4GZ3A

Crystal structure of human o-glcnac transferase with udp and a thioglycopeptide
Total Genus 279
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
279
sequence length
715
structure length
695
Chain Sequence
b'PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKHIYDNRIVLNGIDLKAFLDSLPDVKIVKNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
total genus 279
structure length 695
sequence length 715
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz3A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz3A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gz3A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gz3A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gz3A03
1P29A 1ZBPA 4N3AA 3MS2A 4UQXA 4GZ5A 1F0KA 1HH8A 4XI0A 3EDTB 5C1DA 4BQFA 3T5TA 2IEIA 4BFCA 4G24A 3O3CA 5EX0A 3CEJA 3DZCA 3RU0A 3LYAA 2VGXB 4J8FA 1FS4A 4GPKA 2KC7A 2R5SA 3OXLA 2BUGA 5LCWJ 2Y4UA 2PQNA 3Q5MA 1UQTA 2QN8A 3DD1A 2PQRA 2ECPA 1GPAA 2GPBA 5FZRA 4GPBA 3T3EA 1QQEA 1NA0A 2AMVA 5D01A 4GYYA 4W9RA 1UZUA 1Z8DA 2GPNA 4CTNA 3LKUA 3UYLA 4I9EA 3BD6A 3ZGQA 4A1SA 1FC0A 4N2SA 1K06A 1L6IA 1IHGA 3BCSA 2PZIA 4YUAA 1XNFA 4EL0A 3WXXA 3CUVA 4GA2A 4N39A 1GGNA 3GPBA 2QN9A 3MRXA 2OFFA 5BT1A 3LCAA 2HO1A 3T7DA 3BDAA 3OTGA 4HWGA 3HBNA 2QNBA 2O6LA 3Q3EA 1FCHA 3AS5A 4RIGA 2QRHA 2GEKA 5M72A 4FZRA 3KS2A 4EQFA 1E4OA 2QRGA 4J8EA 1C3JA 3MEKA 5LCWC 3S7JA 3FP3A 4RELA 3VTYA 3LPZA 3L7BA 5FJYA 3DDWA 5ARGA 8GPBA 3QWPA 5CCMA 3BCRA 2XA2A 3K9IA 4W6QA 1E1YA 3QWWA 2H1FA 3E3NA 4AMBA 2SKDA 4JL0A 1GPYA 4CTMA 3Q47B 1NVKA 2C9ZA 3L01A 3U3WA 2LSUA 2HYZA 4RENA 3ULQA 2X0FA 4Z5XA 3MT8A 1RZUA 4F9FA 4YNDA 2YJNA 1B4DA 3RHZA 1JIUA 2FI7A 4G25A 4Y6WA 1L5SA 3Q15A 3RKVA 1C8KA 4REMA 2QZSA 4N9WA 3QKYA 4CGVA 1OUVA 1IYGA 3ZCRA 5DXFA 4EL5A 2JJMA 4MHSA 3FWVA 1P2GA 2IF4A 2JLBA 3HBJA 4U07A 2MHKA 2FF4A 3JYSA 3MTDA 2X6RA 9GPBA 1HZ4A 2XGMA 5GPBA 2XCUA 3L7CA 3SF4A 1K08A 4BQIA 3D0QA 1TJCA 4YI5A 4N2QA 2KS6A 3QOUA 4AY5A 3CV0A 2F3SA 3TG5A 3FFLA 3UUXA 1JG6A 2F9FA 1EXVA 4BT8A 4YVOA 4GYOA 2G9VA 3L79A 1HLFA 4MICA 5DU2A 1QKJA 3QWVA 2VSYA 3IEGA 1ZU2A 4WACA 2VQ2A 1LWNA 2G9UA 3ASGA 2L6JA 2UY1A 4NRHB 1V4VA 1JIXA 5DIZA 4CTOA 1E96B 3NPAA 2XA9A 4X6LA 3LY8A 3ASHA 7GPBA 3MBOA 3QHPA 4GZ6A 4KXKB 3BD8A 3OKAA 2PYIA 4H7XA 3U4TA 2X0DA 2HY7A 3HYMB 4L22A 2FEZA 3MA5A 4N3CA 3RT1A 3ZCPA 1XL1A 2UY1B 4MI9A 5TMEA 3OKCA 1SXQA 3UPVA 4M83A 1LWOA 2VCHA 3WC4A 1L7XA 1L5VA 4AN4A 3WADA 4GCOA 3NC4A 4NEQA 4KQ1A 4GYWA 2VGYA 2G9RA 3L7AA 2SKCA 3CK7A 4F97A 3S7DA 3OY2A 3TSAA 4HLNA 3PE4A 4XIFA 5BNWA 4AM9A 4UI9K 4GCNA 1WW3A 3CUWA 3OXFA 4HOSA 3HBMA 2JZCA 3H4IA 3GW4A 2ONDA 1PNVA 4BTAA 1JEJA 3VDNB 1XKXA 1QM5A 3CVQA 4MRAA 3UYKA 2WPVA 5JTTA 4RG9A 4UI9J 1QZ2A 4LDPA 3ZCUA 4RIHA 2C4MA 5TMBA 4G23A 3MV2B 3Q49B 1ELWA 3EBOA 4KQ2A 5FZQA 2V5FA 3MS4A 1PC2A 3OTHA 3UQ3A 3E3OA 2PRIA 1M5RA 2X6QA 3NB0A 1Z6PA 4BTBA 3C4VA 2OOEA 4G1TA 5KJLA 3HBFA 1W3BA 3BEEA 1L5RA 3ZHEA 2ATIA 2VG8A 3LY7A 4UQZA 1A8IA 3VTXA 1AHPA 4WHMA 4ME2A 3MV3B 1Y6FA 4ABNA 3PDNA 2X0EA 1H5UA 1WW2A 1YA6A 1P5QA 1EM6A 1L5QA 3ZHEB 1VGVA 2C1ZA 4O6FA 5KJKA 1FU4A 2FF5A 2VCEA 3G2NA 5HQ8A 4G2VA 2GT1A 4PQGA 1WM5A 1KT0A 3G2KA 3OT5A 4CDRA 4J8DA 3COPA 3MRVA 3RIBA 1A17A 4UI9C 1YGPA 5CHEE 5JJ6A 3ASFA 4APOA 2ASVA 2AZDA 4HORA 2YHCA 3MTBA 3MT7A 4U0SA 5TVGA 1Y8ZA 2NC9A 3NP9A 4X7MA 5CCLA 2F3PA 3G2LA 2YQ8A 3CKCA 3NP7A 3ZCVA 3EBPA 2C1XA 2C2LA 2IYAA 6GPBA 1ELRA 5D0OD 2QFCA 5FZSA 3CK9A 3E4BA 2IV3A 2G9QA 2H1HA 3R9AB 4BWRA 3WAGA 4N3BA 2KCLA 2QN7A 3GYZA 4I2ZA 3MS7A 4M60A 2AV6A 2AVPA 3RSZA 4WNEA 3T3HA 1IXYA 3G2HA 4EKEA 5A7DB 3VDMA 3ZCQA 1NZDA 1XOIA 3S27A 3IA7A 2Q7FA 4HOQA 4EJ2A 4NC9A 2GW1A 2P6PA 2QLLA 4JHRA 4BQEA 2IEGA 5EX3A 1NZNA 1NLMA 2QRPA 1Z62A 2IW1A 4X7RA 3RO3A 1WUTA 4MI6A 4HOUA 1C50A 2R60A 4G26A 1O6CA 3H4TA 1GG8A 1BX3A 5AYWD 1F6DA 4J0UA 3Q3HA 3CX4A 2ACWA 2GM9A 5KJNA 1Z6QA 4I2WA 2J9QA 1Y6GA 2AW3A 4LEUA 2BGTA 1PYGA 4WNDA 3MQFA 2WTXA 4G2TA 4RBNA 4YI3A 2C0LA 2I6HA 1J39A 3OTIA 3T3GA 4LEIA 4WUYA 4KQMA 1P4JA 3FROA 2XCCA 1NOKA 1C8LA 3GUHA 1WUYA 4I9CA 1NOIA 4H7YA 2QN1A 2QN3A 2XA1A 1P4GA 3O48A 4YVQC 5HI7A 2KATA 4IN3B 3BEOA 2LSVA 2XGSA 3RSCA 3MT9A 5D00A 2R4TA 1YA0A 4JA9A 2XCIA 3NAZA 1HXIA 1FA9A 1JIVA 1GFZA 5DLDA 2SKEA 5KJMA 4NESA 5BW8C 1B89A 1RRVA 3CEHA 3E3LA 3VUEA 3C48A 5JJTA 3CVNA 3GZ2A 3MSCA 5JTUA 3AS8A 2PRJA 4NQ0A 2FBNA 3G2JA 4I17A 1FU8A 2R66A 2PQ6A 2HR2A 5LQDA 2ACVA 3CUUA 4FKZA 2QLNA 5G05J 4QLBA 3ESKA 3OKPA 2E2EA 1P4HA 4WNFA 5DBKA 4F3VA 2VYIA 4MHOA 1JG7A 3CK8A 2KCVA 4RIIA 3S29A 3S0JA 3CEMA 4KYOB 4BT9A 5G04J 3PE3A 3S7FA 3RO2A 2XMPA 2QLMA 1NOJA 3SYRA 4XI9A 2QRMA 1XV5A 3S7BA 5D0QD 3ZCSA 3QDNA 3DDSA 1XL0A 5JJ7A 3QKWA 5EKQD 2C0MA 4X7PA 4RIEA 3L7DA 3T3IA 2PYDA 5IKOA 2FETA 4GZ3A 3N71A 3C4QA 2GEJA 4AY6A 4MI3A 4RIFA 3ZN3A 3IAAA 3T3DA 3S28A 1L5WA 3OY7A 5IKPA 3CEQA 3TAXA 2F3UA 1Y8MA 5G05C 3D0RA 4F96A 4B94A 3CVPA 4EKYA 3MRTA 2LNIA 3MTAA 3VUFA 2QRQA 1WAO1 2FO7A 5FTPA 3TOVA 2PL2A 4KBQA 1GZ5A 2WQHA 2DBAA 2XPIA 5FT9A 5ARFA 3ZFWA 3CKBA 2F3QA 4JA7A 4Y6CA 4U04A 3KAEA 5G04C 3LY9A 1PSWA 2IYFA 3ASDA 3AS4A 1P2BA 4AMGA 2XGOA 3KD7A 1WV0A 4M7PA 3MKRA 3ZCTA 5A6CA 1RZVA 1ABBA 1FU7A 1FTYA 2BISA 5ENZA 3D1JA 4HOTA 1NZFA 2UWJG 3OXGA 1SXPA 4GA0A 1P2DA 3CVLA 2Q6VA 1IIRA 1AXRA 4RG6A 2GPAA 3CV3A 1WV1A 1XC7A 2BGUA 2R68A 4GA1A 3SYMA 2Y4TA 1PN3A 3CUTA 3NCHA 2KCKA 3ZPJA 2IUYA 3BD7A 1NA3A 2FFRA 4WADA 2XCBA 1FTQA 2IFUA 4N5CA 4AIFA 1KLXA 1KT1A 2QN2A 5I45A 2R4UA 3GZ1A 2VSNA 4UQYA 1FTWA 4WNGA 2P58C 3Q3IA 4CGWA 3AMVA 3BCUA 1KTIA 2ZB2A 1GPBA 1UQUA 3RJVA 3URZA 2BFWA 2IV7A 3S2UA 3Q4AB 4U0UA 2XEVA 4U0ZA 2GJ4A 4I1AA 3CUYA 3NF1A 3SZ7A 3G2IA 3TGOA 5TMDA 5HXAA 3TG4A 2VGXA
