4GZ3A

Crystal structure of human o-glcnac transferase with udp and a thioglycopeptide
Total Genus 279
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
279
sequence length
715
structure length
695
Chain Sequence
PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKHIYDNRIVLNGIDLKAFLDSLPDVKIVKNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
total genus 279
structure length 695
sequence length 715
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz3A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz3A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gz3A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gz3A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gz3A03
2QN1A 4G26A 5IKPA 1P29A 4NC9A 3BDAA 3OXGA 4X7PA 3WXXA 2IEIA 3BD7A 2G9VA 4NRHB 4RELA 4AIFA 5G05C 2LSUA 4G25A 3SYRA 3OTHA 3QOUA 1PC2A 4FKZA 1C50A 1NOIA 3ZCQA 4RIHA 1Y8ZA 1LWOA 3MSCA 4WADA 1QQEA 3CUTA 1P5QA 3PDNA 2G9QA 3ZHEB 3NF1A 3BD8A 2Y4UA 3AS4A 2I6HA 3C48A 1YA6A 2GW1A 2HR2A 2QNBA 3G2LA 3TG5A 3BCUA 2QN9A 2VSNA 2PQRA 2UY1A 2BGUA 1WUYA 2QRHA 4CDRA 4IN3B 4RIIA 2VGXA 3COPA 1JG7A 4G2TA 4MI3A 2R66A 1SXQA 4U0ZA 1HLFA 2ACVA 4KXKB 3BCSA 3MKRA 4XI0A 4I17A 3TSAA 2GEJA 2Q7FA 4G24A 4KYOB 2PRJA 5JTUA 4LEUA 1YGPA 4X6LA 2QN7A 3EDTB 1NA3A 3QWVA 4CGWA 1NOJA 4N9WA 2JJMA 3Q3EA 4GZ5A 3MA5A 1IXYA 2GEKA 3H4IA 3NPAA 3LCAA 2QRPA 2ZB2A 1FTQA 3BEOA 3URZA 4FZRA 3MTAA 1HH8A 2F3QA 2E2EA 2IFUA 4RIFA 1P4HA 2QFCA 8GPBA 4N5CA 3VDMA 4WHMA 5BNWA 3ZCSA 2GM9A 5FZQA 3MS2A 3GYZA 3O48A 4RG9A 2IV3A 1WAO1 5JJ6A 1FC0A 1L6IA 1J39A 4WACA 1Y6GA 4Y6CA 1P4JA 1C8KA 3HYMB 1FU7A 2DBAA 2HY7A 4WNFA 4JA9A 4JA7A 1GPBA 3AS8A 4A1SA 3GZ2A 3E4BA 2QN2A 3D0QA 1W3BA 2C0MA 2QN3A 4F9FA 5HI7A 4YI5A 2L6JA 1UQTA 3VDNB 3PE4A 2F3PA 4UI9J 3Q5MA 2XEVA 4ME2A 1PNVA 1H5UA 4H7YA 4AY6A 3MRTA 3L79A 3TOVA 2NC9A 2UWJG 4XI9A 3ASFA 3TGOA 4PQGA 3U4TA 3Q49B 2OFFA 4BT8A 3C4QA 3LY9A 4MI6A 2PQ6A 3RT1A 3OKPA 4LDPA 4KQ2A 3T5TA 4B94A 1XC7A 5G05J 2V5FA 2XGOA 4N3BA 1XKXA 3G2KA 1EM6A 2PRIA 2YQ8A 3T3GA 2XCBA 4JHRA 1C3JA 4F96A 2IF4A 4MICA 2PZIA 3CEHA 1WV0A 2BUGA 4GZ3A 4GA0A 1JG6A 2XA9A 1FCHA 1RZUA 2KS6A 4W9RA 2VCEA 3OKCA 5LCWC 3Q4AB 3MBOA 2X0EA 4NQ0A 1LWNA 1L5QA 4N2QA 4QLBA 4I1AA 4M83A 5BT1A 3RSCA 3G2JA 1WM5A 2R68A 2C0LA 2BISA 3L7CA 1GGNA 2C2LA 3CKBA 5C1DA 1HZ4A 3ZCVA 2XCUA 3CUYA 2R4TA 2YHCA 1HXIA 2ATIA 2FI7A 2R60A 4U04A 4MHSA 3DZCA 5FZRA 4RG6A 5KJNA 5KJKA 5TMDA 1IHGA 3S28A 3S29A 3ZCRA 1P4GA 4EL0A 1Z62A 4BFCA 2VYIA 1FTYA 3WADA 1FS4A 4BTBA 5GPBA 2QLLA 1P2DA 5CCLA 3K9IA 3PE3A 4AM9A 1E1YA 5CCMA 4GCNA 3MT7A 4YI3A 3NCHA 2KCVA 2QN8A 2H1HA 1IIRA 2O6LA 3S7JA 3CVNA 2J9QA 3ZCPA 3GW4A 2IYFA 1KT0A 4JL0A 4O6FA 4MHOA 3MV2B 1JIUA 1FU4A 2WTXA 2F9FA 3S7DA 3O3CA 3R9AB 5D00A 3VUEA 6GPBA 3LY8A 3T7DA 5D01A 3QWPA 2JLBA 5FT9A 1AXRA 4Z5XA 4HLNA 3RSZA 2AW3A 4GCOA 1ZBPA 1GPAA 2IV7A 1WW3A 3QDNA 2VSYA 5D0OD 4LEIA 3RKVA 3ULQA 3NB0A 3MS7A 3CVLA 2R4UA 1V4VA 3LYAA 4RBNA 3NC4A 3BEEA 5TMBA 1OUVA 2C4MA 5M72A 4EL5A 1B4DA 3WC4A 2UY1B 2LSVA 5G04J 4HORA 5CHEE 1E4OA 2SKEA 4J0UA 2VGXB 5TMEA 3MTBA 3S0JA 2IW1A 4I9CA 1EXVA 3MV3B 2F3UA 2MHKA 5ARGA 2QZSA 3U3WA 4X7RA 2SKDA 2C1ZA 2SKCA 3OXFA 1ZU2A 2HYZA 2Y4TA 4WNDA 5FTPA 2H1FA 4HOQA 3CKCA 3IA7A 3S2UA 3C4VA 3Q3IA 3LPZA 4WUYA 5JJ7A 3CX4A 4CGVA 1XNFA 2X6RA 2KCKA 2AVPA 1ELWA 1C8LA 4YUAA 1ELRA 3E3OA 5A6CA 1NZNA 3UUXA 2P58C 3ZFWA 4J8EA 4N2SA 2IEGA 1Z6PA 4REMA 1FA9A 1FTWA 3MQFA 4GZ6A 5DXFA 3MS4A 7GPBA 1NA0A 3Q15A 3RHZA 5JTTA 3RIBA 4G23A 3GPBA 3L7BA 3CUUA 4GPKA 2PYIA 5TVGA 2AZDA 1KLXA 2LNIA 5DLDA 3ASDA 1RZVA 4XIFA 2VCHA 4APOA 1WW2A 3G2HA 2PL2A 4F3VA 3T3DA 3ASHA 2XGSA 4H7XA 4U0SA 4EQFA 1Z8DA 1PSWA 4GPBA 3VUFA 5HQ8A 4HOTA 4BT9A 3ASGA 3T3EA 1K06A 4AN4A 3SYMA 4WNEA 1IYGA 3LKUA 3D1JA 1A17A 3QWWA 3T3IA 3CV3A 3DDSA 3UPVA 3FFLA 4I2WA 3ZHEA 1L5SA 3E3LA 1JEJA 2F3SA 1M5RA 5EX3A 4MI9A 1XL0A 1A8IA 1P2GA 5DBKA 2HO1A 1GPYA 2VG8A 4UI9C 3L7AA 4KBQA 1NVKA 2VGYA 3FROA 1E96B 4YNDA 1PN3A 3HBJA 5A7DB 3ZCUA 4HOSA 3CUVA 1XOIA 4GYOA 3OTIA 4RIGA 3FWVA 3L7DA 3CK7A 2FEZA 4UQZA 2FF4A 2XCCA 5IKOA 3CV0A 1BX3A 1L7XA 2QRQA 1AHPA 2X0FA 3RJVA 5AYWD 4BQFA 1Y6FA 3Q47B 3QHPA 4BQIA 2GT1A 2YJNA 3GZ1A 3CVPA 3OY2A 3CEMA 3BCRA 1JIVA 1B89A 3H4TA 1UQUA 4HWGA 4BQEA 2XA2A 4WNGA 5ENZA 4ABNA 3UYKA 3CEJA 4MRAA 3KS2A 4HOUA 3KD7A 2ASVA 3MT8A 3MT9A 4BTAA 2WQHA 2FFRA 3CK9A 3G2NA 4M7PA 2KCLA 1Z6QA 2BFWA 1QZ2A 5JJTA 5KJLA 4RIEA 4AMGA 4EJ2A 4AMBA 5DIZA 1Y8MA 1KTIA 3RO3A 5FJYA 2AV6A 4F97A 4N3AA 3ESKA 2R5SA 4CTNA 1RRVA 3CVQA 1P2BA 2BGTA 3CEQA 2IUYA 3CUWA 3TAXA 4W6QA 2GPAA 1GG8A 2PYDA 4EKEA 3UQ3A 1L5RA 2XPIA 4I9EA 3D0RA 2FO7A 3E3NA 5KJMA 1NLMA 1SXPA 5EX0A 1O6CA 1WV1A 3Q3HA 3T3HA 2G9UA 3SZ7A 3CK8A 1TJCA 3HBFA 4KQMA 3RU0A 4G1TA 3OY7A 2IYAA 3MRXA 3JYSA 2ACWA 2Q6VA 1NZDA 5FZSA 3UYLA 4YVOA 4X7MA 4UI9K 1KT1A 2PQNA 1ABBA 3IAAA 3QKWA 4GA2A 5LCWJ 2QRMA 2XA1A 3MRVA 5ARFA 4NEQA 5HXAA 3EBPA 3ZN3A 3IEGA 2VQ2A 1FU8A 3OKAA 4NESA 5D0QD 3G2IA 4I2ZA 1JIXA 2C9ZA 4EKYA 1NZFA 2KC7A 3OXLA 1UZUA 2JZCA 2QLMA 3KAEA 4AY5A 9GPBA 2QRGA 2FF5A 2FBNA 3SF4A 4YVQC 2GJ4A 4GA1A 4KQ1A 3TG4A 3ZGQA 2XMPA 1GZ5A 1GFZA 1XV5A 3NP9A 3OTGA 5LQDA 4J8FA 2ECPA 1NOKA 1PYGA 3L01A 2OOEA 2ONDA 3VTYA 3MEKA 3LY7A 2C1XA 1QM5A 3AMVA 4BWRA 3QKYA 4GYYA 4J8DA 4U07A 1VGVA 3FP3A 1F6DA 2GPBA 1K08A 3DD1A 5I45A 1QKJA 4U0UA 2XCIA 1F0KA 4GYWA 3VTXA 4L22A 5DU2A 2XGMA 5G04C 2X0DA 4G2VA 3NAZA 3WAGA 2X6QA 4N39A 2QLNA 3S7BA 3RO2A 1L5VA 1YA0A 1XL1A 3EBOA 3ZPJA 3OT5A 5BW8C 4CTOA 3MTDA 4CTMA 4M60A 4UQYA 2GPNA 1L5WA 1WUTA 2AMVA 2P6PA 3BD6A 4Y6WA 3HBMA 4N3CA 3ZCTA 3S27A 3AS5A 3DDWA 3NP7A 2G9RA 3N71A 4UQXA 3GUHA 2KATA 3HBNA 3S7FA 2WPVA 2FETA 4RENA 5EKQD
