5BNWA

The active site of o-glcnac transferase imposes constraints on substrate sequence
Total Genus 280
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
280
sequence length
715
structure length
694
Chain Sequence
PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDIYDNRIVLNGIDLKAFLDSLPDVKIVKMKNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title The active site of O-GlcNAc transferase imposes constraints on substrate sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 280
structure length 694
sequence length 715
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5bnwA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5bnwA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 5bnwA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 5bnwA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5bnwA03
1WUTA 3RO2A 2R4UA 1H5UA 1P4GA 1M5RA 1SXPA 3CK8A 2H1HA 4KBQA 2VQ2A 2ACWA 3CK7A 3PE4A 4LDPA 4I1AA 4NQ0A 5TMDA 3CUVA 3UQ3A 5FT9A 5JJ6A 5ENZA 3NCHA 3OY2A 4RIEA 4MHOA 1QKJA 1UQUA 2C1ZA 3RSZA 1B4DA 2FF4A 4HOTA 2QRHA 3IA7A 1GFZA 1QQEA 4J8FA 2QFCA 2GPAA 3TAXA 5KJLA 3VTYA 3MT7A 3K9IA 5JTUA 1ELRA 2QN9A 3ZCTA 9GPBA 5TMBA 3OXFA 4NESA 4MRAA 1GPBA 3UUXA 5BW8C 1QZ2A 2ACVA 5EKQD 4GPBA 1Z6QA 1B89A 3JYSA 3WC4A 4GCNA 1FU8A 4I17A 3CKCA 4JA7A 2G9UA 5TMEA 1Z62A 3MS4A 1EM6A 5AYWD 1E96B 4EKEA 3CVPA 2C2LA 1Y8MA 4XIFA 3AMVA 1FU4A 3UYKA 3ZHEB 1FTYA 2ECPA 4U04A 2R66A 1C8KA 3MQFA 1FS4A 4CDRA 5FJYA 1GPAA 4UI9K 2UY1B 3BEEA 2IF4A 2C0MA 3Q47B 2IUYA 1IXYA 3OTIA 4KXKB 2GPBA 2LNIA 3Q5MA 4AIFA 3UPVA 3CVQA 3ASFA 3EBOA 3DD1A 3S7DA 1C3JA 4N2SA 1K06A 3L01A 3MTAA 2AVPA 3CUWA 2XCIA 3Q15A 4BQFA 5IKPA 1W3BA 4HWGA 1PC2A 4F9FA 2YHCA 2PYDA 4FKZA 4B94A 4O6FA 1WAO1 3CEJA 4U0SA 2ZB2A 3BD6A 1IYGA 2QN3A 2PQ6A 4G2TA 4L22A 2P6PA 4CGVA 1NLMA 3MTBA 2QRPA 4RIFA 3TGOA 3BCSA 2OFFA 1GGNA 2PRJA 5HQ8A 2XPIA 3OY7A 3ASDA 3ESKA 2C0LA 3QDNA 3T7DA 1XC7A 3KD7A 4UI9J 3ZCRA 3MTDA 2FETA 4BWRA 2PL2A 2XA2A 1P2BA 2KC7A 4W6QA 3OXGA 2QLNA 2I6HA 3ASHA 1NOIA 5LCWC 3H4TA 4YUAA 7GPBA 3OKCA 2FI7A 4JL0A 3RJVA 3VUFA 1SXQA 4PQGA 1P2GA 4U0ZA 2XA9A 2VGYA 2XCCA 3OTHA 3VDNB 4X7PA 3S29A 3ZCVA 3ZCPA 4H7YA 4XI9A 3C4QA 3Q4AB 3BCUA 2Q7FA 2C9ZA 3HYMB 1LWNA 3E4BA 3IEGA 3ZFWA 4AY6A 5FTPA 4RIIA 1A8IA 2XCBA 3QHPA 3ZCSA 4W9RA 2BFWA 1HZ4A 2XEVA 1P29A 3MKRA 2F3UA 2BUGA 4G25A 2LSUA 3WXXA 4BQEA 5CCMA 4GZ5A 2R5SA 2AMVA 3DZCA 2BGTA 1WW3A 1L5VA 3AS4A 3O3CA 4X7RA 3Q3EA 4M7PA 3CUUA 2ONDA 4N3AA 3ULQA 4Y6CA 2SKDA 2Q6VA 3BEOA 4HOUA 3T3IA 1HLFA 4UQZA 4J8DA 2IEGA 3NP9A 1Y8ZA 4GA1A 3CVLA 5D0OD 1KTIA 3L7DA 2IYAA 3CEMA 3D1JA 4GA2A 3TG5A 3U3WA 4WUYA 1JIVA 4KQ2A 1RZVA 1JG6A 2JZCA 2XMPA 4F97A 3TOVA 3RSCA 1C8LA 2QNBA 3OKPA 3NP7A 3WADA 4N3CA 2KCVA 2GT1A 1L7XA 2IV7A 2MHKA 2VGXA 5ARGA 1FC0A 3EBPA 2QN8A 3OT5A 4YNDA 3T5TA 1WM5A 3MA5A 2FO7A 4I9EA 2BGUA 4AM9A 2GEKA 2FFRA 2QRMA 2GW1A 5DBKA 3D0RA 2P58C 1P4JA 2F3SA 1IIRA 4GYYA 4BQIA 2IFUA 4U07A 5G05J 2AZDA 2YJNA 4AN4A 1UZUA 2PZIA 4CTOA 2UWJG 3CUYA 3CUTA 4RENA 1P4HA 3G2NA 4N5CA 3Q49B 4GCOA 3S7FA 1PNVA 1XL1A 1GG8A 2VCHA 4JA9A 4Z5XA 3LPZA 1L6IA 3O48A 2PQNA 2XGOA 3HBFA 4LEUA 4J0UA 3N71A 3ZCQA 2C4MA 2QLMA 4RIHA 1JIXA 5FZSA 3OKAA 4YI3A 2X6RA 3SYMA 1L5SA 2NC9A 4F3VA 2GM9A 2V5FA 1Y6FA 2GEJA 3MRTA 2PYIA 4RIGA 3AS5A 3D0QA 2O6LA 4CTMA 4EKYA 1NVKA 3MSCA 4REMA 3S28A 3TG4A 5D01A 4MICA 3L7CA 3PE3A 4MI3A 4GYOA 3OXLA 3FWVA 4KYOB 1JEJA 2G9VA 5BNWA 3UYLA 2QZSA 4UI9C 1Z8DA 2X6QA 3MS7A 5FZRA 2XGSA 5BT1A 5HI7A 2OOEA 1ZBPA 1L5RA 1NOKA 5DIZA 1GPYA 3CK9A 4EJ2A 4G24A 1PN3A 2JLBA 1EXVA 2F3PA 4WNGA 3AS8A 3CV0A 2R68A 6GPBA 4RG9A 4WHMA 5HXAA 2IYFA 4YI5A 2QN1A 2KCKA 3COPA 1YA0A 3LKUA 1WV0A 3LY8A 2ATIA 3OTGA 4AY5A 4MHSA 1IHGA 2ASVA 3IAAA 2WQHA 2X0DA 3RIBA 3RHZA 3C48A 2KS6A 3MRVA 5GPBA 5TVGA 3QOUA 3T3DA 4EQFA 1BX3A 1QM5A 3T3HA 3CKBA 4HOQA 3RO3A 4WNEA 1XV5A 3QKWA 3L7AA 3NPAA 3LCAA 3S0JA 3CV3A 5FZQA 3E3NA 2HR2A 1RZUA 2VCEA 5C1DA 3ZCUA 1NOJA 3VTXA 3MT9A 2F3QA 3PDNA 5DU2A 2X0EA 3L79A 1C50A 3KAEA 2KATA 1WW2A 3T3GA 5G04C 4XI0A 4BT8A 2WPVA 3NAZA 1KLXA 3SF4A 1P5QA 2VYIA 5G04J 2HO1A 4GPKA 1RRVA 2FF5A 4Y6WA 4GZ6A 4NEQA 4X6LA 2SKCA 2JJMA 5KJKA 1JIUA 2VSYA 2F9FA 2QN7A 3FROA 2L6JA 4WNFA 1LWOA 2AW3A 2QRQA 3FP3A 3MRXA 3MT8A 2QLLA 3E3OA 2PQRA 4BTAA 3GYZA 1Y6GA 1V4VA 2IW1A 3G2HA 1PSWA 1OUVA 1XKXA 4AMGA 4WNDA 5CHEE 1FA9A 3NC4A 4WADA 3QWWA 1YGPA 2SKEA 4RBNA 3RU0A 3S27A 4ABNA 3BDAA 1FU7A 4MI9A 2AV6A 3G2KA 4X7MA 2BISA 2GPNA 3S7BA 1UQTA 2H1FA 2YQ8A 5A6CA 2G9RA 2VG8A 1FCHA 4HORA 4NC9A 4H7XA 4GZ3A 4BFCA 4QLBA 4IN3B 3E3LA 1ELWA 3MEKA 3SYRA 3VDMA 8GPBA 5G05C 2KCLA 4NRHB 3Q3IA 2Y4UA 1NA0A 2DBAA 3ZHEA 2HY7A 3ZN3A 2QN2A 4YVQC 5EX3A 5EX0A 1Z6PA 1F6DA 5JJTA 2C1XA 2QRGA 4CTNA 1XNFA 3SZ7A 2UY1A 1O6CA 3NB0A 4N2QA 3MV3B 5DXFA 4UQXA 3KS2A 2XCUA 5M72A 5CCLA 3H4IA 3GPBA 1HXIA 4J8EA 4RG6A 2VGXB 4HOSA 1ABBA 3NF1A 1AHPA 4GA0A 3LY7A 2FBNA 1VGVA 2PRIA 1XL0A 4LEIA 1NZDA 1NZNA 3QWPA 1E1YA 4N3BA 5DLDA 4M83A 2VSNA 4APOA 1XOIA 5JJ7A 3MBOA 2HYZA 1J39A 3HBJA 2X0FA 5KJMA 4CGWA 5IKOA 3QWVA 2G9QA 4EL0A 4M60A 1WUYA 4AMBA 3CVNA 2WTXA 2FEZA 2J9QA 3MV2B 4JHRA 1AXRA 1TJCA 3VUEA 3LYAA 1KT1A 3L7BA 2IEIA 4F96A 3C4VA 1NA3A 3BD7A 3GUHA 3HBNA 3ZGQA 5D00A 1K08A 3S7JA 3GZ1A 3LY9A 3G2JA 1E4OA 2R4TA 3CEQA 2Y4TA 3Q3HA 4KQMA 5D0QD 4G1TA 4G2VA 4GYWA 4MI6A 4G23A 3URZA 1F0KA 3RT1A 1NZFA 4HLNA 4RELA 4BTBA 4N9WA 1KT0A 5LQDA 1L5QA 3DDSA 4UQYA 4FZRA 3U4TA 3TSAA 1A17A 1WV1A 2R60A 1HH8A 4I2ZA 3BD8A 1JG7A 4YVOA 1FTWA 4WACA 2XA1A 4KQ1A 3R9AB 3MS2A 3DDWA 3GZ2A 2E2EA 1PYGA 3T3EA 3GW4A 1FTQA 4EL5A 4N39A 3ASGA 1GZ5A 3G2LA 3QKYA 5KJNA 4G26A 2GJ4A 2XGMA 5ARFA 1P2DA 3CEHA 5LCWJ 3ZPJA 3RKVA 3CX4A 5JTTA 3FFLA 2IV3A 3S2UA 1ZU2A 4U0UA 5A7DB 3EDTB 4ME2A 1L5WA 3HBMA 1YA6A 3WAGA 5I45A 4BT9A 4I2WA 4A1SA 3G2IA 3BCRA 2LSVA 4I9CA