chains in the Genus database with same CATH superfamily
3HCFA 1G1AA 2H1LA 2O05A 4UBLA 2B1JA 4L8WB 2DQYA 1ZX1A 2QEQA 3E9EA 2KC7A 4EUKA 4AUKA 1R4NA 2HSZA 1W4ZA 4L4XA 4QPPA 3NYRA 3V4PB 3VYVA 4BMVA 5ENQD 4RADA 5EDSA 1NATA 1EGHA 2WNHA 1T0UA 2GRNB 2ONYA 2QL5A 1RLJA 3GWGA 1CZHA 5T8KC 3A4IA 2I66A 3R0JA 1HLGA 1WB4A 2AOUB 4PQYA 2OQVA 5KWJA 3GZNA 1C0KA 4DTCA 2ETVA 3HVEA 4JKIA 4QO8A 1UBCA 4D92A 3RK1A 1NW4A 3FYDA 2F3TA 3KEOA 3G68A 5LQKA 4RDIA 1WCYA 5BSTA 3E37A 2QMQA 1E2BA 4HKTA 5EJAA 1YDWA 4J49A 2DBRA 1JNRB 3I05A 4P36A 1YK0A 2ZIGA 3P1UA 4GYOA 1S1MA 3DDUA 2P2CA 3V8BA 1CR4A 3I52A 1GN9A 3ZUPA 4WBNF 1TNBA 4LJSA 2GYVA 2L6JA 2WXJA 3G9XA 5HQ3B 4AMZA 4M53A 3BB4A 3GUCA 5DO9A 4ACLA 4LJ8A 1QGAA 1W88B 1E77A 1P9NA 4A55A 3JPYA 5IH7A 5C18A 1N2XA 3PGVA 3C5HA 1O9HA 1OD6A 1U1EA 1H9BA 1V3UA 3WK5A 1P5HA 3EC2A 1XN4A 3MCZA 1ID1A 3TD2A 1JKJB 4OO3A 1KE1A 2ZPTX 3OECA 1H4SA 3IXEA 3ABIA 3OTHA 1K98A 5JARA 2VP9A 1G3IA 2NADA 1KMNA 3O4IA 3JARB 2OM2A 2JH9A 2BVNA 3S7ZA 3NVKI 1QHIA 1X80A 1RCFA 4GD3Q 1NXVA 2IY8A 1Z0SA 1EQUA 4FYKA 1XCJA 4E5KA 3BGOS 4DQLA 3DZHA 5JJ6A 1QFXA 3FLMA 1Z4QA 4BVFA 4X7MA 5CCLA 4RQBA 4WESA 3KWMA 4YDSA 2PU5A 3WY9A 1YQWA 5HSGA 2PIDA 2XCQA 4YDHB 4POOA 2ETXA 4HMQA 3MGBA 2F43A 1T10A 2I2OA 2PKQP 1QHFA 1YS6A 3KT6A 3NAWA 4BMSA 3G2HA 3EEOA 3IT3A 5KSWB 4M99A 4GVPA 4AJNA 1TQ4A 1R0XA 2FZEA 3WYGA 4ED9A 1BE8A 3P9IA 7REQB 2IS6A 1RP1A 2W9XA 4UMFA 2RJOA 4AZ0A 3IA2A 2BGTA 2Q5IA 2VRCA 1JMVA 2NZUG 1RACA 1VIDA 3IP7A 1O1SA 3I6YA 3G9QA 1RQ7A 4RW0A 3ML8A 1Z38A 5GZ6A 3ONDA 3USZA 1FYEA 4N01A 2PLAA 3I2HA 4UVEA 2EWVA 4KXWA 4Z4QA 3H9GA 3WNCA 4WNIA 2O8VA 1C30B 4LNUD 3FPFA 3M6UA 1H2TC 3S7BA 2QY6A 1GRNA 2BF4A 1VIVA 1FW8A 5AW9A 1YRBA 3U3KA 3U81A 4MK4A 3S70A 3E5HA 1TUIA 1V1RB 3RIHA 3AM1A 1OWPA 1OX5A 1NJGA 4UKDA 2JGNA 3PC8A 4B3SB 4M1YA 4NBTA 1ZNZA 3VKHA 3FHCB 4RGQA 1COZA 4KLZA 3L7IA 3F6SA 1UK8A 4TZ0A 1EDUA 7ABPA 4AYWA 5CUQA 4OHCA 4JUCA 4YJ2B 4ZHQA 2VJKA 1ZRMA 3RS0A 1E59A 4IRUB 3HA3A 2AZ4A 1U7XA 1ZMRA 5IMSA 4BUZA 1HG0A 3FUVA 2YWBA 1LKZA 3ZE0B 2WHQA 5HS6A 2Q4DA 1NVUQ 3ZU6A 3TWVA 4TYPA 1LTKA 1NTRA 3DBOB 3C3YA 1GLNA 3DD1A 2IWRA 3C3BA 3MHTA 4M0FA 2GPNA 4HWKA 4YAKA 4IXMA 3EJNA 4GAEA 1MN6A 3IDZA 3N74A 5L3RA 4HWGA 3U4AA 1A9XB 2CCJA 1HDZA 2B21A 3T54A 5T8IA 3TR5A 4NCKA 1D07A 4JX8A 2VT7A 4HAZA 1C9NA 4LVCA 1RJGA 3L8FA 3JQEA 3EOAI 1KQFA 4ZPXA 2QT0A 3E15A 2YNMD 4NZZA 3Q10A 3GJQA 3V30A 3DXKG 4E13A 3FNEA 5HBRA 2CL6X 2PRZA 1S8OA 3FU0A 2VOEA 2ZWAA 4Z5XA 4Y6WA 3EVAA 3E5MA 1XAHA 3FSEA 3SHVA 4HUQB 3SEAA 5BPFA 4B8WA 5JD4A 2CHVA 3R6LA 5H4GA 3UC9A 5FAKA 2VPPA 5AMXA 5GPBA 4LDJA 3GEMA 1IVNA 2WWIA 4IUYA 2O9JA 4NS1A 5EVJA 1EIWA 1QFYA 2XZTA 3NM5A 1NQXA 2HWXA 1PZXA 4O59O 3UG6A 3CZQA 4DCUA 3DAGA 1P4SA 4U5XA 1QG2A 1UP6A 3PCXA 1CZUA 5LB2A 5LJIA 1JWLA 5E8JA 5TS2A 3SS8A 1GPWB 3DKVA 4N3CA 3MB5A 2A57A 1L8OA 5LYJB 1CJSA 4IIYA 4L51A 2ZTSA 2VGEA 2NTJA 2O14A 3TI7A 3UUGA 3GYXB 3Q79A 1NIPA 2WM9B 2Q5FA 5ENOD 5C5EA 2KJQA 3ZXYA 1B2RA 4BB9A 3IBYA 1O5OA 2NTVA 3CONA 3D43A 2VQDA 5DTMA 1HEUA 3I04A 1SCAA 1KY4A 3U7GA 4CR7A 2VCYA 3NTRA 1U9JA 4HBGA 3CVVA 4H7FA 1OU4A 5KNBH 2X6QA 4L2LA 1JPUA 3OHPA 3MMZA 3IOYA 4F2HA 4QWMA 2X6TA 5FUQA 4KXQA 2XIQA 3JWIA 3FCAA 1I7LA 4ERXA 4QLAA 1LLUA 2ZUBA 1O1RA 1Q0HA 2WXMA 1WEHA 4GEKA 4ND3A 3D8TA 3CKMA 4DE5A 1HO8A 3UOAB 1AK9A 2LRHA 2RONA 3IVCA 1D8TA 3RBZA 1SU4A 3DQPA 5ANRB 5I7AA 4G0PA 1FZQA 2QMUA 1K27A 2CSXA 3LUDA 2FV8A 4CI0B 1U7DA 1WUTA 3DBHB 3KS9A 3K5PA 2CHGA 3EGCA 4ND6A 3BWDD 2DF8A 1FX0A 2J6HA 4OGGA 5HCIA 1HDYA 2GQ0A 2JLRA 2ZUVA 3UK0A 1CULC 3C2QA 4FXPA 1V11A 2P4UA 4H0CA 3G0BA 4KQMA 3FGOA 5HRUA 1CQIB 3HN7A 2BGNA 4FQ7A 4V2IA 1WTCA 3SC2B 4HTAA 2Q6TA 1ORWA 3K31A 1R0WA 3R44A 2PNJA 4IQGA 3FTSA 1G4HA 3VKVA 1DMSA 5A3VA 5H5JA 2R7KA 3D7RA 2WMNA 4XWKA 2O0JA 1CY1A 3CF0A 4NACA 4F6LA 1H2EA 2GBLC 3AG2E 3C3OA 3O38A 2IE8A 3QEMB 4U5QA 4TKMA 4GTTA 1FYVA 3C6KA 5AHWA 2HDHA 4AS1A 4JHKA 3GEDA 1T34A 2VIIA 2W48A 2ZBRA 1LJ8A 1QAQA 5K6RA 4MNTA 5A5DA 4TXJA 2WJJA 3PQ5A 4MW5A 1W5BA 4U4AA 3R3WA 1ECBA 4DANA 4AV7A 1NKSA 3PLRA 4PWYA 4ZMBA 1MB9A 1K8YB 4FSHA 4J91A 2BKLA 4HPXB 1PTJC 3UJBA 4HYQA 1XD8A 4BLUA 4OVUA 2R1VB 1WPGA 4ZT6A 3H2JA 3U7JA 1QP7A 1VHLA 1KDPA 5KQRA 3IP5A 4JHLA 1EFPB 3PNTB 4KN5A 3IPAA 3C6BA 3T5CA 4MUIA 2I2DA 3LTNC 2XZDA 2FWNA 4D4KA 1E8WA 3Q1LA 1SQ5A 1TM7E 1FP1D 1U7ZA 4AWBA 3ULEG 3B51X 3C15C 4FQ8A 1QYXA 2G80A 4IINA 2PQRA 1B1CA 1NA0A 4Q02A 3ADOA 3CPSA 3LUJA 3GJRA 4B48A 1H85A 1I2BA 4P82A 3JYPA 4L76A 2GBGA 1MXHA 1UOHA 4G8KA 1UBEA 2WJGA 4HX5A 4QATA 3UT8A 1J7KA 1AKMA 4F72A 4LRSB 2WSIA 4POAA 2O2EA 5EJ4A 1HDCA 2OGTA 3V00A 3GJ0A 4TTRA 3U16A 2H52A 4WXHA 1HE5A 3K1AA 