chains in the Genus database with same CATH superfamily
4MVJG 4WAUA 5UKDA 1X81A 3ML1A 2VH1A 5BPFA 3ULKA 5DRTA 2PSSA 3F1KA 2A35A 1XDGA 3O3NB 1BDBA 5TR9A 1K4YA 1HL3A 3FYDA 4ER5A 2YWFA 1F0PA 1AF7A 3UT5B 4UZFA 2APJA 3NPAA 4N5DA 1ZA1A 4FULA 2VGEA 5JCOC 1XTZA 4WHMA 2QGNA 3LOPA 3S2ZA 3Q85A 4UZSA 4AJKA 1M1YA 1UCFA 1E1QA 3GJ0A 2IIBA 3LP6A 4YRAA 4IJ5A 2PEZA 5AUPB 4G0WA 5IC6A 1V8OA 4IGFA 3RK6A 2X1VA 2O14A 3Q7EA 4I46A 5D3QA 1VZ2A 5KNBH 1UXGA 1PYDA 2Z3VA 2V6IA 5ALYA 1NFFA 4FYMA 4TKLA 4G89A 5H83A 3AYXB 3WWZA 2NNWB 2XTNA 3FW1A 4L16A 3INTA 1D4AA 1M73E 1S2IA 2XW6A 3GJTA 3AKEA 2IJGX 1I32A 3QW4B 4P34A 1Y3DE 4J7UA 4HLLA 3L6BA 2NU6B 1XCGB 4JVMA 1YONA 3TU3B 5CG2A 5BV1A 1G6HA 4FP9A 2XMDA 1ORTA 1PKXA 3F4BA 4DLSA 4OYLA 1DWPA 5FAXA 1ABEA 4CT4B 1RRPA 3LWZA 4NJMA 3KUDA 1H0KA 2C3MA 1PL0A 4EIWA 5HKKA 4ZARA 4YCDA 1O5TA 5AARA 5CDYA 2Y4TA 3AKDA 2O8VA 4UUPA 3WGNA 1U65A 3BHJA 2CHVA 4G3XA 4AG6A 3QKUA 3QP9A 3HYTA 5LOVA 1Q2XA 2ISSD 5C2JB 1GFWA 3X1WA 1ZNWA 2VJKA 1VYVA 3CUUA 2WLSA 2XUIA 1TIPA 3WMEA 2G04A 3PBKA 5D5QA 3HRHA 3TXAA 1FNMA 1BCRB 3BERA 4QRIA 2OCKA 2VJPA 2J6CA 4WNEA 2E87A 4Q1EA 4DX1A 4OJKA 4O4JB 2Q6OA 1PBNA 2NSYA 1ZCZA 1I7LA 3PC2A 1EM8A 4MW6A 4BNKA 4F1WA 3MSXA 3FPLA 3G8CA 2PFKA 5HDQA 4D44A 1QE0A 3DDCA 4DCCA 5CYFA 3FMVA 2F64A 3ICWA 3CCFA 2PX0A 1N0QA 3K2EA 3G2NA 4UEWA 4M7PA 3GLRA 2XE6A 3KVNA 2FRDC 3NHFA 4W8HA 1PZMA 4B45A 1SBTA 3T9KA 2OEPA 3LPLA 1SZAA 4FOOA 5GVRA 4EKEA 4UKDA 3C8DA 5DM70 3GJ8A 4F3YA 1TF5A 1QKIA 3ROPA 4YRCA 3LKVA 5U9CA 4IRUA 2A4MA 5BT8A 3QPAA 4RFSA 3SQLA 3D8UA 2IEYA 5HKOA 2QL7A 1YRQA 4IVPA 3RRNB 5EZYF 2EOAA 1QM5A 2XT0A 2QMYA 4J75A 2GVNA 1GRVA 1CQIB 3TNFA 1U2EA 4XA8A 3JQ1A 1GADO 4L8LA 3FTUA 3FEXA 2J5BA 4P7FA 3NBMA 1XK7A 5K0CA 1V7QA 1RXIA 1EJ2A 4X94A 2AG0A 4HRLA 4BN4A 3FN4A 4ECEA 1ODIA 2EHJA 2V97A 1J2YA 4GBED 1ZH6A 4IDAA 2EGGA 5J4VA 5IJ9B 1SQGA 1NFQA 1G291 2OC4A 4KFRA 4TN5A 3AIIA 1YFKA 2XCSB 3FYSA 1QQEA 3NF1A 4KL8S 1SHKA 1W1WA 4HRYA 4FC8A 3V2OA 4LISA 3ND5A 2OCDA 3LQQA 1UT8A 1MHPA 3FJ1A 1NG1A 3C5EA 4XUGB 2OYSA 3H2ZA 4BO3A 4J7AA 3TJZA 1Y81A 4AXBA 1H1TA 3DVAB 4I2VA 1J5PA 3ZWVA 2B35A 2FSVA 4CMAA 3O4GA 3THYB 3ACCA 4LYEA 4Y0NA 4AVXA 3ADOA 3AS8A 2QN2A 3MOIA 3FYUA 3GFBA 3CNEA 1EUDB 2OORC 3KOZA 5GM1A 4DQ0A 4ZWNA 1KS9A 1TJFA 5C5IA 5AP9A 3E84A 5GV7A 2QD2A 5TPWA 3LYLA 3DEOA 4DMHA 2C92A 1ZWLA 3QOWA 2AFHE 3EXHB 4AD8A 3Q2IA 1RTKA 5CTAA 3T1VA 3CF2A 5DHUA 2PZKA 3WJ7A 3NHLA 1E3WA 1JI3A 4JBHA 5HG0A 4POAA 1MV5A 3ZX4A 3D5QA 4OQYA 5LLSA 1YS6A 1NPYA 4O02B 3PZDA 3T0GA 5AK0A 2R4TA 4BE7B 1UFOA 1MXHA 4D0GA 5TQJA 3OOHA 4Q3AA 1ORHA 4OVUA 2DQZA 1JT9A 4M9UA 2R7MA 2IELA 4PGFA 3Q40A 4QU5A 2V54A 2AG6A 3BWMA 4DIMA 1VPEA 1KT0A 1T6ZA 3ICPA 3HU3A 5CTJA 3TWXA 5E7MA 1DARA 5IYZA 3OE7D 3C3AA 4OUKX 3RVLA 4QODA 5EE3A 3O95A 2XCOA 5C32A 10MHA 2O8DA 1OA1A 8ABPA 4GI2A 3QLUC 4HNSA 3T1OA 1PGJA 1J8YF 3OPQA 2UVPA 1U7ZA 2A9JA 4HG2A 2HQ1A 4JDPA 4RZIA 1J0CA 5G0TA 3K1AA 3C16C 1A71A 1E9EA 2C1EA 2X2FA 2ILVA 2YW9A 1YJXA 4FS8A 1EVZA 1IONA 1AQNA 3A4TA 5EKXA 2GBPA 4JT9A 4F6CA 3UGJA 2HF2A 3BAFA 1JLLB 3GB9A 2QF7A 1Y9DA 1AKWA 2LTAA 2QW1A 3ZY5A 2V4UA 3A32A 1U7IA 5LB2A 2EERA 4QYSA 2QVYX 1KQNA 3OEHD 2YX1A 3E9QA 4PLCA 2P30A 1BQ3A 3VXKA 1MT3A 3QVUA 4Q9NA 3IBYA 4H08A 3JQ9C 2QTRA 3L1HA 4B6EA 1X7GA 1BJTA 4EGQA 3OZEA 1TDJA 4ND4A 3KS2A 1A7JA 2I99A 1TJYA 2ZYWX 2PBRA 4JODA 2EWVA 2VRCD 3LT0A 4R7LA 3PJDA 4WL0A 2QX4A 3DF9A 2BEUA 2FUNB 1C9EA 2CMHA 4L02A 1P2UA 1DKMA 1TNOA 1CQJA 3ESXA 1GTZA 3QWIA 3UUGA 3HXPA 2ODEA 2REXB 1S8NA 5CFRA 4BFRA 4LQ4A 3TLAA 2BSAA 3R24A 3ICQB 5D84A 1CE8B 5JE8A 3T3OA 4CEJB 1JIJA 3ELUA 2Y99A 3UIOC 1NVUQ 2AZMA 5EIFA 3PL5A 2P3OA 2ZM6B 2X7JA 2ZPAA 2XGMA 4B8WA 5EXSA 3F97A 2C2MA 4N39A 3D2LA 3R0QA 1QFXA 4PR3A 4J0DA 1UZAA 1N3YA 3RTGA 3EFOB 3UJ7A 2EILE 4Q5IA 4S1OA 4ZFNA 2G3YA 3AINA 5AVXA 1G60A 3JUEA 1YDMA 4UREA 5F77A 4IYRA 3PE6A 1FLDA 2H11A 3SS7X 1NM5A 1NKTA 2GK6A 3N39C 3SQNA 2CHWA 2P9SG 1NDUA 2V65A 1TNUA 4A6PA 5L8VA 4YRPA 4R5MA 3ZJTA 2WR8A 5B3KA 1DRUA 3HHPA 2QRHA 2CJXA 5JUWA 2DUNA 4UWKA 3WLTA 4LEUA 2E18A 1KI9A 3Q1KA 1RC0A 3KVVA 2R1VA 3TJMA 4CR6A 3MZLB 2JD0A 3KKMA 3BMQB 3HZHA 3I2IA 1Z7BA 2GZMA 2H2IA 4IQ8A 4G0YA 2AOTB 2XEDA 3V42A 3Q78A 4RVDA 1HZZC 3FNGA 3VSBA 4I8XA 3P9ZA 4ME2A 4DV3B 3AUFA 1Q5PA 3AAAC 2BBWA 1N54A 1ISSA 1UBCA 2QUHA 4FHEA 2HCRA 4HZUB 1K2WA 3R6LA 3OKPA 2YS6A 3TQOA 1ECCA 3SFYA 3G2KA 3MC1A 3RYCA 1CFZA 5DMXA 1E98A 4D4GA 3KSLA 3C6YA 5E9AA 2CHFA 5DYNA 3RUIA 1O97C 1GZHB 1TCBA 4KFTA 1WB9A 2W2KB 4LTDA 1G55A 4AJNA 2ISQA 2BMAA 1PJRA 2J6HA 2I78A 3L7CA 4TV8B 3M6FA 2XH8A 4R9RA 2J3IA 3FUEA 4QEKA 2WZCA 1COWA 4PLYA 1JHRA 4JBXA 1DIHA 1UN9A 2VP2A 