chains in the Genus database with same CATH superfamily
2J3KA 3JQAA 5B3LA 1Z22A 3IQIX 3QWFA 4PYLA 2FUCA 3IBYA 4PC7A 1EUDB 2PX3A 1CUAA 1L7AA 2UZ0A 4CKWB 1XZFA 1IVSA 3B1VA 4OP2A 3PRHA 2H48A 4E46A 3EIWA 1ADFA 1ZIDA 5G0VA 1ZN9A 1ZM7A 1O03A 4M9QA 4MVJP 1E7QA 1X80A 1XQWA 4G0WA 1HLDA 4D8TA 3URKA 1HZZC 4MRNA 5BW8C 3OX2A 2P2DA 4DFDA 4X45A 3NVDA 5ENQD 1TU3A 1UK8A 4BIIA 2MIIA 3PUXA 3GARA 3ZYZA 1XJ0A 3SG0A 1K0FA 1EUCB 3DR5A 2HZ7A 4LX0A 2N47A 5ALYA 5TPWB 2W6JA 2OV2A 1BHQ1 3N2YA 1OH7A 1N25A 1P80A 2IY9A 3D7LA 4QU8A 1A5AB 5KYGA 1Y9EA 3CEJA 4K0KB 2F8TA 1DWUA 4L85A 1TNOA 1E2DA 3ORHA 2F1KA 2JATA 1CSEE 4A91A 4CZ2D 3FTXA 2FHPA 3VTFA 4BCCA 5JQGB 4X1IB 3VPXA 4GR5A 1HL3A 5EKTA 3MTDA 2HA5A 2R7KA 4PC6A 2ANCA 4GOMD 1ZAYA 1KO8A 3EF3A 3INYA 1QV6A 3E2IA 3I9MA 5AKHA 4FI3F 4QXOA 1NR7A 2D7JA 1XMXA 4ZQGA 3PVCA 1X92A 4KWEA 3TJPA 1CDEA 1HOTA 1RJGA 1NVFA 3R74A 1SCQA 1LI5A 2KJQA 4NJEB 1R9NA 4CMIA 4I6EA 1ZJ5A 4BOYA 4OATA 3HJTA 2VP5A 1IY8A 3EAQA 3I42A 3K9WA 4M4SA 1SK8A 3B2NA 2IY0C 2D59A 1L4BA 4F97A 3JW8A 1K1AA 3MILA 4PYJA 4U00A 3ZV3A 2VSXA 3H97A 2VKTA 4J9UE 3F6QA 2IZ6A 1KY2A 5K8JB 3I9V6 2PUVA 3TD6A 2VWGA 4QOEA 4P35A 1ND6A 3PXDA 5JHGB 4D3SA 2PGLA 3IHVA 4EEZA 2J5XA 3JARA 2Z30A 1KI4A 3P32A 5F5LA 5ENOD 4MV4A 3AP3A 1PV2A 4RY8A 4CFZA 3AOEC 5DLQC 3GLIE 3RRBA 4JVSA 1TXGA 5EP4A 3FNQA 2BTEA 4IXMA 3N74A 4EVIA 1A9XA 3OIYA 5AQ1A 4ZOBA 4DDMA 3GFPA 1FX0A 1XRJA 4F72A 1NBHA 4FP7A 1XTQA 3DT6A 1WMEA 4BWFB 4U02A 1UPCA 4R69A 3E8SA 2GEFA 1XKXA 3PTAA 5EKSA 2IXGA 4E15A 1FA9A 2CLFB 3ZI4A 1NL4A 2Q1UA 2HMWA 1FXWA 2BFEB 4KXYA 2H51A 5KX5F 1TLLA 4ZQFA 3F97A 2FDXA 1ZIPA 4RPGA 4JROA 3VHXB 2QRGA 5JRDS 1DIBA 3KJZA 5I9MA 2DUMA 5JC1A 4YJGA 2GA9A 4DJAA 2HV8A 3IEXA 1DVPA 2J9YB 1Q20A 1RAHA 1PFVA 2GN9A 3NHFA 1B42A 1G20A 1RXSA 2W8BB 2J3EA 2CJFA 1HA3A 1JFSA 3PC8C 4C01A 2I6QA 1MYOA 3VNVA 1QE0A 2QT0A 4X94A 3RHSA 4G0UA 1QVRA 1TCCA 1AY0A 1OWNA 3NB2A 2R96A 5AIAA 4D2IA 3WBKA 4K9KA 4KG7A 3U16A 1K6XA 2C2GA 1WSWA 5E6UA 3EPPA 3X1YA 5TX7A 5BWCA 2HUPA 4K9SA 4CU5A 4YIKA 1U3TA 1BXZA 5IU6A 4E32A 2HLPA 4KQHA 3FHTA 1RI1A 3BUSA 1F2DA 4BRUA 5KJCA 1YB7A 3UMBA 3FH0A 3LBFA 4RYDA 1P6XA 1BDHA 2WYUA 2BJHA 4ESEA 3CQGB 2F62A 4KBQA 3QXXA 3WNVA 3LAWA 4S12A 4Z7NB 3VISA 4F84A 5T5QA 4UBLA 2XUGA 1ZHFA 4EO4A 1E32A 2WA2A 5AXBA 2OZPA 4RDIA 1C30B 5FWYA 4HNVA 3QNKA 4AG3A 4HVBA 1PK9A 3H3XA 4P7GA 2VEDA 5KYVA 4L16A 5CB4F 3GT3A 1O6ZA 1T0PA 3ZY2A 4KBYA 1E6WA 5A04A 3T5GA 1V3UA 2O5CA 5B1DA 4JDUA 2Q7DA 1Z2DA 3CSTA 3PQ2A 2G80A 1AMUA 1X0VA 4GLOA 3R0XA 2ETVA 2H6EA 4BO7A 5BY2A 3AHHA 3DUFB 3MSXA 3NHBA 3TUIC 1QLJA 2QL6A 3KKMA 1YQUA 2NACA 5EJIA 4U0ZA 1QLHA 2WJJA 3EHQA 3B1ZA 3K1TA 1RC8A 1XF9A 3C4QA 4Z0HO 4MITA 3TUZC 2HQ1A 5KYXB 4LJ7A 1YJAA 1D4ZA 5TT0A 2JIPA 4QO8A 3P2EA 4EG4A 4J1NA 4G25A 1Y1QA 4UM5A 1Z6TA 3FPAA 2DPMA 1EAMA 3HY3A 2HFKA 1JU3A 3LUAA 4MS4A 3R8FA 4PWZA 3ONKA 1TM1E 5T3RA 1T9DA 2XCLA 4IDFA 2NP6A 3QYJA 2QNBA 2O3JA 2DAPA 2ODEA 2R86A 2I1QA 2QMOA 4YNDA 4QOJA 1C3VA 2FUG6 3ZD8A 2WG2A 3VR3A 2GEKA 4WGFA 7MDHA 3Q8LA 5JCOC 2V7TA 3OEEA 4GB9A 1H9BA 4JYZA 5AXCA 2Q41A 4EZBA 4EHMA 5KCZA 4ZZ3A 3HJHA 1AE1A 3H8JA 2ZB7A 4RA6A 2PG3A 4H1VA 5T4EA 3ELDA 4D9MA 2GZRA 4CKBA 4YI3A 4DPRA 4HQRA 3AS5A 3WMRA 5JS1A 4ACAA 2H2WA 4Q19A 5HIAA 3PDJA 5LP6F 2GKOA 5TEVA 1UBUS 4R2HA 3NHZA 3CLSD 4E5SA 1N6KA 4CCAA 1ISJA 3SMQA 2HLDD 1JEEA 1U0FA 4DQLA 2BBTA 3RS0A 1Z4OA 2XX3A 3VMFA 1RP7A 4AY5A 5AVZA 5TVGA 4FYYA 5KU7A 5DHFA 3PXCX 3HJUA 3IIEA 3WXBA 1D8DA 2MSCB 1I4WA 2B37A 1KZ6A 4TOIA 4MAAA 4UDXX 5B7PA 1PWHA 4UCFA 1LRJA 1J2TA 2O5RA 2IXDA 1KZPA 1J8YF 4OYRA 3EWAA 1YBHA 4BFTA 3GGJA 1U2QA 5JWRA 4OV6B 1S01A 5AM0A 1M5UA 1LTHR 2VK8A 5LP0A 4RVUA 4DIEA 1IG0A 5J63A 2H16A 3ZWXA 5CLIA 3TQCA 3RAGA 1FFGA 1FYVA 2R8ZA 3KKLA 3D6AA 2HA7A 3H7IA 3NT2A 5EJGA 1HDYA 3OT1A 4TZKA 5JMOA 1SOAA 4UFNA 2WMDA 1XF1A 3CHMA 2IPMA 4DJEC 1ZLXA 2H7XA 3DLAA 1GRRA 2IUFA 3IDFA 4LYAA 1TMGE 5JAPA 1U0HC 4EMBA 2IOHA 5ESRA 1X0XA 4DSZA 2GZ3A 4ZDIA 4XPIB 1JKJB 4LJAA 2VK2A 2CCKA 3IESA 1USVA 1ECPA 3QC1A 1WKBA 2PV7A 3QE2A 5LKRA 2CW5A 4XLZA 4UU0A 2VI5A 3WV5A 2CHEA 3P94A 1N2EA 3KJQA 2QTVB 1XXHB 3OZRA 4HS4A 4J2TA 5A06A 2CKMA 4BVJA 1RADA 3W2HA 2FI1A 3TOSA 1FSGA 2J3HA 3USZA 2C3OA 1GITA 3HVIA 4JI3B 4I8DA 1I36A 3ZCTA 4PM4A 3OSZA 2QVXX 1GNLA 3DHYA 4A10A 4BC0A 1E4VA 3APFA 3JUEA 1ZUNA 4FMCF 2B5OA 4RGVA 1YDHA 5AVVA 3BGSA 3UYKA 2B9EA 4NDAA 2CNWA 5CLHA 2Y6VA 4AICA 5BOSA 3RS9A 4U9IS 4QYSA 2A0XA 4P1ZA 2JD2A 1T2NA 1K7FB 3B38A 1XD2A 2X13A 4L8FA 5G3ZA 4O6FA 3P19A 2AC7A 3UUEA 4BYMA 3D0OA 1HS6A 1NONA 5FBZA 