHOA 4PSKA 4EVSA 4CEHB 1M2EA 1JYEA 3U3XA 2EC5A 5LXTB 1PJBA 1BTOA 1WHSA 2OZLA 3M8KA 1ZOLA 2HQBA 2F00A 2FR0A 2BL4A 4PZCA 2ACWA 2Z56A 2CJPA 2D5LA 1L5RA 3FH0A 4IXTA 5TIIA 1KWGA 3KPYA 2F2TA 2BTEA 4MKIA 1VKNA 4MGZR 3CCFA 2HK9A 4WPGA 4L3OA 2GN9A 1JNXX 3V80A 3ROXA 2VDMB 3R6WA 1AJEA 3QKSB 5DO9A 1GARA 3QVMA 3T9BA 2HPVA 4Z4QA 2LRHA 1JSXA 1IXRC 1N5JA 2E4AA 4O2BA 4XE0A 4OBXA 5D2CA 3SX2A 5KZMB 3KEMA 5GM1A 4DWJA 4OXIA 2LZ0A 1V43A 1XTPA 4IJUA 3GHHA 1AUPA 3ECAA 2OL4A 1V0JA 3VISA 4H60A 4WCFB 4ZCPA 2YZ2A 1VMDA 3ELDA 1N36B 5SYAA 1XNQB 2VHXA 4R8KA 4YCSA 3SBOA 1R5OA 1X92A 4QDXA 5EKDA 1WVGA 3KE9A 1XSEA 4FJYA 5IAOA 4JB0A 1HKUA 5A3VA 1SCDA 4QVIA 1QANA 1P1IA 1WPXA 2NVUB 3S2SA 4NDNE 1IN4A 1H9AA 3GT4A 3R24A 5F3DA 3ZLJA 3OEHD 4XPZA 4JQOA 4I6EA 3WSWA 2QPLA 3RVSA 1NU6A 1KNXA 1RWNA 1W4AA 3WDKA 3EQ8A 3P2OA 2OGUA 3ZK7A 4BB9A 4CMHA 4D4HA 4KYUA 4J7CA 1LKZA 1DC6A 3BZBA 2AV6A 3UOGA 2Q3LA 3X2EA 3MX3A 4OJNA 2FFBA 4KYIB 4J6FA 2DQZA 4LHEA 2VQ3A 2BBOA 4DZRA 3JQ7B 3MUFA 1CUDA 1Q1AA 4E2XA 2GA8A 5KQSA 1Z8DA 3QU5A 1BA3A 1KJJA 1Z8FA 2I6SA 3MKQB 1Q95A 5ALYA 1XPUA 2ATXA 3D54D 5C1DA 2EW1A 1EFPB 4C6TA 1NXTA 4PO9A 2WBLC 1LWNA 4LMRA 3U7HB 3RFCA 4GPMA 2UZIR 2F67A 4EKIA 3INRA 4GCNA 3RSHA 4D8XA 3Q7QA 3A0RB 3W5SA 4M21A 1BX3A 3Q5EA 2FJ0A 3FPEA 4LBZA 1U2RA 5B3JA 1RXSA 2EU8A 1MABA 2O8DB 4OGWA 1R10A 3H65A 5E4FA 1LLUA 2WQZA 5HP4A 3ONWA 3TWVA 3DMTA 1EVZA 3QUCA 3AV0B 2FWMX 4B43A 3TXMA 1K5GA 2Q1SA 1I3OA 2OV8A 3IDAA 2BBWA 4LGMA 1RWXA 5CYOA 4RCYA 4HQFA 1MEOA 1XKTA 1QMGA 4RTRA 2XTNA 2CCJA 1E0SA 3H18A 4LYEA 5EJ7A 1W87A 4Q19A 2PGXA 5CFPA 1JQAA 1SUDA 4C0MA 1MJFA 4GCOA 4MLDA 4G1EB 4HQOA 2FPPA 2CFZA 4M8LA 4PN3A 2YMMA 5C8XA 2ZU6A 4NXNB 3PTLA 5GINE 3ND7A 1E1CA 4ROSA 2GO1A 2G04A 4I8DA 4X90A 2GN6A 1KPGA 4HPJB 3ZJVA 3NOCD 1C2TA 3VNBA 4RY0A 3VR2D 2COKA 1XD8A 4CETA 3T1NA 3FMIA 3QFHA 3S1AB 2RHMA 3PV0A 3DAFA 1EHYA 3IP6A 2H1WA 3KLPX 2FMHA 1R8SA 5JHHB 1RHMA 4TRMA 3GUHA 1HYBA 3PNOA 3AVVA 3BF8A 3J7TA 8ADHA 2XUPA 3N2YA 4DA7A 1NYRA 3OJEA 4AJLA 3TMAA 2HCJB 3SBTB 1RACA 1JFTA 3O1JC 4XGRA 4JC4A 3D02A 3DTYA 5FO1A 2YWBA 3ZVRA 4YDSA 3C5WP 1O0SA 4DX7D 4LCEA 4P7JA 3L17A 2AD5A 4BNTA 4DX5D 4CIWA 4DNOA 2AMLA 4LJ9A 1A27A 3CNLA 3V2GA 4LOHA 3VTZA 3LEWA 1VJGA 1JI0A 4D0NA 1CRWG 4FDLA 3DVAB 3WR5A 4GM1A 3L6BA 1QR2A 3LKDA 2CLEB 3GLGE 3RO3A 3L7JA 5HYVA 1AMOA 1OCEA 1FUIA 1JA1A 1GIAA 1VA5A 4C43A 3B1XA 4EPVA 2OG2A 4LGVA 2EQBA 5BSWA 1GNTA 1WG0A 3WQSB 2HDNB 4CIBA 1M34A 1LRLA 4ZYZA 1J8DA 2P2CP 3ZGOA 3VZPA 1GKIA 2XWPA 4JR2A 2P40A 4KJZA 4BSXA 1JP7A 3JVUA 3AL0C 4DUPA 3GDOA 4URXR 3HVIA 5KNCH 1YIDA 1J25A 1GL3A