2F4VB 5F2OA 5JZVA 3LA6A 3THXB 2VRCD 1TEZA 2NPFA 3ES9A 1IOWA 2HK9A 5TJHA 3B7BA 1RWBA 2K7FA 2OP1A 2IU1A 4E46A 1TO2E 1C9JA 1ISGA 4KG7A 4OSOA 4RY9A 1J8VA 1T2NA 3UUXA 2FOXA 1VTKA 4XGKA 1HLFA 5AOXA 3RFUA 5HZMA 1J20A 4APFA 4MGKR 2WC1A 3L0PA 4W99A 4BLOA 4KBYA 5CJ2A 4YP7A 4NE9A 4DLKA 1P1JA 1ZMBA 2J5XA 1FQWA 2I6GA 2ZUFA 5NULA 3BD8A 4QRDA 4J3FA 2R96A 4C88A 4MUJA 4UVIA 4FLFA 3Q7PA 2PS1A 4K9QA 2HI0A 3A2LA 4NXMB 1PF7E 4YALA 2CVOA 4LHYA 4XIFA 4GPEA 4UI9K 3M4JA 1NYRA 4IDCA 2C7RA 1N33B 4BEPA 4P5DA 2NU8B 3LQQA 2XEXA 2OR3A 3AF3A 3KT3A 2PZKA 4PO9A 3UT4A 4XUDA 3C97A 1A8IA 4J3NA 4JDUA 2VHYA 1SUSA 1SG9A 1SZ9A 1DUVG 1ZD5A 3ICVA 3G6KA 4KNVA 3WIVA 1PFGA 5C8DA 1FU4A 4LBZA 2ZE8A 2QR3A 2DZNA 1WM5A 2JIDA 4LZLA 3SD5A 4D46A 2BFBB 4CT4B 3LLSA 3OZFA 3OZXA 5IVDA 3DZJA 2EJVA 3PL5A 4PRKA 2EJWA 4M0EA 1IRIA 1E8XA 4MAAA 3C3EA 2AJTA 1PJ3A 1N9ZA 1TLTA 4CEJB 2HNAA 2XD4A 4OHXA 3KDAA 2NXJA 3UW1A 4FNAA 2UZAA 1GUFA 3KTAB 3GB9A 3T1QA 5AKLA 3OZUA 1VMDA 4YV0A 4QRHA 3QNWA 4ZT7A 3A3YA 1LPNA 4D9IA 2XGGA 4YV7A 1TW3A 1J97A 4Y1EA 4QPJC 3IQDB 3V8RA 4MKGA 3EXEB 2BUAA 3KQNA 5H0IA 3RQSA 5KHAA 5ISMA 4MIEA 3HKDA 4YMHA 3UKRG 4HX9A 2I3GA 2W98A 1QQTA 3ZOZA 2VQFB 2B25A 3GAZA 5E9AA 2C42A 2X40A 3MINA 3UC5A 1U2VG 3R4VA 3DG9A 1Z4MA 3RT7A 4AF7A 4LKOA 4CEHA 1R8JA 4BRUA 2HLHA 3VHRA 1B8VA 2P9QA 2Z2XA 4F6CA 5EKQD 3CFYA 4QBIA 1KGDA 1BSVA 2DPHA 4XPIB 2QD5A 4N0PA 3MK31 4NY1A 2WXQA 1B43A 2OD9A 5DSXA 2WSLA 4MGZR 1XGWA 4U04A 3FMOB 5GV7A 3FPCA 3ASDA 5HVNA 3WV5A 3SHQA 4ALLA 3U9LA 2AHRA 3NH6A 5JS2A 1AKTA 4PZUA 4IICA 3VAYA 3UJPA 5LA6A 2QZ4A 3DV0B 2JH8A 2OUKA 5ADVA 2QC9A 5KVQA 2FN9A 1E3MA 3AMVA 2AS0A 5K01A 1Z2CA 2QG9A 4GI2A 1KZPA 2BTQA 1RYZA 4V0OA 1L7NA 3Q6NA 3W5DA 3LDAA 2HK6A 4W5NA 2IXAA 4MV9A 5JAOA 4RKEA 1U2RA 2XNCA 4M1MA 4UC0A 4UJ5A 2C2BA 5CLIA 4AN0A 1Q16A 2JEZA 3CT4A 3TKLA 4K5BA 1ULSA 5MGBA 3WWDA 1MRSA 4NNJA 3E84A 1I0IA 1X74A 5A5EA 3CKLA 3U3MA 3AESB 1J8YF 2NU6B 3WJ2A 4W7IA 4P7GA 1PJAA 3APFA 3V9PA 3QXSA 2G82A 1S02A 4KH0A 3VR6H 2J85A 4O4JB 4ICIA 3D3NA 3FBTA 3AW8A 3FB1A 3WV4A 3FFBA 4QFMA 4XB6B 4DRXA 5EJ2A 3KUKA 3UGQA 3TZHA 2I0FA 3ZNPA 1THZA 5LOVB 3QVUA 4RESA 4XYGA 3TG8A 1TU3A 4IBOA 1UODA 2XQJA 3CQGB 5ALPA 1RHKA 2P8SA 3CHQA 4MW4A 1RQNA 2YINC 1RI2A 1X39A 2FKAA 2FMFA 5AK5A 4TMYA 3FZGA 2CB9A 3ROKA 3QOUA 1F3OA 1Z37A 4GKKB 1E96A 1NU8A 1SXJB 4CM9A 1YOVA 3GX1A 5ALNA 3JQFA 4NRHB 2O4UX 4U2CA 2UAGA 1U8UA 5CM2Z 3U44A 3CSSA 2WWYA 3WLSA 3RW9A 5CJJA 4GTSA 3HE3A 2VCHA 3TJZA 2V54A 3UMYA 4DUGA 4HDMA 1U3TA 3AY7A 3JQBA 4D3YA 5FEUA 1R0RE 2HA0A 5LBTA 4KR3A 1NXPA 4YMUA 1VM6A 2HJRA 2OYSA 5GAJA 1QIJA 3V2XA 2ZLBA 5IUNC 1P80A 1HYBA 1T9BA 3R5HA 1QANA 4EYQA 3LUFA 3G59A 2O48X 1I5EA 2HXSA 5IAJA 5D3MA 4LZNA 5AR1A 2Z2KA 3W9YA 1J90A 1O0SA 2ZETA 2ZRFA 5BSVA 2V7WA 1ZIXA 1GUDA 1S8NA 5F5XA 4KUEA 3GA7A 2VK1A 2BEKA 2GWRA 4CGZA 4NEHB 1KU0A 5HZKA 2GILA 1Y63A 4JVNA 3PQ8A 1EDDA 4D44A 4D6YA 3PXDA 1PR0A 4LKRA 2QW1A 1GAEO 3I76A 3HUTA 4HC4A 2YNQA 2Z1MA 4DRZA 3O21A 1XZBA 1KIMA 3CX4A 2ACWA 4B75A 2AN4A 4KRFA 5C31A 2VPZA 2JJ8A 2QTMA 4B9AA 1QZXA 2ORWA 5U4XA 2C0LA 3E9MA 4L4YA 1UEXC 4EJSA 2AFVA 5FUYA 2JZNA 3VDRA 4TV9F 2LSVA 2CXXA 2B83A 3IJEB 5JJKA 1UEJA 1F2VA 5C2JB 4IEFB 1G6OA 2IXDA 4FGJA 2Q0XA 2XRYA 1U6KA 3ZY6A 2B1QA 2PXAA 5F7JA 4FKZA 1VB3A 2VHQA 3C5WP 2D5BA 4QUKA 3MMNA 4DY4A 3L5OA 1YD7A 1T8SA 4BSZB 5LYJF 2F48A 2R8XA 3R0VA 2Y68A 4O4LA 4EG6A 1DKQA 4DF3A 3BE5A 5JO9A 4JSTA 2P6RA 2VNJA 4YQYA 1ZIPA 4HLEA 3SQWA 4WV3A 3H65A 1KO5A 3HSYA 1TYAE 1JZSA 1A96A 3B9RA 1RWMA 3JD0A 1X7WA 3LT2A 4HLUA 1UIRA 1R5OA 1UK9A 1QH9A 1R6TA 2YQZA 1YDMA 1XLTA 1T2AA 3E61A 3KJXA 4ENVA 1I9GA 1GJRA 3N7TA 1NV9A 1K4MA 1MO6A 2OXIA 2W2QA 2Y4TA 3NM4A 4X8QA 4FLHA 1FTQA 2X1VA 2LDXA 3UX4A 4UNQA 4I2NA 4X3CA 1GFWA 4IILA 4ZALA 2Q1TA 2MINA 1HNNA 2ZI5A 2O52A 4CHGA 3PENA 2R11A 2AMVA 4FEYA 2Y0CA 4QZVA 5AK4A 3BD6A 4RPHA 3GEPA 3CUVA 3A9UA 3KYCB 5BN5B 3BDAA 4KK4A 2EKLA 3AFGA 1LY1A 4KX5A 5LP6C 4GP6A 5DSZA 3CZRA 4MWTA 1AWCB 4IV5A 4W5QA 3THYA 2PZJA 4WAFA 1KAHA 2P2LA 3SO8A 4FFVA 3MEKA 4M1WA 4GMLA 3FE2A 1DZIA 3D2AA 4RA6A 5G0VA 3PEFA 2QJTA 3QYPA 3V97A 3APCA 4IHKA 3E32A 2GZRA 3Q87B 3C0KA 2VTKA 2WD8A 2YMPA 4NCIA 3OUUA 3L0IB 4PSKA 1DIRA 3CISA 5IP5A 1N94A 2X0NA 4AECA 1X7ZA 5HGXA 3KAPA 1Y6QA 4M76B 3PGLA 3RSLA 2VUHB 4ZZ2A 1BU8A 3KWLA 2I54A 4X1OA 4DTIA 3T95A 2NU7B 2PMCA 3ASHA 4BFXA 2WPNA 2FEZA 1K5HA 2C7VA 5TMEA 1GNSA 1PJCA 2W6CX 3AU4A 3LF2A 1ZK2A 3OZTA 3HADA 5C46F 3I6BA 1XCMA 1OCZE 4BQNA 1RHJA 1ZEMA 1YFZA 1UF9A 2X0IA 4B2YA 1R6BX 4MPTA 3K96A 3CRQA 3AVYA 1JTVA 2LXNA 4UE2A 4WRRA 1XKXA 1AVTA 2HJHA 3CWQA 4M49A 2G1UA 1A7JA 5B64A 2I62A 2I3AA 3OZDA 2AE1A 4PTYA 3ZKWB 3RS5A 1V9CA 3KSMA 2VPTA 2GXQA 1W3BA 2CUNA 1TM3E 4UDXX 1RM4A 2ZJZA 2ZYGA 1T9DA 5EHIA 4PQGA 4TV3A 3O8QB 5T41A 2WYUA 3EVCA 2AJBA 4WK0B 1E69A 2X38A 1AT1A 4RH1A 1IB6A 1S89A 3EASA 3E22B 2C4NA 1JHQA 5FBRB 3EUFA 2WICA 4N3BA 4DCJA 4RD3A 5K0NA 2PA3A 2WV7A 4WNEA 3T5GA 2DU8A 2NZVG 5FBHA 4NH4A 3RKSA 5DT2A 2DBYA 3VU9A 1CQXA 1FMCA 4UFPA 1QBQA 2R6AA 5K05A 4UOEA 5IJAA 1N9KA 2B61A 4GE0A 2JFPA 1E9CA 2VH5R 4JR0A 1DJOA 4D8VA 2YMMA 4A8PA 2YBEA 3LV8A 5KYWB 3BF7A 3LLCA 4PM4A 3FUEA 4ZYTA 1HYQA 2YWEA 3X0DA 