1Z3IX 3LHKA 2FETA 3QFSA 3DMRA 1WCIA 2CHXA 1W0JD 2XCCA 1SXJB 4CGZA 3O8NA 3CW2A 3L6RA 4KWCA 1E6MA 3QLJA 4ER7A 5J9FA 1ORIA 2GASA 3R3XA 2CJXA 2VJKA 3VJLA 3OMSA 1UJMA 3J7TA 1ICIA 1ZI8A 4FQ8A 4MH0R 3PXBA 4PGFA 1U80A 4C2UA 1NBMA 2I87A 2Q99A 2UYOA 2LUHA 3UMFA 5TQVA 4DCCA 1X9GA 3IPRA 1ES9A 4F7DA 3V2HA 3FGNA 4FLFA 2IRWA 5EFOA 1DEOA 2RGCA 3I76A 1CJKC 2GK6A 2P27A 1TK2A 4UOZA 1H8ED 2V65A 3AEUB 1GY8A 2YWEA 4F04A 3V6MA 1E7SA 1AXEA 1OT3A 3AEQB 3RIHA 4PN3A 1E2PA 3UKRG 2GM9A 1Y6FA 2WHPB 2DSNA 2AHRA 5KOJB 2OZKA 3U44B 3L7CA 1ZQ1A 5B4TA 1QGOA 3KZOA 1B7GO 5E4FA 4ETNA 2DERA 1JKMA 4AJLA 2RB5A 1UQRA 3SGHA 5CYFA 3KZ1E 3VR0A 3DBIA 5HZKA 2UVQA 1IHGA 2AD1A 1EFAA 1T91A 4RV5A 5KDDA 4QFDA 3QOUA 5M7EA 1P9NA 5K0FA 1XPJA 1LVGA 1UC4B 2FV8A 3PEVB 3W3AH 4RLQA 4HNRA 1OXJA 2PKCA 1XG5A 3RIEA 3PHHA 1VJCA 3I01A 3OM8A 4H08A 5KJKA 4WJZA 4INOA 1GDHA 4XXHA 4XOUA 5FTMA 2ATXA 2W2LD 4EATA 1Y6GA 2QKYA 2XBMA 3GGPA 3T9AA 2VF5X 2FW0A 5CVEA 3C16C 4Y9SA 5JAIA 4JGIA 1K89A 2CMGA 4E2FA 4LWPA 2YHIB 5KQRA 2BFFA 5AOXA 1UKVY 2A9PA 2YYAA 3FMPB 2LKCA 1VHWA 2RAVA 3BX1A 1VKZA 4JLNA 4GA0A 4RZ2A 2FBNA 3WWPA 4LEIA 4GDMA 3K0EA 3KSUA 3GX1A 2ZBFA 1URPA 3JATA 3TR5A 4NTZA 5EXEA 3U5ZB 3C43A 1OIVA 3KOYA 5ISMA 3IAXA 3JVVA 4V2IA 4MLZA 3KKOA 3UJDA 4DC1A 1RJEA 3KPJA 3SXJA 5C31A 2WTNA 2GN2A 3PPIA 3WGLA 1D2NA 3HG0D 2C20A 2VYFA 3ON5A 4K6HA 2QAGB 1E6CA 2QUHA 4EB3A 1B76A 4C6SA 4CDNA 3EOZA 3ZPJA 4DJDC 1WXHA 3OESA 5K5EA 2IZZA 2CDNA 1WHTB 2ZJ5A 4UU7A 3D2AA 1T15A 4GBMA 1VXRA 2XZPA 2YV1A 4QUGA 1VKNA 1N7HA 3S99A 1VBNA 2WZBA 3GAMA 1P62B 1J5PA 3U3DA 2ZAGA 4JEMA 4OHOA 1O08A 1U4OA 3IXLA 1PNOA 4RS3A 1RZRD 5J4VA 5I4BA 5BN3B 3F3MA 1PEKE 1DG9A 2H4WA 4CM8A 1EJ6A 1S2OA 4LZOA 5E75A 4B09A 1XTZA 5EQFA 4JI1B 2P9KG 3O92A 4C4OA 5EHIA 5BWMA 4RKFA 4LISA 1YU9A 1DS6A 1WMFA 2AC4A 5CXUA 2DWQA 1D6NA 4KZKA 4F8EA 2FK8A 2FSVA 3OD5A 4MVWA 4WECA 5EJ7A 4WN9A 4NOJA 2VHVA 3IEPA 3M3HA 1LU9A 2AMFA 2BMFA 3BRWD 5SZJA 4QXQA 2XB9A 1D5WA 2OFFA 2Z5FA 2LWIA 1OHHD 5JQWA 1RAFA 2VLBA 3HTXA 2UZ1B 4QUKA 3T12A 1RXEA 3DLCA 3H4TA 4EJSA 2A0FA 2JJ2D 4EUSA 4LQLA 4CM4A 3U3ZA 4I19A 5DJ5A 1FFYA 4KQGA 2OHJA 4LMRA 1SR8A 4OXYA 1WKCA 3DPIA 1SCUB 4HMOA 4RIIA 3R09A 3DPUA 1WU8A 4LRTB 2HHHB 3LPDA 4BQEA 2HF2A 1UOQA 1TPZA 2XVMA 3DYVA 5DBOA 3F8SA 2I65A 3BJEA 3IVMA 4AZTA 2XYGA 2HGZA 2YWGA 1UG3A 4ARUA 1OX4B 1O5OA 1J9EA 3VDRA 4HZIA 4DI4A 1VL5A 2FPMA 2X0JA 3GFQA 4EG5A 2GR9A 4YIHA 4ZVQA 3ILYA 4ETMA 1JFRA 3FNBA 2XGOA 3PWZA 4L6CA 1GZVA 1I80A 5ANRB 1WZUA 3TM5A 2K6GA 5GZ3A 3F67A 1GYQA 2H1LA 2HJVA 4DCNA 1GSAA 4UCXA 2HIGA 3LRXA 4N48A 2YUIA 1PVVA 1Y8RA 1DXHA 3AKEA 3PFWO 2HWXA 5JO9A 4YI5A 2YVLA 4IGKA 1IHOA 2IHTA 3I2YX 4CBVA 3GD5A 2C3PA 3QVGB 1GZSA 5KC9A 4GOLD 5HKKA 2DWPA 3IXQA 1ORVA 4WI1A 2KATA 2FZ5A 3BL6A 2KLBA 2QI9F 1PFWA 1VLHA 2W9JA 4YCCA 1YT5A 3WGUA 1MAUA 2FYTA 4R1SA 5FWNA 4R1MA 1UDBA 4KGXA 1U5BA 5JCXA 3Q0TA 3NBYC 4PC3A 4QHYA 3U56A 4IGEA 1Y7HA 1T2FA 2WM8A 4GRDA 4IJQA 2DJIA 4BFCA 1RMQA 5FFMA 3ISVA 3KFLA 3HDJA 3CRQA 2ZB4A 4TMVA 1NFQA 1N4AA 1FOEB 4C0EA 3QEJA 1ZA2A 3FOWA 1J20A 4UEWA 5C7OO 2HMVA 4FM9A 3GCXA 1Z88A 4N6GA 1E66A 1GTZA 5A3QA 2AMYA 3IP5A 1YA8A 4B83A 4DHEA 5IKOA 3DBHB 4KAJA 4HXEB 3G3EA 4J0FA 3FTEA 2ILVA 1U8YA 1GNQA 2YOGA 1M7HA 2YBEA 4A0HA 2EX4A 5HDBB 1MJHA 4MTLA 4A2CA 4TV9A 4K8RB 1HH4A 3BT7A 2UZ4A 1EU1A 4ZAXA 3QI7A 2LCIA 3TI7A 2WV9A 2HM8A 4ENWA 1YDGA 1TVCA 4MUNA 3EDYA 4ZCMA 3VHQA 4F3NA 3AU4A 2P6UA 1RC1A 1K1BA 1VECA 2H0AA 3WAJA 3KUKA 5JLAA 2BOVA 1XJ5A 3RO2A 3LBIA 3FNRA 5DGDA 4LDPA 4DCSA 2JLUA 3A1UA 3ED1A 1PTJC 4V1CB 3ZVKA 4OAQA 4BNKA 3IR6A 4BY9E 2G8LA 1Q7CA 3GJXC 1ZD9A 4FPXA 2IKSA 3GJSA 4US0R 2UYCA 1JHVA 2P9QA 2QM3A 3UV3A 2QTTA 1ZSNA 3GNLA 4LNGA 5HKPA 2OAGA 4GI2A 1YS2X 3IXMA 3GBSA 3PPWA 2HXSA 2CB9A 2RD0A 2IEDA 1A8SA 1TNZA 3JQDA 3ENNA 1NVUQ 4EY3A 1UAAA 5JJKA 1IXYA 1Z8HA 2ZS9A 2FKNA 3QITA 3A9UA 4ROTA 2VJMA 4BGUA 4I9GA 4DIKA 3MTAA 4BNMA 3CMCO 3ORYA 3IULA 2G7MC 2WWXA 4FCTA 4R7ZA 4C08A 3OX4A 5EZ5A 4D92A 1G0OA 3CF4A 2XODA 4EBFA 5DCYA 3VR4A 4EY8A 1ATZA 3SQWA 1VPDA 4U7GA 4CFYA 3ZE7A 2XA9A 2OTCA 2BBSA 1LWNA 4GFDA 4BNHA 4ZQHA 3G2MA 4YA6A 2UDPA 3KTFA 4LZAA 2QSYA 3J81A 2Y93A 4N3AA 3JASB 3HU3A 3HN6A 3GNQA 3KR9A 2NU8A 5BR4A 2WM2A 3HDXA 5ENPD 1LW7A 1XTKA 1VLQA 2P35A 5LQSA 5LYJA 4LYDA 2GW1A 4TKUA 3LZCA 3AQ4A 4P5DA 3L6OO 1GNRA 5A4MS 4LOIA 4Q4JA 3SJUA 6YASA 4KXMA 3IP9A 1RWQA 3A9CA 1ZWLA 1TCAA 2JIZD 1MJGA 1EBFA 2P79A 4C0MA 4YR9A 2V45A 4XCVA 4XLLA 4RK5A 1YMUA 3OCYA 2G1UA 2E9SA 4F4HA 1QRSA 3WP1B 4MW9A 4I50F 5GGYA 3RW9A 2QT9A 2L6BA 5BNWA 2ZRNA 3VZRA 2EWMA 1XAGA 4Y1RB 1MJGM 5LZ4A 5LJIA 1SZDA 4P0PB 1PN3A 5EFZA 3CV0A 3OZGA 4HDSB 2R2AA 3IDSA 3AJRA 2ILRA 3T3DA 4L3WA 2FXVA 2RC6A 1DO8A 3HWRA 2O8DB 1P0FA 4PE5B 3D3WA 2HHJA 1FSSA 1GRVA 5KYYB 4GZ6A 1HTTA 3RSQA 3VMMA 3NI2A 3W4IA 2C4VA 1R6VA 4L7QA 4FHDA 1G3MA 1GA1A 5DV9A 3K2IA 3VYTB 4L07A 1O95D 2HK8A 4JVNA 4ZVLA 2B0JA 3SHVA 1H6CA 3R9MA 1X7YA 4AMUA 3PVSA 4J6EA 5KTYA 2XMZA 1GFSA 2KCLA 2PSSA 3UJHA 3CSDA 1VBFA 3LVRE 4AJJA 3FTPA 4U7TB 3FUWA 1TF5A 2W2MA 3GJ0A 1ZKMA 3QUAA 2H9AA 4P3PA 4H16A 1N2HA 2FMIA 1I3CA 3A1WA 1XSEA 2ZULA 1S70B 2ODAA 1QFXA 1BEUB 4AURA 2GN6A 4BNIA 4PS1A 5CVDA 1LPSA 4O59O 4M8LA 