5BNWA

The active site of o-glcnac transferase imposes constraints on substrate sequence
Total Genus 280
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
280
sequence length
715
structure length
694
Chain Sequence
PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDIYDNRIVLNGIDLKAFLDSLPDVKIVKMKNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The active site of O-GlcNAc transferase imposes constraints on substrate sequence.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 280
structure length 694
sequence length 715
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5bnwA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5bnwA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 5bnwA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 5bnwA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5bnwA03
1M5RA 4UI9C 4Y6WA 5DXFA 1ABBA 1P5QA 3BD8A 1AHPA 2VCHA 1L5RA 2C1XA 2YHCA 4BTBA 4EJ2A 3MTDA 1KLXA 2VGYA 4N9WA 4I9CA 1FTYA 1NVKA 3VTYA 3T3EA 3S0JA 2PYDA 1C8LA 1C50A 3K9IA 2F3SA 3MQFA 1SXPA 1YGPA 2G9QA 3CUVA 1NZFA 2WTXA 1P4HA 1KT1A 4A1SA 3HBNA 4MICA 4NRHB 5JJ7A 1E96B 5LCWJ 1JG7A 4KXKB 1YA6A 1PN3A 5CHEE 2SKCA 5KJMA 5EKQD 4MRAA 4G26A 2ONDA 4X6LA 3NC4A 4X7RA 1OUVA 4WACA 2Q7FA 3S7FA 4AM9A 3MRXA 5ARFA 4I2WA 3T5TA 2P6PA 3MRTA 3UQ3A 2PYIA 1K08A 4MHSA 2VGXB 2OOEA 4KBQA 5FZSA 2PRJA 4YNDA 4MI3A 2FF4A 1YA0A 4RIIA 2QRPA 3MTBA 2KCLA 3D0QA 3AS5A 3L7BA 1HXIA 3OTIA 3ASHA 3S28A 3ZCVA 1B4DA 2Y4UA 2SKDA 4EL0A 3Q3EA 4NC9A 1Z62A 1KT0A 4RELA 4EKEA 3OTGA 4B94A 1XKXA 3TOVA 4AMBA 3MS4A 1V4VA 1Y6FA 4G24A 5DBKA 3CUUA 4O6FA 1XNFA 2GEKA 1SXQA 3ZPJA 4HOQA 1LWNA 2JLBA 3T3HA 4PQGA 4W9RA 4KQMA 1FC0A 3MT9A 3WXXA 4N2QA 1RZUA 3RSCA 3S7JA 1PYGA 3RSZA 1H5UA 3ZCPA 4JL0A 1L7XA 2GPAA 3KS2A 2F3UA 5HI7A 3RO2A 3E3OA 4BFCA 2VCEA 3HBMA 4BT9A 3CK7A 4GA0A 4J8DA 4UI9K 4G2TA 3RHZA 3ASGA 3TAXA 2QRMA 2YQ8A 1EM6A 2UWJG 2VYIA 5HQ8A 5JJTA 3UUXA 4GCNA 4EL5A 3S27A 1HH8A 2AW3A 1RRVA 3G2JA 4U0ZA 2IV7A 3MV3B 2KATA 4WADA 4BTAA 3D0RA 2WPVA 3PDNA 4RIFA 4WUYA 3T3GA 4GYYA 1E1YA 3QKWA 4UQZA 4HLNA 2FO7A 1E4OA 4G23A 3FROA 4CTMA 4GZ3A 4H7YA 5AYWD 3MSCA 2PRIA 2R4TA 5CCLA 1XOIA 1UQUA 2FETA 2OFFA 3EBOA 4NESA 3Q49B 1WAO1 5EX3A 1FCHA 4YUAA 3RT1A 5JTUA 3GUHA 2H1HA 1L5WA 1Y8ZA 3FFLA 3BEEA 3L01A 3ZCQA 3CUWA 4FKZA 1NA3A 4XIFA 4J8EA 3CV3A 2XCIA 3DD1A 4UI9J 2C1ZA 2FFRA 3D1JA 3NAZA 1NOKA 3T3IA 2QN1A 3CUYA 2KC7A 3ZGQA 4HOTA 2ACWA 2XPIA 3MRVA 4BQEA 2VSYA 3QOUA 3AS4A 3QKYA 1A17A 3U4TA 4APOA 3TGOA 2O6LA 1ZU2A 4RIGA 3SYMA 3HBJA 4I2ZA 2E2EA 5FJYA 2PQNA 4RG9A 1WUYA 2GEJA 2XCCA 3QWVA 1XL1A 4N3CA 2XMPA 3S29A 4G1TA 2C4MA 2FEZA 3RU0A 3OXFA 2ASVA 2IW1A 4HORA 1Z8DA 3E3NA 3WADA 2PL2A 1EXVA 4N39A 1KTIA 3CK9A 1NA0A 3OXLA 2V5FA 1F0KA 1RZVA 3RO3A 2QRQA 1IYGA 4GA2A 5G05C 3N71A 1K06A 3BD6A 3LYAA 1GPYA 1ZBPA 4I17A 2GM9A 1HLFA 4KQ1A 2HO1A 5C1DA 4XI9A 1F6DA 1P2BA 3MV2B 1GG8A 1WM5A 3CEMA 2QN7A 2QLMA 3GW4A 2F3QA 3DZCA 3KAEA 3G2NA 3C4QA 1C8KA 2R66A 4H7XA 2QRGA 5LCWC 4JA9A 2FF5A 4GCOA 1QZ2A 2C0MA 1IHGA 4NEQA 4F9FA 5EX0A 1NLMA 3S2UA 4G2VA 3O3CA 2XGOA 3HYMB 1P2DA 5M72A 1P2GA 4L22A 4MI6A 1Z6PA 3NCHA 4M83A 2XCBA 3H4IA 5D0OD 3LY9A 4CGWA 2HR2A 4N5CA 3EDTB 2AZDA 5FTPA 4F3VA 1VGVA 1GPBA 5IKPA 3MKRA 3Q15A 3G2HA 4BWRA 2R60A 3CEJA 2ECPA 7GPBA 1Y6GA 1WUTA 3TSAA 3WC4A 5CCMA 2BGTA 1FA9A 3FP3A 3NPAA 1B89A 2UY1B 2XGSA 2XA9A 3C4VA 2F9FA 2GJ4A 2IEIA 2R5SA 3COPA 5JJ6A 1O6CA 2G9RA 4X7PA 3QHPA 2C2LA 2YJNA 3MBOA 4I9EA 2AV6A 4LEUA 5GPBA 5FT9A 3MEKA 3NF1A 3MT8A 2AMVA 4M7PA 4GZ6A 2H1FA 4U04A 3BCRA 4U0SA 3CEQA 4AY6A 2BFWA 3PE4A 3ZCUA 5D0QD 1XV5A 4GPBA 2AVPA 4N3BA 4WNDA 1WW3A 2FI7A 1JG6A 2GPBA 3BDAA 3SYRA 3CVNA 3S7BA 1XC7A 5TMEA 4JHRA 1P29A 3L7DA 3MS7A 1PSWA 1UQTA 3OKCA 3QWPA 1TJCA 4AY5A 1LWOA 2P58C 2G9UA 2UY1A 3ESKA 1HZ4A 2HYZA 4F97A 5BW8C 4N2SA 3LY7A 4HWGA 3L79A 