3L6EA 3DOOA 3EULA 1FP2A 1G8FA 4CODB 2MSLA 3RK4A 2IYUA 1F1BA 2VIIA 1D03A 3O7MA 2ZJFA 3OZUA 1KY3A 4PZYA 3T99A 4JL0A 4QTXA 3KHSA 4LHVA 5CP8A 4HNAA 2II6A 1MD9A 3E35A 3TPFA 1Z45A 1JNRB 4K6OA 3YASA 1AUPA 1ZD1A 4W5RA 4PZAA 3QUTA 1SUEA 3SD5A 3MINA 5BW5A 5IANA 4EKNB 2X0NA 1S0PA 4ZT2A 4EGAA 1PG2A 1Z33A 5KOIA 3SNHA 2YXDA 3RU3A 4EJSA 2X6RA 4ZK2A 3DXXA 2IXFA 3GN1A 3F9CA 2XI4A 1U3DA 1XEWY 4PVDA 4AF8A 4KACA 1LS6A 3QU5A 2FW1A 1TQ4A 1NA0A 2MMGA 3DQPA 4W5OA 1QE3A 2IX3A 1EWYA 1QZZA 1WW2A 3DKRA 3BXEA 3T3DA 1WDYA 4E46A 4BAUA 1YRBA 4CEIB 1O96A 2GF0A 1WXXA 4CM5A 1X19A 4OQMA 3HPQA 2VWQA 4BIMA 4C7BA 2WXOA 3IE0A 3I58A 4I08A 4U2FA 5IF3A 3AHIA 4I50F 3FLAA 4ZMRA 1QQ7A 5JWRA 1N2CE 4DT1A 1ONSA 2BN4A 2GRMA 1M6VA 4AKGA 5JDCA 4CFYA 3DOIA 2DYRE 3F6SA 1ONBA 4A6EA 2WMNB 3VJKA 4EYQA 4J29A 4ANVA 1DDIA 2JFFA 4AJPA 1JZTA 3IYLW 4BLVA 4MV1A 1V96A 1PK7A 3RU0A 4V38A 4WWNA 4JJKA 2HU5A 1JHUA 3C0KA 4RK4A 2XA1A 3W2IA 4IG4A 1EWKA 2GFQA 2XTMA 3ZQ6A 1Z4OA 1ZSVA 3I2YX 1ADBA 5AJVB 1FDTA 4BUCA 1K7EB 1G42A 3E32A 2HXGA 2WQ6A 4BV8A 5GWXA 2Q28A 1FQJA 3HJCA 3TLZA 1OYOA 1H65A 4ZC8A 3MX3A 4PPYA 1QZXA 1DPGA 4G4SO 4O1OA 2X6QA 3WP0A 1QHGA 3SQWA 4JA0A 1PNTA 3BIWA 1SXJE 4N7MA 3DWEX 3PEVA 4IDPA 2OMKA 3LUCA 3OD5A 1M34A 2AI1A 3QVKA 2G7ZA 4D9FA 3ZGZA 5AQ1A 4F4CA 4G01B 3COSA 1SVWA 3FU0A 3QJZA 1EGMB 2H92A 3SGLA 3DBRA 2HCBA 3CRW1 4B3SB 4KODA 3H5LA 3R5KA 1JDTA 4F86A 2ZU6B 4CIVA 3H9QA 3ZDZB 4CYMD 1T4DA 1IJBA 3UJPA 4LZNA 3I72A 5IDYA 2I7DA 5KYVA 1T4CB 2QG9A 2FZLA 5ITVA 4YASA 5IY5E 3KUXA 4JPSA 3U4HA 2Q5FA 2JLRA 1ZXLA 1JFFB 1X7ZA 3UJDA 2GHTA 1ADFA 3TIGA 3H99A 1RKXA 3RRXA 1KO7A 4YDWA 1UH5A 5FFMA 1E18A 1W87A 4F9FA 3MCTA 3R20A 3F1LA 3EWSA 3H3FA 1QHEA 4QARA 2C84A 4RD3A 3H11A 4KT6B 1YTLA 1D7OA 4ID3A 5DLEA 1CIJA 4U7EB 1TKRA 3GPDG 4Y0VA 1GW6A 3EUVA 4ZZ0A 4C2BA 1W46A 3MN1A 3FDFA 2XA9A 4XWOA 1UAAA 4KNWA 2A0FA 1ZN8A 4D0SA 4EUHA 5I3CA 3DLHA 2COUA 3JYOA 2OG2A 1DKRA 1OY1A 2QN6A 1R4MA 2BMWA 1G8AA 3SK1A 2I6XA 1ZXXA 1N34B 1M0WA 4DNOA 1RQ2A 4YRJA 3S2GA 1BI8B 5AVYA 2PANA 3BK2A 3M4ZA 1KMCA 4I5EA 5HIJA 3VUEA 1VMAA 2Z1MA 2EYQA 3NTXA 4OXQA 1XTPA 4XQ0A 3LYAA 2WUDA 4CQLB 3QYPA 4DMFA 1ZOSA 3MD9A 3HCBA 4UVEA 3CJQA 2PKQO 1JG3A 3ZZ1A 1XTJA 2OV1A 2JIZD 4FFBA 5IWCA 4UE3S 1JR6A 3TW0A 3AJIA 2FZWA 2QAIA 5FPYA 4OAUC 2KE5A 3KTAA 3H9UA 4FXOA 5AW4A 5DX8A 4P3PA 2PT7A 4I81A 1FA9A 4TS4A 1J8DA 5B37A 1P7PA 3EJNA 4RC9A 1LGYA 3V7UA 1EESA 1FVOA 4E30A 4EYSA 4A1OA 1CUUA 3PC8C 4G8CA 4MQ6A 4GU5A 4XB2A 1ORIA 4ZO9A 4EQFA 1Z5PA 1UW4B 1GRNA 2RGUA 1QX4A 2MINA 3CMMA 3W2TA 1HMYA 3KJFA 5DE3A 4PG4A 2IC5A 4L5AA 2Q4DA 2WXQA 2ADMA 3U5TA 5IXYA 1TECE 4RHEA 4YCCA 4J0EA 3V1NA 4BLQA 4QXAA 5K0TA 2JA2A 2JLYA 1DAFA 4U9IS 1PWYE 1CLUA 3DAPA 3VR5A 4ZPJA 4EHKA 2F67A 1AZLA 4D3YA 2D06A 3H9GA 3T3PB 3R7NA 4EFNA 2Q3BA 1RQPA 1CUGA 3VZPA 3QVWA 4PO8A 3UQ3A 5ALGA 3PXCX 2IYNA 3CJRA 3AW8A 3RTCA 2W48A 1H1DA 2HFKA 4BDSA 3L8GA 2IZ7A 2YH2A 5KNDD 1L1FA 3HKCA 3O4HA 3MF4A 3ZHCA 2VHWA 4PZ0A 3OXLA 1C4OA 1JVSA 3SF4A 4V0ME 3SP1A 3G2UA 1WABA 2KZTA 2YJGA 2LNDA 2XV1A 4UNNA 1EK5A 3DOCA 4V1CB 1YQTA 3KQSA 1L4MA 3REOA 5F9FA 3DSXA 5FA6A 2HA5A 4HYTA 1Z83A 1ZESA 1ZNZA 3LT5A 4YRDA 1RLMA 1J42A 2FSPA 5ALPA 3K70C 3O8LA 1ZEMA 1T8YA 3WLKX 1VKRA 2NYUA 4MR8A 2LD4A 1G7SA 1IRXA 1L7QA 2V98A 5JVDF 3PGVA 1C9DB 3QJ5A 1GL6A 4DDVA 5AVVA 5TF4A 2YFYA 3SC6A 1O95A 4CIDA 5ICSA 1FXWA 1GQYA 5D8DA 4HS4A 1F2DA 4E4YA 1JTVA 4XJVA 1CJMA 3FOBA 2I9CA 4P35A 3C8MA 3I9KA 1W19A 4NMWA 3F8WA 4GGPA 3DT9A 2PX6A 1JNZB 4UBOA 1NQVA 3HJNA 3BDVA 2OHIA 5K7SA 3IAXA 3N2EA 3DE6X 3M9LA 3HNOA 3PGJA 4RMNA 3O4FA 3QE4A 2WJ3A 3W3AH 3ORRA 4HNVA 5AVJA 1DQNA 3KDAA 1EVIA 3IP3A 2AMLA 5D66A 1T2NA 5LWQA 3O7WA 3A9CA 4KSCA 3KNZA 3NVDA 4URXR 4ZODA 2I1JA 3QV2A 2WDZA 3IT0A 4AX8A 5KYKA 2CJWA 3G1TA 3HABA 4HRVA 4L8GA 1CRZA 2X4IA 1FPQA 4JJZA 4G9EA 3HY3A 4JJ7A 3ZWPA 1H6AA 4B0ZA 1BMTA 3R6DA 4KYTA 1RPNA 1B1AA 3F3MA 3CIFA 1EVLA 5L3SB 4MWOA 3HMQA 2PFSA 5E2BA 3NANA 2GMWA 4DCSA 1K8ZB 5H68A 3VBCA 3ETNA 4RU1A 3S7JA 2Z2KA 4IHJF 4PFSA 2AX4A 2ZWOA 2FN7A 3DT8A 5KYXB 2D0OB 5EXXA 2MYOA 4JV5B 3AU4A 3LFUA 1WE2A 1MH9A 1YK0A 4YGXB 3CNQS 3I5YA 1QVWA 4PLFA 3S2FA 4UXHA 5JAPA 1YUBA 4LJRA 4GZMA 3ZDBA 4ZZ2A 3T7EA 3J80A 4X63A 1H1LA 2XWJI 2KBXA 3SBTB 1I5OA 3I73A 4IIHA 4ZKEA 2FUEA 2GHRA 4OOEA 3IVCA 4TKUB 3X1KA 1XLTC 5CYGA 3MFQA 4HVLA 2OXCA 1USGA 4GNRA 3VUFA 4C7MA 1YGYA 4G0UA 1E1MA 3U3DA 2Y4OA 4Z6KA 2C83A 5CGQB 4G8JA 1KY4A 2LGJA 5JANA 1BH2A 4IIYA 5LQCA 2C9YA 4KXQA 1XVTA 5CA1A 1XQ9A 1C9NA 2WAXA 1L8AA 2FW8A 1N4DA 3I9JA 4TUYF 1C3OA 3M33A 4YN3A 3TWUA 5CR9A 1NXXA 2QTAA 2GAIA 3C97A 3CEJA 4KIJA 2B6CA 2XEXA 1QB7A 5I7HA 2H48A 3ADDA 4CTNA 4ZT7A 1XGKA 4HN2A 1FDWA 1E2KA 2LO6A 2XPIA 4YYEA 3TPCA 1OQAA 5ISMA 3GNSA 3EXG1 2O57A 3ZKAA 2PPVA 3P9RA 3MOGA 4M8NE 4Y2RA 1RHRA 5KSZA 1FFSA 1KF0A 3C3KA 2IBSA 5HXAA 3E8MA 3Q15C 3RH0A 3JQAD 4HBZA 4Q48A 2TRSB 2VJMB 4LQDA 5AUNB 1DBPA 4C89A 5CD1A 5JH7B 2BEJA 2BHNA 2WM2A 3P2MA 1S3IA 1PG0A 4OQPA 4HD8A 1PV1A 3G2OA 4U7WA 4B4KA 4I1IA 3GZNB 3OIVA 1OROA 5G0VA 1UOQA 1P17A 2VP9A 4P22A 2OESA 4E1AA 5F5NA 1RBYA 5FWXA 4TV9A 4QYXA 1T5DX 4XXHA 4CNBA 2W9JA 1WLYA 5KWEA 2Q1SA 3A1NA 2ZVPX 2VTEA 2WPVA 3HK2A 1NXOA 