1YOBA 2NO4A 1IZ9A 1YS1X 4OPMA 1TCUA 1HFJA 1KETA 3V4FA 4IDNA 4HLDA 2XYVA 2HHCA 1NVGA 4RKQA 2F43A 4RMIA 2PD3A 4RWZA 5I7SA 1DQYA 4JHXA 2E2EA 1KQ3A 1QAOA 3TDMA 4YRZA 5ARFA 1A3CA 4W8HA 3ANLA 1DKQA 3U0VA 3WR5A 2VPIA 2PTHA 1RIFA 3TAUA 2VHZA 2V7XA 4LZWA 5TRTA 1DJOA 3NVKI 1DL5A 1ZRMA 5IY5E 2PTGA 1YBMA 5FTWA 2Y1CA 4JLKA 5GQSA 1XR3A 2QVYX 2WKRA 1DOHA 4UJ5A 1YKGA 1V48A 4ZV7A 3PDCA 1H6AA 1RHMA 4ZP1A 3I12A 5HRCA 3IUJA 3FDXA 1UDCA 2I6TA 4F86A 4OB7A 4RCVA 3JXEA 2JASA 3JQ7A 3K8YA 3E6AA 4X8OA 4GPBA 4EGJA 3JQRA 4OK5A 2REQB 1ODIA 5EERA 3AU8A 5FL7D 4DA0A 1I32A 1TX4B 4JLWA 2JPDA 1OLSB 4P92A 2HMSA 4RETA 2EQ5A 1L1EA 1OCOE 1G3IA 1FFSA 3C3QA 1RIIA 4ZTUB 3E0QA 4PSUA 3FCOA 2IHVA 3OVMA 1JKFA 3C14C 3TW4A 4ZI5A 2OYSA 1T1EA 1HRDA 1V4NA 2YHCA 3DE6X 1H2TC 1QG4A 3C41J 3CHRA 4X95A 1CQJA 1HU3A 1NN3A 2J6IA 3TPCA 2R47A 3NIGB 1YMQA 5BNZA 3O90A 4P9NA 3FH8A 1UADA 3MIZA 4DLPA 1WPGA 1J23A 5FUXA 2CK3D 3JALB 5JFOA 1I4TD 4RULA 1EQAA 1LK0A 2PH1A 3VU9A 1KYWA 3WSVA 3WIUA 3SYNA 4LCBA 2XEVA 3L0BA 2F3UA 3WGGA 4TSFA 5E3HA 2AXPA 4UAUA 3GLFE 3V55A 2MU1A 5EMKA 3C3RA 2CVZA 3HZZA 4XLTA 1US8B 4B75A 4FE7A 1CCWA 2P78A 4UYJB 1OXMA 1GAXA 4EG3A 4LAFA 2KCVA 1F8UA 4TYPA 1IK6A 4HLCA 3FMIA 3SYLA 4NBTA 4RQUA 1BXGB 4IMIB 5JMPA 4D9IA 1DIGA 3Q0IA 4JL5A 4ZVKA 1VLVA 1CQPA 3ND9A 4JY7A 1T5TA 1M34B 1O54A 2MSDB 4LBZA 4C1NA 3HDTA 2JAUA 4HJRA 4TV8A 1CUEA 1T8WA 2Q62A 5DTQA 2YJTD 2VDPB 4MGHA 2PX4A 4Q24A 1GSHA 3FGZA 3LP8A 1RKUA 4D4LA 1VYUA 4UE3S 3W8FA 1HSOA 3PQ6A 2D62A 2ZJZA 4B31A 4NYMQ 1R16A 1AXGA 5HJ5A 3TRKA 2YJ4A 3SR0A 1ZNZA 4E33A 3ENWA 5JG7A 2QN1A 5FBWB 3HYCA 3BGIA 2J48A 4GSYA 1H2WA 1XTBA 1MAAA 1S4MA 1II8A 3PPVA 3OHMA 4NK5A 3GJ5A 4FEEA 1KJWA 4UAGA 5C9ZA 2FG5A 3QELA 3Q72A 3TQFA 3GJ8A 1C1DB 3L4JA 1RQLA 3AR2A 1C29B 1B6GA 3RJMA 3Q8KA 1P91A 4DRXE 4ND7A 1RT9A 1WZIA 4BKPA 2VJ8A 3NTVA 2FR1A 4JT8A 5BYJA 4PIPA 2ONJA 1IQUA 1OMOA 2A8YA 4HLLA 3GJ3A 2XR1A 3DVAB 1R8JA 3I6ZA 1ELWA 5B1IA 3SSMA 3L05A 2H2AA 2ZYTX 3KO8A 1HG2A 5IXJA 3IDQA 1M2FA 1ABBA 3NF1A 2EZ4A 1GPJA 3PYMA 2Q3CA 4MDEA 1C0LA 3IKJA 3LBNA 3KTOA 4YMVA 3FF1A 4JKYA 3Q2OA 2CYBA 3EUVA 2HYDA 1TTQB 2PANA 1NWCA 5ITVA 3ROXA 1W88A 3E61A 4NP6A 3H9BA 1SQSA 4KI0A 1Q7BA 4Q3CA 1H0AA 3LHFA 2I9CA 2EHJA 5F1PA 3NM4A 1NJ8A 2AFRA 1NVEA 3Q5DA 5AN8A 3E70C 4AUEA 5AR1A 1FXUA 4YJ3F 4UCWA 1G17A 4N39A 4EO7A 2DJ5A 3IKVA 3D4NA 2IVFA 4Q4HB 3I62A 1NX9A 2XOEA 5FEUA 5JHBA 1MIOA 2X8JB 1SA0B 4RVHA 4BT9A 4ZHQF 1HWYA 2H1HA 3R7FA 4PG6A 3ZHVA 1JA9A 1L4GA 3QU2A 2J09A 4D10C 1W1UA 5CERB 1ILWA 1JP7A 3KKZA 1Z5NA 4JKOA 4L76A 1GFZA 1RAIA 3WGJA 5K4GA 2DULA 4XB2A 3CEAA 4DDUA 3FFBA 2CHVA 5HQTA 1VDZA 1QQ7A 1PV1A 1HEYA 1QYVA 2ZZNA 3MUOA 4CR6A 3U09A 4JXTA 3T1NA 4AQ7A 1P60A 3MQFA 4HSGA 5LXTF 1GPAA 1JCSA 5C2JB 4O4LA 2YN0A 1QF7A 3V1MA 4B9AA 1KMMA 2DCPA 5K2OA 2ZEJA 5FINA 2F8XK 1ZD3A 4FYMA 1U7WA 2ODBA 1PRYA 3FNHA 2LZ0A 3P9YA 2PRJA 3U1VA 3CVXA 4D3FA 3VO8A 1V2GA 2IL1A 1H0RA 1K0UA 1FF9A 4MVXA 4Q0MA 3ASHA 3KUCA 1UKBA 2GCOA 1UDRA 4FBGA 4M0DA 1QKIA 2X2FA 4OEHA 1ZJ6A 5HQ3B 4GL2A 5FA6A 5BUCA 1MB0A 1AKMA 1ONBA 1IULA 4KE8A 1YHNA 4GTRA 2NPIA 3DXZA 8MHTA 5T8KC 3WHPA 1P7PA 4UM9B 3G9UA 3DZCA 2GXAA 1HLPA 1ZN7A 4L6AA 4RMJA 3R2JA 3T9FA 5ECDA 4AP6A 3CX7A 3UWOA 5KAPA 3MUEA 4GA2A 1VSVA 3GA5A 2FRDA 2OGTA 2NV2B 3D31A 1ZCAA 3WL5A 3MA5A 1M8GA 3HB9A 4O5AA 4UE2A 2VRBA 4L9SA 3VR2A 1U02A 4DPLA 5C8ZA 1ISFA 5EOVA 1A2BA 3LBYA 3IAM1 4LS3A 4DDTA 2G08A 3E9RA 1S1MA 2HQRA 1IAQA 2ZPUA 1IK4A 3ITKA 3GDGA 1ZZEA 2PU5A 1YASA 2ZS8A 2GK7A 1K4YA 1Z4QA 2WF6A 1WQ1R 2ID7A 3CUKA 3PX3A 4NCXA 3RCBA 4YDHB 4LNBA 4C9BA 5JNLA 1DDIA 3L6DA 3NBMA 2REXB 3L77A 4K05A 2OY0A 1KH1A 1QPZA 1NBAA 3QEMB 4HH1A 1D7OA 1FRZA 1DO0A 1CF2O 5SYNA 1GFWA 3I61A 3LUFA 3LDZA 1KXZA 2ZYIA 2JIDA 5JJLA 2PUHA 1ULAA 5TMPA 3VLFA 3FUXA 4RF3A 4FXPA 3VJRA 5CA1F 4YLGA 2NO7A 3TVDA 5DLPA 3GLHA 5IKMA 5TV2A 4AS2A 2OORA 3VOTA 1S3GA 1W6UA 1W1IA 4C0KA 1UN8A 4Q9NA 4PZDA 3ZDQA 2QLLA 4PNEA 3VYVA 4CG1A 2WTBA 2R84A 2B25A 3AUAA 4HN4B 3CYFA 4WE3A 1UMBB 2H1FA 4EKDA 4Q93A 4EM6A 2I3ZA 2QWXA 5H8WA 1U4NA 1JR3E 2V5QC 5CFOA 1D8AA 3KUDA 4TV3A 4B0PA 2OV3A 2WJ3A 2YWFA 3K9CA 2GD0A 2J0SA 4JMLA 2ZATA 1W36B 3WGQA 3K71B 1CIJA 1RNLA 1NZNA 4RD6A 3W78A 4IHJF 1WAMA 3BIXA 1TJ5A 2VSQA 5FHRA 4B46A 1B15A 2WU1A 5JSFA 3A6FA 2Q5EA 1Z0IA 2HU8A 5B57C 1SQ5A 4GBJA 4L28A 2HHAA 2N75A 4C5AA 3WLAA 4GI7A 1CR2A 3SXUB 2X5OA 1JU4A 1FDTA 3NAQA 3X0DA 3QBEA 5IASA 1J90A 3QWIA 5M5BA 1AF7A 3B95A 1D9ZA 4YRAA 3FN4A 3B1FA 3WL7A 4B4KA 4X61A 1U8TA 2FZGA 3P27A 3ROZA 2XA1A 2IH2A 3QVTA 2JKVA 1JECA 1WIWA 5F4BA 1BXRB 2BFDB 4AKTA 5DASA 3RVRA 5EPUA 3OOYA 1Y6ZA 1OWPA 2GROB 5ECWA 5LSAA 3AESA 4WK6A 4FDUA 3B52X 4Q00A 1KE1A 1N7IA 2PZ8A 4NEHB 4TXNA 3TXXA 1E6UA 2UVPB 4CEJA 2XPYA 1O1RA 4AF7A 3UHOA 3HVUA 3ELWA 2W6NA 4ILGA 5H9VA 2GZ1A 3ZQ4A 1SXGA 5FNZA 4QBFA 1AQLA 1VXOA 5E3JA 4A82A 1KEEA 3OQHA 1L4NA 1PEAA 5EESA 2J6BA 3ONLA 5C3UA 1DT3A 3PENA 3JCZA 2O8FA 3GVCA 3O8DA 4RZUA 1K8QA 2MT9A 6Q21A 1P44A 1PDOA 4H77A 4FC6A 2ZTSA 3TRDA 1S2NA 2QGZA 1OI7A 5FPYA 5KJEA 3U31A 5BNFA 3WLFA 4P81A 4TLMB 4TUUA 4HFJA 4M54A 2J49A 3V1NA 3NTUA 4NYIR 4HDMA 1JDZA 2PXCA 2QBYB 3UK0A 1K3FA 4B0ZA 3VPCA 4FZ3A 2EWVA 1FMTA 1ZM9A 2LTAA 2BFWA 2ZXFA 