5KWEA 4OXQA 4B5LA 4E3ZA 1VLVA 1DWPA 4IF4A 4M1OA 3T7AA 3G1UA 5K0ZA 2QLNA 2X7JA 3QZUA 5AW4A 4CV0A 5TQ0B 1SN7A 1JEYB 4U2BA 2W7TA 2XMPA 2VDLB 3NWPA 7AT1A 2XOKA 2IEBA 3SNXA 3B1XA 4CM9D 3GJ6A 1H9AA 2TMDA 4HGRA 4GYKA 1O6FA 3AI1A 3AUSA 4GZ3A 3AJRA 1IC6A 3OY7A 4AB1A 2ZBUA 2ZYAA 3AM4A 5CEFA 4EO4A 1DAGA 1JH9A 1ZSNA 3KAEA 3B85A 3EGDB 4DUGD 4YJFB 3DOFA 1H1DA 2GD0A 5CJPA 4MARA 3EZ7A 2OGUA 1Z4NA 3DZ8A 3I4CA 5K8CA 3ZY5A 4HFRA 1WIWA 5JNTA 5JXJA 4M7CA 3M6MD 3NDPA 2R8RA 3HXQA 2CD9A 3ZBUA 1NHWA 1PLLA 3KOUA 1GYQA 1G8JA 1JG2A 1CERA 4B83A 4N3AA 4W7SA 1R15A 2RIRA 4GLLA 4UCQA 4BUJA 2X9LA 2V4MA 1K8QA 4BLVA 4DA4A 1ZG3A 5L4SA 3SHTA 3EEYA 1TZCA 2UUPA 4V0LA 5KNCH 5A7FA 2EGGA 4IHJF 4MLDA 2XT9A 5F77A 4V3BA 4IJUA 3B5JA 4N2SA 3BXOA 4JL5A 3AQ4A 1HL3A 2GN8A 4IOJA 2HJWA 2ZQ5A 2OM6A 1BRTA 4MRPA 2KSQA 4AF8A 5ENVA 1HFWA 3THOA 3MWYW 5ARGA 3G85A 4CLDA 5JI2E 4ZV9A 1KWKA 5LMNB 5B3KA 1FK8A 4KFTA 3TNLA 1DIAA 1TIPA 3Q47B 2QRVB 2VBCA 2VNKA 5G3ZA 2WVIA 4QDKA 4G3XA 1E94E 3HNRA 2F6RA 3A1VA 3HCBA 4DYHA 2H6GA 1NR7A 3FTVA 3WLOA 3ZI0A 3WYAA 4Q4DA 4TQGA 4E22A 5JAHA 1Z8HA 2KXPC 1LRKA 1FMTA 4JBIA 2X2FA 3AX6A 3DVAA 4O0MA 2JLAA 2BEDA 4Y8VA 5E4YA 3L8CA 1ZU2A 1FT1A 4RHCA 1R6UA 3FU3A 5EIAA 4NL4H 4R9UC 3S2AA 4KQ9A 2BFAA 2AXUA 3TB4A 5BQ5A 3DTVB 3O83A 1OZFA 1WBBA 1C8BA 2ZJ7A 1RFGE 4JBYA 1L3IA 2INGX 4PS3A 5DV9A 2HSGA 1P62B 3HRAA 4OHRA 3KPUA 5FZQA 3WK9A 3VU8A 1GG9A 4MRVA 4YMLA 1RBQA 1CYDA 1J0AA 3ZOKA 4B93B 3W6NA 3KLMX 2EX0A 4CW7A 1DXHA 5C0OE 4P3KA 2A4MA 2ZBEA 1H2XA 4DV4B 1VXRA 4N5HX 1LBIA 2VI5A 1QVVA 2IYXA 2XNJA 2WUEA 2J9FA 5CLHA 2CUKA 4GU5A 3ZH9B 1QAMA 1CUSA 3TS1A 2W2XA 1QH0A 4CM3A 2YFYA 2ZKLA 5B1IA 1CEXA 4LXXA 1T9KA 3AUFA 4KXVA 3UWSA 2UYQA 3WL3A 4LV5B 3ZWMA 2BKGA 1XEWX 1B0UA 4QQNA 2MSWA 5G41A 5MHTA 1YDHA 4WOPA 4BFSA 5A02A 1PWZA 3UWKA 1GDDA 3SG0A 4O4JF 1EFAA 1ADCA 1V37A 5H68A 1ZK0A 5LNK1 3RANA 2TECE 1UJNA 3H3XA 3VV3A 2X2PA 1Q2UA 5JJIA 3O8RA 1EVZA 4DIEA 4M3NA 1ESDA 4YUVA 2F64A 5J5VA 1JXOA 1YS4A 5AHOA 2Y99A 3LKDA 3EDRA 2XB9A 4A9AA 2QLTA 3N6VA 3FOZA 1NVAA 4TUYB 1N2HA 1WG8A 5ECWA 4ZC1A 1B6TA 3CNLA 3L7OA 3M6AA 3MFYA 1KZ7B 1R4MB 3DP9A 3IBGA 4PR0A 2PUJA 2OXRA 3QXHA 3K70B 1OREA 2OHXA 5E4FA 3IGFA 5K8TA 5COBA 2EFGA 4H6XA 2OCPA 2ZT8A 5A1TA 2RG1A 1FFGA 4R1TA 3ZW7A 2QT1A 3Q41A 4PBRA 2ZJ3A 1U5BB 1VJGA 2PSEA 1A95A 1DLJA 2W2MA 2BGLA 1LXCA 3DBSA 4DNQA 5TPWA 4KR0A 3GDWA 2CXHA 4LGCA 1M74A 1GCIA 4XD2A 3G3EA 3JQGA 1LX6A 3U4GA 1GL9B 5JNLA 2O2DA 4W5OA 2PBRA 1BOFA 4HTFB 4JT8A 1RT9A 3TW4A 1R0KA 3TZBA 1PT7A 4C6TB 5AK6A 2R97A 1F2DA 4KXMA 2P9GA 4F85A 3ZWOA 1H2WA 4OB8A 3WWEA 1AGPA 4ENRA 2AWNA 1AZLA 2FG5A 1O96B 1YI0A 3EIHA 4JUIA 2BR3A 1ZFNA 3GU3A 3O3CA 1VPVA 2B5VA 3BL8A 2GTHA 1MIHA 3V3KA 3P52A 5K0EA 2H4JA 1JBKA 1Y37A 4PX3A 4UU8A 3LOUA 3IJ5A 3DMYA 3A27A 1RXEA 1M2OA 3BORA 1VMEA 4QULA 4Y9SA 4AU1A 1A9PA 4UWKA 2HD4A 1RXWA 4E2YA 1QDEA 1XA4A 2JL1A 3D9JA 2QZPA 4I55B 1B42A 5ENPD 1LLQA 3RVMA 4JOQA 5FJJA 2OGZA 3M3HA 1UM9B 1PGJA 4HVLA 2A8YA 2F9MA 1XX6A 5TR9A 3ZLTA 4B44A 3G82C 2P9LG 2AF4C 2HMSA 3TLKA 1KSGA 3UXHA 4WCFC 2GGSA 3LT0A 3AR4A 5TDHA 3AJDA 3HK2A 3F7MA 1W47A 3KZKA 1MRZA 4YMVA 1XEWY 2YCBA 4ILGA 1J2TA 4ID9A 3RSOA 4IUBS 3FDFA 1GU0A 2HV8A 3CQ9A 3R9XB 3BS4A 4MYCA 4ILEA 3UOGA 1NMZA 4YRJA 3R9KA 3V46A 2EEZA 1EE2A 1TQ6A 2O8EA 3UUEA 3MJEA 4TTVA 4RVFA 2KI5A 3LT4A 4CMJA 3QF4A 1JNZB 1QHGA 5JBIA 2XOKD 1M2HA 3WRVA 5F3WB 3EXHB 1W581 3QHAA 4IX9A 4RZ2A 3ZU4A 4F84A 3CE6A 2ZGDA 1T1EA 1MR3F 4CDMA 2B69A 2PH3A 3LHKA 3GW4A 2PMWB 1P1HA 1Q50A 1QF7A 2I3ZA 3UYKA 4OX9Y 1VCHA 1EG7A 1NHGA 4F4JA 4BGIA 3HHEA 1A27A 3LO5A 1EWKA 2CJWB 3H9EO 2H2AA 4YFVA 4QDZA 2Q3BA 1F8FA 3NHAA 3O95A 4QTUB 1IU9A 3TPCA 4MQLA 4WY8A 4TN1A 3N2YA 2Z4TA 3V8QA 3IDOA 1NBWB 3BU8A 4HLLA 4FEGA 4AMYA 1M1YA 1PX2A 3BK7A 2FWBA 5EUCA 3RUHA 2N75A 5BMVA 4LZPA 2VSXE 4P8RA 1FLNA 5KDOA 5EQTA 4JJ4A 1X2EA 3D6AA 3HTXA 1GT6A 2D1TA 2QRPA 4ITVA 5A6VA 1VG9B 2ZSAA 2YV4A 2A58A 4D42A 3HRIA 5EWLB 5TB5A 4ZXFA 2GN6A 1ZLYA 3WB2A 1U31A 4LDNA 2W2KB 2N42A 1XD2B 4LF6B 3TF5A 4BGEA 5G02A 3M2PA 3U4QA 3ILYA 4OXXA 5EIBE 3C39A 3IDAA 3N7AA 4O4IA 4G41A 1JAYA 2JCBA 3RU9A 5LDDC 2GNPA 3ZV7A 4N5MA 2VDKB 3KOZA 2JAWA 1IN5A 3DF9A 3V3LA 4R40A 4AJOA 1DV2A 3HJRA 2FWRA 5K3EA 3MLBA 4EF6A 4XI9A 1KJQA 3P4UA 1PKEA 3IO5A 3MYRA 3IEPA 4FCTA 2WT4A 1PL0A 2JW5A 2FN8A 1ZSYA 3WB0A 3WK6A 1T91A 5T64A 3SIRA 3LEWA 1D2GA 1RSZA 3LQFA 3WIBA 1A1SA 1WV0A 4CCYB 1PI3A 4DFDA 2O23A 4ALKA 3TJRA 3UMJA 3ZJTA 1W30A 3SJZA 1HYEA 4NU0A 5J63A 5LQNA 4JYBA 1P5FA 1YNSA 3N05A 2RAFA 1XQYA 2MSLA 4MMZB 2RK3A 1ZU5A 4S24A 4HR7A 4DXAA 3ZVNA 4HH4A 3S2UA 3H9UA 4GL2A 1XU7A 1BRMA 1JZQA 3CHPA 1S9HA 4I1VA 1CY6A 3IMEA 2BKVA 5F1KA 1KI7A 3LPLA 3O1IC 3UT5B 2PBFA 3W8EA 3N39C 2QTWB 3RU0A 4TYQA 2D00A 5F7OA 1XLWA 1FFYA 5K0LA 3VTZA 6REQB 1H2RS 1B16A 1XTQA 4KSBA 1B00A 3UGJA 2JARA 4Z3KA 2ISCA 4UNPA 1JEQB 1UBLS 1JI0A 5LZ8A 1AQJA 2PUBA 3FWHA 1K8RA 4N3NA 4YT8A 2NUAB 4LOIA 3AAAC 5B30A 4V1CA 3KYJB 1Z4PX 2V58A 2X7HA 2I03A 4B3XA 1DIBA 4DPLA 5F9FA 1X1BA 3HU3A 3SP1A 4DAEA 5K5EA 3HBLA 2Q7XA 1DKOA 2P69A 1ZAKA 2Q6IA 4LG1A 5DBIA 2MYUA 4R1NA 1TZJA 1EUYA 3ICQB 5D2CA 2BRUC 5JASA 4FCVA 4CL0A 5A4AA 2VQ2A 1GCUA 2AJDA 