3FE2A 4Y30A 4CLRB 1ZI9A 1YE8A 2X2EA 4MKRA 1Y9EA 1H05A 4F6RD 5H82A 4J8YA 2WUGA 2AQ8A 4CGZA 3SQXA 3GAMA 4JELA 4BNLA 3ITWA 3H1AA 4KVZA 1QZUA 1DRKA 3NXSA 4FOPA 3V46A 4NBVA 2WWFA 2W8ZA 1AQIA 3R6WA 2VZEA 2MYPA 1WEKA 1C1DB 4A27A 3DD5A 3IEIA 1WXIA 2FU5C 1W5FA 4B76A 3KKPA 4A8PA 3O48A 1G4UR 4FKMA 3OZGA 2G83A 3RC8A 5DBIA 5CDUA 5HHTA 5HS4A 2C7RA 3HUTA 1L6RA 2QUBA 4OKIA 4NHEA 2EF0A 4O4IB 3MCVA 1HXHA 4FD3A 1S2NA 3HXOA 2FAXA 3D59A 3HHEA 4YUZA 4E7PA 4FM9A 2JGAA 2Z6AA 1USVA 3AFIA 3OLCX 1NE2A 4MA4A 2DWQA 2R0QC 2YYAA 2Y05A 3T4PA 3S81A 4W82A 4N65A 2DXIA 2R68A 3GHYA 2FWRA 2OOSA 1H8HA 4R41A 1BVHA 3G2TA 4LK2A 5JNWA 2LUOA 4RZQA 4FB5A 1TKBA 2ORED 4R1UA 3ZNPA 3UM2A 4C0LA 1IU9A 3OZRA 1FYFA 3DEAA 4G5QA 3LF2A 1CQXA 3I2KA 3UTMA 4C0AC 3P7MA 4Q3CA 1RJFA 3JD3A 1WY5A 4POOA 5EWJA 5I4CA 3O3CA 3S7DA 4Q9HA 5TPZA 3GT4A 4G2NA 3LXMA 1Y98A 3GYBA 1ZUHA 3NIGB 4KFUA 5AYVA 3NUGA 4NAVA 5BUCA 2HCJB 4QHTA 4GX1A 5BY2A 1J1ZA 4YT4A 3WLNA 2N0SA 2WMDA 3P71T 3V00A 2HYZA 4KZCA 1X7XA 1I0LA 3L82B 2CWDA 2NM0A 4OHMA 1GZ4A 1ZJYA 1QANA 3GP5A 3IELA 4IH9A 3ND7A 1UWKA 4YDOA 4PG6A 1ZHHA 1LVGA 1EVEA 3I05A 2YZ2A 4EUEA 4HWTA 1SVSA 4EJ6A 1PR3A 5HIIA 5ANLA 3FTFA 5B58T 4HQNA 4OU4A 3C3EA 1ENZA 2ZZKA 4FHKA 2JFHA 4FSHA 1A96A 1QONA 4AMUA 2XCLA 1RHJA 1X80B 1T3TA 3F98A 3GNLA 1V95A 5HKPA 4FEEA 5EOVA 4KJXA 5U4QA 4BNWA 3OI7A 4K9MA 1Y7IA 4YDEA 2GEVA 1UMCA 3G5TA 4YA6A 3SPXA 2G77B 2HHHB 1MZVA 4KQFA 5FYQA 2NQ2C 4HRAA 4EJ2A 3HH8A 2HWWA 1EFRA 3FFWA 5ENOD 3B8HA 1W0CA 2HJHA 1KQ3A 1OI3A 2J31A 4QM7A 1B16A 4PAGA 1LU9A 3TCXB 4LNUB 4L51A 2IPNA 3EXEB 1R4NA 5TIIA 1XCPA 2WB4A 3QVMA 4KN8A 4J2OA 2HHJA 2X2OA 3EIUA 1IZYA 3VH4A 1PQYA 4IW3B 3IERA 3HXLA 3RD5A 2GJ4A 3X1JA 2HF8A 3LCUA 1JGTA 4WDRA 1P6QA 3IT3A 2PT5A 4HH0A 5FTWA 3P94A 1NXSA 2HBRA 2WM8A 4JB0A 3VTXA 1EG2A 3WV4A 4L3WA 3IDOA 2AE2A 4ZV9A 4ZCQA 2FEAA 3PNLB 4CTMA 4BMYA 1W75A 4PM4A 4DNPA 4M1MA 1DBWA 2A0UA 4IFEA 2YY5A 4CFSA 3DDWA 5K20A 4KYVA 2DU8A 3H2SA 3SJZA 1KAEA 3S7FA 3CG4A 1KJIA 4IO1A 5EZ6B 3UMRA 2QSZA 2ISCA 2EZ9A 3H05A 3FOEC 4IFBA 3ZE0B 3J81A 1M8FA 4L28A 3WIVA 1FRVA 2PH1A 4UCQA 3G7UA 3S55A 1S70B 4QVGA 1KFKB 1R64A 3SX0A 3MKRA 4HDQB 4FOTA 1B73A 5JFTA 2VSQA 1I13A 3OPYB 2HLDD 3OLVA 4ZAXA 2GERA 4Q4HB 5E8JA 1FC0A 3ANNA 4QSMA 1G3MA 5AOBA 2XKJE 2QZZA 4QECA 4DW8A 4Y1EA 2ZJ8A 3B5JA 3PRYA 4V2IA 3IR6A 3AEKA 5CW1A 5BNIA 1QCCA 3BYZA 2XOKD 1CS4C 1C7RA 1TKAA 4YONB 2W4QA 1QO0A 1UK6A 3J5QB 3HDXA 1II0A 2VQ3A 4CG2A 3T7SA 4O60A 4RFLA 4NMMA 4MS1B 3JZMA 1RYEA 3JSXA 1MO4A 1KFCB 3G0IA 3ENZA 1LBEA 1CNFA 4J8SA 1OT8A 4J49A 4QWWA 4X7BA 2V6FA 4BTBA 1EWVA 2QM3A 4MVJF 3PUVA 2AXQA 4B3XA 3CIAA 3WLFA 3E58A 5I7EA 1XNHA 5LN1A 4ZRMA 3F7OA 3KJEA 5JASA 3BGOS 5GZ6A 3QKTA 5EE0A 1QOPB 2OC9A 2PA0A 2XIJA 1I2ZA 1T9DA 1L3BA 2B3TA 2XYHA 4XCVA 3UI2A 1KI2A 1U5BA 5GVSA 2GPWA 3SSMA 2AZTA 3GRFA 4I9CA 1BWRA 3G9TA 3H9CA 3IULA 4B7XA 3KUCA 2I8CA 3AR3A 4PO3X 3QVGB 2TMYA 2OTCA 4K8OA 5ENPD 3BWCA 1GTL1 2VF8A 1AQJA 1J49A 2XUPA 4ER0A 4J76A 1FTWA 1G2QA 3HS3A 3PKZA 1A9TA 5DBFA 1CZHA 2JLWA 1O89A 3LDZA 2IYQA 3OD1A 1BS1A 2CDBA 4FNMA 5KAPA 2IEDA 1XFAA 3HACA 5FNVA 3H9JA 4YJDA 1E60A 3B1JA 1UN8A 1E89A 4KPFC 3KQWA 2GF2A 2EZUA 3V80A 3FDXA 2EINE 2A0WA 3QLVA 1X7HA 1YOVA 2WIFA 3L8CA 2OP1A 4LF9B 2PVSA 1UBEA 3VAAA 4D79A 2P2SA 1GZUA 4YK7A 4BL5A 4BV2A 5AHOA 2LE0A 2CXSA 3WLIA 4GKKB 3FNIA 3N53A 3VSAA 2W8BA 5CNIA 2JGNA 3SHOA 2Q2NA 4QTZA 2BR3A 4Z68A 1K6MA 3EUEA 3T3NA 3EPRA 2PWPA 3H86A 3Q41A 1HTWA 3AM3A 5JQGA 5KWDA 4AUKA 3KQKA 1HF3A 1S0UA 4MVJH 4Q7KA 4WZAB 1OC2A 3STTA 3T15A 3CUSA 3KAEA 2CE2X 5HF8A 3HCFA 3OFNA 5EQDA 2NO5A 2C8VA 3IJRA 4O2BB 2DECA 5IAOA 5EGSA 1PS9A 3UJBA 4YVFA 3P45A 1Z17A 4LCBA 2ZYDA 1W5SA 4Z49A 3WAGA 5EHQA 2QLNA 2X19A 3PFGA 1PLKA 2O0LA 2WTEA 4MP6A 4RK1A 4C22A 2P9QA 2LZ0A 4P4NA 4EVRA 4MJLA 2QIPA 2PGNA 4EX7A 1PS0A 5ICFA 3T1HB 1WUKS 2V1XA 4Y67A 3QFRA 1U0LA 1WUJS 2Z43A 2FX5A 3JAKB 4ZCIA 3PDNA 1LDGA 1ZITA 1KGDA 3TG5A 4IV5A 4CE6A 2OK8A 3GT7A 1E2HA 1VG9B 1WQ4A 3DDOA 4TKMA 1NI1A 4YJ2B 2ACVA 5JI3E 1NU8A 2B4QA 3TX6A 4YACA 2G6TA 2OBBA 2RFAA 5A4AA 1AHNA 1YZTA 1C3XA 3UXEA 3FCEA 4MVCA 2G5PA 2X6IA 5CXXA 1KK2A 4HN9A 2GPJA 1NUPA 5CH8A 3H8WA 2BFPA 3F5MA 4QUHA 1A7KA 2FG7C 2CNWD 2W83A 4NYMQ 1Y3BE 1REQB 4OXKA 3VYUB 1PEKE 1UOHA 2FEMA 3N76A 3D9HA 1MX5A 1L9KA 5AVRA 3ZIMA 2W6ZA 3ZD8A 4M9QA 4QO7A 4ZDWA 4G85A 2AXVA 2PH5A 5TNXA 3EGOA 1QDLB 1JR4A 1QLJA 2GO1A 5J2TB 4KE6A 4J7XA 4E08A 4XEIG 4AS2A 4NYMR 5E7IA 3G59A 3RTEA 2AFIB 2O0KA 5EZ5A 4MHSA 2CVPA 5FZRA 1JPLA 2EHDA 4B6JA 1SCBA 5CCLA 2CKDA 5T8KC 4ZN6A 3CY6A 3RYIA 3FR7A 2DQKA 4H2DA 1Z0ZA 2GJAA 4EG3A 1CERA 1KJYA 4FFSA 4A8JB 5FEUA 4LJYA 2XQ0A 3EOAI 2Q2QA 3WTCA 4RH0A 3AFGA 1P62B 4PN7A 2X3FA 4S1TA 1Q50A 3O8BA 5I47A 2FEXA 2MT9A 5C4MA 1N94A 1WP9A 3JQPA 1RLUA 3WTBA 3AVTA 2GD1O 2EFCB 3T34A 3CKCA 4D3XA 1WDMA 2FKAA 1QYMA 1JBKA 1QV7A 2ECOA 1WCV1 3ABQB 4GZ6A 2C78A 4Q39A 2ZJ4A 1FS5A 4BOYA 2FCRA 3EIJA 5DLDA 2QRLA 4DIDA 3Q9UC 1H6BA 1N2EA 2IYPA 2E82A 3EQ2A 2V03A 2ZIXA 1DINA 1G9TA 4IGKA 4DUGA 2P9CA 3SYMA 1R9JA 4C4SA 3HGMA 4U2GA 1DFHA 4C6TA 5JLJA 4HTFA 2R86A 2JIQA 4UI9C 2IZ0A 2ZISA 4PNEA 4FGLA 3EW9A 3NOQA 3SQMA 3NNDA 2R2GA 2QI9C 3RUPA 3U26A 3VR3A 