1NF3A 3U26A 2AVDA 1GV1A 2NVUB 4RTRA 3A0UA 4YAJA 1UWCA 1B6SA 2Q6VA 3BXHA 3EC2A 3KEGA 2KZTB 4L2IB 3L9WA 1Z7YA 4IBOA 1JNYA 5BXYA 3OIVA 3TMKA 3VU0A 2P9TA 5JSZA 3OT5A 1C4XA 1Z5WA 2QX7A 2FB9A 2NXJA 4YO8A 3TQTA 4LPKA 5K6TA 4EP1A 4BFRA 2Q5OA 3MCXA 3OCCA 4CMAA 3KWFA 2W2VA 4MKIA 4ZOQI 1FVHA 1T13A 2ECQA 1P1RA 2PMDA 2HDNB 3OQVA 2FZVA 1KOFA 1TAGA 2QW0X 1SOWA 3IV7A 3WDLA 2H1WA 1ZMOA 3RARA 2WXHA 4GUAA 4CKEA 3D5QA 2B2CA 4EY7A 2PGXA 2FGKA 1H5NA 1WVGA 3O4ZA 4KEAA 1JHXA 4HGOA 2RHBA 1GRCA 5L4LA 1KC1A 2X40A 2BKGA 4NURA 1LFAA 4V38A 4R51A 2A2ZA 3LY8A 3K1YA 5BN5A 5I7AA 4Z7JA 4DV4B 3EQ2A 3IO3A 4Q02A 3FZQA 4HXYA 1QB8A 4ME6A 1KBOA 5C1DA 2D0PB 1MB3A 1KLXA 4LY3A 5JNWA 1ZO8A 4OGGA 1EMDA 3GYZA 3ZR4B 4JQZA 3SZLA 3UCXA 2ZBVA 3BDAA 1EVLA 4YCBA 1TUBB 4FSDA 1QRTA 4HORA 1V11B 3BMNB 1QMGA 2X58A 4IV0A 3VDMA 5H81A 4BPRA 1JAXA 3HRHA 1FT1A 3O83A 1FUKA 4WZBA 3OETA 3QRWA 3H4IA 1PS0A 5FXMA 2V6MA 1I13A 5F7JA 3NTOA 4K87A 2RHMA 3CRRA 1VCMA 2GESA 4XWYA 3ADCA 4FFWA 2J9QA 2O2ZA 2QDKA 1G5TA 4CM6A 3U1BA 1OLOA 2X6KA 4Q15A 1GTMA 1TYCA 3H1GA 4G4IA 1QO9A 2ZWPA 3EMDA 2ZRHA 1KMHB 1T9KA 3L6AA 1CJUC 1EDBA 3O1IC 1ZZGA 4KREA 4TXQA 2BFBA 4GM0A 1GQQA 3EX7C 1IHDA 3F5MA 4PLWA 1PEYA 1QPGA 5JXWA 1SPBS 3BRQA 5DN6D 4EITA 2BF4A 1CD5A 9ATCA 4HPXB 5GIPE 4H3HB 1BI8B 3STYA 3DBOB 4J0HA 4PV7A 5IXSA 5AAOA 3A11A 5K9ZA 4TKMA 1T29A 3F1KA 4L5IA 4OXKA 4MV9A 3FCCA 3DVQX 3C3JA 1UXOA 2QJWA 1E5QA 5AJVB 3I3OA 2MOWA 5JAUA 3REOA 4ZO9A 2ZM5A 2GCPA 4NDNE 1BQ3A 1HT0A 2IEJA 1RDFA 4NF2A 3VRHA 3M4XA 4KYTA 5TGDA 1UOPA 1XLTA 3HLTA 1KNXA 2QMUA 3P0RA 1BX0A 1X15A 1VMDA 1CB0A 2CFOA 4WESB 1LRLA 3W0LB 1E7YA 1W25A 2HWYA 2VPYA 1KYYA 1T4DA 5LBIA 4WOBA 2VXYA 5KMGA 5JVDA 1DB3A 2BR4A 4HY3A 3LS2A 4FKZA 4N5IX 3FSGA 3I1YA 3WQSB 5ED0A 1N5OX 3T1YB 4QYIA 4HQ0A 4LXTA 3BCSA 4DXDA 2LKDA 1JHRA 4OQDA 1GUZA 2HK9A 3IA2A 1E5TA 3K70B 2MYNA 2OK8A 4B4OA 1CW2B 5JO0A 4B32A 4NBVA 1EQ2A 7GPBA 1RFLA 1HT1E 3QVSA 4Y6RA 4PPFA 4CMGA 3U7EB 3VDNB 4HWKA 1MN6A 2BKXA 2VK4A 2FDRA 2EBUA 1S8FA 4OYYA 5AHWA 1E8XA 3RRFA 3RUAA 2BWJA 1HV8A 3UH1A 4O2AA 1JVBA 1Y8ZA 5JPDA 4RJ2A 1A9SA 5BPHA 3HADA 5C80A 3DDUA 3BMCB 3IBCA 3B1JA 4LDNA 2AR7A 3FA2A 2GZ2A 3DVRX 4OSPA 2BLNA 2QN8A 4M86A 4I9EA 4M8SA 2PZAA 4C2BA 3A2KA 1B14A 3AHFA 5CD1A 3HL4A 4BFLA 4BMPB 2NP7A 2ZRGA 4WOJA 4L8GA 1GA6A 2PM8A 1OY1A 4OUDA 4A1FA 1ML4A 2I7CA 4W9NC 3W7VA 4Q9DA 1HMYA 5CB8A 3AEKA 3N71A 4G2NA 1O8CA 1KYXA 3IVXA 5JYEA 4OLFA 2WXOA 4JIMA 2HT6A 1JEOA 3EA0A 3LSYA 2FSSA 1X8KA 2F1JA 3ADBA 4XUDA 3NJRA 5A5GA 2E6UX 5CRVA 3ONVA 5AKYA 2OD7A 5IULC 1Y9AA 1DMSA 3M34A 1M2JA 2LAHA 2H4XA 3QUBA 2QOEA 4LRZA 3A4TA 3DSXA 3Q2IA 1RLIA 3DGEC 1JGTA 4XIGS 4HOQA 3L7AA 2ZG6A 1U9IA 3S0JA 2H7VA 1ZWKA 3PEUA 3LOPA 4WEQA 4JP1A 3NAZA 5DDIP 4BVLA 3N2LA 5FA5A 1OGJA 5CDHA 1DGQA 2JFUA 2VQSA 4QBTA 5LJLA 3M6WA 3KEAA 4UFOA 5K0GA 4WNDA 4DDHA 3UKDA 2C2HA 4KPEC 3FHOA 3DW1X 3AZOA 3HFGA 3AX6A 1BD4A 4Z0PA 1FCHA 5BXOA 2AQIA 3C5EA 4IN3B 1XDSA 4MINA 3FLAA 1E9AA 3A4YA 1ZW6A 1KJZA 5DBGA 3R0VA 2C82A 3KD2A 3AI1A 4Z4FA 2IZ5A 1XRLA 5FTLA 5PNTA 4EBAA 1JSCA 4OHKA 4Y30A 1UOEA 4BVFA 1GPKA 5FIUA 3S1LA 5D3ZA 5BVGB 1KJQA 3R24A 3FHEA 2CNLA 1ZN2A 1X9HA 4ERNA 2EL9A 1MC1A 1E1DA 2C3UA 3UC9A 4WZAB 3OURA 4QU9A 1X4RA 3HBNA 1F2TA 3RUDA 2OO3A 4AXXA 1G16A 3VVLA 1H2VC 2IV2X 4EGCB 3PXGA 4ACKA 2PM6A 3BAFA 2I62A 3U7HB 2GPWA 4G8KA 2CVHA 3EHDA 3G2WA 2IOQA 1WO8A 2HYIC 2FEOA 1N8KA 3DS8A 4NYJQ 3U5TA 1KO7A 3PNQA 4C48B 1JAIA 4A2PA 2JJ1A 3MWDA 3U7IA 3BDIA 1QYDA 2VRWA 5CDFE 1ZCFA 4EYQA 4I2WA 1R0LA 5C0OE 3W6NA 4INJA 3JPWA 4CMEC 4FOLA 4GYKA 2OAEA 3UQ3A 3EQZA 4CMIB 4CV3A 4CTKA 5BT9A 2VDWB 4DV3B 2TRSB 2G82A 3IH5A 3U4HA 5DM4A 4I9FA 2HSWA 5L4NA 4Q3LA 4B2YA 4HWTA 1EDEA 3OQIB 5CEDB 2B36A 4WH0A 1YK0A 4WXYB 3F0TA 2H11A 5A4KA 1QE3A 3ZHSA 4ZDJA 5K20A 4HOYA 2JCBA 4Q1AA 3S2YA 5HEKA 4D25A 3K94A 4GZDA 1Q16A 3A1VA 5KTNA 4JA0A 2LD4A 3NV7A 1E3QA 4DQXA 3IMEA 2J3DA 1C7IA 5ICFA 1S3SA 4BNNA 4EB8A 5KNCA 2POCA 5B7GA 1WAO1 5FWQA 2I3GA 3I0MA 4ZZIA 4ILKA 2AOUB 1CKEA 4A0FA 4DG8A 3R7BA 4N47A 1EEXB 1ULTA 4MQFB 4WNAA 3JWIA 3WAKA 1RSZA 1N75A 4X20B 1A50B 3FGPA 5EIEA 4I81A 2ATCA 1OWLA 1KZ4A 2WJVA 4J0GA 4Q48A 5BRAA 3IKTA 1VC2A 1X7ZB 3F74A 3A28A 3LX4A 5A4IS 4BTLA 3Q7FA 1ADJA 3PJDA 1P29A 4C0XA 5BR7A 1ORRA 5GZ6A 2BUGA 1CUGA 1NMXA 4K3UA 3Q6MA 4PYMA 4O1HA 4ZIRA 4OVUA 3H2ZA 3HMQA 2FG6C 2VJOA 5FI1B 3UMCA 3GV0A 3ZYMA 3TEFA 2P3LA 2FWIA 4GPIB 5HRYA 1RQPA 3MK31 2C59A 1AKWA 1V71A 3ZU7B 1SKYE 3K8QA 4AJIA 3EWNA 2YJZA 1YONA 1BWSA 4MMXB 2NQ8A 2OQIA 4U8HA 2EW2A 5BSGA 1SURA 4N5CA 3SO8A 4MS1B 3QPDA 4JA9A 2ID4A 4J3FA 5B3KA 1ZK0A 3BMQA 2D7DA 3O73A 3ULEG 3QM1A 1JPVA 4RIHA 1TVKA 2PR2A 4HYQA 1EP1B 2EHDA 2YICA 3AETB 2P2SA 1YQTA 5BYKA 4QJ4A 4FMDB 1QXSA 3C1OA 4F1KA 5A02A 2QUKA 4MW2A 5GWXA 2WWIA 1C4OA 2QVZX 4EJFA 1MX4A 4G0PA 2DHQA 4F92B 2HMAA 1LV8A 4BTEA 4K3VA 1ECJA 2QQGA 3M6VA 5D51S 5TQJA 4X1YB 3D3JA 3KRTA 1QGED 3LVBA 3ZUGA 1NJSA 4UBIA 1RZUA 1UBLS 5HFNA 1P7CA 5BURA 3KELA 3Q15C 1Y0BA 3G9TA 5BPFA 3EZFA 2IIPA 3QVWA 3S8YA 1PT6A 3PC7A 4N6NA 3HV2A 4ZAZA 4EGQA 2H7CA 1YCHA 4NAVA 2Q7OE 3D0KA 1NBOA 2LRHA 3IIMA 2NZWA 1ZVKA 2OOSA 1SUFA 4FFLA 3P20A 1BC5A 3L4KA 2H1CA 3SZ7A 4EVRA 1C7QA 1Z74A 4J0QA 1MAVA 