2UVQA 4OHBA 4DPMA 3UMMA 4ZD6A 4CKWB 2FZCA 3DRAA 4LCJA 4FLBA 1NNI1 3QH4A 4P7FA 3WMWA 2GYYA 4DR7B 1JWAB 4OK5A 4EQ6B 1ECGA 1ONNA 1TKBA 3UMRA 2WQ6A 4GCOA 4J2HA 3HB5X 5IJXA 2O7QA 2WKRA 4HVAA 4B47A 3R6TA 1ONSA 1NDUA 3RQIA 3WB1A 1JKJA 1P9LA 1ZD4A 1ZM7A 3U7HB 4OBWA 5EAIA 3HU5A 4LGVA 2ZBDA 3BC1A 1YB7A 2C83A 2FJDB 2ZT6A 1KSFX 1ADBA 1SVUA 3BJEA 4QLOA 1YIDA 1NNEA 1YI8A 3ZG6A 1RJ9B 5AVVA 3GLHB 2ZU6B 3R5TA 3EIUA 5KVSA 3VR3D 3ZDEA 5ANLA 3ZHEB 2Y0BG 1NI3A 3LDFA 4ARZB 4K2AA 4XGIA 1QVZA 3QLTA 3J7TA 3T9DA 3D4OA 5B7PA 4YT2A 4GLFA 3BSSA 3KKMA 1GNLA 3NP9A 2JVKA 3VZSA 3V2HA 2C95A 3E27A 3BDIA 721PA 2X2OA 3ESXA 1T29A 1G16A 2B92A 1JHXA 4RH3A 1U28A 1AMUA 4M60A 1LV7A 3OCXA 2PS9A 1FJ2A 3RVJA 3KZ1E 4Y3UA 2C9BA 1D4OA 7REQA 2VNAA 3RYCB 3BGSA 3KPJA 3PREA 3BTVA 4LJAA 4L3OA 4UYKB 1QK5A 2GUGA 2BDUA 3VNVA 2WYWA 5KWVA 5BXYA 2YX1A 1U2GA 4A15A 1R2QA 4LFBB 3GFRA 3S2GA 1NWCA 4Y2GA 5HKPA 3DSVA 2D0IA 2VP4A 1M0SA 2QN3A 3ENWA 1V47A 1JUQA 3QHQA 3NC1C 4IN3B 4HI0E 3R3YA 4XE5A 5A04A 3QRWA 3I5YA 3AG3E 2C07A 1N4PA 3IH5A 3KUDA 4OYHA 4RY0A 4JUDX 3C3XA 2NO9A 5ALKA 2YJ6A 3O73A 4F3VA 2A9RA 3BIWA 2MYNA 3E9ZA 4JW1A 5E3HA 3EVNA 4H27A 4YMIA 3P0FA 5EKUA 3BXGA 2ZAYA 3WP0A 4IDGA 5CFOA 4KNYA 3PNMA 4D9JA 1ZZEA 3VOTA 3UICA 4QOHA 4HX2A 1GZ5A 4QYIA 3N2GA 2O2IA 2H1SA 2OZVA 2GASA 3HJGA 5GQSA 2MT9A 4JC4A 3OSZA 5GIOE 4YJ2A 4B0OA 2IUEA 3JZDA 3QOXA 2ACKA 3VI3B 4K9PA 4TV9B 5K3CA 4CM8B 4HQRA 4JV5B 1F48A 3PXUA 4ZYXA 2BC9A 4P32A 3EYAA 4NBUA 5E76A 4AIFA 3HJHA 2HHHB 4HDQB 4ITUA 3QKRB 3T15A 1WVIA 2QMYA 3GJTA 5EGSA 2X8WA 5J1SB 3HYTA 1H2ZA 1VYVA 2P91A 3JVUA 5AM1A 5BT9A 1QGUA 2ZR0A 5FJIA 1EBUA 1XJCA 5JYCA 3FSGA 4Q3EA 1OIXA 1L4LA 5FZRA 4TV8F 4I8DA 3K71B 2V4LA 2YZMA 3M6XA 2UDPA 1TAGA 3A6EA 3NORA 2H7YA 1NNUA 1UXIA 3DKKA 4HZGA 4KUHA 4CRWA 4HQLA 4K9DA 3TLAA 1COWD 4YJGB 2EIKE 1ZM2A 4INZA 4URKA 5AW0A 4A8JC 4UZEA 2FPGB 3G79A 4CQLA 3E7DA 3OZRA 6AT1A 2P9SG 3LJ3A 5AKJA 2Y0PA 4R6WA 4I43A 2NPIA 1P7ZA 3QK7A 1E2DA 7MHTA 2XTJA 3E3NA 3LQ4A 4KBGA 1PK9A 4HUQA 4TUYF 4EOGA 4N5LA 2NVUB 3LHSA 4CTJA 1JDBC 2C0CA 1J33A 1LDMA 2Q46A 2J32A 5DE3A 4RPLA 3AHIA 1PY1A 4FKBA 4EVIA 1Z6YA 1GDHA 4HSGA 2ERCA 5JRDS 1U94A 2CG2A 1XALA 4XVUA 5HE8A 1JXQA 1QK4A 1WSWA 3DE2X 3OESA 4RZQA 4H4CA 3SC4A 1B41A 4R1UA 4S35A 4TQAA 4ACBA 3QHPA 1RBYA 2HY7A 3VH3A 2XNHA 2F67A 1I4DD 2WM9A 2GK7A 3ZHTA 3H05A 1ZGJA 3AGPA 3PXCX 3GJSA 2RI6A 2WKPA 1SVMA 1Q6YA 1YC5A 2FJBB 3DXZA 3DLCA 2DULA 4KR6A 4DR4B 5KNLA 2FUNB 1HDGO 4N41A 5IXSA 1QIGA 3C4VA 3RG8A 3N8DA 2UZ3A 2IXGA 1CIJA 2E4YA 2NWQA 5JS1A 1ISIA 3V2GA 3TG2A 4JD5A 3A6HA 4UM8B 3U7EB 5C52B 4X94A 3ME5A 4E14A 1AQUA 2LZ0A 2QYOA 4H4DA 3UM3A 1SZDA 1WSDA 1X8LA 2ECOA 2P2NA 2BD0A 4CJXA 4RTJA 5JMWA 1MJHA 1FXSA 1VRCA 5JZBA 4Q4JA 2FMHA 3COVA 2IPXA 3M9WA 4W5RA 3WQQA 1PG0A 3DBHA 4I55F 3TDNA 1NSYA 2QTHA 4FE3A 1CRZA 2ZIVB 3HHMA 1II0A 4HQDA 2G08A 2XIJA 4II2A 3A37A 1T15A 1ZU4A 1SKYB 3QU2A 1NBME 3AJ8A 2IPMA 3GZTB 2VRNA 2EF1A 5TQJA 4KQEA 2GX6A 1O0CA 3SC2A 1GQOA 1SRQA 4OK6A 3UWDA 1Q0UA 4H7YA 4YHBA 2BFFB 4ALJA 1NONA 3I09A 3WGJA 3T7RA 3UJCA 1V4NA 2O2GA 5DOVA 1Y8AA 2RE8A 4MZXA 2GRPB 2SICE 1H0SA 1Z28A 4P4SA 5CAEB 3WG7E 4NU5A 4KYOB 2QZ9A 1VA5A 3BMXA 3B6IA 3KOXA 3N28A 3SM3A 4D7AA 5IN5A 2IYWA 2LW7A 4JUFA 3R41A 1KI3A 2FPWA 3S28A 1VG0B 3IOBA 3UXEA 2XUKA 3L8EA 1D09A 4NJMB 5FT9A 1AQIA 4PBSA 5CLQA 4HBZA 1U1IA 5K3OA 3U9SA 1Q0LA 1WG0A 3N70A 2HA7A 1MKYA 4P3NA 1KO8A 3DEJA 3QFFA 4WVLA 3OXGA 1KMMA 3GEGA 4A26A 2Z8YM 1ZS9A 1EFPA 5HHTA 3GCWA 4NENB 4R2IA 3X1ZA 1L4EA 3K0EA 1P3Y1 1PVVA 4E30A 2IX3A 1K86A 2DFNA 5K20A 4EIWA 4RKWA 2M6SA 1XXHE 4A6PA 3V7YA 2QVLA 2P3QA 4WGGA 4YIKA 1L4BA 4I4CA 4US1R 2R7MA 4YAUA 3DPYA 3WGGA 5LCWJ 3I53A 1UPXA 1E6CA 5FQNA 4U2FA 3OLQA 2M1ZA 1N57A 1B2LA 2OL4A 5EZ6B 1XTKA 5CITA 2ARKA 1H19A 2VXOA 1VMIA 4AX4A 2QNBA 4KI7A 1KQGA 1ODKA 2QUBA 5BPPA 1ML4A 1BW9B 5HUJA 2QUKA 3GJ7A 3PVZA 1CQZA 2YFKA 1HTWA 4TWRA 1H3FA 3ZZNA 3DHYA 2BMDA 3AY0A 3WGIA 2E4ZA 4MR7B 1E1NA 3J80A 5FBLB 3RC9A 2W2PA 5KTYA 2OBYA 2V5UA 3WSWA 2VDNB 3P27A 2YH2A 1CY0A 2FCRA 3B3QA 4WN3A 1YTLA 1MJNA 2ZRGA 1T6NA 3OFSA 1C9YA 2F3SA 2PL3A 1BXGB 2C98A 4IHJB 5ICCA 4DM4A 1TNOA 1G66A 4HDNA 1LWNA 1DDGA 1LV8A 5ICMA 2RKKA 2HAEA 4G6ZA 1K1EA 2Y71A 2ZKIA 3TLXA 1U1DA 4GSYA 1HOXA 1B8UA 3WC4A 5TLSA 4QUEA 1SCBA 4MGIR 1U9YA 2OBMA 1SQSA 5L4NA 1A8UA 2MTBA 3FVTA 1QCCA 2NU8A 1E61A 4C87A 3FTXA 2HCFA 2P2GA 4TLEA 1T5LA 1Y8CA 4OIFA 3VDNB 3O03A 3N9IA 4KQ2A 2FWMX 4ZU6X 5FO1A 1A2KC 5E2BA 4Q4AB 3RVPA 4JLPA 2MYTA 3FPHA 4FW9A 3JWPA 4MIOA 2M2IA 4GBED 1Z29A 1EINA 1UBOS 2OBFA 3GFBA 1P5QA 3E8XA 4MPJA 4XEIG 5L45A 2OXEA 2BFBA 1RU3A 4CT4A 3K32A 1EYZA 1N8SA 1ENPA 1E2MA 1G18A 1W4BA 1JU4A 3DOJA 2BP7B 3WA7A 4E0BA 4J8PA 3CF6R 3RIBA 2F7SA 4KQKA 3IQEA 4Y6GB 1DDIA 5J2TB 1QRAA 3ANXA 1YVPA 4ZYZA 3HGQA 3TWSA 4JX9A 1YBMA 3AF6A 3NDBB 3BK2A 5FZSA 1A4RA 3HFRA 3FSGD 4IW3B 1OTHA 3HNPA 1NW8A 1AO3A 1K4KA 3KLPX 5I5GA 4RDCA 1Z0ZA 1BE0A 2IZOA 2NXPA 2PWBA 4E1VA 3K9BA 1YZKA 4X7RA 4C4OA 3BXZA 2XT0A 3ROFA 4GKBA 4F5DA 2I34A 5JJ5A 3VVBA 3EXEA 1HPLA 5E9WA 5GJBA 4V2UA 3CNBA 1LD3A 3IOEA 4WD3A 4P83A 3MTEA 5B6PA 1VGQA 4EENA 2EX1A 3BGWA 3RF7A 1NOIA 5AUQA 5CT5A 2O0KA 4GMFA 1FFEA 