2GF9A 3EVAA 3P1UA 3E5RA 2V4LA 4C2AA 2HJVA 3H8SA 3RHTA 2XUHA 5F21A 2QBYA 5A3JA 4YAKA 2YKGA 7REQB 4ILEA 1Y8MA 3PXBA 4GP9A 3OPVA 5BMVA 1XTRA 2R8PA 1PEAA 5HGJA 2RHWA 4ROSA 3QKSA 4D9NA 1BI7B 3TGLA 5K5EA 4UU7A 2EKDA 1IHXA 4RTSA 1Z0IA 4DBLE 1HURA 4FYYA 2A2ZA 3H1PA 2KC7A 4IEEA 3RIXA 1UZUA 1R5NA 3IUYA 3OX1A 5K45A 2AWOA 4N18A 4DR5B 3IAUA 3ZC3A 1OI7A 3TTXA 1P77A 3RVKA 4RDHA 3P2OA 3WBKA 1F0KA 4EG7A 3THXB 3BK7A 4LJKA 3J81k 3UK0A 1IWOA 3HBMA 1N2BA 1Q0QA 4DE5A 5EJ5A 2FUCA 4ROTA 4HYYA 2X7HA 3E3MA 4HNTA 4UYJA 3T8YA 2J6BA 4RCVA 4UPDA 4ZOLA 4NRHB 4W7IA 5A6SB 5H59A 4FYPA 4RYLA 1N57A 1W1UA 5L95A 2BGUA 3NFRA 4D43A 1EZ1A 1O3YA 3ZHUA 2C2WA 3UHPA 4TWAA 5H16A 1WOMA 3Q87B 4XI0A 2IIQA 1I0ZA 3V8MA 5DX0A 4A15A 1KJNA 2RAUA 5DYTA 2R6CA 1NYRA 2DPMA 4WV3A 1IDOA 3JV7A 1YYHA 4KQGA 4KFSA 2VEDA 4HRXA 3IH5A 1R4AA 2CLIB 2H1IA 1U28A 4C14A 4YAUA 3QVVA 3UK2A 3RF6A 4M37A 5EINA 1C8KA 1QHSA 1V16A 1KHTA 4EJ0A 5HI7A 3RUDA 2H2FA 2OVBA 3GLQA 4G1FA 4WNCA 5EKDA 2O4CA 3U4QA 4W1PA 4DFDA 4TWZA 5IBRA 3VKHA 2GROB 4X6UA 4CLEA 1J2UA 2XMGA 5CBKA 1U0RA 1U8UA 3OKCA 3RFXA 2H16A 3RRUA 2P2YA 2ZXWE 4ZP1A 4FQ7A 3KKLA 1J8VA 1EK2A 5KOYA 3NX4A 1KFJB 3VA7A 2R60A 1W4AA 4PGAA 3HXEA 3TG8A 1K3UB 5JJ5A 5TY0A 4ETNA 4ARVA 2GCIA 4HB3A 3JQBA 5TEWA 2H9IA 2EP8A 4Q3EA 2P90A 2DUJA 2O6LA 3RC3A 4CETA 2FOIA 1PJSA 3AM1A 1R37A 2R7NA 4CG3A 3G0BA 4U4AA 2M6KA 4C7XA 2HN9A 5LUBA 5JADA 2PNJA 1WW3A 2ETVA 1MPTA 3NC4A 2W2TA 3E5HA 2O06A 4FFWA 5AWFC 4EL5A 4E1VA 3RUAA 4WNAB 1BMQA 5ERGB 3ZIAD 5I7VA 1KMIY 3IALA 2QZSA 2ATCA 3RQIA 3MHTA 2R8ZA 4TVSA 3NM5A 5H7PA 4YJ3F 1M34E 2A86A 3FF1A 3P4YA 1JP7A 3OU6A 1X1SA 5FLEX 4DJDC 1T1GA 2OZLB 3OEWA 2QGFA 2PE5A 1A3CA 2AMFA 4YCLA 1SQSA 2PAFA 2PUWA 5DF1A 5T5QA 4MDEA 4WWHA 3LFHA 1KMNA 2B21A 4H7XA 5K8TA 1Q0LA 3I62A 4C4ZA 2OCPA 4B6RA 4ZALA 4X95A 2D2FA 3LKUA 5JFGA 1U98A 2DCUA 4TWBA 1J5XA 1U80A 2IHBA 1T10A 2X5GA 5HPYB 5TGDA 1TO2E 2IIPA 4TLCA 4JI0B 3UK6A 3LM8A 3HUEA 3CUVA 2DLNA 4EPRA 4G4JA 1Z4MA 4UUQA 4JYMA 5FOSA 1QE5A 2YWXA 3MK31 4XYGA 1ID8A 3C43A 5AHXA 2BFEB 2QRZA 4HWGA 5K0SA 3EMDA 5IXSA 4LXIA 2FMTA 2QD4A 2UU9B 5T7BA 4MVJM 1RI4A 3KSUA 4LECA 4CKCA 3B36A 3CKLA 1MHQA 4BLPA 3IBGA 1NPTO 4B31A 1C81A 2O1SA 3ENWA 4BVGA 3WGKA 2NZXA 5FBZA 3INRA 2I3DA 2PT9A 4P3XA 4I9HA 4IXDA 3DXMG 1YKFA 2XE4A 2NVBA 3PREA 5DNCA 1S2DA 3L1VA 5SYNA 3IJ5A 3HB0A 3QJYA 4MWEA 3F5SA 2A1UB 5E3IA 2ZTSA 2W98A 4K2HA 2Q5EA 3M4XA 1T4GA 3N59A 3JRWA 1HYQA 4RGBA 1RCUA 1KYYA 2FEWB 3KJIA 5PGMA 4FJZA 3HA2A 2F1KA 2O6HA 4K1LA 4ASUD 2QJRA 1LF5A 2Y0PA 3X2EA 4BO7A 3GOQA 4UNRA 1ZA2A 5K0BA 2DFVA 1Y8QB 1H2RS 3AF6A 4BEVA 1H6PA 2E85A 3UF0A 3SSAA 1E58A 1ZAKA 1ENOA 4X3PA 4MHTA 3CW8X 1Y42X 5IKPA 3X2SA 1U7TA 4QPZA 1PBTA 1IHBA 4BSZB 3K0SA 1TO6A 2VQEB 2QU8A 1Q1BA 4HGNA 1NP3A 4QYMA 3MERA 1PGOA 3ZKWA 2PQMA 2BF7A 3GLHB 1SHJA 1NJ5A 3AO0B 4WBNF 4XVHA 3BSFA 4OHWA 4FIZA 2KMLA 3TRKA 1UBOS 2CBZA 4YMSA 2FSSA 3SSOA 4X84A 5CK4A 2QL6A 4MGYR 2VZ8A 3T06B 1A9XB 2WF8A 1RT9A 3WMRA 1OXJA 1KHHA 3K6RA 5EGNA 4WXYB 2DLDA 3IHTA 4QQNA 4M1SA 1XRJA 2AK2A 3HWSA 1A88A 5T8IA 1XD9A 2AQKA 1X7WA 2BFFB 3U13A 4F4JA 1NQ5A 2RG8A 1E1CB 1CD5A 1ZUNA 2R3SA 4MW9A 2B98A 4ZVPA 1PT7A 4EAQA 4ZI5A 4EW2A 4EB6A 3DTVA 4H7YA 2ZRGA 1OWOA 2G9ZA 2IEBA 4HH3C 2ZRCA 2F1IA 3SF0A 4LDPA 3MGGA 4RK0A 1K8KG 4ZEWA 4LKOA 1EM6A 3DVQX 4PQYA 3QEAZ 4PLVA 1R4ZA 3LQYA 1Z7YA 4U2CA 4AZ0A 3NOXA 3WNCA 3OCUA 1LTQA 4GPMA 4A91A 1W0KA 2BISA 2H6IA 2PA3A 4PYRA 3PD7A 4GPD1 4Q03A 4LK3A 2MMCA 1GA4A 3ZDFA 3W5SA 1R27A 3ZBUA 1X8LA 4CZ2A 4G4SP 4L8VA 4DJAA 4HQ0A 3CBGA 1JQ5A 2GEBA 1LTKA 3ZDEA 5ALVA 5DDIP 4MQBA 2X9VA 3O9MA 3DT6A 1OVGA 1JHAA 6AT1A 4YRFA 2F55A 3ZHQA 3PNQA 5FBLB 3CE6A 4FSDA 3CQGB 3D6FA 4FOLA 3VSCA 1E4OA 1PJTA 1WMEA 2B7LA 4F72A 4AMVA 1ISRA 1D4OA 4GOJA 1IVNA 3UB2A 1MABB 1N2GA 4H0FA 1USWA 1LB1B 3ETJA 3ZH2A 3RW9A 1PYOA 4DCMA 2YMMA 2XQVA 3FCYA 1UWLA 5IWAB 2ZSIA 5TVGA 4IGEA 3V5NA 1QJCA 4C4YA 1AV7A 2WRZA 3ND9A 4H3SA 2PMBA 3EAFA 3PCXA 4BVKA 1U2QA 4QXPA 2WK1A 2Q7OE 2XITA 2AJTA 4Z9YA 3SR0A 4JUBA 3K1ZA 4OL9A 4X0EA 4AN4A 4E6PA 4K8RB 1X86B 1EP9A 4JHLA 3I04M 1A0OA 4URWR 1B42A 3OE1A 2R65A 5A23A 1MG0A 3NRBA 3KBOA 1CKEA 1N5IA 4L08A 3OTIA 3OC0A 5KPJA 1KNXA 3FKQA 4FFLA 1YHYA 4AJLA 5HTOA 2HCFA 3LIPA 3WWYA 1E2PA 4ESHA 3LECA 2DJIA 4K6FA 3UYKA 1RI3A 2PS0A 3KD7A 3IEMA 3MWKA 4BTAA 3BJRA 3FRJA 3U4AA 4I5DA 4LGYA 2GLUA 4P2BA 1CVLA 3ASNE 4F97A 3OQVA 1Z2DA 4KOEC 1BJKA 2PIDA 4WNYA 1P0IA 5AW9A 3AL0C 2GN8A 4HKTA 5CNJA 1VPTA 3G9UA 4D0LB 2B4YA 2PFGA 4AICA 4HDRA 3OLQA 2ZUCA 1UBGA 1E6WA 5FBQB 2J48A 2DFLA 4JQZA 5J63A 4LI0A 1DC6A 3NR2A 1U04A 1H4SA 3VHXA 3L02A 1P80A 4RPIA 3SIRA 4MDYA 1SUDA 1EDBA 3MEKA 1EEHA 3LY7A 5ANRA 3GX1A 3K73O 3DBHA 1H5NA 5IF9A 1YVUA 2PKQP 2VK1A 4Q3OA 5FOTA 1GILA 2DT5A 2GTIA 2QXYA 3EBOA 2X5TA 3NLLA 5CVJA 1LXCA 1XRQA 4KBYA 5BXUA 3HXTA 2PD6A 3KQLA 4N8EA 3ET5A 1S3SA 1JG2A 2HJRA 4WE3A 1F2VA 3L8HA 2ENUA 1WTAA 1IUNA 1P18A 1IBKB 1G5PA 4PIPA 2YN4A 4XH9B 1SXJC 4P4LA 4PINA 3H5VA 4NE7A 4NV1A 3BD8A 1N0HA 5GOTA 4PEVA 1XMIA 1HG0A 2QVGA 5IDXA 4A26A 2JIBA 5EUMA 4GNKA 5AVKA 4UAJA 3TOZA 2NU8B 3AUSA 3TZHA 4UPEA 3KK0A 1HE2A 2XENA 2FP4A 3G9ZA 2V7VA 3LC7O 3RSOA 1CP2A 1OX4B 1XZBA 