3ULQA 2QFCA 8GPBA 5G04C 2QN3A 3EBPA 3QDNA 1QKJA 3L7CA 5DU2A 1WW2A 2QNBA 2F3PA 3ASFA 3E4BA 3RJVA 3BCUA 3U3WA 1P4GA 2QN9A 2LSUA 4LEIA 2PQ6A 3T7DA 1IIRA 3VDMA 4KYOB 3TG5A 2WQHA 1C3JA 3GZ1A 1JEJA 2XEVA 2LNIA 1QM5A 3S7DA 2PQRA 2X6RA 2XGMA 3LPZA 4CGVA 4U0UA 3CVLA 3QWWA 4YVQC 1FTQA 1FU7A 2C9ZA 2GW1A 9GPBA 4YVOA 2ACVA 3SF4A 2PZIA 2XCUA 3OTHA 5BT1A 3SZ7A 4N3AA 2GT1A 3GYZA 3CKCA 1JIVA 3IA7A 3O48A 3KD7A 4GZ5A 4EKYA 3BCSA 4U07A 2KCKA 3FWVA 3UPVA 1Z6QA 3CV0A 2HY7A 1L6IA 1FU8A 3G2LA 4CDRA 4IN3B 3ZCTA 3LY8A 3VUEA 4EQFA 4MHOA 1P4JA 3CVQA 1FTWA 1L5VA 5FZRA 4I1AA 3ZHEA 5JTTA 2IYAA 5HXAA 4RENA 4BQFA 2IUYA 4J8FA 3ZHEB 4Z5XA 3GPBA 3ZFWA 4QLBA 3Q5MA 1GFZA 2KCVA 3E3LA 2QRHA 3DDWA 1UZUA 5ARGA 3L7AA 3GZ2A 1GZ5A 1ELRA 3ZN3A 1XL0A 3WAGA 5TMBA 4RBNA 3Q4AB 3BD7A 3NP9A 5D00A 2IYFA 3G2IA 3ASDA 4CTNA 4J0UA 3MTAA 4LDPA 2VGXA 3R9AB 4BT8A 3PE3A 3MS2A 5KJKA 2X0DA 4BQIA 1PC2A 3OY7A 2IEGA 3NP7A 3NB0A 2G9VA 1NOJA 1JIUA 4NQ0A 2ZB2A 3T3DA 4W6QA 3CEHA 4AMGA 2QN8A 3BEOA 3CK8A 4MI9A 5ENZA 4RG6A 4CTOA 4F96A 1BX3A 1A8IA 2X0EA 1L5SA 3VDNB 4GYOA 1W3BA 3CVPA 1GGNA 3AS8A 1WV1A 2Y4TA 3OY2A 5DLDA 5KJNA 4WNEA 1PNVA 2NC9A 3ZCSA 3HBFA 2QN2A 3C48A 4RIHA 4X7MA 5TVGA 3UYKA 2I6HA 2VQ2A 4HOSA 2X6QA 2FBNA 4ME2A 2GPNA 3VUFA 2J9QA 3OXGA 3CX4A 5IKOA 5G05J 3Q3IA 5A6CA 4AIFA 2R4UA 3DDSA 1L5QA 4GYWA 3MA5A 2QLLA 4XI0A 3CUTA 3UYLA 2C0LA 4AN4A 3IAAA 4HOUA 4GPKA 2VG8A 4UQYA 2KS6A 2BGUA 4WNFA 2XA1A 2IF4A 4GA1A 3ZCRA 2XA2A 2LSVA 5G04J 1Y8MA 3URZA 3Q47B 3IEGA 3VTXA 2JZCA 3OKAA 3G2KA 1FS4A 1IXYA 2QZSA 3Q3HA 4RIEA 2VSNA 3LCAA 1FU4A 1QQEA 1ELWA 4UQXA 4YI3A 2JJMA 3OT5A 1GPAA 4YI5A 3JYSA 4FZRA 3RIBA 1NZNA 4G25A 2SKEA 5A7DB 5KJLA 3TG4A 6GPBA 1JIXA 2MHKA 4WNGA 5TMDA 2QLNA 5I45A 2BUGA 3MT7A 2ATIA 3AMVA 4REMA 2L6JA 5DIZA 4ABNA 1J39A 4JA7A 2Q6VA 4M60A 4WHMA 3CKBA 3RKVA 2BISA 2DBAA 1AXRA 2IFUA 1WV0A 2IV3A 4Y6CA 2R68A 5FZQA 5D01A 5LQDA 4KQ2A 3LKUA 1NOIA 3OKPA 1NZDA 3H4TA 5BNWA 2X0FA
chains in the Genus database with same CATH superfamily
1M5RA 4M1YA 3IEVA 1T2DA 1D6JA 3OM0A 4FOSA 4KX3A 4JOCA 1XLTA 4MUKA 4OIMA 3TYXA 2BE7A 1QGDA 3ZVRA 1ABBA 4CEIB 4M7WA 3NFYA 2BBWA 4W9NC 2PAAA 3R5JA 3BB4A 5IG2A 1WTCA 2A4KA 5H9WA 1JEDA 4MPRA 1SURA 1HV8A 4M3OA 4PONA 2ONYA 3MTDA 1J8YF 5BOVA 4X90A 1C1XA 1S89A 1MVOA 3HEAA 5IAGA 4QG7A 1RXSA 3DLPX 1N5IA 3GLIB 1RAFA 2WQ6A 1HF8A 5JMND 4PS3A 1LI5A 1XIVA 4KXWA 2PUGA 4IDNA 2VAMA 3SQWA 4IVNA 5CVEA 3VTFA 3CRQA 4WCDA 1XVVA 5JJ7A 1E8XA 1OYOA 1XEWX 1VDMA 2QVXX 1I5RA 3V4OA 3ZQ6A 4AYWA 3IRVA 1PV2A 3OZEA 3FPLA 4A16A 4TSRA 1UM8A 2YHUA 5JCXA 1KYTA 3RROA 1N32B 1CUGA 2YX1A 3V1KA 1NW8A 4G01B 2E7ZA 4KRXA 4M1KA 3PRYA 4WACA 2DR0A 3FM9A 2PX5A 1GTL1 4PGGA 1MENA 5ADHA 3OHPA 2F67A 3QYPA 3V8MA 4UOQA 3VZDA 2GN2A 3MRTA 4RY0A 3HEMA 5JAUA 1RI4A 1GL3A 1IUKA 2WIDA 3DMPA 1CP2A 4PHTA 1XRRA 3ETDA 5HRAA 1TNDA 2GK3A 4R0VA 2E6KA 4CDGA 2Q45A 1C9MA 1CK4A 1AUQA 3ZGVA 3AESB 4FSDA 2O23A 3LPMA 4B75A 3E22B 3IILA 1J2EA 2JFVA 4HNGA 4IJVA 1HX7A 1ST3A 4ZYZA 1N92A 4HV4A 2C61A 4FBLA 1IOVA 1LXCA 4R1TA 4ZOCA 1E1KA 1LX7A 1Q15A 1TJYA 2WYUA 2Y93A 4LKOA 3C4JA 2I03A 3QEBZ 3I2FA 3A4IA 4LNUA 1GYRA 1T6XA 4G4SO 2VTKA 8ATCA 1M6WA 1M0EA 3JY6A 4RMHA 3IO5A 4XDGA 2HU8A 3EBLA 3DQQA 2HMAA 1QBQA 2ZIEA 3QOXA 4YWHA 2A1IA 1GQOA 4DW8A 2I54A 4AO8A 1TE2A 5A4AA 2DOKA 1DAEA 1QK3A 1T26A 4MVJH 1YL6A 2J5XA 4LYJA 4OSPA 4P4GA 3UAXA 3D8HA 4HVBA 1TUBA 2AUNA 2QW0X 3AJEA 3I64A 3I9OA 4V0RA 3QLVC 4DDMA 3WHKA 5D3MB 3E18A 4YCAA 5HVNA 2J45A 1R8QA 3AR9A 3RS4A 3RSZA 1MN6A 2O3JA 3TXMA 3LOQA 4GXRA 2IH4A 5DASA 4DWJA 2NVBA 1ID8A 1FFSA 3TW0A 3AETB 3N53A 1SIOA 3VR4D 1UDWA 1RKQA 1RHQA 5E4TA 2EU8A 1AKEA 2PJZA 4EW6A 4H3VA 3PU6A 3AL0C 2QKYA 4RVCA 3UCFA 7REQB 3PKZA 1CQIA 1RKBA 4PZAA 1CERA 4BNDA 3G7UA 2NPOA 3WL3A 5GIOE 2R62A 1YF3A 2D00A 4NE9A 5FPTA 4DLLA 4YV7A 1MG0A 1C0LA 2X2FA 3CSTA 2FZLA 2G07A 2B8NA 3V79K 1ULZA 