2YYSA 4BECA 2P41A 3IIKA 4BPRA 3D6FA 3I9OA 1U7TA 2ZXEA 5EN5D 3Q9SA 3ASVA 1JYEA 3K9NA 2JNWA 4FYVA 2R84A 4O8CA 4YRKA 1S2MA 5TIIA 2YFQA 1B8NA 2EDCA 2P2DA 3DDNA 3MAJA 3Q40A 4DMKA 1GV0A 2R5WA 3TAUA 2V4ZA 4OF4A 1USIA 2L0IA 1SELA 4LNGA 4R1OA 3QVJA 4NMHA 1XB2A 5JVDA 2DJIA 4BKPA 3R3HA 4R05A 3DW1X 3OBBA 3WNDA 1G64A 4LRZA 2PS3A 5AM5A 2ZAOA 4DSZA 3RRBA 4QFCA 1SUCA 3OHMA 1DKRA 2D74A 3ANSA 3DD5A 1Y1KE 4CDGA 3VFDA 4ME6A 4J2TA 4HOTA 2EG9A 1UC8A 3HJTA 4X65B 4IFIA 4ITRC 2PGOA 5A62A 2VSNA 4Q96A 2WA2A 2G5GX 3BTOA 4L6IA 5F2EA 3ANMA 3IHLA 3MWJA 1KYZA 3B3GA 5AVQA 1B15A 5LQCA 3ENQA 1VZ3A 3KAKA 2Q9AA 5JY1A 1OILA 4B89A 1RTTA 2ZGVA 3H6GA 1E9RA 4N0QA 5KC9A 2Q4EA 4JLJA 1MVOA 3RG2A 3QV1A 4WI1A 4I14A 3SXUB 1HF8A 4K5AB 4PG8A 3WAKA 2Z0MA 3VVLA 4P4LA 6CHYA 2BIFA 3L07A 2NU6A 1II8A 4EL0A 1EZZA 1WCIB 3C7KA 1KEEA 2HADA 5TXGA 1VKJA 1HT0A 2JB9A 3WVNA 3SMVA 3AT1A 2IS4A 4W82A 5K4HA 3K5IA 1NRWA 3A7DA 2CW5A 2YZ2A 1GUZA 4BVKA 1L5HB 4JELA 4PCLA 5CCMA 5HMMA 1EH5A 3TSOA 1VECA 2GRRB 4CT5A 4D1YA 4Z4EA 4HNAB 4DADA 4EFKA 2BE9A 3U3WA 2FAXA 3VJKA 5LOVA 1RKVA 1TYBE 4E3WA 1A7UA 1SBNE 2ETCA 3NUQA 4KT6B 1USUA 1JCQA 4PQEA 4GFDA 1YZVA 2P9EA 4PYJA 1DRJA 2JJMA 3F1LA 4G1EB 3K4HA 2RD0A 3V79K 2Q27A 2GSWA 3LXUX 3VJMA 1P91A 5JO0A 1AG9A 3F49S 4FONA 1S70B 4LV8B 4GPMA 5CDYA 1MVLA 4QUAA 4GPD1 1QZZA 1CDOA 4QJIA 3MVEA 2IGTA 3TQFA 3VAAA 1EVQA 3F2VA 4F1PA 2VVTA 4WN9A 5KPJA 4ECAA 2P6OA 1TX4B 4ALIA 2X23A 4JVMA 2B2CA 1DB3A 4X1IB 3NCTA 3N53A 4KMRA 4U7WA 4P34A 2BFEB 2H31A 3LVFO 4FI3F 2FSVC 2ZE6A 4O1PA 5CVVA 2Y1EA 1D7AA 4DMRA 3MS4A 5TEVA 3HXLA 3CNQS 3ML1A 1F5NA 1L4YA 5L3SB 4G65A 3WRYA 1UBKS 4EHFA 4WH0A 1NAHA 5ENSD 3RSQA 4GPTA 1PGNA 1ZMXA 4NG4A 4TYNA 2P6NA 3U49A 2QD2A 4G2VA 3W5CA 4W5TA 4F4HA 2EHJA 1A9RA 3AR6A 3G2MA 3G02A 1Q0SA 3ND5A 3D9IA 3KEQA 1TTHA 2Q7OE 1MQSA 4OM7A 2FLVA 2GR9A 4LJ5A 3E9CA 4K1LA 5SZIA 4E4TA 4FINA 4NMLA 4I6EA 2ABWA 4RUKA 4LC0A 4EI2A 3BWCA 1NZDA 5AJHA 4MV0A 4TS4A 2W0SA 4DR6B 1C1DA 1T9AA 1Q84A 3NYIA 3N8HA 4KQFA 1FPMA 5DLEA 2O7SA 1PBNA 4EY4A 3V5NA 4V38A 3JQCA 3HWRA 3LDHA 4BFYA 4QPDA 3LXRA 1M2GA 4PQRA 4KIJA 1Y5RA 3ZYCA 2O3SA 1I10A 5D00A 1OOEA 5GVSA 4Q7KA 3FCCA 2A5EA 4NESA 5I7VA 3P0RA 4OQLA 3ZWYA 3E9RA 1KXJA 3PJEA 3C3DA 1NI4A 2VJLA 2YWJA 3IERA 5FNVF 3T9AA 4KVGA 4A2PA 5FTWA 3GYGA 5UKDA 3DVSX 2VAPA 2EGUA 4MJ3A 4M1QA 5CDGA 3ZZUA 4V24A 1VE9A 1U7PA 3FR8A 4R7ZA 4HSEA 5ALYA 3DDCA 2O5CA 5EZ5A 1Y82A 5JXWA 2A9VA 4P4UA 2JFQA 5C35A 2WXOA 2HA2A 3QFCA 3HVRA 1RWKA 3OQIA 4OQPA 1FTYA 3FDZA 1KTVA 2FNAA 3WFIA 4XGQA 1MQ8B 3F2IA 3H5NA 4IF6A 4M9UA 3B7TA 1TPZA 2CNLA 1DAFA 3DE1X 2FPUA 1M7HA 4UQYA 4X93A 4R69A 1IWOA 1YQUA 2GRQB 4A2WA 3ZU5A 3TG4A 4K6FA 1XZLA 2PGNA 3DO6A 3W04A 4EW1A 3I64A 3T0IA 1BD4A 1QAOA 4E5UA 3T61A 3OXLA 3GPCA 3B6JA 1OAOA 1AC5A 1I8TA 3K05A 1LQ2A 5BN5A 4DBZA 1Z8NA 1YSCA 1XWIA 3KBBA 4MWCA 1RI5A 1KI1A 3ROMA 1ZPDA 3S7TA 2ON6A 2A84A 2CHQA 5M72A 2F59A 1CP2A 3Q8WA 3LC2O 5EJ8A 1FVHA 1ZJZA 4C03A 2J59A 1SH7A 2O0LA 2PJUA 4IDBA 2OHOA 3C3AA 9LDTA 2QOEA 3BXFA 5J5AA 3QW2A 3JR7A 4DX7D 1XRJA 2GBFA 5IAEA 1KPHA 3L18A 1F5SA 3K5WA 3RU2A 2CGEA 4G25A 1CEQA 3BA6A 3VBEA 1JEOA 3Q5DA 4LVOA 3FIJA 4C0XA 2C4VA 3GCZA 3F78A 2DAPA 3SBOA 2ZK7A 2P5TB 1KHHA 5I8ZA 3AG5A 1TVMA 4RWZA 1A77A 3MIIA 4RYLA 1HT3A 4YXFA 1AXGA 1W94A 1JLHA 4NFLA 3MBOA 1XMIA 3BH7A 3D02A 1EE1A 1914A 4UUAA 2MCFA 1OA1A 2GXSA 3GGCA 5IVIA 1VL6A 5J4LA 4NJEB 3RF6A 4K6CA 2NAPA 3HDXA 3KKLA 2XXAB 3R7RA 4LUCA 3OIDA 3HEBA 5LU9A 2O20A 5KQSA 4CIAA 2GN2A 4LY9A 1N0WA 3E8MA 2B78A 3L9XA 1MFZA 1RXIA 5AYVA 4IO0A 4YDWA 3SHFA 4MQUA 3QU5A 3AVXA 4MR8B 1YBFA 4TSFA 3WRWA 2F1OA 2PZAA 3KJFA 3PJGA 4X61A 2R7NA 2BEJA 2GCGA 1XRQA 1DTWB 4JI2B 3DPIA 3O8QA 4HNUA 4YO8A 1MVNA 4WBNA 3F1KA 3OE7A 3KHUA 4AK9A 4M86A 5GWXA 1KETA 3WFZA 1KT0A 3KKZA 3W6OA 4ZVUA 4J8DA 2JANA 1E9BA 2FR1A 3SKVA 1W49A 2QZAA 1N95A 2V55B 4JROA 5TVGA 4Y9RA 4L1BA 3E22A 2WF8A 1CZRA 4L0CA 2QP4A 5DSTA 3EBPA 2AN5A 2IK8A 3DZDA 3G0GA 3HJNA 3WMRA 2AV6A 2WIKA 1NVDA 4WFQA 1Y1TA 5JSYA 3TLCA 3T3OA 1UBSB 3ZTWA 1QG4A 4HOQA 4K87A 4JWTA 3G2VA 3HIZA 1JHRA 1KI6B 3QE4A 4LZJA 3U7QB 3ZU7B 2XTAA 4JT9A 4MLZA 2G67A 1HNWB 4B2PA 4I8XA 3SYNA 5KYWA 4J4HA 2X19A 2GZ3A 3SN6A 2NVWA 1H0KA 4PR3A 4M8SA 3UTMA 3V1UA 1SKQA 5JCJA 2QAGC 2CHUA 3H5LA 3ANNA 3EZYA 2OKGA 4W8GA 5FLEX 4LGYA 1VSQA 5ITWA 4GX2A 1VGRA 3L6DA 2QRZA 1E2LA 1T5HX 3EWIA 4EG0A 1WHTB 3I2GA 1A98A 1IG3A 1SXJD 4G4SO 4M22A 4FE4A 1OF1A 2Z9CA 5D6NA 2R17C 1L7AA 3CB4A 2QSZA 3EGDA 4YJFA 5JG7A 4R2XA 1GZVA 3VDQA 3HWSA 1H1LB 5ENTD 4UNNA 3WG9A 5EUBA 4XWTA 1XEAA 4I1RA 5DRYA 2VJ8A 3O8CA 1N6KA 2FFRA 5IH3A 3PZRA 1FTWA 3RRZA 4RLQA 1TE2A 3WYEA 3W8DA 3D7KA 1TCUA 4BOYA 5FOQA 1C81A 1FSFA 1OT3A 5J2TF 1QG0A 3HFSA 3G2IA 2ZCVA 1IXVA 4D79A 3TXXA 3UXGA 3OSUA 1LK5A 3I92A 2ZB7A 3OBIA 3CS3A 5DGDA 3FMFA 4YMSA 2FFGA 1A76A 2DEUA 3H11B 5A1JA 1STOA 1YRYE 1SBTA 4FJ2A 3DZKA 3OMLA 1G2IA 5JDIA 5CFZA 2PGIA 1BQEA 2H1OA 3DUFB 1G3RA 1JU9A 3UJHA 3KLOA 3E82A 1MABB 5FWDA 4U7DA 1FZTA 4G97A 3GIWA 3AR9A 4Y2JA 3C8ZA 3E30A 2PKRA 4LQDA 2B94A 5LCXA 1L7RA 3UQZA 5FR2A 1AK1A 3LUBA 4Q7EA 3IDSA 4P5PA 2C3MA 3TM4A 4EL5A 1T25A 1SAYA 1A2QA 2N47A 4AO6A 4F46A 1IEVA 2JAXA 1RYBA 4KZ0A 