3ZD7A 5EEHA 2BDUA 4DV5B 1IZ9A 1X1RA 3ONWA 3CQ9A 4H3KB 1E4YA 4WVLA 4EY8A 3CKMA 2OQRA 3RS5A 2CNLA 3MXTA 1GL9B 1XROA 2XPYA 1WB4A 4K6HA 2R17C 2RAVA 1DC8A 3S2IA 2WHQA 1MB2A 4WFQA 5JC8A 4F9EA 4IUDS 1JKJB 4DG5A 1JA9A 4MYCA 3K5HA 2HU7A 3ESQA 4JD5A 4OO3A 4LVCA 2V5FA 2H1LA 1C3JA 2QY7A 3AUKA 4DLNA 1ST2A 3C7CB 4I55A 1G8JA 4O1PA 1ISHA 2DZNA 4DGSA 4P92A 5IAAA 1ZJZA 4JJFA 4TSKA 3IVGA 4JUDX 1RJGA 3U4IA 5JNVA 1W8DA 1M2VA 2L17A 2BM0A 1F7UA 1XRPA 4FDMA 2JANA 1UMBA 3QVJA 2FPIA 4C20A 1OV6A 2XNJA 2HX1A 1J9EA 4XEUA 4UNSA 1WIWA 4GC9A 4FHCA 4NBWA 1B0AA 3C3MA 5AK5A 2V1UA 2IDMA 5JSHA 3R7DA 1Z0FA 1HFJA 1SC6A 3NB0A 4JGGA 1IM5A 2ID7A 4DANA 3K9QO 3USZA 4MRMA 4RPLA 2WTMA 5D3MA 2WHPB 4XB6B 4MB6A 4QAJA 3TSYA 2H2AA 4Q02A 3INNA 1BCSA 1DAMA 5B1SA 4A92A 4LNBA 2SKDA 2NQTA 1J06A 3FMIA 3DBLA 3U7QB 4QAQA 3MWGA 3RVSA 2PWYA 3TCKA 1X1QA 4IMRA 3QF4B 1YCDA 1ISMA 3UANA 3KC2A 4KBFA 2XUAA 4DC0A 2JIPA 2CFZA 1KEUA 4AK9A 3Q75A 4GH5A 1W2GA 1NNUA 2OT3B 3ISJA 1UDWA 4M6WB 1CYEA 1GLGA 1U0JA 5DTMA 4LOJA 1CV2A 3KLBA 5T3UA 4DRYA 2EIJE 3PEYA 1NF8A 1KA9H 3PA8A 2EEPA 1XEAA 1UMDA 2JK1A 4PSAA 4YUXA 4WXEA 1XVLA 2WXJA 4U8YD 5AM0A 3W7BA 3OZTA 3OJWA 4GSYA 4D6XA 2CJFA 1SVKA 5A04A 3G2MA 1H2VC 3ZTTA 5FV4A 1M5UA 3IS3A 4OM8A 1P7ZA 1N2SA 5CLLA 4IZ6A 3HCEA 1LDEA 2XPZA 3KQTA 5TJ9A 3CHQA 2I67A 5IVPA 1MAAA 2EBHX 4L2IA 5ED4A 4OQZA 2R8OA 1XZ8A 3M1AA 1G0OA 2ZWMA 3CGHA 4CKBB 4Z51A 1T4MA 2I3ZA 3SEZA 1NURA 3KEFA 3UB4A 3H87A 2XNDA 2GK7A 1IVYA 1S01A 2WD7A 3E2IA 2CXUA 5AM4A 2R62A 1BU9A 2XJ4A 4ZHQF 1BXRA 2QAGA 2G80A 2R03A 1FFHA 4B3TB 2CFIA 3LK6A 4C05A 3ABZA 3GJ4A 3QY9A 3IILA 4ENSA 5M04A 4QFVA 3O2QB 2R1UA 1I6KA 1Y82A 2IP1A 2EG5A 3PI7A 2NG1A 5I45A 3ZWWA 5AW0A 4FMPA 3RB8A 4ZJUA 4OQ4A 3B85A 2VJDA 1BA2A 2AF4C 3RV4A 2O4UX 2G70A 2FPRA 4K9RA 2M63A 4P7GA 4ZCPA 2WFZA 1JQ3A 2D5IA 4I4IA 2XMCA 5C18A 3S7TA 2ZIAA 1MIOA 5KHAA 4P4TA 4D9GA 3VR1A 1SRRA 3DAYA 1YVEI 3GO4A 4CPDA 2R47A 4I99A 1NVXQ 3PPWA 3AB7A 3GRAA 1EFDN 4KQ6A 2IWRA 3PD0A 2PXXA 4UWFA 1MOSA 2NXJA 5ALEA 3ZYCA 1A5EA 5I01A 4HDKB 4NMHA 3T52A 4MI3A 4GI5A 1DJNA 4LRTB 3UOGA 1UBJS 2WYOA 2L0XA 4OL0A 3UWDA 1SD2A 1P8JA 5E75A 2PJRA 3MXOA 4BMCA 5DCWA 4QFBA 1F0YA 3KTFA 4ZT3A 1XYVA 2PJZA 5BNWA 3R77A 1CR4A 4DF3A 1XXLA 2C9MA 4JI7B 5F33A 5ENRD 4L9RA 4DSOA 4EJFA 4OB6A 3OPXA 3PE4A 4YMVA 1SG6A 4JLSA 2ZSDA 4CUJA 1Z82A 1TAGA 2B0JA 1N52A 4IXTA 1TZKA 4WKBA 2HSZA 4G5SA 2PX5A 4JKOA 1K7SN 3VPAA 2JVJA 4XDZA 1XC7A 1FFDA 1C0LA 3MA0A 3D7NA 3SXUA 4E5PA 5JNSA 4FMCF 1RAIA 4DKXA 2QENA 2AI2A 4BEJA 4CR7A 4XJXA 2YTZA 4Y2XA 1FF9A 4AC9A 3RDPA 4X8QA 3JRNA 4F5ZA 5A3QA 4Z2AA 4ZQHA 2PRZA 2P68A 1K75A 2V7TA 2PUVA 1V0JA 4AROA 2KM1A 1FX0B 4ITRC 1TZBA 2X9GA 4YI3A 1NIJA 4WXPA 2W2LD 4UAVA 5JXWA 4RM2A 2IXAA 1LJ8A 3RASA 3HL4A 1OPXA 4MWGA 4Z9FA 5C31A 3O8QA 3D5TA 3CC8A 5DK4A 2C4MA 3DZGA 4G0OA 5K3DA 5D2CA 1C1YA 2YNMD 3BQMB 3PX7A 4OYRA 2AT1A 1FFWA 1YZQA 4EHHA 4IWXA 4ENVA 2COEA 3I3SR 4IIJB 1CHNA 3KYIB 3PHLA 2O2IA 2PLAA 1QNFA 4IIFA 2Q3EA 3ICOA 1HEYA 2Y0CA 5HOQA 1IYZA 2R6JA 4JBNA 3ZS9A 4KDCA 1VKHA 4GD3Q 1XZFA 1W30A 2ORYA 1MC8A 3OZFA 3IAS1 4JI5B 4CTKA 4Q05A 4XQCA 2W2MA 2O48X 3AC0A 2G4LA 2ORVA 2I33A 3VKVA 1I3LA 1RYZA 2VGYA 1CIVA 4MQUA 4K5BA 1GLVA 5DM2A 1V8FA 4BO9A 3WRXA 1GNVA 4N54A 4K9LA 4EHLA 2FEKA 2PCLA 1L5JA 2ZJ0A 3O8RA 2RC5A 1R8SA 5ECDA 3F7TA 1WVMA 3KP1A 1YAJA 2ODAA 3OCZA 5EMJA 5SYAA 1F3LA 5DM0A 2R5SA 1U8CB 1Z2EA 3TQSA 1H4TA 1SD5A 4XAQA 3ITDA 5LDHA 4PHCA 1ARZA 2D7JA 4BC1A 2K2WA 2WNSA 3DC7A 4U8VD 4QATA 5HA5A 3OICA 4L6AA 2HIMA 5EHIA 5IULC 2QJTA 4RA6A 1GUBA 3W4JA 4AZ3A 3KT8A 2P69A 2WTUA 1NZFA 2QLMA 2HJSA 2A4KA 4CIWA 1SVIA 1LS1A 4FWIB 5GZ1A 4UVHA 1QIDA 4HAWA 4I1MA 3PRZA 5HM8A 4OKSA 2BI8A 4PCUA 4MUXA 4RULA 3HLKA 5LP6C 4KK3A 3ZJ5A 3FUFA 2HK9A 4DILA 3KOXA 2PMCA 5L3VA 4X5OA 5G0UA 2O2YA 2ZZNA 1XK6A 2GKOA 2IOQA 5K6AC 1FFEA 1YE5A 3DGFC 3BD6A 4MPJA 2CLSA 1F8XA 2VP0A 4INAA 1TJ5A 3AOEA 1A04A 4BUJA 4NYIR 2FJDB 4KZ0A 4OQXA 2WPDA 5MN4A 2HV8A 2IU1A 4ETWA 5KTPA 5JYCA 4OYSA 5IVKA 2JF0A 3L6OO 4JBWA 4X20A 3Q9NA 2JI8A 1NVWQ 2GW1A 1DXOA 6CHYA 1KZ9A 1PW7A 2UY1A 3IMKA 5J43A 4Y2UA 4YUWA 2VGXA 4C7OB 1GQSA 4ZGWA 3GJYA 1HLFA 5JROA 3BCSA 4ND7A 3LTEA 4QO8A 4ZVNA 4M8SA 3RSGA 4AB1A 4RPJA 2GEKA 1IY8A 5FWYB 1EFHA 3BEOA 3VBEA 1RVDA 4GHWA 3HRKA 3QARA 3AVVA 1KK0A 2BFDB 3L7MA 1SU6A 2OCAA 4FBLA 4RHCA 4S0ZA 3S8YA 3VMFA 3G5AA 4ZKDA 2OECA 2EL7A 2EBUA 2HA7A 3Q9SA 4F8JA 1IEWA 1HOTA 3SEQA 3ZVKA 3E9ZA 2QTBA 1PLJA 2NSLA 1T8WA 5I7UA 2HRCA 5IFLA 4Y6SA 1OXBB 4D9JA 4KQ2A 1LDBA 3KETA 1WSBA 3ZZUA 1QTQA 4JHRA 5CCDA 1TUGA 3DF7A 2WF5A 3Q7TA 5EJ4A 3WL5A 1YB6A 2Q3JA 4ZRDA 4XPIA 3FWHA 3UJAA 4E4TA 1F38A 3MM4A 3C1UA 3EWIA 4XASA 5KNLA 5FLKA 1E9SA 2VDWA 3GVXA 4QDUA 2QR5A 3HN2A 1AHIA 1P2DA 5HBGA 3UTDA 3WSTA 2CJPA 2NO4A 1M1YE 3UIPC 4LBVA 1T15A 4LAFA 5K0FA 2DBZA 4NFYA 3VZCA 3UXYA 1HE3A 3FYTA 1DEXA 3ECSA 1GPAA 4NNPA 1KDPA 2GZ3A 2ID8A 3BSSA 1Q0RA 2QKYA 1CETA 3AH8A 1X14A 1O97D 3EC7A 2F1HA 4PBTA 2Q4BA 1NR5A 3OZVA 2H5IA 5B3JA 1I1HA 4M0PA 3WWOA 3VDRA 4CL8A 3SVZA 4D4KA 3ZY4A 3S2UA 4NOJA 3ON5A 2YWGA 3ZHXA 2JHPA 1Q77A 1J00A 4AJHA 1HFEL 3DFIA 1XNFA 1TNBA 2IYEA 4N48A 4ICIA 3QHAA 1E9DA 2QMUA 1I4LD 2H6GA 5IT5A 4L23A 