1SIUA 4HEA1 3ZYQA 2NU9A 3MGBA 4HVAA 1R50A 1KOJA 4KKVA 3RBAA 3GRRA 4HGQA 2YXEA 4MUJA 3HYRA 1QTIA 1H1DA 2JW5A 1VDYA 3DPSA 1QFSA 4ZJZA 3IKOB 1QMOE 2QVCA 4DYHA 3ZHZA 4JEHA 4F96A 2C9CA 3L8DA 3A1CA 3Q7AA 3G5TA 1FTGA 4H27A 2FWNA 2GBPA 2VPWA 1Y1RA 2BKKB 4GVPA 4TXLA 1UMCA 4V0LA 4GX1A 3I6BA 2P62A 2VVTA 3HSKA 4FZRA 3VKGA 2BZ1A 2EGGA 2XTZA 1PR3A 1W4AA 3E7WA 5EDSA 4KR6A 1OCEA 4UUCA 1YE3A 3QE0A 1CYEA 4DV5B 2OBMA 1BDBA 1UR5A 5HF6A 3B9RA 5TNXA 2Y69E 1EHIA 4UYKB 1KBZA 3UG7A 4K6KA 1GZ3A 1GARA 4HZGA 2YRWA 5GJVC 3VC1A 3QP9A 1X3SA 1KMNA 3TKAA 2GM3A 3FBTA 1N2OA 1A5BB 5HK8A 3DF9A 3W9FA 4L4RA 5TMBA 4EBBA 2GRRB 3KHKA 3KYDA 3G89A 3A14A 3SEFA 5AK3A 1DT5A 4CIWA 5COAA 4YDEA 3OJLA 5JISA 1R4NB 1S96A 2YN2A 4NSNA 4ZYZA 2WWHA 2IUTA 1JTVA 2OENG 3SQMA 5HFAA 5CH5A 2IEZA 2PA0A 1BD8A 4RWEA 3RYIB 2XDQA 3QFTA 4IEEA 3S4YA 3UJ8A 3HWX1 3GROA 3KYJB 1KWGA 1Y8AA 1NV8A 3GEHA 5AO9A 3ISTA 3GZNA 1TA0A 1NVVQ 2Q1SA 3EOBI 1XQVA 3H5OA 1OFVA 1NLMA 2EFEB 4Q9KA 4F91B 2Q3LA 1VLJA 1P1FA 1YZHA 4BZPA 1RYBA 1Z8FA 1FP4B 4IWYA 4I3FA 4UU8A 3UK2A 1CZOA 5TARA 3QUQA 2BE7A 5F78A 1P1KA 3QPVA 4QQRA 4F6RB 3IIJA 4RYLA 3HYTA 1WB6A 3E34A 3HCPA 5TQ2B 5CFLA 3TNDA 1N9GA 1RYYA 4H17A 3IBTA 4OI1A 3KZXA 1RWOA 1WB5A 3ND8A 3WRXC 1HT3A 2VEOA 5TR9A 3DRAA 4UNPA 3DNMA 2OCBA 2O0JA 5EKDA 4M3NA 2HBQA 4KQ2A 3VU3A 4EGSA 6NULA 3ZTYA 5A3RA 3DT8A 2CMDA 1PJRA 4HUTA 1W581 4WXPA 1T1IA 1XWFA 1Y8QB 3GVIA 3TNLA 3K73O 3QMWA 4Z9AA 4JJ8A 3RSSA 3J81k 1F2UA 3OJOA 4BO0A 4RW0A 3BORA 4JBXA 1AQYA 3PC6A 3ESRA 4XWAA 3UWKA 2O8CA 4JI2B 2NU7B 4OA8A 3VLEA 3T3PB 5KWVA 4TXMA 3GGOA 3TYXA 4U6QA 1FVXA 2GCNA 1MVOA 3DE5X 1IXSB 1DDOA 1K6MA 4L0CA 1N11A 2RHDA 4TUMA 5ITSA 4IKEA 4WAFA 2ZW9A 4Z3KA 1N77A 4PO3X 6LDHA 4Q47A 1IE3A 3MELA 4FYPA 3UHJA 1YVPA 5K6AA 5CJJA 1KVRA 1EX9A 1N36B 3WMEA 5DT2A 3H6KA 2ZE6A 5LIPA 2FZLA 3ICOA 3RU3A 3C5VA 4FX2A 1Z15A 2V6IA 3DE1X 1Z7BA 1A2KC 3HB7A 2KHZA 5G04C 2W2OA 2FWAA 5IS2A 1PU2A 2IBMA 2CE2X 2QSUA 3PGKA 4U7WA 2AXQA 4A3SA 1GFIA 1RHKA 4WKNA 4PBRA 3GFFA 3BILA 2KM1A 4L78A 4M6WB 3A05A 4M1TA 4EHDA 4YV1A 4V2UA 5KKCA 1G2QA 2RHCA 3KTDA 4XX1A 2K5UA 3DEYX 4GF5A 2YIMA 3NG1A 1R7RA 3CTPA 1JHMA 1CX9B 1AMNA 1O2DA 5D2MC 2X7JA 4DM4A 3BBLA 1ZBDA 5HKLA 3Q11A 5LQRA 3L8HA 5L6MB 1T8RA 3IODA 2XUHA 3TOXA 4EB0A 2EFDB 1K6JA 4KMSA 1J07A 3OPQA 4X65B 1R4MA 1OTXA 4BE7B 4J8EA 2CLKB 1B6RA 1Z56C 2E4XA 3T99A 2OV4A 3PKZA 2RGWA 4OXQA 1K5PA 4WNCA 2XEHA 4OKSA 2X0FA 2R6R1 5AVOA 2A1UB 2AMLA 4DG5A 3UPTA 4UUBA 1Y6IA 3DXFA 3K30A 3PT5A 3C4VA 2ZSIA 3UCEA 3Q3HA 3V6LA 3QSGA 1WMSA 3K0AB 1ZA1A 3O8OB 3ICWA 3CLTC 3F4KA 5EMNA 4B0OA 1FYXA 4FDMA 4ZWNA 2I2BA 3EVZA 3RADC 3ZY3A 4E13A 2Q5CA 3HYSA 1LPMA 3ZDZB 3EZ9A 2C7OA 3L54A 3DBRA 1FP1D 3COZA 3DBSA 3WAGA 1BE1A 3MWJA 1U7UA 1R9MA 3KTAB 4BVEA 2RHJA 2FVXA 1XTVA 3WMGA 4U8YD 1M2EA 4P2BA 5EYPA 1OXTA 1MXHA 4ABYA 2DH6A 5KSOA 1C3OA 2YZMA 3C15C 3BIJA 1RXVA 5AW1A 1EK5A 2VBGA 1GPUA 5I9NA 4N3NA 4IYJA 2HPZA 3OXFA 4LGYA 3F7NA 2GBCA 1A72A 4PIMA 4J0IA 4OXIA 3TX6A 4MX8A 3SEQA 3BE6A 4TXPA 1IDOA 5J59A 1OA1A 4CMKA 5HMMA 1Q7TA 1GDDA 1T25A 1M1NA 3ILHA 3HLYA 4TLCA 3DSSA 1QIKA 4TQUS 4B2LA 3ENZA 2JI7A 2B94A 2V74B 1JBEA 3SVZA 1ZM3A 5E7IA 5AHXA 4B6OA 2HLDA 2C07A 3DL2A 5KTMA 1W30A 2JZOA 3C45A 4P0QB 4LRSB 1RKVA 3RRNA 4ZHSA 3FPCA 3STHA 2YH2A 4JW1A 4B47A 1Z75A 4HPWA 4AZSA 4P58A 2ZVJA 4TTIA 1E8WA 5K01A 2I99A 1Q0ZA 4YCLA 1ZH8A 3R9XA 1RWBA 1WPXA 1XCPA 3S1AB 1H3FA 4QRDA 1L6RA 1UXJA 1ZR4A 5KOHA 3KE8A 5JH7B 1KF0A 4ALIA 5CJ2A 4V0OA 1UN9A 2ZYSA 1HF8A 3T9KA 4OQQA 5ELMA 2WFMA 4BVBA 4U6SA 2P5TB 4IIBA 2BFFB 1FYFA 1M2WA 2YXPX 1ZMBA 1Y34E 2QRJA 5DHPA 3SYMA 3AKDA 1MW8X 1X77A 4ZCPA 1ZVMA 2ATEA 2VFAA 3SBTB 4ZGWA 1O94C 1O6GA 2NVOA 1JH9A 1IG3A 3C7KA 5DFAA 2HJ9A 5F3RA 4KYIB 5B6IA 3LP6A 4L3OA 5IAGA 2GHRA 1SUWA 4DCVA 4IPTA 4I0WB 4XYGA 1GW6A 5BV2P 1Y63A 2VJCA 2ZSKA 3LUKA 2WVIA 1UBEA 3E48A 2HM7A 3UWSA 1LDEA 5IYZB 3GFGA 4Q7KA 4AKXB 1USKA 3QZUA 4TX1A 1WPQA 4YWJA 5CYOA 3UJ7A 2L6JA 5REQA 2AW3A 3EDRA 1Q2UA 3VZCA 1PWEA 2E0IA 2QSJA 2PRKA 3LT1A 5H82A 1U8FO 1YGPA 1FSFA 4R9UC 1UKZA 4B81A 2D3TA 4HAZA 2OHHA 5KWDA 1IUOA 1AGYA 3M82A 3FI9A 4ENUA 1E2LA 4ALJA 2X5KO 4JI7B 4DLXA 4XFJA 3FKJA 4N7RA 2QTFA 3D3EA 4EY5A 4OHMA 1EFCA 1XX6A 5LPNA 3IO5A 1ZOIA 3WL3A 2PT5A 5AQAA 1IWPB 4Q6WA 1L5FA 2XUQA 2AI3A 2PRIA 2C96A 1YDEA 3SHFA 3D6VA 3ZW8A 1GWNA 4ND8A 1ZK2A 3GZTB 1JHQA 3K9BA 4IZ6A 2Q0QA 2VUUA 4GSKA 4JB8A 4WDQA 3E0XA 5D00A 2VHCA 4CW7A 2B1IA 3Q9SA 1GGEA 1TZCA 2G5TA 3AF5A 5IFLA 3LDHA 2EZ8A 1HH8A 2P2CA 1IM2A 3LRTA 4WACA 4KMMA 4ARAA 2CNBA 4DT1B 4YXFA 4P34A 4BLRA 4O4JB 3RVSA 2W11A 4TS9A 1XNJA 4HAOA 1ZEJA 3MGCA 2J9FB 2ZIXA 4PO9A 4KXXA 4C0JA 5IUJC 4DLKA 1HDCA 3QG1A 5JE8A 2P9JA 3BK1A 3OX1A 3HN2A 5FX2A 1XZLA 4RVSA 4NU6A 3UENA 1ZI6A 4RACA 1FDWA 5IHXA 1PQUA 3CONA 3ZWBA 5EJ2A 3IBEA 3DB1A 5AVSA 2I0FA 2QRVA 2IPAB 3EPHA 4A63B 1EJ2A 1BLXB 2G3YA 3HKBB 5A6SA 2LO6A 3H6HA 2Q3DA 4MR8B 1GGHA 4N40A 3V2UA 1JSXA 2C4WA 2A3NA 3WMFA 3RC7A 2DHRA 3KT3A 2Q1TA 1P81A 3R5JA 5JS6A 3VZPA 2ZWOA 4JOBA 1ZD5A 3Q9NC 3VH1A 2ACEA 3G0GA 1H8EA 1TZKA 3GJRA 3DYBA 1VCIA 5LN1A 3QVLA 2ODTX 4BRZA 4HQDA 3O91A 2XUAA 3R3VA 4HNAA 1PJTA 1MO5A 4NATA 3ZDAA 3B89A 3QYFA 1P1CA 4FYVA 3ZRHA 2O8EB 