3HGMA 4ZEXA 5M3BA 4C0SA 4CKZA 4CCAA 2O1SA 3NBZC 1UBGA 1HH8A 4I6EA 1CETA 2APJA 4QGHA 3DA8A 5KJCA 5AOBA 1RNLA 3NB2A 4GP9A 2JJ2A 1FOEB 4U8YD 1HE5A 3AXTA 3JQ8A 4KQ9A 4KPFC 4WADA 3T9EA 4D4IA 4OXRA 2P8SA 1Z6YA 1NJSA 2PMBA 4DJDC 1VE6A 2RCYA 5FINA 1EFKA 2ZR9A 1TTPB 3LECA 4BO5A 1XPOA 1PS9A 3VVMA 4UZSA 4CM1A 1EJ6A 1TI7A 1PNTA 2GBLA 2TMDA 4H7YA 4WUTA 1QYXA 4LJYA 4F5EA 1F12A 2W8BA 4GAAA 2WFLA 1QR2A 5G41A 4IHJA 5EX3A 1WBBA 1YC2A 3ISVA 3IQDB 2C4HA 4M2LA 2XW6A 3I5XA 4AS1A 4U6QA 1L5WA 4DQXA 4MPJA 7MHTA 2M32A 1HDEA 3BEEA 2OZLA 1GITA 2FQWA 2P2SA 1KK1A 3I6MA 1EQAA 3M5PA 1HDRA 1SCKA 1U2RA 5KYYB 4UXIA 3HJGA 1YRAA 1XRQA 1Z74A 1SBNE 2WM2A 1V96A 3PDIA 5ED4A 3N0RA 5LQCA 3DOHA 5DTQA 5C7IO 2ETBA 4D57A 4ILGA 3ZDRA 1LDEA 2XYGA 3ZGQA 4V0OA 3V00A 4YONB 1KBZA 2O7VA 3W8DA 3G8YA 3WHIA 3IV6A 2ID7A 5B6JA 4M88A 4ZARA 1ONOA 2Y27A 3HO1A 1Z08A 4L3OA 2J4FA 4GE0A 5ALXA 1XAHA 6ADHA 1MEOA 2P3QA 3STWA 4OQLA 1UMDB 1SCAA 3GJTA 1HSZA 4XD7D 4KUEA 5JCJD 3T7KA 1QPZA 3QWHA 3BB3A 3R3YA 2DR2A 4KO1S 1QJCA 2GBFA 5AM4A 1M5UA 4YV0A 2WICA 5AW3A 1KKUA 4URHA 3PREA 5LJLA 1RKUA 4L7TA 3FETA 2FO1E 4WXPA 2ZI9A 3LXRA 1IM8A 3ORFA 2O0MA 1JVNA 2IHTA 2FEZA 4M8SA 7REQA 1P9WA 2VQDA 2H54A 4WBNF 2ZU0C 1SVNA 1VBKA 2RGXA 3HYNA 5DCYA 3U5TA 3EW7A 3PJEA 2PL2A 4FJ2A 2BEUA 3EVFA 3LUHA 3TJMA 5HKPA 5F23A 5C81A 5DK4A 5ICEA 3R6GA 5IT9A 4GTMA 4DA6A 1UEXC 1EFTA 1O1RA 1R8SA 2RGNC 4FIZA 3NAWA 1KOFA 3E7FA 1SA4A 1TZJA 3D3MA 3UVEA 3BD6A 2W8ZA 4IRUB 4U2CA 3MCUA 4K9PA 4R1PA 4LYYA 1YR9A 1T4MA 2XT6A 1IY2A 3KU1A 4RLQA 4U3JA 4R01A 5CA1A 4JLOA 4MOWA 1VIMA 1V48A 5CH5A 3KXLA 2CDRA 3REOA 1M76A 2JB9A 4D9FA 3LS2A 4Z3KA 1W46A 1QHYA 3OO0A 3C5WP 3F2IA 3Q1LA 3ULKA 1VLLA 2YHBA 2XXJA 3VKWA 4A0SA 2Y1CA 3N2GA 4BLUA 2OZEA 3IXMA 2Q5EA 2QXUA 5KNLA 1WZ2A 4HB5A 1QGAA 5JZSA 4TVOA 3X1ZA 2Q50A 1GNPA 1S6YA 4ZO7A 3E03A 1C3OB 1T1IA 2WJ3A 3G2VA 1SEPA 4KB5A 5EXPA 2YINC 2O5RA 4C4AA 3FU6A 1JR3E 4BY6A 1QIMA 3OFNA 5FPSA 1HG1A 3QX9A 4AMYA 4EBAG 5IAOA 2VHVA 4R68A 3FVVA 4ZYUA 2HR2A 3UQZA 1X94A 4L23A 1KGDA 1WWKA 1V1MA 2AZDA 3FUFA 4L8WB 5D3MA 3WAJA 3MAGA 2UUBB 3G2HA 3KPYA 2LO6A 1KY3A 4AL4A 1Y6GA 3NOGD 1YQWA 1TM3E 3TSAA 2AWNA 4WWHA 3H86A 2R96A 4RPLA 3STTA 4HRMB 4X7PA 4EHAA 1CQIB 5KI6A 1YIOA 2EFCB 2AV6A 4LEUA 3EY4A 4GLLA 1OA1A 2OOKA 5CMYA 2XVYA 3KB6A 2FP4B 3GQBB 4IQ4A 3WNQA 3AIMA 4KCGA 4FB4A 1NM5C 1QO9A 4ZVPA 4BY9E 5FEUA 3CSUA 1K88A 3KNZA 5BYBA 2LWIA 1Q92A 1SWWA 1PV1A 3I04A 4GOXA 4J7CA 4MCJA 3WAKA 3IBTA 5U4QA 4EB6B 3O4JA 4FOPA 2RGUA 1F8FA 4K6CA 1JUDA 1EWQA 1G4UR 4BFZA 3I52A 4HPXB 2CF5A 4J1SA 4BEJA 3HP1A 3L08A 4PR3A 5KYWA 2OEWA 1WBDA 3HDGA 4TTVA 1LWOA 2YV5A 1N4AA 4AYXA 1D09A 4KDCA 4LVOA 5EKDA 3QP9A 3UCXA 4PLGA 3ROKA 4AKHA 3ESKA 4F97A 1KAHA 3HR7A 2GQ0A 1PAQA 5DMXA 4FBGA 4LYFA 4BO8A 4F2DA 2B1QA 1OIVA 1SA5A 3SX2A 4DF3A 2HSJA 2YWEA 3G2SA 3T4UA 1KKMA 1TQ2A 2WIAA 4FD3A 4WLFA 1XUOA 2ZSBA 1QKKA 3OP4A 3E9NA 4PIMA 4EG8A 3PRZA 1PEAA 2CUNA 3DVLA 4FOTA 1ESEA 4YJ2A 4EO4A 1E7SA 3NVAA 1I5OA 4L73A 3CHMA 2VAXA 1DEKA 5A4JA 3VMMA 1L5MA 1A9RA 3IAUA 1NFIE 1KC3A 1IY1A 2P41A 3AKEA 2EBWA 2H9IA 4AF6A 1PDWA 3LIIA 3HJFA 4ZAFA 3ANTA 3L17A 1I32A 3KZOA 5DBGA 4W5OA 3IE0A 4R84A 3ZVNA 1NBOA 3T7SA 2ORIA 3H1GA 3K9QO 4G0VA 4OP2A 3LKZA 4B35A 3DBVO 3R7QA 1TQ8A 3N8IA 1JU3A 1WUKS 2IE8A 4JI8B 2AI2A 1FNMA 2V7VA 2X5KO 3BJEA 5HCNA 4EQZA 2OZPA 5HZHA 1USVA 4JDPA 1Q84A 1N94A 1GYPA 2XCUA 4LISA 4R8VA 1AGRA 3H11B 5K8TA 1CY2A 4C20A 4CMIA 3ZLTA 5E3HA 5CDFA 3DHEA 4MIKA 3ESCA 3MPUA 2XDYA 3HKBA 4ZAVA 1LSSA 2DPHA 3GOQA 2HY7A 5FTMA 1L6IA 1NYTA 1NUHA 2OCPA 3GMSA 4XH9B 2JJ1D 5H70A 4MUAA 1E99A 2FPPA 3EHMA 1RBZA 3ZCTA 3SBSA 5HE9A 4PSKA 2WQ7A 3SF0A 3VUEA 4YUYA 9ABPA 1PE0A 4F6LA 1E9EA 4U3JB 1G64A 3C3KA 1K7SN 4P4SA 5A4FS 3IMEA 1XRJA 3K92A 4IAOA 1RM4A 4MINA 4CR8A 2YWJA 3QX7A 4X00A 1XQ9A 4D6PA 4ZOEA 1EK0A 1K8KG 4FNMA 3D9LA 5JALA 2LD4A 1OCEA 