1DEAA 2ZWMA 3CJTA 3DBLA 3RC8A 1X1TA 1O94D 4N2QA 5HBGA 3A2NA 2WU3A 3C8DA 4TV8B 3O4ZA 4D43A 4BPBA 2VTDA 4ENSA 4DT1B 2VPIA 2G83A 4FZJA 2W8BB 2XD9A 1RRPA 4Z0HO 3L1JA 3UPVA 3VOAA 5THQA 1QOZA 3E23A 4BESA 3DTVA 5DN9A 4OMCA 1EM8B 2IXBA 2Y2UA 2Y9PB 3UVEA 5EJ5A 4Q9HA 5FUVA 1IN1A 1Q57A 3HBMA 1PQPA 2P5YA 5JJBA 4WNCA 4KLCA 4N7MA 3JQRA 4OXIA 2NW6A 1ZNWA 1Q0PA 4O1OA 4TLMB 5PGMA 4FHCA 4AKSA 2N3ZA 4RPIA 1SB9A 4ND5A 4JCOA 4C0SA 1Y6FA 2YWRA 2ICAA 5JC8A 3TIVA 4Y98A 4IFBA 3FUDA 3BQ9A 1N8NA 3OPMA 5CDFA 3HG7A 4L15A 3GRVA 4GB9A 4FMCF 1LVUA 4U0SA 5A0VA 1A97A 5CU7A 5C5DA 1DOZA 3ROPA 2PIAA 3OZGA 3R7WB 1WQ4A 4IHAA 4CMEC 2IV3A 3AZPA 1OX4B 2WFAA 4FYIA 3U3RA 4W1PA 4RF2A 4PEVA 4JC8A 5AOCA 3Q85A 3IX7A 5AI8A 5B1AE 2G7ZA 4JYZA 3VR3A 1U3WA 3M3DA 1N1MA 3JW8A 5L7WA 3I1FA 3PD7A 1J39A 4NCJA 3ED5A 5DGHA 1ZCBA 1IZ9A 1LD7A 1BH6A 3JQPA 1KH3A 4NNPA 1NYTA 2QYSA 3Q3GE 1R4MA 3D9PA 1GKKA 4HS2A 1UJRA 3H6HA 2WXLA 4CF4A 1VSBA 2QB5A 3JS5A 1TJ3A 3OI7A 4DMLA 1DPFA 3TIIA 2RHMA 4QQRA 4R6XA 3SQNA 3DJYA 121PA 3WMEA 4NABA 2JF0A 1U5BA 4NMMA 1UDWA 3TVYA 4C1BA 4HDSB 1G3NB 3L7DA 1I6MA 1UANA 4HAUA 3C4QA 3EISA 1X8KA 2R02A 1YRWA 3D0RA 1FYXA 1P0QA 4HEJA 3P9XA 1GZ3A 4AKTA 1TOAA 1JDJA 2P65A 2LCFA 1X94A 1G42A 4HTFA 1FX1A 4IVQA 5J9FA 1LZKA 1K0FA 1TMGE 3VTKA 2H3EA 4C6TA 1ZD8A 3BZWA 3FMVA 3IHWA 4ERNA 4QT4A 4HL6A 4OHYA 2XE6A 1GTG1 1E8MA 4E31A 4OI2A 2G25A 2BL4A 2IFUA 1KT1A 3VZDA 1GZ6A 5GJWC 4FFWA 1H66A 4TSFD 1T13A 5D5QA 3NATA 1J8FA 2BJWA 3I39X 5CERB 1YJXA 1O96A 2QTZA 3ESZA 2LO6A 2YASA 4URFA 1WMBA 1AN0A 1H6KA 4GTRA 1WMFA 1ISPA 3OE7D 3LCMA 4FCWA 4B6PA 2BYTA 5CPBA 1MF7A 2IOSA 1AK2A 3SFZA 3PWSA 2PQNA 3IDQA 3MWGA 2DHEA 5B3AA 5DGXA 1UDBA 5JNVA 3R7QA 2ZM5A 2HT1A 1XQ6A 1YZGA 4P08A 4IYRA 1GVNB 4I99A 1M54A 4DMHA 4N39A 4NFYA 3D0OA 4KGVA 3F67A 3CCCA 3G17A 5JNWA 5MN6A 1U0FA 3DT6A 3MGGA 3W2TA 1RI4A 4N54A 4EHKA 3AK4A 1O9BA 3SJAA 1XT6A 4BV8A 1WNFA 1UM9A 4TTPA 2AEJA 3S1SA 2C77A 1Y98A 1M73E 2E55A 3U3JA 2VHWA 5A6SB 3P2EA 2NQTA 4QYMA 3KQTA 3VQTA 3ZGVA 1PW7A 1MDBA 4UWHA 1EWRA 3R9XA 4CNBA 3QI7A 1IBRA 3DPUA 4WVFA 5JCJD 2IP4A 4CF3A 1COWA 2CG3A 1ZCJA 2HRZA 3FFLA 5AJWA 5AICA 4AW9A 1CB7A 4A8TA 1E6LA 1F7VA 4FADA 3UO8B 1X6VA 3NBXX 1BCRB 2ZT7A 5SYNA 1RAEA 3CMMA 3MJWA 1EDBA 2GDZA 3EXHA 4KRXA 3H83A 3WZLA 1FPPA 4J0IA 1UINA 3DWLG 4U6QA 2IYOA 1JR3E 5BPHA 2IPNA 1V71A 1SULA 3DJFA 2F0YA 3Q7IA 1RRFA 2YHEA 3KJZA 2G9RA 4C7VA 4LYJA 4U00A 2G4LA 1N4SA 3NX4A 4MVYA 1PGOA 2DOKA 1JAZA 1BWQA 1OFUA 2SECE 3BJRA 5FTNA 1NJ1A 1D3AA 2CJWA 1U3GA 1FFSA 2YW2A 4OLBA 3UCFA 3BN3A 4BTBA 5FPPA 5BSGA 5KPDA 4QXRA 3RUFA 4DLTA 3WYNA 3VR1A 2ZJ5A 3L5KA 2R8ZA 1W8IA 4YPOA 5KKAA 1DELA 1A9ZA 3LJKA 4MP3A 4Z4FA 5FWQA 3AQIA 2A7QA 5AENA 4C2UA 2TRSB 1FP6A 1M6WA 5LOZA 1ZUWA 1ELRA 4JB8P 1ZH6A 4PHHA 4EDHA 2CKDA 2PBZA 1VE1A 1NLZA 5FWAA 1H2VC 1MOZA 2XWSA 5KYUA 1FP2A 2IDKA 5LUBA 2IIBA 1JEEA 2D7CA 5EWLA 3Q8LA 3BAFA 2YN2A 4G26A 1V9SA 2IEYA 5BW5A 5BW6B 2H59A 2LR0A 1XD2A 4XLTA 3SBXA 2QIPA 1SUFA 3RKRA 1E64A 2PGXA 1GZSA 1SC3A 3V8NA 5JSQA 1ND5A 1QG6A 3FMGA 4JQSA 1I3CA 3QVGB 5JCOC 3WL8A 1KVRA 3AVWA 5LQDA 3BJIC 3ZDAA 1LS6A 4RJIA 4GMGA 3VSDA 1JG3A 5ADHA 3TLEA 1SC4A 1AB6A 5BSUA 1NOJA 1VJ1A 2AOUA 3TD6A 2RB4A 2WP8J 4AS2A 1N6NA 1ZW6A 2AKAB 3AL3A 5DYIA 4FEAA 4KUGA 4RWEA 2OD2A 3ITWA 4CCYA 5CEEA 1TUEA 3DTVD 2JHAA 5TPZA 3EOZA 4Q69A 3FLBA 4UARA 3GFPA 1BMTA 1NSTA 3TGPA 1NMQA 3EWSA 3NCHA 1OBOA 5F5LA 2FW1A 1K2VN 1WB9A 4AQYB 3FH8A 5HQ3A 3N75A 4XVRA 4GKAA 4BVHA 1Z5SC 5FOUA 4OU4A 4ML3A 1W88A 2EFHB 4M9ZA 1HH4A 5BN1A 6REQA 3GRCA 2G09A 3NV7A 4MP8A 1M7GA 1Y81A 2VGXB 5FPSA 1ODJA 1F7UA 3HLKA 2DTXA 1SC6A 1JEQA 4RVUA 1ZKDA 1L0BA 2J9XB 2GRAA 4N8DA 2QTTA 1EP3B 1XTIA 5AIJA 4GO1A 2VPWA 1Y9AA 4Z1OA 4RTPA 4H3KB 2Z8YA 4BEWA 1YBHA 4K03A 3JARA 4EEZA 1I6KA 4RVCA 4PSUA 5TRTA 2VJBA 2OWEA 3VZPA 4UDOA 5TGZA 4EMTA 4Q66C 4W6QA 1H23A 3MZ0A 2PZ8A 4BHTA 4WY2A 6NULA 2YJTD 4X6YA 3MCVA 1UAYA 3O3MB 3PWTA 1OFHA 4PZPA 5F21A 4FD3A 2RGXA 2PKQO 4UAJA 2CXNA 2G1PA 5CA0F 2GMWA 1INLA 2OWDA 2X0RA 2Q2VA 1CR2A 1EXVA 4KE7A 3T8MA 3EXIB 4CF7A 1Q91A 1YNOA 2YIJA 3K70D 5C8XA 5E3JA 3ASGA 3IMGA 4KL8S 2XA9A 3UHAA 2ZSJA 4GX5A 2AYXA 3LHIA 3KO8A 1E3TA 4P0PB 3VJRA 5JC1A 4HRMB 4UHBA 3U60B 1XZHA 1RBMA 4GYWA 3IQIX 2C5FA 1ZJ4A 2WEKA 3ONNA 5E1MA 4WXEA 4ROSA 5B7NA 5F1OA 1T4GA 1P39A 1L7DA 3TTUA 2ZUCA 5ARBA 3SQDA 2PLNA 3C85A 4CF6A 3A6KA 5BURA 1RJ9A 3WL5A 4JJGA 3GLHA 3QFTA 2Z08A 1C30A 2FDXA 1S3FA 4TKLA 3OU6A 1XROA 3ZHEA 2ATIA 3TUIC 5GZ3A 1BN6A 4GPIB 2JBAB 1I4OA 4HRAA 1L5QA 2HSWA 3RAUA 5E1DA 3G2NA 1V1RA 5KTSA 1C9MA 3MTBA 1PR6A 1B7GO 1HO3A 3SF0A 4CM7A 5GGXA 3HVUA 1VB5A 5C4IA 1G8MA 3JALB 1IZ7A 4GR9A 3ZR4B 1N1GA 2NXEA 3S4YA 1FPQA 4GI7A 4PGAA 4IRUA 4UYKA 1NQOA 1UT5A 1Q21A 3JZIA 1R16A 5CFRA 5CLFA 4R9RA 4FBMA 2VDWB 2XE8A 1XA3A 2IOYA 3HVKA 4V0KA 1BFDA 2WOJA 5L40A 4LHSA 1JQJC 1QFMA 2WXIA 1P2FA 2YTZA 1PFYA 4FHKA 4D4JA 4NICA 3C3KA 1N11A 1FFXB 2Y27A 4JR2A 4KMOA 1GTVA 3H5RA 4BNXA 4KQIA 3GLGE 3CVNA 3MSCA 4HAVA 5JXIA 2J4DA 3SGLA 1A9XA 3QXCA 2P9IG 1Z22A 3TMAA 3O8OB 1KEPA 4CM4B 1A88A 1UMCB 4GBJA 4OBBA 1FS5A 1MJGM 3K30A 3W3AA 1CZLA 4CEMA 4GX1A 3ZDXB 2M63A 3M2TA 1B14A 3EVZA 4G0ZA 3OWXA 2GUWA 