4HK4A 1D8EA 4OHUA 1B16A 3KBBA 2XZDG 1DBVO 3MCUA 4JHJA 4LYFA 4WOPA 1LD8A 2PNFA 2BF7A 4W6QA 1E8ZA 4P33A 3UBTA 3G0BA 2AGVA 4JR0A 5HFJA 1W7AA 4Y2VA 3OEHD 2CLOB 2IELA 2P9SG 2DYSE 2QTGA 3TOCA 2XE8A 2XAAA 3CZPA 2YFKA 3OAAD 5ADUS 3CPSA 3TWUA 5BYAA 4ZAVA 4IDCA 3EGIA 2M63A 1Z12A 4ZVTA 2V4HC 4EI7A 3CEPB 2I6GA 3QY0A 3R4VA 2IXBA 3OZAA 2XNKA 4BLWA 4OX9B 3E2MA 3HCCA 1OYYA 1TMYA 1VKRA 1NRWA 5CU7A 3D3NA 1XU9A 4B3TB 1TLTA 2R85A 4NFYA 1JLLB 1P4HA 4R8KA 4G9GA 4CE6A 3BL5A 3IUEA 3VSAA 5IKEA 4KXQA 4PICA 1V1RA 4J2OA 4F3VA 3CQCB 2BJWA 2IU4A 3K20A 4CTMA 4ER6A 1FL9A 4Y7DA 1U2DA 2IBSA 3GOHA 5JZMA 2H2HA 1ABFA 3ZIMA 5HOEA 4J0EA 4E94A 4AU1A 1SC4A 3BG5A 3CGHA 3TXYA 1QORA 2C7GA 3QX9A 1UDWA 2FEMA 2C8VA 2D1TA 1Z4IA 2NTYC 3GDOA 2AN4A 2HMYB 3TQRA 1I0ZA 4GOOD 2XW6A 4BMXA 3RVPA 4YVFA 1MFPA 4ZVOA 5I5GA 1PW5A 1YZYA 2O8NA 2NX2A 5EIBE 2ZAYA 1QGUA 1WOYA 3ABIA 1Y3BE 1JPJA 4B45A 5C4GB 3JVDA 5ICCA 2CLSA 2AEFA 1YZGA 2ZU6A 4YMUA 4ARZA 3FPKA 1NY5A 3LBAA 1W73A 5IRCD 2I4MA 4KTVE 3T3OA 4PZAA 4Y2XA 4CM1A 1U9YA 1OZAA 4TTPA 4AG5A 3CNEA 4QLBA 1QO0D 1U0OC 2BHNA 3JAKA 3EIOA 1RZRA 4L4YA 5K3CA 1PGOA 3T06B 3CC8A 1L9KA 3AJAA 4KO8A 3E81A 4LNAA 4HZUA 3GRPA 4KN6A 1XVIA 4MQ6A 3DMNA 4HATA 8ADHA 2V7EA 3IAFA 3R3SA 3W5IA 2QY9A 3BB4A 1XT6A 3RU7A 3VVCA 5JAQA 3Q7IA 3KDPA 4QGSA 4JLOA 4MQUA 3B6MA 3RK0A 1QOQB 4W82A 1UZMA 1IXZA 3VR6D 1Z4LA 4C05A 3NEJA 2P9IG 2YFYA 4BFSA 5AJYA 4M0CA 4J4TA 3TF5A 2VOJA 4IJ5A 3WZMA 2CJPA 3HR7A 3K5IA 1SHKA 4UDOA 2PZEA 4ZYLA 1GVHA 3P2IA 3HM9A 4QWWA 3BRWA 3LXRA 1GM5A 5HS6A 1IEQA 1WV1A 1MTZA 1JG7A 3EJ6A 1GZ4A 4ZQCB 1NFRA 3GZ2A 1D0IA 4Q3NA 3UJCA 3FRHA 3I9LA 3BXEA 4WBNB 4G5QA 1BMDA 4ZT4A 1E1LA 3PDUA 2GD2A 2VQEB 2ZRLA 4EZEA 4WASA 2PKXA 2GDZA 4M7RA 2H8KA 1L5HA 5JD5A 3RUIA 1B1CA 2FDCA 4PTZA 3TO5A 4TPKA 1ISHA 4H7PA 1T5OA 3UFBA 3SS8A 4I3GA 1VPTA 1PT7A 1AQNA 2C54A 1CZRA 4HOTA 2UU9B 5U4QA 1C9EA 1LI4A 2L42A 3RU9A 3MT7A 4KQFA 4KYUA 5T41A 1G19A 3Q8XB 4Q4CA 3T1QA 3OX3A 5DBHX 2A33A 5KIAA 3L7JA 4K5QA 2C2MA 4JSYA 1QSGA 1PL0A 2OLKA 4EZJA 1SZPA 3KR2A 3LQQA 4PZZA 1C8KA 3QKRA 2AZTA 5IHPA 1YJ5A 2AEEA 1ZD4A 2B1JA 4O2BB 4ZVUA 1V25A 2ZRBA 2Y4NA 4LNUA 4DJTA 3ZH2A 4HQLA 2C42A 1NKTA 4LJLA 2H5EA 2IO3C 3FPFA 3BEDA 4E3WA 4L57A 2WI8A 2GPSA 3UA4A 3I3SR 2JK1A 1LPOA 4A0QA 3KYCA 4KPUA 3ZDRA 3X1XA 2R87A 1G2OA 3TWOA 3THOA 4DLTA 2PMEA 2OV6A 1DTWB 3OLCX 1CUDA 1U2PA 3LM8A 1XCMA 3I6YA 3L0SA 4OREX 4PLGA 4C0AC 4FK8A 4BFYA 3B1WA 3WLSA 3CRW1 3PWTA 4WNYA 2BFCA 7ABPA 3P9XA 4QOHA 2PO7A 3JQ0A 4Y7CA 2LSUA 2WB2A 1IJBA 5CA0B 1Z6YA 2VHUA 4IGIA 1F5NA 4I5FA 4LSMA 3ICCA 1UJRA 1IWOA 1ZUIA 2XBUA 4DSOA 1J33A 4CMJA 2QYUA 1SUEA 4W9MC 3O2NA 3EGDA 4S0ZA 3I45A 4FNAA 4IGFA 3X44A 4HV4A 3SPXA 4RLYA 3H87A 1LC3A 3LBHA 2X9LA 1Q7RA 3ZE9A 2I1VB 3ZDFA 2FPSA 3N2ZB 3FYCA 1GUDA 3S7FA 4HUQB 3AVXA 3QUSA 3ESAA 4J29A 2WSSD 1KZ1A 1F8XA 4N5DA 2Z5VA 2BEUB 1RJDA 2QMYA 4DQKA 2B35A 2ZYHA 3ETHA 5AD1A 5J2UB 3CHSA 2BP7A 4GKVA 4Q21A 4M0FA 3IP8A 2NZYA 1HTWA 2GO1A 1P2TA 3AHDA 5EILA 1A96A 1JDVA 3AJ8A 3PFBA 2VH1A 2YINC 3KT6A 4CI0B 3O0DA 4MWCA 1J8DA 1LFDB 2F43B 3IT3A 3M1IA 3PDNA 3SVTA 2XCSB 4K26A 3KQQA 3SYKA 2F9MA 1RQ2A 4KGZA 1LLUA 2CLLB 3Q9LA 5JCJD 1G21A 3LTEA 4OQZA 3FNEA 1CE8A 3C1AA 1PFGA 1HG1A 4W1QA 1EIZA 4ER0A 4H7XA 1XZBA 1V8FA 3ZWQA 5B53A 3AUXA 5H4HA 1F0PA 1NA0A 3WLOA 2HY7A 3WLTA 1N0QA 4CTNA 4LHEA 1LCIA 2Q9AA 1UM9A 1PG2A 1S9DA 4WMLA 3T4UA 4EO9A 1U5CA 1AS0A 4JAVC 4Z9XA 2IYUA 4YALA 4ZA2A 3HUUA 3FCXA 1DAKA 3TEMA 2JFXA 3L0YA 4GG1A 1U0LA 1QK5A 4OHYA 1E4EB 1SNYA 4ND6A 3LH5A 5IT4A 3GP5A 3RT1A 3FCYA 2WQZA 1NYTA 3ODPA 1QONA 2R7NA 1ZD2P 5TS3A 1HDEA 3B5EA 2ZTHA 5ADWA 4FB5A 1QMPA 1S6YA 5KI6A 4RFVA 2AIRA 4UVGA 4GI5A 2O0KA 3HJFA 3ASGA 5A4DA 3O82A 4NOLA 2PAFA 4BMVA 5L8VA 4D9JA 4W5TA 1FFWA 4J4HA 2R1TB 2AOXA 1JX6A 5EGNA 1ZU2A 3E32A 1TPYA 1GTRA 1N9AA 2WD7A 1VMAA 3KU1A 2FQQA 1SOMA 4NQ0A 1C1YA 2WFZA 4G63A 2GK3A 5TXGA 3BTOA 4DIOA 3KKPA 3A6HA 1FNNA 1YB1A 5AQEA 2JFBA 2WXLA 3RIXA 1L8LA 1W8IA 3LVFO 4O1OA 1MRZA 3GN2A 4O4IB 3WLMA 4TS4A 4A16A 1KOLA 1VJDA 5JU6A 5FKJA 4DCPA 3DONA 4D02A 3C6ZA 2QU8A 2ZI7A 1YNSA 2ZT5A 2I5PO 4S1OA 1EZ1A 4BSZB 2P4EA 3UXEA 1W29A 5D3MB 3AKZA 4I1MA 1W44A 3PUYA 3DP9A 2JIZA 3ASFA 1Y33E 3BKWA 3W5DA 1O0CA 4EYKA 3N2IA 3DSTA 1NA5A 1OBFO 2W6QA 3GJYA 1E1CA 4HP8A 4D8YA 3GFBA 2QTZA 3A1DA 3HPRA 3W3AA 5CPBA 4OJYA 3MOGA 2B1QA 4Q1DA 4L50A 4IUDS 5CM8B 1GGNA 2JIMA 4MCHA 2ENUA 3AC0A 3JQQA 4U7DA 2QL9A 3OPXA 2W9XA 2HSDA 4FD2A 4YUAA 1USIA 1P2SA 4Y0NA 1O5IA 1GUAA 5GM1A 1G9TA 3A25A 3TECE 1XDDA 5A5FA 2FX5A 4HB2A 3HFSA 3TVTA 3A6JA 3AY3A 4PYOA 3II6X 5JPCA 1V8DA 3DL7A 4G4SP 1UBHS 3V4ZA 2B82A 3MHPA 4GA1A 3TR0A 16PKA 3KPUA 2NUAA 2WTMA 5C4IA 4ZYWA 1C8LA 3L5OA 2RK3A 1C14A 3E22B 5C7YA 1M2VB 1CIPA 1JHDA 1NVAA 2OUIA 2IUUA 2QUIA 3GQBB 3DCYA 5K3OA 1E8YA 2X7HA 1DWQA 4PINA 2WAAA 1UPXA 1M2GA 3VHRA 3AJDA 2JEYA 4YGYA 2VNIA 2WVHA 1ETUA 1VLMA 5INTA 1VE9A 5FORA 4CDGA 3I4CA 1VLZA 3IMGA 2YW9A 2J0VA 2V7GA 2G76A 4TSRA 2I29A 3X2QE 4RVDA 3AERB 2X4IA 2JHPA 1EGMB 3QXCA 1TTPB 3ESCA 4DSUA 2CZGA 2H6IA 3DYIA 1Z08A 3B6JA 4UPVA 3FAZA 2R59A 4ZFNA 4F8YA 1G5IA 1MQAA 4O6VA 3GRCA 2AUMA 2CFUA 2Q45A 3T3HA 4WNEA 3ANXA 4HNGA 5JWOA 4MW5A 1QFZA 3PH0C 3TMYA 2Y0DA 