3F49S 4AVXA 3CINA 2KJQA 3I83A 3B36A 4D4JA 5J4LA 2PJUA 1N2BA 2WYOA 1GFZA 4MXDA 2KCVA 1TK2A 3AVYA 2P2CA 1AO3A 4LG6A 2L0TB 4E5KA 3U44A 1JJVA 4KH1A 3JQDA 2Z2IA 2A9RA 1H23A 4YNBA 1ODFA 5AHRA 3WYNA 2NO9A 3C6MA 3EZXA 3THWA 3DXFA 4L9RA 1CUBA 1B0AA 2QMQA 3FKSA 1RI3A 1TDJA 2V65A 1C0EA 3FAZA 2VLBA 1G3IA 1LGYA 2BV3A 2G06A 2GHRA 2GX6A 2ZT6A 3PQ3A 4L15A 1QH8A 2IXDA 5LYJA 5NULA 4LJ8A 4KZ0A 4BBZA 4BQIA 2PZBA 2VAVA 3AUYA 2A78A 4KR9A 4EZKA 1MTZA 1LZKA 3A6JA 3FOWA 3U3JA 3N8KA 4OKSA 4W6QA 2Q6OA 3FPGA 2X2EA 1SUPA 4L95C 3KQQA 4GOLD 3Q2OA 1QG2A 4ZVRA 2NSHA 1JECA 2JD2A 4Q1DA 3OCWA 4GXTA 2C31A 3ZUVB 1A8IA 2DHQA 3U9WA 1QF7A 3WG7E 4PQRA 3TOZA 4FCCA 5AKYA 2BKAA 2GXQA 3C3JA 1KI8A 4J6EA 5LWHA 1J8MF 1V5FA 2AGVA 2VEDA 3RK0A 1ISSA 5CEFA 4O2AA 3SD5A 2LE0A 4S1TA 1KMHB 3EXFB 4F6RB 3L16A 5IBPA 4IWYA 1G17A 4C4TA 1ISPA 2NSZA 1Q0ZA 4FR0A 2YN4A 4QPDA 3D6TB 3WKCA 5WRFA 2OQVA 4RH0A 4OLFA 4A0RA 1YQXA 2Y0PA 4U63A 1EFVB 3Q3IA 4HRNA 4C2UA 4LCBA 2P7HA 4QTZA 3O73A 3ZU6A 5IAAA 4K87A 5C52B 1KY5A 1DOZA 3D7LA 2G36A 1QGZA 2JLYA 1YZLA 2WT8A 4WFKA 4AP5A 3BTVA 3DKRA 1N6IA 5ALTA 4C0XA 1XZPA 1FUEA 1LNSA 1ZN2A 2BI8A 4L5CA 2WWYA 3JYLA 3CN7A 1MT0A 4H08A 3CEAA 2BFMA 4WJKB 5AK0A 4LE0A 3HUTA 2AOTB 4Q1AA 3U48A 3VMFA 3RC1A 5AVJA 4MVYA 1T4GA 1NP7A 5IBQA 3WXBA 3HFRA 3QMVA 3EVNA 1MOPA 2Y0DA 3PX7A 4LF5B 5JC8A 3UHOA 5KNBH 1SKQA 1SZJG 1U5AA 3DEFA 3RUIA 3I5AA 2PLAA 5FRDA 4N0QA 5LA6F 4FS3A 1IFXA 4YIHA 4B0ZA 1FU4A 2XZLA 1J5XA 3NJ8A 3WIBA 3KL2A 3PUJA 3TLKA 4F7DA 2D0PB 3UOGA 3PUWA 3GYXB 2ZYUX 2JLSA 5AKHA 1E1RD 1EFPB 3R8CA 1F2TA 1HE8A 4X71A 1ILEA 3TWVA 1WL8A 3GNQA 2XUZA 1XTVA 1V7ZA 1BO6A 4HWSA 5A7DB 1A2BA 1ESDA 5C5EA 2A5UA 4YMLA 2FEKA 1EX9A 3HACA 1R5OA 2QLNA 1OX4A 4DRXA 3L84A 2FP3A 2II6A 3WLHA 5KYXB 2IYLD 3QK7A 5TRTA 2GM4A 4XIJA 2IBMA 4DYHA 5FJJA 1OWMA 5EIFA 1DQYA 1KQPA 2P2LA 1U7DA 1JJFA 4ABNA 1UWLA 1HUQA 1F60A 1R37A 1UMDA 1Z88A 2GYUA 2DPYA 2XUFA 3OJWA 3PGLA 4WUVA 3F7TA 1M7BA 4WHMA 2Z4SA 3YASA 2DTXA 4EW3A 5E9JA 5C2JB 4JUFA 3MGBA 3ANNA 5TGDA 4LJRA 1U8EA 2BVNA 1POWA 2W83A 4G5YA 2QXYA 5EZQA 3PFCA 3KRTA 2HFJA 1OXUA 4PM4A 3W4IA 4EVSA 1OZFA 2YV4A 2R2LA 3FGOA 3QV2A 4Z4GA 2QRUA 2I4IA 2PT5A 4C78A 4QUDA 5CX1B 4P2BA 2Y1LA 3TH5A 2JBAB 1KVSA 4C0HA 1N9GB 3TI9A 3RYCB 1N34B 1ZH2A 4GECA 2N1MA 5DLEA 4LV5B 4R9SA 3MYVA 4Z7QB 3TDKA 3CCCA 2VJKA 4N5NA 4Q4CA 1OB2A 3R24A 4IGIA 5CA0A 2ILRA 2ECQA 4FI3F 4OHRA 4DMFA 1QC5A 2VTVA 3OT1B 5JCPA 2VT2A 1GHTA 2B99A 3KZVA 3WK9A 4D9CA 1YB4A 3LJKA 4KFRA 5KU7A 1JB1A 1KLXA 2GRJA 3T9KA 4RSRA 3JVEA 1T9HA 1G8GA 1NVKA 3ELDA 1VMIA 5JWHA 2O1EA 2ZT7A 1ZLXA 2MYUA 4IJWA 3VX3A 4BL5A 5K20A 2DWCA 4G1MB 2WNIA 4HS9A 2AZXA 3JZMA 3ER9A 1ZUWA 1PSZA 4D1YA 1H85A 2Z4RA 3WL8A 4W5QA 5C80A 4L4UA 4GOKA 4LGMA 4RGQA 1VYTA 3C3DA 1F7UA 4UBKA 3HM2A 5AXBA 2BTQA 3NRBA 2H9YA 3E0XA 2BSQA 3WMWA 1GGEA 4RVBA 5ENSD 1AF7A 1J4AA 1G7CA 2FU5C 2GZMA 2SKCA 3AOEC 2C94A 2BFFB 3ECSA 2FPKA 3N58A 4MRAA 4E88A 1RZ4A 5JAHA 5MGBA 4EZBA 4JD2G 3MCZA 4EF4A 4LSGA 5H16A 3WKDA 2QPTA 2PK3A 4HFRA 1O94A 3IP7A 4GI5A 3K6SA 4LNBA 1QIFA 2XWQA 1JAHA 1OC2A 5IDYA 3ADBA 2XWBF 3LHIA 4L5IA 4MEAA 1NN5A 1YVPA 3B3JA 3SLGA 2IY0C 4KBQA 3NS7A 3ZYZA 1MZPA 3MSXA 2FWPA 5IFKA 3E9YA 3DCYA 2Z2ZA 4C3OB 5SYNA 3HB0A 3FCCA 3INTA 2I1KA 1ECGA 1LFDB 3E2IA 3GIDA 5EG5A 1EGHA 2PVPA 3E5NA 1KQNA 1I6LA 5DBOA 1PWHA 3RFFA 2OB1A 3WK8A 4BO1A 1XDBA 1JWFA 4A63B 2VJPA 1SJ9A 2QK4A 1H5QA 3AHCA 3NHPA 4X92A 2NU7B 3CIFA 4I1OA 4LGVA 3U7QB 2CLDX 3ZDAA 2OHOA 4AQ7A 3TRJA 1ZLYA 4O2AB 3RCBA 4A5SA 2HRCA 1NNUA 1X19A 5J23A 3SFYA 2E1RA 4HUQA 4NZNA 1UKVY 3AF3A 3OE7D 4NR0A 1Q16A 2VAWA 3TRDA 5IAEA 1OFUX 5IK2D 3EEOA 5C5IA 5SZKB 4ZI3A 1Z3YA 1NG1A 3DFZA 3T6KA 4A36A 3V2XA 1X42A 1H6CA 3W6ZA 4YP5A 5JS1A 4KQMA 2C7VA 1U0LA 5KYUB 1Y1LA 4QAJA 3ML1A 1IWOA 4UAUA 1ICEA 4MAAA 2OPHA 4GLFA 1DBPA 3UZUA 1PWXA 5HUJA 1DCFA 1X1EA 3LP8A 4BERA 4QYIA 2D1TA 