1CXZA 3O47A 4S04A 3COWA 3M2PA 1U11A 2JG3A 4AJIA 1M1NB 4O0MA 2UUPA 2IZ5A 1TU4A 4PRYA 4XPZA 1XRSB 2QQ0A 2A94A 1V71A 1B93A 3L0PA 2HDHA 3R3XA 5ENQD 1F17A 2DWPA 2HTEA 3UC9A 3EH1A 2WSSA 3DM5A 2P2GA 4W5JA 4JC0A 2YFHA 1AZTA 1GGHA 3U39A 1FP4A 1EFKA 1EXNA 4IH4A 4BEWA 4B6OA 5WRFA 2CEAA 3H1TA 2E4UA 3T9FA 4BQEA 1NRJB 4FYWA 3ETGA 1MJGA 5B7GA 2BE7A 3VPXA 3RYFA 3NH9A 4J6EA 4RD0A 3DE2X 3ANTA 4ZQFA 3FPFA 2JLUA 1V55E 2LKCA 4EG6A 3IGFA 5H70A 3DKKA 5K0EA 4M9SA 2FQXA 3BB4A 3WE7A 4TLBA 2XMSA 1NJ2A 4MGIR 1BQEA 3ZV7A 3IP8A 2X1HA 1CY8A 4LFAB 4D9KA 1YO6A 1IE3A 2HLHA 4RE5A 3AHDA 4LYAA 5KYYB 3MRVA 5JSQA 5IT4A 2YN2A 1D5CA 3LZ6A 4YP6A 3FTDA 1GUDA 4IHKA 4IIVA 2NUPB 3AETB 2CGEA 4DBVO 5ILQA 1W8IA 2Y1DA 4Z9BA 2Q4RA 4Q9LA 4G8KA 5AW6A 1OLSA 3IESA 1HS6A 3ZW3A 4Q9AA 2X0DA 1QH9A 2J1LA 2HPZA 3GEPA 4MMXB 5LQSA 4N0MA 2Y1FA 3NVMB 4IXMA 4RY0A 2IP2A 4EVSA 1EPUA 3ZGVA 2VJQA 3C6KA 3PX2A 4KGZA 1BN6A 3Q3CA 2QMQA 4BN0A 3FBTA 1J1IA 3QMVA 4X7PA 2YZ7A 5K99A 4PQRA 1Z0KA 1BAPA 4HDMB 4JVSA 4B6SA 2B36A 1RMYA 4XD2A 4D41A 2J5RA 4BY9E 2UYQA 1GD1O 5KS2A 3CKKA 1XEXA 5A4IS 1EEXB 4QYTA 1HY3A 2ZDQA 3NV7A 2XUGA 2Q9CA 4Z9XA 1914A 3MA5A 4ER6A 2R7AA 1SC1A 3L6CA 2GTPA 3RKRA 4TTTS 2ZXEA 1Z4QA 1QKKA 1L1EA 1L8QA 1TXGA 1D2MA 3L8YA 3PIRA 4AECA 3HJFA 2VOJA 3LW7A 4BNDB 5KNCA 3K8OE 3D9NA 3JQ7B 4HBGA 1FRNA 5ENSD 4N49A 2JKVA 1J8FA 2DFTA 4PYNA 4N1AA 2NZUG 3NBFA 1SUBA 2OXFA 3ZXSA 3WX0A 5AK3A 4MYUA 4F0JA 1TZCA 4MYDA 3R9XB 1ZMBA 4IBOA 4BT8A 1SK8A 4R0MA 2NQ8A 4XUEA 2E4ZA 1GPWB 2IDKA 2Y76A 4ERXA 3IODA 4PR0A 3IVXA 3AUXA 2HREA 4MP8A 5BN3B 3SD7A 3CW2A 1BFKA 2FR0A 3N5CA 4I1AA 4E09A 4KRYA 4V3IA 3W3AD 3ZEFA 1N1DA 4D4LA 4REQB 5DHSA 1F0NA 2H6EA 2Q1WA 4MPRA 4H6PA 2G63A 1AU9A 2XRFA 1PFYA 3W6PA 1DWQA 1SVXA 1D4FA 2Y2UA 2QLLA 2WSBA 1VL5A 1Z5SC 1M2EA 3E70C 3A3YA 1ZJWA 2HHCA 4IJKA 1YE3A 4R8KA 3SJUA 4RKFA 3WGZA 5D01A 1AKTA 1AXRA 1I1NA 2JBHA 4ZVUA 5JMND 1KJZA 1G6KA 3RKVA 4PO1A 2RGYA 1GGMA 1SHUX 1AURA 3W5AA 2UYYA 3K0HA 2QL9A 4DQLA 3CRVA 2PWZA 2FPOA 5ARGA 2FY8A 2HU8A 3KYCB 3H13A 2Q2WA 3MWEA 2PUBA 4UHJA 1RMQA 4DTCA 5FQ6A 3ZXIA 4S3MA 3CM0A 5J2UB 3O5AA 4Q96A 1NBMA 1UKAA 1P7CA 1G5FA 3IPCA 4NBLA 1FVFA 1ZMRA 3CRNA 1QHFA 3QX9A 3R1IA 1LW6E 5C46F 2XSZD 5BVGB 4K86A 2XHZA 2OHHA 3E3LA 1KYTA 4QICA 2PWAA 2E21A 3ME5A 2GN6A 2NUTA 5KOJB 2HDOA 3BZUA 5HR5A 3HCOA 2WM9B 1BX3A 1CLEA 1ODFA 3N70A 2GJSA 4BQFA 5IPFA 1T36A 2XNHA 3CVPA 2FPSA 4P36A 2NU7B 2NVUB 2ZU0C 1NVGA 2WI8A 5LOVF 5JEEA 4OHUA 5KJLA 4DA0A 4CLHA 2G1KA 3K4QA 2AG1A 4P54A 3EMBA 3FYUC 3KB2A 3KV3O 2G9UA 5FR1A 3JPWA 2YC2C 4NBNA 3WJ1A 4EHBA 1H2TC 4KGDA 1ULSA 5BNTA 1W44A 3SK0A 3K32A 2E55A 3VU9B 4NOKA 3GGJA 2ZYSA 3LZDA 4JCCA 1Q17A 4TYQA 1V41E 1IN5A 1XD2B 3QKYA 2W0SA 3RTDA 4L5CA 1HEIA 4GAAA 2PSEA 2OQVA 4QRHA 1EDOA 2IYZA 2XBMA 1GXSB 1XFDA 4G0MA 2GCOB 3TZQA 4EA7A 3SDSA 2EQAA 3VQTA 3W6OA 2WAMA 4YHHB 5JR3A 1W36C 4K9DA 2LXLA 5EP3A 3PDWA 3LLVA 3TWOA 1Y8RB 4RENA 4JP5A 2WYWA 2B1RA 1UC8A 4ND2A 5F7JA 4BQOA 4JP8A 1O77A 2AC4A 4G25A 5IJZA 1VSUA 3IA2A 5HRYA 3TINA 4WADA 4E11A 4GTOA 3I6QA 3QELB 3DVAA 3JARB 4NBKA 1AH2A 2CXHA 5FCDA 1SU8A 5CIQA 1RJWA 1J2TA 3COPA 1Y9ZA 2ZSJA 2JLXA 3DEKA 5KJ1A 1OHHA 2PRJA 3ONKA 2Q0XA 1EUDA 1O6ZA 4ZANA 1A97A 5AVZA 1QYXA 5EPOA 2PS1A 3ANXA 3T5CA 4AXXA 2LIPA 1ENPA 2G7MC 2H5LA 1T5BA 5JYDA 2JHAA 3LBYA 4A1GA 3SZGA 2FWBA 3C8ZA 3HMKA 3EXHA 2X6KA 1UAYA 1MC4A 3ISMC 1GTJ1 4JJIA 3D9JA 3CNBA 4JL6A 2VJNA 4HVTA 3TW8A 1VFPA 1G19A 3ZXYA 5C3UA 1DVPA 4MPDA 5I7WA 2B9EA 3HM9A 1PJQA 3KQYA 2C54A 2Q9BA 4L4YA 3FTEA 3LUBA 4I6JA 5DXAA 2LIVA 2OWDA 1E32A 3EWAA 5IKEA 3M9XA 1SBQA 1N4PA 5FA8A 1L8LA 3Q8KA 3FHTA 1TNYA 4W99A 4A2QA 2O7QA 1U1EA 1JSLA 6ABPA 5BWNA 5JDIA 3PF8A 3P2JA 2IYTA 3L7NA 1X3LA 2IVZA 4CWAA 4JSTA 3G23A 4B9AA 1PFVA 4UMVA 1S7CA 1PF7E 3RUFA 2VC2B 4YDQA 3B5EA 3CVNA 3N6XA 4DCTA 5ILGA 3GFPA 3WRYC 2G76A 1DBSA 3GCGA 4N0PA 2Y67A 1W6RA 4B80A 4DQKA 4LEIA 4X1YA 3CF4A 3DC2A 2DK6A 1TJ4A 2ZJ5A 1A8HA 3PT5A 4EX6A 3V4FA 1QGAA 3FNRA 4FOSA 1P1CA 3B2EA 4PO9A 1RM4A 2EW2A 3ROXA 2HNAA 2BEVA 1NXWA 1KC1A 2H5JA 1JLLA 2GR9A 3SYTA 5EQJB 1C4KA 3D6AA 1DDGA 2KCKA 4C0BA 2PGLA 4EKIA 4ARAA 5MF6A 1V8BA 5DBOA 2QZ4A 1UJRA 2WJ4A 4JLOA 2IUTA 4RQBA 4EYGA 3DE3X 5IRCD 3IQHX 3MWLA 1ODKA 4DMLA 4ENTA 1WUIS 3AF3A 2JKYA 1T9CA 4TQGA 3EVCA 3A05A 4A0QA 1GGJA 2WFMA 1Y5LA 2F43A 4H27A 4PPQA 4C5AA 2W4MA 2E6UX 3TIIA 3UJCA 2J87A 4UQLA 4BPRA 4EPWA 2XD4A 4I4TA 4R0VA 4QUBA 3RJVA 4M36A 1BGVA 1BYIA 1QAQA 3UKRG 4KIFA 4XQGA 1F7VA 4AYWA 5EFZA 4BE4A 5T3RA 4ZEVA 5CA0B 3INGA 4N3AA 1Q3HA 1N6IA 3IHWA 2JATA 2VHXA 4UHCA 3D9PA 1AQ6A 5D6NA 3OHPA 5AJTA 5IP5A 4EMBA 1HH4A 1GYRA 1EUZA 1ABBA 4IKOA 3T8KA 2I2FA 4XUDA 4DBZA 2VHUA 3PCRB 3EU9A 2B8WA 2BR4A 5AOCA 4FLFA 3BXPA 1JDVA 4J0GA 3UT8A 3IPRA 1MRSA 3EFOA 3CR8A 4DBLC 2RHTA 2RKKA 3FUTA 2C2KA 2ASEA 2JFGA 4FEYA 4UEJA 4PQFA 2WVIA 4FGWA 1WXEA 1Y1TA 4CI0B 3UB3A 2IEJA 3A37A 3A1VA 3OMSA 2QI9F 1HSOA 3TCNA 4LIPD 1RWMA 2L42A 4ZI2A 2PSHA 1H4VB 3ZGLA 1K0FA 1TT5A 1H3EA 3N6VA 1TC2A 1ZK0A 5KVAA 4YC7A 1VJ5A 5EMNA 4OYYA 3GLGB 1ISFA 4KDFA 1JH9A 4BO2A 4NCXA 2IE8A 2WXMA 1XRLA 1G0NA 2VNIA 1FMLA 2ALJA 4PNPA 3EVZA 2GEJA 5DEIA 4YRRA 4N9WA 2WJPA 2GBGA 1E2BA 3QAQA 