3NDRA 1DRWA 1E8OA 2VF7A 1CZLA 2X6IA 2IS6A 2O20A 1CVIA 3G5LA 2J45A 5A05A 2EQAA 4WCVA 3V4VB 2CSXA 3CKYA 4KMOA 3NUGA 2B69A 4M53A 3DOOA 2CD7A 2ODWA 2P41A 1G9SA 4GYJA 4WY2A 1TJFA 3QE3A 4KUHA 2Y92A 1ISIA 5FLXA 1QH1A 3TLYA 3ZN3A 5IBCA 4ZHQA 3KD3A 4MYUA 1OTYA 3ZK7A 2GAIA 1Z07A 4HOSA 3D9IA 3RWOA 3OUZA 2UUPA 3LF1A 3AOGA 2V7PA 3AVYA 4M83A 4TKVB 1914A 3KQKA 5ALHA 4YRLA 4NENA 3RFTA 2YMQA 2C9YA 1FQOA 4YEDA 3EUAA 3JQ8A 3R5TA 2I2XB 1TQ4A 1MOSA 4LY6A 3UT7A 2ZDQA 2JHCA 2W6MA 3GZ1A 2DRIA 2Y0BG 5ETJA 2DFDA 3B9BA 2ICAA 4B8AA 4MRSA 2V4UA 4IO0A 2PJZA 3U2QA 5K0TA 3MYYA 4OQLA 3ZVMA 2W37A 5CG2A 1ZRNA 4CEIB 3KHUA 1R5JA 5MF6A 4I46A 3IV9A 2P2YA 3AB7A 2ZBPA 1N6NA 1TK3A 2H4YA 2EKPA 5EAIA 1U99A 3DEKA 3UXYA 2AK2A 4OJTA 3BREA 1IBSA 4S24A 4YCJA 1AJEA 3FUUA 4OO3A 1TIPA 5FT9A 3IIKA 5IAJA 4AWXA 3FGOA 3SZUA 3JD2A 4B3SB 4MRUA 4ZVNA 1B4DA 2FJUA 2F67A 1P9WA 1ELRA 4KRXA 4Q01A 2YMLA 3A58B 2NLOA 1GPBA 2YQZA 3PU6A 4OIMA 2C94A 3CWQA 1AZLA 2G88A 3M4JA 3MCVA 3CVPA 3SKVA 3JXJA 3ZE1B 2WTEA 1P1BA 4P3YA 4LOAA 1J2JA 3V4SA 1L7QA 2BM9A 3OTIA 4K9DA 4HFGA 3NWPA 3SIPA 4P54A 3Q7RA 2DQZA 2V9PA 1K06A 3RIGA 5DKFA 4HDNA 4U0SA 2D00A 3RBZA 3ZBTA 2FZWA 1V96A 5EJ8A 4C7MA 1OVGA 4BS9A 1XZQA 3VV3A 3KD7A 2ZAIA 3MTJA 1YB2A 4FGWA 5DNYB 1PW7A 5EE0A 1CEEA 3UUGA 3T38A 4C0QC 4RSRA 2VGYA 1KAGA 4GC9A 3ZZMA 4EENA 3JRNA 4RGBA 3WWEA 1B8NA 1GILA 4UD2A 3FTSA 2F6RA 4C04A 1I6KA 2UZIR 1JE0A 2WICA 2SKDA 3FVVA 2YNMC 3CCFA 3MJVA 4DVGA 4QEKA 2NXEA 2O8BB 2ORED 2IYAA 3LDFA 4XYEA 5FTJA 3AFOA 3VKUA 1J24A 3JQAB 2V4MA 5FO0A 3OKPA 4XZ3A 4WZ6A 2XUJA 1G8FA 5DYYA 4DIMA 4ZMBA 2DLNA 3ZXXA 4TMXA 2QTRA 5BW4A 4O8ZA 1N5IA 5LQKA 1LDYA 1MH1A 1N6RA 5D5PA 2YW2A 1IBMB 2BGGA 2ZOSA 1X80B 1YDFA 5EIAA 2A30A 3M6FA 4F2HA 1JPUA 2NTJA 4LYYA 2W2KA 4DZZA 2ZI6A 3MSCA 5IK2D 4PVDA 4QC2A 2VN8A 5E2BA 3DOFA 1IM8A 3DEFA 3UYLA 3D9MA 2YXNA 2EFJA 2XGSA 4KVGA 4BO4A 2FZKA 4GMXA 4DA9A 2VJDA 1HL7A 2MRIA 3PGJA 2FF7A 4FHGA 4I55F 1XMSA 4XJXA 1T8SA 3RO3A 1R4AA 5EIWA 1T3SA 3WYEA 3MC1A 2OEVA 1R6UA 2B20A 1B93A 4BT8A 5HJEA 3HDQA 4NEQA 1Z7WA 2WXKA 2VSYA 3KXIA 3D9KA 3TJZA 3K9QO 4R0NA 3RSGA 1BDMA 2CFSA 5FRDA 3V7YA 3N3BC 1FYEA 1AV6A 4WLNA 1FTSA 1RJFA 4NCKA 2H1OA 2ZVPX 4U8VD 2O07A 3LUCA 4TS1A 5A3SA 2VNKA 1PFQA 1WABA 3L0OA 2FR8A 4R2MA 4QJ5A 1OVMA 1E18A 5BUSA 3HO1A 4ZCRA 3O3OB 4YR7A 5HK9A 5JDCC 2WFLA 1XXHE 3V48A 5HS4A 4W5RA 2PH7A 2J0EA 4G1VA 2IHYA 5BMOA 2K7ZA 4R2IA 5GGXA 2AG8A 4LERA 3I37X 4JYBA 3UF0A 3FTQA 5FBKA 4UWLA 4A23A 4EPXA 2L0XA 3JARB 3PL5A 1NZFA 1CWUA 4DZTA 1A17A 1M0WA 3DMTA 5ALOA 2FPGA 4PNPA 3ECSA 4HYYA 1X70A 2DHCA 1XE3A 2ZR0A 4BQOA 1I7PA 4JVSB 1U8ZA 5WRFA 3QLVA 5F1OA 3EY4A 4F06A 2C2YA 4DX1A 3V7FA 1SN7A 1UJ6A 1A9XB 4XD2A 2VAPA 4B6QA 4PZLA 1B1AA 1UXIA 4S1WA 3FFTA 1PI3A 2QEQA 1FX0B 1QHNA 3E9DA 3W6UA 2GRLA 1UL1X 4O4HF 4YUZA 3W6OA 4G0OA 4WXMA 5JW6A 4DMLA 1PZMA 3E27A 2PLNA 3I4RB 1NV9A 4K1XA 4QPPA 4XASA 1XZJA 3G59A 1XZEA 2BDTA 4EZKA 5K3SA 3L8YA 4M0KA 1N6LA 4TQAA 3C3BA 1SXJE 3AIMA 1M2KA 4HGPA 3MLBA 3ZHRA 4WCFA 3QU5A 2WHQA 4M0UA 2I03A 2Y1DA 3N75A 3K0SA 4JLPA 3I4FA 4WK4B 4L8LA 5KX5A 5ITZF 1L7DA 4E5YA 1JFFA 4YJGB 2FPKA 1DKRA 3DWGA 2WLTA 1G20B 3AFHA 3E5RA 2I80A 1LVUA 5K8UA 1B23P 4JLBA 4NNJA 3DKPA 1ZHHA 5E6UB 1ZGAA 3FPBA 3UM2A 1KDYA 3NJ8A 3RROA 1IL0A 1TNBA 2H4ZA 3ZYLA 3BCUA 1AB6A 3C87A 3FMFA 3I5PA 3ROEA 3AYXB 4E5VA 4K9QA 1EVJA 2ZLBA 3OQPA 3PV0A 3WXXA 4XFDA 4JP5A 1N8TA 4GRAA 1JCRA 1RZVA 2YV5A 2XMPA 1RW2A 2A88A 4OHCA 4C6TA 4XYLA 2XZOA 3O75A 1QHIA 4AJWA 4JPSA 4ZI7F 3IMCA 4DIFA 5ALTA 4G8BA 3M1AA 2FA9A 4G56A 3V8BA 4CLOA 1KHHA 4Q6BA 1RLTA 4HWSA 4Q03A 3EE6A 3CUTA 4NBWA 1K92A 1NJ5A 1OX5A 3VPFA 3ORRA 4QYTA 2IY8A 3KK0A 3NBUA 4JJEA 3ITDA 5M29A 4A8JC 5FWYB 1Z0KA 5KDOA 4B89A 2XRYA 4PQFA 4UVIA 4E4RA 3C2QA 5EMHA 4JJ6A 1WZ2A 3OXLA 2JLYA 4KYOB 3A37A 3PNKA 2I55A 1GNTA 2JI4A 3IUQA 1JSRA 2JLBA 2CL5A 5CB4A 5KSPA 2ZBEA 4ILIA 1HO3A 1T9CA 1U0JA 1Y7TA 2DECA 1IJFA 4CZ2A 1HNZB 4F45A 2HCRA 2VNAA 5BSKA 3SE0A 3D8RA 2D13A 1E7WA 1IU9A 3LCMA 1TN6A 2CLIB 4IDGA 2BKLA 3MT8A 1E2EA 1NULA 4E5UA 1RWNA 2J8ZA 3TLCA 3JD0A 2IYYA 4Q34A 4B85A 4XH9B 2L2QA 4KO1S 2TMKA 5IW8A 5DGTA 4CMCA 2WUWE 3WZ2A 1TI7A 4MS4B 2Q6OA 1GV0A 4JL8A 4YP9A 5BQ5A 4R16A 1RM0A 3GO4A 5FOTA 3TSOA 1FFHA 4KWHA 4GI3A 1XJCA 1I4LD 3ZWNA 4EUEA 1Q7EA 1QH8A 1ITZA 1E8NA 4CVNA 2H59A 1OD6A 3KEFA 1G8SA 3RREA 3WICA 4RA6B 2FWJA 2QRZA 3KIPA 4CKBB 2KB0A 2Q6TA 4G4SO 5CLLA 2X76A 1ZJWA 1F0KA 5JATA 2J33A 5HZGA 1DP4A 2Y9MB 2XUPA 1UT6A 3NVAA 2L0TB 4KQ1A 3AGPA 1K8KG 4CEHA 4CQLA 5T8IA 3KZVA 2GD6A 4DN6A 4QELA 4KLRA 3K09A 5LP6A 4DW8A 5HRAA 3EY9A 3NASA 2QE7D 3N6RA 2O48X 1N9KA 4KGVA 1L4KA 4HJXA 3L7LA 4E5NA 3KT8A 2EGHA 1GG2A 5C8YF 1E3SA 5UKDA 2W93A 2ERXA 5SY9A 4KRYA 2W83A 3BFVA 2QN9A 1BE8A 1R15A 4RL4A 4ANFA 3WYCA 1ENZA 3ONFA 5SZIA 2WBLC 4I17A 4AQYB 1TAQA 4C14A 3GA7A 4XM0A 2Q9CA 2ECPA 1USUA 2PVSA 3LS8A 2GAAA 3CH5A 2WFAA 3ND7A 2ZISA 5FBRB 2WWTA 3ZIDA 2FFHA 4N0QA 4XKCA 3OT1B 5IKPA 3AJIA 1H9CA 3HC7A 4B94A 3EPKA 1MX3A 1Y4SA 2OXCA 3UM9A 5CCXA 4Z3OA 1D7AA 4DBLE 1ST2A 3S8EA 4IF6A 2R11A 4HBDA 1ZVJA 4HLUC 4F5YA 1NMEA 3OXGA 4BNTA 1XA3A 4WJLA 1QOZA 3C7AA 3FF4A 3W04A 4U0KA 1LLCA 4CTJA 1ZKDA 1G98A 3ND5A 2EIHA 3VOSA 1C4WA