3VR6D 1SCIA 1UBLS 2OC9A 3QW4B 3AVUA 3KKOA 3W6UA 2ZE5A 4ZCLA 3ZE2B 3FOAA 3AM1A 1T36A 3DAGA 1RYBA 2FRVA 2VUHB 4ANWA 3DBSA 1OFVA 1UFOA 1Y6IA 2G67A 2A0UA 1Z8FA 2OHFA 2YVUA 3QFRA 1RI1A 4NYJQ 2HA2A 3HMKA 4JI7B 1U99A 3SZ3A 4JNCA 4ARBA 1NVVR 1KIAA 1VJ5A 4BVKA 2QN6A 2XDAA 1FJ2A 1XEFA 3KVYA 3UV3A 3AP3A 1T13A 3VKVA 3DRAA 1DV2A 3B8EA 1TT5A 3ZYCA 4BGVA 4KRFA 4C87A 1YSCA 3CISA 1UXOA 5F51A 3TLYA 3N05A 1G21E 5GIPE 3AZPA 1B6SA 4TKUB 1K75A 5CBPA 5F52A 2O48X 3TS1A 4OK3A 1A9XA 3BX1A 4AROA 1P1BA 5BV1A 2PUFA 2XJ4A 1F9AA 3NVDA 1QQTA 5HZMA 4GPMA 3EXG1 1IXRC 2NU9A 5EFOA 5HKLA 2Y1KA 3HUDA 3MCWA 2WG1A 4ZANA 2XRYA 1Z3CA 4CW7A 3FTSA 3QKWA 1NBAA 1KDYA 3U49A 1CUFA 3A1FA 4GXQA 1CE8B 1XN4A 3H1BA 1IZ9A 5CNKA 2HMUA 1R0BA 1V7QA 3IDZA 1HMYA 4BE4A 5JCOC 5JVDF 1OI4A 3A70A 4AY3A 1C1DA 1DBIA 4IJKA 1SAYA 4RKEA 4X41A 5FO1A 5JTUA 2YVKA 2PZFA 3EUWA 4M9SA 5C34B 5KVSA 1XYYA 1H2RS 3FU0A 3PUZA 2XGJA 3PF8A 4I81A 2EKDA 4IWNA 1NL4A 2FGJA 5ICGA 5DM2A 3DUFA 3Q10A 2XNDA 3F3SA 4ON9A 1ZIDA 4UUQA 3UO8B 3SJAA 2A4ZA 3FNEA 1XX6A 2C1ZA 4QO7A 1R9GA 1AOXA 3HUFA 4OAPA 3I58A 2JLQA 3LT1A 1NOKA 5AJUA 5CEAA 5LDGA 3W78A 4CRWA 1HTTA 3AL2A 3LC7O 4CTJA 3A4MA 1VHDA 4J8SA 4Q3AA 4HOYA 2Y2VA 3MVEA 5JROA 3FDIA 5DN6A 3H5NA 4FYXA 4IDHA 1HC7A 1YS1X 2UZIR 2VOJA 2PH5A 5FYQA 1PUXA 1WD7A 3QX8A 1UDXA 4FSHA 4BQPA 5JFOA 2GK6A 1IN1A 1MRSA 2A9KA 3KJGA 1R4NB 4G5HA 4RG9A 4MUBA 1TO1E 3D59A 3KUDA 2JD1A 1EX7A 3T7JA 4KXFB 4HB0A 2IHJA 1F2UB 4AJIA 4G1TA 2PKQP 1JCQA 3RU0A 1HDGO 1PZXA 3L6AA 1T6BY 2MSWA 3L0IB 1XEAA 5IC5A 2J3QA 3CPSA 3V6LA 1RYDA 4BS9A 4R1UA 4DNPA 1O8BA 2WJ6A 1Z8DA 2VJMB 2C2KA 2A1TS 1J21A 3L82B 1WMBA 4Q4AA 4TWIA 4NX2A 1EWKA 3OEEA 4V38A 4O4JF 3LA6A 4OV6B 4B3XA 4B4KA 2BFAA 3RC3A 1EEXB 1O95A 3FOEC 4O2RA 4BMCA 1UOEA 1JZQA 3Q7AA 2AG0A 3AR5A 3LQ4A 1S2OA 4QDXA 4FFVA 3WKBA 2PFGA 1JPLA 3DE0X 5F7XA 1SWVA 1E4EB 1V8OA 4LHSA 2Z9CA 3QKRB 3FWZA 4G0QA 5D85A 5LB4A 2PKWA 1AX9A 3EEBA 4IUYA 3UM9A 3RRXA 2ZUSA 3I0ZA 2EFGA 1KEUA 3VPGA 5JDCA 2WUWE 3G8BA 1T3GA 4TWZA 4A8JB 3GFSA 4UYJB 4FGUA 4DG9A 3VVCA 3LFUA 4IGFA 4KRYA 5DYNA 3ZU2A 1KBOA 1C7ZA 1N9ZA 1YE5A 4KTTE 4Z3DA 3ZU4A 4H7XA 3L5OA 2VP2A 3TEMA 1U0BB 1PO7A 4KPEC 1DQSA 3WLOA 4UUNA 4AP6A 4PN3A 1IXVA 1QZ2A 3HI6A 2Z6AA 1U8FO 5C53B 5EX0A 4G2VA 1PR1A 1PJCA 1I7QB 4BGIA 2HT1A 1ZO8A 4L22A 3NCHA 3EWAA 2ESRA 1M2KA 1Y9EA 2A35A 4UPVA 3G0OA 3DWLG 1NMXA 2QTHA 5FTWA 5JHBA 4GZMA 2VDJA 2GZ3A 2YIJA 2P11A 4PTYA 5I4KA 5AIJA 2ZVPX 1DUIA 4BWRA 1F4VA 3Q2IA 1EVQA 4NYIQ 1FZTA 3SQNA 3IULA 4HAOA 3GJ3A 3SF8A 1SQ0A 2BWJA 1J56A 2CHUA 1EF1C 3ASOE 4FZVA 1V43A 2CLMB 3PKJA 3F7OA 2Q21A 2XGSA 2GK4A 2XA9A 3A4YA 3OEHA 3QXGA 4DSUA 2BFCA 2F9FA 2A9JA 4MH0R 5JHGB 2JA2A 4AJ1A 1ENZA 5JJ6A 2AN5A 3EXHC 2V9CA 1ULAA 3DMTA 3FDZA 4GGMX 3N2GB 4I9EA 4QBTA 5KHOC 1AH2A 1NWCA 4P93A 2ZULA 4EHBA 4C4PA 3ZIDA 2VI5A 5ALMA 3NZSA 3G79A 3DL0A 1KZ6A 3MQ4A 3ZX5A 4Z3OA 4P1ZA 3IEUA 3VNSA 4B8WA 2CSXA 4DX2A 4AWBA 4AMZA 3OZWA 2P3SA 4AUNA 1C8VB 1FFEA 1ZP6A 2NUBA 2O57A 4EI7A 2QG4A 2RHGB 3O0DA 3ODPA 4B2LA 3QENA 4BFYA 3HFJA 1ZOLA 2R1ZA 2VF7A 4F56A 4JEHA 2MSDB 3OZTA 4K5AB 4UKDA 4AY4A 1YYHA 4NCIA 4F5YA 2V3WA 3PC4A 5ECYA 5J47A 4B45A 4DA8A 3T5XA 1FDVA 3F5SA 1ZA2A 3ZDZB 4LJKA 3FGZA 3EK2A 1YGYA 2Q6KA 4HQFA 4N2SA 4MUJA 1AQJA 2ICAA 3LXMA 3FPAA 3OBBA 4INAA 4TPKA 1N2OA 5EXSA 2GXAA 1E3WB 2YJTD 5THXA 2QN3A 3MAJA 4F4DA 2QYTA 2PMKA 2PZLA 2UUOA 2VA8A 2BKVA 5H4HA 3PVSA 1U0EA 2F3PA 3R9MA 1F0PA 3ASFA 1N6HA 3GVCA 3N28A 3KIPA 5ALEA 3GBSA 5JAZA 5K7SA 3JVUA 2P9TA 5KYNA 3INYA 1CY7A 4W5WA 1P5RA 2EF0A 5CDGA 4BCBA 4MUHA 2CXXA 4ZMBA 1GTRA 1TPZA 2H52A 3CMCO 4PIVA 4S1OA 1H4VB 1KARA 4Q4HA 1RFLA 3ONEA 4Q9IA 5DF1A 2BKKB 1T0HB 5TF4A 5LP6B 1UXGA 1L4LA 1X1TA 4DCOA 5IKEA 1HFAA 4DGQA 1YB6A 1OAOA 2PQRA 2RAVA 4Y2UA 1CEXA 1TK9A 2HQSA 2R65A 3H0KA 3BBPA 1YAJA 3ND8A 2HK9A 4M49A 2ATXA 4TKLA 3LT2A 1CR4A 3KB1A 3WRXA 1NF2A 