1X7YB 1JWFA 2Q5LA 3RSLA 4EJSC 3BREA 1RPZA 2B0OE 5LBIA 3V7YA 3B3AA 4HZUA 1TTPB 2C2HA 4HEA6 1QJ4A 1IHOA 2YOHA 2IP4A 1WHTA 3EHEA 4R3UC 2XS8A 2V74B 2NO0A 2FQQA 3EVGA 4JI1B 1OH8A 3R3SA 1YJ5A 1LI5A 3WLPA 4X64B 3T94A 3I9NA 1JEQB 3K9HA 3MRTA 3FSJX 4M0FA 2FFAA 3O4RA 2N47A 3KBBA 4Z7QB 1FJGB 3PRJA 3QBVA 2F2TA 3GIWA 3QYAA 1P60A 4RJKA 2DWOA 3EVEA 4OGWA 1V39A 3QITA 2K7FA 2VRBA 5CBPB 3QXGA 3H0EA 3B6ZA 1FCHA 1SQ0A 2AUMA 2P27A 2BI4A 5IVHA 4WD3A 5JDCC 4YRZA 1THTA 2B8JA 1XYYA 1Y1RA 2JAPA 5LXTF 4CMHA 1D8DA 4DLTA 1ZJ5A 4NCBA 3TQCA 1QF6A 1XP5A 2KCVA 2ZBFA 3FFTA 1IIRA 3A7EA 2ZI9A 1OLXB 5CEFA 5B7QA 2FZGA 3QWPA 1ZBPA 3QDNA 1MNAA 2B30A 4PU0A 5K3FA 1T2FA 2X8AA 3GLKA 3LL7A 4PX2A 3E81A 5T4YA 3CO0S 5G04J 2AYXA 2INGX 1NQAO 2QJOA 3ZHTA 1GGKA 4FKBA 2WVAA 3U37A 3H2KA 3DMNA 5TQ0B 3PHJA 2ZRJA 3DTNA 1JU3A 1N5KA 1OFHA 4P4SA 1YI8A 4L78A 1VL2A 2XXAA 1FPPA 2B7BA 4ZU6X 4CL3A 4ALIA 3KSZO 1ZPDA 2PVPA 3FSRA 1DKUA 4IUYA 3TWSA 5FO0A 2O0MA 3GG2A 3JYNA 1ZOLA 1N6LA 3Q8MA 3GI1A 1OLUB 4UHKA 3WK8A 1DB3A 4F4FA 1P6XA 3CHRA 4U3JB 1JAHA 1HNZB 1VE6A 4HLDA 4A0RA 1JDNA 3HP7A 5IK2A 4JYPA 3QVOA 4YIKA 4NPHA 5I7AA 3UZUA 5DKFA 5JY1A 5LX8A 1X9GA 3ESDA 4KN6A 2X4DA 4EA6A 1H9AA 2PKEA 4IRMA 4WLOA 1QFMA 1Z7WA 2X7XA 3FFLA 4BMNA 3EDCA 4M22A 2HTFA 1KDZA 2NACA 3QHPA 4LY6A 3QLEA 3I34X 5AJDA 4II2A 4TTSA 5KX5B 2X5JO 2YV5A 3RVMA 1ESDA 3QPWA 3FU5A 1ZONA 4BP9A 3CEAA 5AJXA 3R9IA 2NV6A 4OX9Y 3DUFA 2JAHA 3QPVA 1ZUIA 1IWPB 3KEQA 1PU2A 3WKBA 4F9GA 3BRWA 4WEQA 4CDMA 4PWZA 1KZ6A 3KLPX 4BX3A 1RZ3A 4PXAA 4NCHA 1KI6A 4WGGA 5BWMA 3W8EA 4HXFB 4DG9A 4A6DA 1ZJ6A 3D81A 4DQXA 1OI4A 2G40A 3Q7RA 3FP3A 2BKEA 3VO8A 3QEMA 4GYWA 1NR1A 3GMDA 2A6PA 4P3KA 4ZRNA 4NBTA 3D1LA 4AJWA 2WMYA 1A7UA 3K0AB 2PQ2A 2ZU6A 4RO0A 4DCPA 2R6GA 4KO8A 3OQHA 5CIWA 3PHCA 1Z7EA 5KBYA 2OCIA 1T9GR 2HEIA 4RF5A 1OTHA 5H02A 4RA9A 4C4OA 1FDSA 3UAOA 1ZM2A 1SUFA 5KNBD 5CECB 4DLVA 5JXHA 5C37A 1HTTA 3DYVA 1L2TA 3VAZA 4JHJA 3D3WA 1UJ2A 4R54A 3FUCA 4CMGA 1RC8A 3OURA 1QDEA 3M0EA 3BZWA 4Y2PA 2YWEA 2I6TA 1XZHA 3PGMA 2C88A 4B3HA 1FU7A 2P3LA 3I37X 3PUKA 5JZOA 4P6VF 4JT2A 4GRAA 5BSTA 3JQCA 5K0JA 1F6BA 2GSDA 4V24A 4RQUA 4PRLA 2J4FA 5LDGA 4BUZA 2L0TB 4K05A 3IBSA 4XRGA 5D1HA 3F2VA 2GHQA 2PMWB 3GT3A 3CN9A 1G21B 1R00A 4HWOA 1O94D 1SK9A 1OCOE 3ESBA 1PWZA 4KQWA 4AL4A 2R59A 4GR9A 1GKLA 5BUZA 4JLBA 5F5LA 1I33A 3FLBA 3KQHA 4RL4A 1MHTA 1LK0A 4ARIA 1G8YA 1DV1A 2GKSA 4DJTA 1OXKB 5FBKA 4RXMA 3KEAA 4Q3KA 3NW9A 2D5LA 2RGBA 1UAGA 2XEHA 2QMHA 1P5JA 3E48A 1JQKA 1TX4B 4N41A 4NCAA 3DONA 4QEDA 4LG6A 1M67A 1YCSB 5EYLA 4Z1MD 1PAUA 1HX8A 4KDRA 1UG3A 1GU7A 3NHKA 5EIDA 1OCZE 3R76A 4K5CA 3MT7A 1G2IA 3IR5A 4DC9A 4W6ZA 1YV9A 4NHOA 3L18A 3M3HA 2XDWA 4MUMA 3TL3A 3TAUA 4ZVMA 2AMYA 1ZWKA 5FHRA 3Q12A 1KDRA 3BMCA 5A5GA 5CNKA 3TLMA 3IJPA 1XDBA 2BHLA 1H6OA 1UUFA 3BEEA 5TMBA 1FFGA 4BMSA 1V9LA 1VLQA 1BX1A 4JR2A 5AI5A 4DADA 4DV2B 2OMEA 2D7CA 5FQ7A 1E8YA 2JJ2D 3S5JA 2C8KA 3EUAA 4YP5A 3DOEA 2QRJA 2W6PA 2RJ3A 1UK9A 4RQTA 1KYIA 1SELA 3T35A 2FZ5A 4REMA 2CNBA 3B1ZA 3TZLA 1Z75A 3GPBA 5IMBA 1KOLA 2G0TA 3P32A 2H65A 3ROQA 2D8AA 5ER9A 4KUEA 1PJ3A 3V1KA 4GZLA 1Q95A 1GSAA 5FA5A 3U31A 3UGKA 1NIPA 1C0KA 4IMIB 2HDNB 5JXIA 5CLQA 3B7UX 1M33A 3O82A 1LPAB 1E62A 4CQMA 1PVVA 5A7DB 2AYYA 1PT6A 3HZZA 4UQOA 1ZG3A 5FI0B 3P2YA 3L0YA 3OUUA 2YVKA 1N9ZA 3FLMA 1JA1A 2VAXA 4LF4B 1R8JA 4GOND 1YQQA 5B57C 4C3VA 4WNGA 1FQWA 1XJCA 4KZKA 4NDAA 4GQBA 4ITVA 2C2OA 1Y7HA 2WQ7A 3P0HA 3RS3A 4DXAA 3RU9A 4B44A 1MMFB 3MG9A 1XDZA 4KW7A 4B79A 3ILYA 4M0LA 3RVNA 5T6MA 2ZR0A 1I2CA 1AS3A 4BNXA 2EZTA 2Q46A 2DKOA 3E9MA 3D6TB 1L9XA 2HU2A 2QTTA 4HGZA 3T3HA 5EXEA 4FUTA 4WSOA 3E23A 4FFPA 3OTNA 4CM9D 1U63A 4JYZA 3QI7A 4XDYA 1MJ0A 3OAWA 3U1VA 3T61A 4U7JA 4JU8A 2WINI 1XPJA 2XMPA 1GZ5A 4H7DA 3V8RA 3IE2A 4QOIA 3PZRA 4PAMA 3CHPA 4NDNE 2P3QA 3CR3A 1BEZA 4XCXA 4KEAA 1L4FA 1PY1A 4DSAA 3WBBA 3SF8A 1PTKA 2D4AA 3LL4A 3PJRA 5GJBA 4KPUA 1YA0A 2BTQB 4ND6A 2XTZA 2YBDA 1RABA 2WHRA 2DWZA 1AGRA 3VCXA 4DMGA 5CFQA 4N47A 3KJGA 1NMZA 3PFCA 4E1BA 4YMUA 2RE8A 1KWGA 4HB2A 4YJFB 3I83A 3DS8A 3GQBB 1BA3A 3N71A 4RLFA 3UFXB 4XYBA 4FONA 3FTXA 3BKWA 1YC5A 3TTSA 1HF8A 1VJTA 3L41A 2QE7D 3VPSA 1TN8A 1R0KA 4IIUA 3K9GA 5FBVB 3GXBA 1V8PA 3DMRA 5EA2A 5AQ7A 1ZMXA 1WXDA 4OQQA 2HXSA 4URUR 1G41A 2D0DA 1YA8A 1CZLA 2FZCA 2B1IA 1WF3A 4DPMA 5F2OA 1Z0SA 2H4HA 4O2AB 4Q1BA 3L8MA 1J0BA 4MR9A 4RV4A 4S1PA 4WK0B 3PQ2A 1U2DA 4C29A 2ANBA 3H5WA 1ZIOA 5TJHA 2AVDA 4TUMA 5B3SE 2FO1E 1QO7A 2JJ1A 3GYZA 4DG8A 1T5SA 1MC1A 4J43A 1WETA 5JHHB 2A7QA 3HDGA 3X1ZA 5DLQC 1GCAA 4DHWA 2O7SA 4GM0A 3HEBA 2F8YA 3GYXB 2FPGB 3K5WA 3JQ6A 5FPSA 4B89A 2HF7A 3DXZA 4E2ZA 3QTTA 2IWHA 4HK4A 2BV3A 1EFVA 4BWYA 4E88A 2XB6A 2WW8A 2VLIA 3UV7A 5JZBA 3R3ZA 4FE3A 3B6MA 3VU0A 1GEGA 1LLUA 4JJ6A 1LSOA 3VKFA 1M2GA 1O5MA 3G0OA 1M8GA 5KJKA 3K0CA 5EJGA 1EAYA 2PU7A 4DR1B 4HI9A 5A9TA 3BA1A 3ADCA 3HYRA 3GJ3A 3CTPA 4D9EA 1KIFA 2PUGA 4RJJA 3KJHA 4ETMA 4E5MA 1QUFA 3V32A 1OH5A 2R6DA 1N5DA 2LDBA 2VSXA 2I4IA 4YJKA 1UP4A 3MQ4A 2R25B 4Z0HO 1OFVA 4UBKA 1CT9A 4OBWA 2L19A 1IHDA 1XR3A 3X1YA 3NC0C 4B32A 3MB5A 4CKXA 3RVOA 4GTVA 4GRIA 4TYNA 4WUYA 2ETBA 5CT9A 3RCBA 1KO4A 3LCJA 3R7RA 3LPNA 3LBNA