3KJIA 1AF7A 1I2CA 2PO5A 4GMXA 4LXQA 4TGLA 1Z0IA 3ETLA 2DT5A 1PE0A 3U62A 1XN1A 5C3MA 1Z34A 1MP0A 3EHDA 3BA1A 4TV9A 4LSMA 4IZ6A 4GA0A 2WUFA 2BJHA 2J3IA 1RLUA 3QKRA 5H8WA 1QIEA 2PRSA 4RF3A 3RAFC 5E7JA 2XT6A 4QJ3A 2ZB2A 1QV9A 4PN3A 3JQ9C 5LYJA 3EUWA 4DK5A 3MUEA 5FNVB 1U4NA 4EKGA 1ESCA 2VLBA 1FQJA 4QGGA 1T0HB 3N3AC 1SUIA 1W0KA 5EZQA 1E66A 2QWXA 4A92A 1FJGB 1J0XO 2H2FA 2FHPA 5BVGB 5JANA 2A2ZA 5JR3A 2Z5LA 1Z5PA 4BBPA 4I3GA 4OJYA 4OXKA 2VBFA 2FPGA 3NV9A 1RTKA 2PT6A 5CT4A 3ESLA 1XRPA 1MLDA 3B8EA 4FZRA 1SY7A 4IGKA 3FG9A 4Y9UA 1CY4A 1XIVA 1ZP6A 2ZQYA 3OM9A 1ZR2A 2PMKA 5KVCA 2HQBA 4QNNA 1QDLB 4TS9A 4IX1A 2DETA 3ZK8A 2NVUA 3KZXA 5DIFA 1SZAA 3VOBA 4XRGA 2B4QA 3D6NB 4LMBA 2P9ZA 2V6MA 3H13A 2DVMA 3B7GA 4HNQA 5ANRA 2QTCA 3SY8A 2A1TS 3C8HA 4PLCA 2MSEB 5L7TA 4CWAA 1RM3A 3DA8A 3VRHA 1DQZA 2HWWA 2OAQ1 2VNSA 4EB0A 1GGVA 3PDIB 4M46A 1JIXA 1ETHA 3TW0A 1CJKC 4KXUA 1GTZA 2P9YA 1JWGA 4GRAA 1LJLA 3NDRA 2HF9A 4YCMA 3MA5A 1SZJG 4YV2A 1KA9H 1WXEA 1FFBA 1CQIA 1NP6A 4EEKA 3L3BA 4Q4CA 5DM0A 3SJBA 3E3AA 5K0TA 2OSVA 2IE0A 4XQGA 5AHRA 1W1UA 2Z56A 2I1QA 2RSLA 4A27A 3L9WA 5TPZD 5ALDA 1GU7A 4L27A 4X92A 4J7WA 5HZHA 1TZ2A 3QEMA 3P2YA 2V7VA 3Q73A 4AEZC 4YROA 5IAKA 4AP5A 1UMDB 2GH1A 2R6R1 1G2QA 3S2YA 1WW2A 1QYDA 5LQRA 5C81A 2CEAA 4EECA 2GCPA 2HDWA 3TX6A 1QP8A 1S7CA 4ATGA 4KWEA 2BMWA 3I32A 5HILA 3EW7A 4ZV4A 3MERA 3G2LA 1T36B 3H97A 3LKVA 4WASA 2NNLD 4F2WA 3H1AA 1CJTC 5H9VA 3OJWA 3UHFA 2PAFA 1QO0A 1H6DA 1Z63A 4WUVA 1QO9A 2R1VA 3OZIA 3VDMA 3H2ZA 1P0MA 5GM1A 4N5NA 1EP1B 1BPOA 1JTEA 2LBPA 3A9TA 1YCHA 4Q3KA 5HDBB 1C50A 3L02A 4Z68A 3K20A 4WXMA 4GECA 1VBFA 1C4WA 4RHYA 2ECKA 1QHSA 4MCJA 5DCLA 1Z6AA 1L7QA 2PH1A 4I5EA 1RWXA 4GXNA 5AVRA 3WK4A 3FWNA 4R68A 2PYZA 5DX8A 3RSCA 4AJ4A 3UZUA 2E4UA 3UF0A 4RVBA 4P3PA 3O8LA 4MKXA 5F1PA 5CAEA 1GWNA 1TZBA 1VDYA 3UMGA 3DAOA 4NZ9A 1EGMB 2Q6LA 4G84A 2XUHA 1RXYA 4OU5A 4IFTA 3FRIA 1RLOA 2OFXA 5HS0A 1XV5A 2ILTA 2DZDA 2XH8A 2DQZA 4XB1A 5BUCA 5ALZA 1G19A 2EG5A 3L1UA 4H1WA 4GYJA 3S1AB 2GCNA 1XMPA 1L7EA 2NYAA 3THXA 3GW8A 1DVPA 2AIRA 4Q0MA 1E0KA 1YZFA 3P2MA 4RQIA 2P9TA 1YULA 4BNMA 1S2OA 4O1HA 5BP7A 2VWPA 3A26A 1SXPA 4NENA 5H4HA 1AXRA 1XZIA 2ZBGA 1YO6A 3NBQA 1ZOLA 3A10A 4OAQA 3C3WA 3DZIA 2YZKA 3DT9A 3NRBA 4EBBA 2JGDB 3RDPA 4F7AA 3HXFA 1CWUA 3WIDA 1W87A 2D5AA 3AUXA 2AR7A 2JI8A 3IJRA 2BH2A 4KX3A 2G28A 1P45A 1R6DA 1RHMA 1LSSA 3RRMB 3JVDA 1U6JA 3PRHA 4R0NA 5IYZB 1K06A 4YUAA 2EF0A 1Q92A 4BNDB 1E8ZA 3TBHA 3GLTA 1KS2A 2WM3A 3FTDA 4GAAA 5JBNA 3CA8A 3F6EX 3U9TA 3DFIA 5BSKA 2ZIAA 2EYQA 1C7FA 3HYCA 1CEEA 3P9KA 4MR7A 7MDHA 2IF2A 3WP1B 4MBGA 1Y7TA 4G0OA 4H6VA 5FULA 3W2FA 5AHKA 1LBQA 1SBYA 3AR2A 4IJKA 3KSUA 1B4DA 4DQUA 3B38A 3DLIA 4CQNA 2GN1A 3T7KA 2AA3A 3D5EA 5F5NA 4DM7A 4CEJA 3AGQA 4EMSA 1EFCA 4IHJA 3KPVA 3UAGA 1ZQ9A 5JHHB 1WXIA 2A86A 1USKA 3KTAA 2QROA 4GS5A 2VTVA 1RVDA 3DEHA 4LG6A 2DFPA 3Q2KA 3MF4A 4N6NA 1KY2A 2GXAA 1IHUA 1O97C 4JGBA 5CNKA 1EVLA 3QLVC 3OKCA 3EE6A 5C37A 1JRLA 3W3AD 3UHOA 3FD8A 4NCXA 2OUIA 1T3TA 3SOPA 3OY2A 4HB5A 5DEIA 2PL5A 4XYLA 2MOWA 4JKOA 3C16C 2W6QA 1KMCA 5I4BA 1F0NA 2OV6A 3D9OA 1NN5A 3B1ZA 5EJ7A 3ZV6A 1J5EB 3A28A 2C4MA 1JX6A 4AZ3B 2AQIA 1Q6ZA 4JKYA 2C58A 2P6UA 4UUOA 2Z30A 2FQ1A 5BSRA 3BEEA 1E2EA 2BP7A 1J8QA 3IAM1 4MULA 1R3UA 1EFKA 3PQ4A 4WK6A 4TRQA 3U40A 3UJ6A 4XPIA 5LMCA 2FRVA 4R8KA 4PNEA 4X8MA 1SVKA 2C4TA 1NUTA 2H0QA 3LFHA 3Q0TA 3OX4A 1Y8ZA 2QM7A 1WL8A 2Y9MB 3GFOA 2Y69E 1EDZA 2ZZNA 2DWZA 3BG1B 4F56A 4BQPA 1W0KD 3U80A 1QLHA 4AIIA 4WWOA 3WK8A 2GJAA 2ZROA 4V0MA 3JSXA 3RSEG 3WLIA 3SOZA 1Z36A 3DV0A 1NWHA 3O26A 2XCLA 1J07A 3ONEA 4F1KA 1E9FA 1I6WA 1SHUX 1V3VA 4J0QA 3K16A 4TYMA 3R6WA 1SRRA 2V59A 2WVGA 3O31A 3T06B 2BMAA 2WXNA 4EO7A 1OV4A 4RBNA 4WOCA 5U9CA 3TTTA 4D8WA 2ZTMA 4IXNA 3R5KA 3R3VA 2WG2A 4JA9A 1HDXA 3IUMA 2SKEA 5FLXA 2O8DB 1TA0A 3QWFA 4MXDA 3S8YA 5CK4A 1GQSA 5LQSA 1JDTA 2UV8A 4D5GA 4FMCB 2JFWA 3AESA 3DOEA 4D9BA 3FF1A 8ATCA 3BH0A 4EMBA 3Q15C 4O4JA 1Z2AA 1Z33A 3NAGA 4IDPA 4G81A 3JAMA 5T4HA 2XKKA 1BDIA 2V7EA 3DZBA 3LGXA 3CY6A 2PR7A 3HDJA 1US8B 1QMGA 5AVUA 1Z45A 4JA7A 4KAXA 4MYHA 2BGRA 1NY5A 5F3RA 4AMGA 3WX0A 1GR1A 2VRWA 4H7HA 3Q6IA 3GVPA 4MQ4A 3WLEA 4N76A 1DX9A 2OE2A 3U56A 3EY9A 2UUOA 3HDTA 4OGLA 4AXHA 3VYUB 4B3CA 4B9EA 5IWCA 1SXJA 2JEKA 2PV7A 3BHJA 3JVVA 5IM5A 2CFRA 3PQFA 2ZR7A 8ADHA 1NQUA 2JIMA 4P93A 1DWOA 1T4MA 3FCEA 5DLPA 3LWBA 1SC9A 4WX2B 3O9MA 2Q3LA 2KM4A 4L4RA 3VCXA 3SHOA 2AQKA 1XZ8A 4G24A 2IH2A 3SBDA 2R59A 2W4IA 4J8FA 4TN5A 1BO6A 1Q0RA 3FYSA 5K1ZA 2AZTA 2X86A 3SYLA 1MB3A 1WCIA 4ZT2A 3KHTA 3B2EA 1OLUB 3MCAA 3GPBA 3LCAA 1KZ1A 5E9JA 2GN4A 2QUAA 3QY9A 1QO0D 2VK4A 1KPIA 3W1EA 1N4AA 2QTGA 2NNWB 4HNAA 2FOIA 3BCRA 1TLFA 4IRXA 1T2EA 4RXMA 1Y7HA 3RVSA 4A63B 3B1KA 1ZVKA 2JIPA 1Z0AA 3WLTA 2B6CA 3RWMB 2CFSA 3BQMB 4OJKA 1MA3A 3IP1A 1OFVA 2P67A 3L6RA 4HQ0A 4N7RA 3M0EA 2NSYA 4KQJA 2Q5OA 3U4HA 2ZB8A 3B36A 4N49A 5E2AA 4URXR 2RARA 1R0ZA 1PSZA 5K0BA 2O2HA 4CGYA 4A91A 3HXKA 4V3IA 5HOQA 2E3JA 2FUG1 5HF6A 1MGPA 3L7NA 3ETDA 1P61B 4KO1S 2AE2A 5ADWA 1HG2A 4X85A 5ALEA 4UM9B 1EEXB 3EY4A 4B2LA 4QYSA 4L0QA 3Q8XB 3PHBE 4DPRA 1D4ZA 3WKAA 3HQ4O 4ZQGA 5IULC 1TB4A 1KDTA 3EVFA 4YK7A