4HUTA 4RPKA 1QAMA 1T9CA 3GNTA 2A86A 1K68A 3I76A 3H2YA 4J3FA 4AF8A 1P2VA 1DTEA 2BC9A 1ORRA 3ONNA 2DCUA 4FMCB 4MYCA 5JCZA 3RVPA 4MKIA 1KRXA 2KQUA 3FYUA 5LOVF 1RPNA 1U0JA 3SAJA 4CDNA 2CHEA 1GW6A 3HJAA 5A62A 1O5MA 2C5BA 5E6RB 1RFGE 1ZD8A 4LWQA 3EH1A 5IYZF 3AWIA 5TQJA 3UOWA 3AONB 3DUWA 4DLWA 3ZX4A 1PJBA 3EFBA 3SS8A 4DV3B 2ZDHA 4G5FA 4I1MA 4WBNA 2BGRA 3O8NA 2QTLA 3N0WA 3R9KA 2G40A 4FHEA 3HVEA 1K66A 4R3UC 4TTIA 4Y2JA 3CO0S 4YUVA 3RYHB 1NXQA 2J0SA 2FCRA 3JVIA 4OMDA 5KYGA 3LA8A 3K73O 2HMTA 2R6FA 1U8UA 1R5NA 2G1AA 2VDNB 3IR6A 3NDPA 2DBQA 3R9IA 3U17A 3EVBA 3TW6A 3IIKA 5K8CA 3UT7A 4BPBA 3DBHA 2IBTA 1UMBA 2OT3B 3EN0A 1Y4ZA 5ARGA 2XB2A 3GZ2A 1Z73A 3DW1X 1FRVA 2VT6A 3QNMA 4RE5A 3JQ7B 4GU5A 1VRWA 1Z5GA 3FCOA 2QTGA 3SDSA 5D00A 2FR8A 1MXFA 3K9CA 5KKAA 2WKPA 3A6EA 4MRMB 4J0UA 2DUUA 2QM8A 2YZGA 4BT8A 3BWEA 4N01A 4UEWA 5JNTA 2HU2A 1Z4LA 2P4QA 5DTRA 4YYEA 4V0LA 4Q66C 1AUOA 2WHRA 3PZRA 2FW1A 3R74A 1HQDA 2XMQA 4DDWA 3M49A 2D0IA 2P65A 1QFMA 3JASA 3BXOA 4GEKA 4IGAA 3TSWA 4MV7A 1TNUA 3H0EA 4KLAA 4PINA 4CTOA 1MA3A 2AC7A 2JD0A 3D9NA 1WHTB 4RZHA 4F1PA 2BUBA 5AK6A 1HEUA 4BNKA 2QQGA 1M3SA 3AGPA 1JHDA 1R4ZA 1OB5A 2IZZA 4OYYA 1XKQA 1G7TA 3ZJYA 5CYGA 1JAZA 3ZCSA 3UB3A 3Q7IA 3B3FA 2R1TB 2BCJQ 3WLAA 5B4TA 4NG4A 1R9JA 1HT1E 3IT0A 3KS9A 3LKVA 1D9XA 4LGYA 4DR6B 2XWPA 1LD8A 2IHZA 5LBTA 3TLCA 4F9EA 3JWIA 4M3NA 1YU6A 3PD1A 5C35A 4A27A 1UT8A 1G1MA 2WMNB 3F71A 2I3ZA 2ZRHA 4KEAA 4DCMA 4IIJF 4EYGA 4JDUA 2F8YA 1E6UA 4B2IA 1KYWA 1FT1A 3FUXA 3VJLA 4AZVA 1P0IA 2BJHA 2W2LA 4JX9A 1T6YA 2F8LA 4RTNA 2WUFA 1RAAA 1FX0A 1RABA 4ZC1A 2PZJA 2Y92A 4BKQA 3AERB 5K3FB 4ZV4A 2O2ZA 3JQGB 1R0LA 1A8PA 1LTXA 2GRAA 2NIPA 4HADA 4RX1A 4YH1A 3W2FA 1PEYA 4NZ9A 3ZDQA 4TZ6A 3O3NB 3UT0A 1VCHA 4OM8A 1GWNA 2V54A 2DFTA 4BP9A 4DILA 3N2IA 3ZZUA 5F9FA 3UWOA 2VSNA 1Q0LA 1P7ZA 2R7AA 1F2VA 1TM7E 3N2KA 1Y3HA 3E7XA 3OT5A 3OTOB 2VUSA 1MEEA 3D2LA 1ZBDA 2YYZA 5I4IA 4RC9A 3L8GA 1H1LB 2OWDA 1KS9A 3VGPA 1B43A 1NZNA 2YASA 1F3LA 4Y1RB 5INTA 5JEDA 4D4MA 3FNIA 2CMKA 2W48A 3LHKA 4HS4A 3RARA 2GBGA 3L04A 2ZYVX 2H1VA 4Q0MA 2ATIA 1DCEA 5DNVA 2QZAA 4DV1B 1DWUA 4L9WA 1GTVA 1QO0D 2L6JA 1CVLA 1OLXB 1H2UA 3ML9A 1T8UA 2PR2A 2ZAOA 4DKXA 2NQ2C 3TIXB 3UMBA 1E2JA 4IDEA 4MBGA 4PBTA 1R0KA 3RKVA 3E2MA 1W0KD 3A9VA 4JV5B 5D51S 2C3MA 3HWSA 1N4SA 1N2HA 4F1JA 1TAHA 1ZOOA 1WUHS 2BZSA 2QTVA 3ZE6A 4DAOA 8ADHA 3IOBA 5B2EA 2W6PA 1RJDA 3L54A 2EIHA 2FSVA 3TMYA 4BO3A 4YAJA 1NOIA 3H4TA 4L0CA 1BA2A 2XTZA 5EZYF 4Z0NA 4ZV9A 5AW9A 1ESCA 1P1RA 3TOCA 4OK6A 5CG2A 3GD7A 5EKXA 5JIBA 1DAPA 4AN1A 1P9OA 2XE8A 4JI4B 3KSAC 3E32A 3WKAA 3FHTA 2VAPA 1PLJA 3ES9A 3QMMA 1PEDA 1OFTA 3N07A 4II7A 4Y0VA 3SHQA 2P7IA 2ZBGA 5BQFA 2OO5C 5E3JA 3T4XA 4BTBA 1QOZA 2FZKA 1BS2A 4QL3A 4YGYA 1A95A 2IU3A 2C8KA 2YVQA 4II2A 5D66A 5FWNA 4FGSA 4HI9A 3FTDA 4DJ5X 4MJLA 3P9ZA 4XUEA 3S0JA 2V7QA 4Z9YA 4YIKA 3I9KA 1N5LA 2I7XA 1MC5A 5D1HA 4A8TA 2OL4A 1LLFA 3ROGA 3MWEA 3BMOB 3E9ZA 4KXKB 5GY7A 4O4HA 4G5QA 1PN3A 2PUVA 3HJCA 4LXYA 5CHEE 4ZODA 2VJMA 4G5OA 4ALNA 4ZHSA 3NONA 4PZDA 1UFKA 1IBRA 2ONDA 3JWGA 1I8TA 3PHJA 4CV1A 1T6ZA 2P9KG 2IUFA 2FX5A 4JQCA 2O19A 5AW4A 2AN9A 1FYDA 5C8DA 2J9RA 3K30A 2GXUA 5JY1A 1V5WA 5DNUA 5CPFA 1MQ9A 3H2SA 3NATA 4UBJA 1C7EA 4B0PA 3W5HA 1B1AA 3ABRB 1RXWA 4XSHA 1JJBA 2G08A 3I2KA 2HPVA 5DE3A 2EBHX 4GUAA 4UNQA 4PYNA 5JE8A 1L4YA 1IE3A 1SIWA 1Z2CA 2RARA 2I9CA 1JSXA 4FGZA 1KKLA 2BFPA 1CR6A 1SZDA 2E1PA 3K1AA 3QLUC 4X45A 5H68A 4ASUA 1DIHA 1VSBA 1X38A 1AIPA 4TXPA 2G0NA 4P7FA 4YJKA 3ZIAA 2IOHA 4YWJA 4KN5A 3SKVA 3X1DA 3TQOA 4D9NA 4K9OA 3IKLA 4NOKA 3KKLA 3V80A 3ZLVA 2FQ1A 3QWBA 2WYHA 2EFHB 3EXFA 2GA9A 3KSRA 4OQPA 2X4DA 2VQ3A 4F6RA 1VJCA 1BI8B 3TOVA 2WWWA 2VDKB 3NXKA 4FOOA 1XMOB 1SUAA 3UT5B 5FO0A 2AG8A 4KR6A 3KD2A 3M6FA 4CPDA 4EATA 2WDPA 1OJ7A 2W58A 2IYSA 3DWIA 4MZXA 4Q3OA 3FZQA 1OIWA 4QFVA 3IB3A 1FRFS 2WVHA 1WA5A 4W9RA 3WYEA 3N5KA 1AA9A 2GVDC 4KQGA 2WMNA 3FLAA 1YR3A 1IZ7A 4A8JC 1PT8A 4F84A 5HKBA 2ZJ3A 2AH5A 3MJHA 2AMYA 2X0KA 2QRVB 3SG0A 4LHXA 5LNK1 4YCJA 1WEHA 4LCTA 1F1BA 1SHUX 1Z56C 2F3UA 3R3HA 4J16A 4PZ0A 2HUPA 3RB8A 3M81A 4DIMA 4F71A 2OFPA 1Q57A 2HA4A 2HF8A 2QIPA 3FDZB 2J0VA 2VCEA 3LU1A 3SQDA 4DBLE 5CBKA 4GA0A 1N57A 3AJIA 3D4IA 3GLHE 2IYYA 4MUGA 2I1JA 1N7JA 1MW8X 3OLXA 2WMDA 3HCBA 4EQ6A 2XEHA 4MIOA 4GNRA 2LV8A 5ALIA 3WX0A 2KB0A 3S2UA 3PR1A 3ZEIA 3SCZA 2WAXA 2R8OA 4PS0A 1RC0A 4UU0A 4MIYA 1WTAA 1DAGA 3VJRA 5DGIA 2MHCA 3MV3B 4HB3A 4KT6B 4BAGA 3Q7EA 5BVHA 3KB8A 4H1UA 3H42B 1N6LA 4YRTA 1JHYA 1I6KA 4JP2A 3DDZX 4N5MA 4YMIA 3U66A 1TD1A 2ZPAA 4XPIA 3ZKJA 3HR4A 2XEEA 1PR0A 3MBIA 4GYYA 4MGIR 2RFLA 3X2EA 4RJKA 3E1SA 2PSFA 3DGFC 1O1YA 2O2CA 2QSZA 7AT1A 2BN4A 4MKGA 2GAOA 1RHUA 2PS0A 2GEBA 3VM6A 2W4MA 1RM0A 2Q8NA 3CZ9A 1J0EA 1XNHA 4DVGA 4QHSA 1FDTA 2WKRA 4RH1A 2ZJZA 2P5YA 2XVXA 3DXXA 1N6OA 4UCWA 4HAWA 4XWYA 1H3EA 1Y1KE 2I67A 1H0KA 2O4UX 2VDWB 4B3DA 3UK7A 4QGGA 3B7TA 4CM8A 3CUWA 3NQPA 3NYRA 4JI1B 5KHAA 4O29A 3VH1A 3U4AA 3SVLA 2RSFA 1JPNA 2RAFA 5AQ7A 1JFFA 1OJLA 5AVWA 2W98A 2EKLA 4URZR 5K3OA 5CIYA 5D3KA 3EDCA 2O8FA 1NR7A 2I55A 2R03A 1H8HA 2DQYA 3T3IA 3O75A 2B7CA 2RJOA 2Q1YA 3KEGA 5K3EA 2E3JA 4HPJB 2PT9A 1O0CA 3AS4A 5JSQA 1G6HA 3PHCA 4ASUD 6CHYA 4NXMB 1KDRA 2FOIA 2ZP1A 3FYSA 4ZEVA 2GK7A 3EIQA 1R6VA 2G77B 3AU4A 1I2CA 1QGYA 3JVVA 3V7FA 2FJEB 4GLOA 4RVUA 4BE7B 1QE0A 3SXUB 2P9YA 4QFMA 5ED0A 1MHQA 1P44A 4FDAA 4ZXFA 3IUMA 2QQ0A 1QTQA 3RAUA 2QENA 3KLMX 2X1VA 4EPZA 3QTLA 2XMCA 3A1NA 3W5BA 2Q5QA 1L1EA 4G1BA 2I6TA 1MT3A 4C2BA 3I72A 2VJOA 3EC7A 1BDIA 2QX9A 4MVJA 1DC3A 3ZHUA 1QIEA 3N3AC 4QSHA 2YHIA 1DT5A 1KTIA 3UMYA 2JFYA 1G5HA 1F0KA 3HCPA 2OUIA 3KC2A 2PUBA 1D2EA 1L4KA 5A9TA 3TW8B 1BMTA 4OMCA 1G3RA 2UVDA 3UMSA 1W30A 4LE2A 2IGBA 2XNHA 3HN2A 1QRTA 3HK2A 2OM6A 1ZBPA 5AARA 2KLBA 2OP1A 4I1YA 1K7FB 2HCTA 4O3FA 1MB0A 1U0GA 4OTZA 4XJTA 2P2ZA 3QA9A 1X8KA 3WO0A 4MCIA 1IBLB 2YWFA 4RMNA 2R6JA 5KOJA 5KYKA 4OBEA 3B89A 1NXWA 1M10A 2C9DA 2PBRA 3HCEA 3AU5A 4LXXA 3GW4A 2ZPTX 3FN4A 1I0IA 1RJFA 3G68A 4DA4A 4HCJA 1KP2A 4LJ9A 4I1IA 4IVQA 3D8BA 3QLUA 1QQAA 1KY2A 1SCUB 3APDA 5FI1B 4NAVA 2H7XA 2R44A 3SIRA 3TL2A 5KJ6A 4GCOA 4PC7A 3PB3A 1D2GA 3LUBA 1Q7CA 4WNIA 5DX8A 5EGSA 2WU8A 3QMWA 5I8WA 1AKTA 3K5PA 3M2TA 3SMQA 5KKNB 4RQUA 2QVLA 2QYJA 4PHFA 3LUPA 1Z6PA 1KI3A 3IAS1 3L0BA 3A2NA 3B9RA 4Y9UA 3USZA 3ZJVA 2B21A 3G5LA 2X58A 4JKOA 2A0XA 3EX7C 4TTPA 3APFA 3MKRA 3OIVA 3PQEA 2JH8A 4IHQA 5FQOA 1WMDA 3SNHA 3AXSA 3OOWA 2PL3A 5BW6B 1ETUA 3JRXA 3MWGA 2VATA 4OOFA 4LG1A 1QGED 2JVIA 3JTEA 3Q3VA 1E4VA 1PK8A 2UY1B 4OQZA 3T7IA 3U7RA 1EI9A 2IEIA 2UVPA 3EQZA 5GGXA 1NURA 2NSYA 2WKWA 3DZDA 3TOSA 1CG6A 2YC4C 3EMVA 4EY4A 1EYHA 1DCTA 3D7SA 2G4CA 4Q69A 1Y3AA 4GZ6A 1H05A 3LVRE 3EQ6A 4S24A 1BGWA 4XYBA 2QL6A 3AM3A 3EQ2A 5EPOA 1UPXA 5KYTA 1CDEA 5CLHA 4PIPA 3B52X 1JZSA 2MYPA 1JNRB 4F38A 4TKVA 4M22A 4NP6A 3GAZA 3JALA 2VGEA 1BWRA 1TC2A 1WF3A 2DFNA 4BIIA 1SCDA 2PMFA 3KD3A 2XB6A 1YVDA 3KQUA 2VRNA 2F43B 3Q40A 3P0JA 2JVJA 3V4VB 3EZ6A 1KQ3A 2L69A 3AC0A 2QSYA 5HOQA 1GILA 1MRZA 1G4AE 1VJ0A 2SECE 3N8NA 5FUVA 2FPIB 1Z6AA 2FSVC 2PGXA 2PLNA 3I9MA 3DG9A 3AKYA 4GBGA 4BBAA 4OVUA 1GYQA 1G3QA 3L6RA 4PHCA 1XQVA 2AC4A 2GJAA 5ITVA 4AY5A 2C03A 5BORA 5KSYA 4DM7A 1JXOA 4DXHA 3K1TA 4QX6A 3RRBA 5F3DA 4YO7A 4ZIRA 3NBKA 4FHGA 3MLEA 4GIBA 5E4YA 3RSLA 1PTJA 2V96A 3HXFA 2OAQ1 4YR9A 2PIAA 4XR9A 2CWDA 2N9UA 1SKYE 3RSGA 1W73A 5LQAA 4JZYA 1IJKA 1CZUA 2WR8A 1CXZA 1ZICA 3O7MA 4CFZA 4D8TA 3I23A 3UWMA 1OXXK 2PD3A 4PGHA 4FINA 5BV0A 4XQGA 3IB6A 3U3ZA 2YOFA 4ABYA 5A5DA 4CI0B 1QKJA 5ES3A 1TR4A 2JFNA 5JVDA 1XHEA 1YACA 4CLXA 4LTMA 5LP6F 2GBIA 2HE0A 4RCVA 1G2PA 1NI4A 1U7OA 1IUPA 1IIRA 1XZAA 2FOLA 4UU7A 4D0NA 4YCNA 4ILEA 3SI7A 3LRPA 1QNLA 3OOEA 1Z9BA 1ZA1A 1J7JA 1NN0A 3ZVKA 2XEVA 3WGNA 4BRSA 4N18A 2IYEA 2CFZA 5JJCA 1X7YB 1NTRA 1KMIY 2F8MA 4DCPA 2WIFA 3DV2A 1NRJB 3O82A 4QU9A 3BSFA 2REBA 5EEGA 1VKZA 3SZ7A 3K0FA 4GMDA 4X63A 1Y4AE 3QKIA 4Y9TA 4RLHA 1QOPB 4PX5A 4BZZA 4V1CB 1DKNA 2E82A 2N42A 4JJKA 1X7GA 4D8UA 1PFUA 2V7GA 2R3SA 1E1CB 4N7BA 4J29A 1TQDA 1SXJD 4UTOA 4LMBA 2ZGVA 1I4DD 4RVSA 4Z7OB 4AKXB 1XRSB 3HNOA 3CBQA 3KYBA 5BSKA 5BXYA 2F1KA 1AS3A 5CERB 3E53A 4IYRA 1KO1A 4LWOA 4B7AA 3E27A 5A03A 4PAQA 2V59A 3CJTA 1X2EA 3DFMA 3GJ8A 3LWZA 4EHJA 3JZIA 2UXCB 2KXPC 4RQIA 4R98A 1P4JA 3JUEA 5CT9A 4YXWA 1TCAA 5G2OA 2AFHA 3AH8A 3RU2A 3VR5H 5BSGA 1ZH4A 2ZEJA 3D8TA 1BQEA 2EGGA 2QD5A 1OQAA 4EA9A 3GLGE 5HKKA 1KJ9A 1FQWA 3A3YA 3TAHA 3D6HA 3HL0A 5JZOA 2GNOA 1U94A 5JD6A 4MTCA 2XEDA 3AOEA 3L06A 1KO5A 1TQ4A 1WPQA 4U95D 2VCYA 4JIGA 1ORVA 3BRWA 4G63A 4PSUA 4Q00A 3REQB 1I94B 2BCEA 2O7QA 3EULA 1C3EA 4YMGA 1DEAA 2H65A 4BZWA 1XL0A 2WHQA 2WT4A 4WZBA 2BHLA 5IF3A 4L08A 1Y7TA 3SJZA 5A04A 3OQIB 1RZRD 5B6PA 5JISA 4TQ9A 5L40A 3QYFA 2A0FA 3PE3A 1AJEA 4OAOA 2E4XA 5L3ZA 4FEGA 4WERA 2EV9A 2QJWA 5I51A 4HBGA 4PVCA 4X1KB 3BN3A 3QLTA 3NB0A 1NLYA 4KXUA 3TW8A 4KVAA 3ZU7B 3ABME 2CL6X 1G20A 4I7EA 3O31A 5FJIA 2QTRA 4S35A 3LL4A 4ZVNA 3TLGA 5FX2A 3CK8A 3RS8A 1YNSA 3D4NA 4OHXA 4UVEA 2CEKA 1JA1A 5BSUA 2QDXA 5ENPD 1LK0A 4PGAA 1U0TA 4IVRA 4RFSA 1AKYA 1T9KA 2C4VA 1YCHA 2UYGA 4ZVOA 3K0CC 5KMGA 5MN4A 2AKEA 1S96A 4X6YA 2RHCA 3IC5A 5KNDA 4JD5A 1ZGGA 3K1ZA 1CUYA 1SB9A 3DCIA 1IHUA 5FADA 3WLPA 1DC4A 1K8RA 1PT7A 3B48A 3CRRA 1RHKA 3KUXA 2QN2A 4INPA 3T0IA 3KO8A 5FUXA 1HQCA 1K6EA 4GR9A 4LW8A 2PLFA 1NUSA 2X6QA 1KVTA 2XZTA 2KE5A 2D7DA 5AXAA 4U5QA 1LFAA 2Z09A 3L4SO 5CG1A 2XLCA 3MW8A 4MGEA 1DO0A 5EWMB 1SHJA 1LTKA 2FFQA 2HD4A 5DHSA 4K86A 1M2GA 4MQ4A 3D2CA 3FHLA 5T3RA 1X1CA 4QVGA 2ZIVB 1ZNWA 2C0LA 2JZOA 3P26A 1OBOA 4BNNA 1P0QA 1VBFA 4R2IA 3CVJA 4FFBA 4OHKA 4ZO6A 4BAZA 4URWR 4H7IA 4Z7NB 1K97A 4EJMA 3ESDA 3FOZA 2R00C 5ENNA 1LEHA 4HX9A 3ZDYB 2FI1A 1XEWY 2GASA 4AEZC 4GA1A 1CYDA 2BKXA 3JD0A 5DZSA 1MIOA 3INNA 2B8EA 1U2DC 2LUOA 1NMEA 2GRLA 3EGCA 3BMNA 4AJWA 1O94D 3AERA 1QORA 2Y9MB 4L3VA 3H9UA 1F8UA 2COKA 1FS4A 3QTBA 4RQBA 2ATVA 4XFJA 3BJMA 5F33A 5AW5A 5A7GA 1914A 1CZOA 5K05A 4BSXA 2OENG 4QWMA 1XCMA 5I9BA 1ELWA 1EHCA 3EVDA 1C80A 1JHUA 5BWNA 2EEZA 1U9YA 5K0LA 2EW8A 4N82A 4TZTA 1ACJA 1YTUA 1YOVA 2EKPA 4S3MA 2NO7A 5CB4A 5KVVA 2XB4A 1Z2DA 4D9GA 1MV8A 4J1QA 4XDHA 2ZJFA 3INGA 3QPDA 1NHWA 3PQDA 3RC2A 4BLTA 3FHOA 4PVDA 1FQOA 2FA9A 4H6WA 1UG3A 4JHXA 1LBIA 4KO4S 3S6JA 1OWNA 2OCDA 3C1OA 4BV3A 4DR1B 3PHIA 3AMVA 3ZLJA 4AQYB 4CEHA 2CG2A 1DKOA 4AXXA 4QTYA 4ILHB 2Y0EA 1R18A 1CF2O 1WXHA 4PG7A 2XS1A 3IQGX 5ER6A 2YXLA 3CKBA 3D64A 3FH0A 5J59A 1F8XA 3GX1A 1AXRA 3BIWA 4GKVA 1N95A 5ALRA 4APFA 4AK9A 4UPDA 3WP1B 4P3KA 1LVHA 1EB8A 2WJHA 3ZD6A 1UPAA 3VO9A 3QEAZ 1NZDA 3EG9B 4N8EA 1MIHA 2ZDQA 4DV2B 3STUA 4O63O 3P4XA 4NHOA 1MPXA 4BYGA 1E1CA 2O54A 3Q0TA 4HBZA 2KZTB 3WWZA 1X9IA 3ASUA 1DCKA 3O26A 4P4LA 4WT7A 3RIGA 1LU9A 3FNRA 1P31A 3TM4A 4YYZA 2I4NA 5LZ5A 3L22A 5K01A 1H2HA 1MZVA 3WWCA 1EIZA 1ZJJA 1L5RA 1SHZA 3EGDB 1SD2A 4XKBA 3MXTA 1ULUA 4I5GA 4F1KA 1ZH6A 4RF5A 4YP6A 2RFAA 5SZHB 3SU8A 3DZBA 3GG2A 3DOUA 4UYJA 1FXSA 1CV2A 1QHXA 1G5FA 3T3EA 1C8LA 1FDSA 1U2DA 4WSOA 3T5GA 3D6FA 4MGZR 2WD7B 1U8XX 1XJ5A 2BAGA 1UCFA 1JEOA 1XNQB 4MR7A 3PFBA 1P4HA 2P8JA 5HS4A 3SWWA 3PTAA 1EQ2A 4JK3A 5KQGA 1YJBA 4YAWA 1C3LA 2BFFA 4F4HA 3GMIA 3PRJA 3USCS 2OCIA 3ICEA 4WY5A 3W2TA 4AMVA 4DEXA 4Y6RA 4FLFA 3LPLA 1Q12A 4K28A 3I37X 4G26A 1MAHA 2VVTA 4HNTA 3R7RA 1GNSA 4XFKA 3IEPA 1Z29A 2FPXA 2IS6A 4FLMA 2Q7FA 4M6WA 1EUDA 1QTIA 1WPGA 2UKDA 4Q4AB 1W2GA 2CN1A 4WOKA 4BQOA 2J30A 5IC4A 1TZBA 4JFRA 3CH6A 2K6GA 3KE9A 1TM1E 3DZJA 3GRCA 2AJAA 2BD0A 3H6GA 2PYIA 2FE4A 1K08A 4MHSA 1O94C 3FPFA 3GRYA 5HYVA 4XZ3A 1F4PA 1J33A 4WOPA 1FMCA 1V9SA 2QQFA 1DRJA 2E9SA 1EDEA 1DLIA 1WDLA 2UZ0A 3DQZA 3OOJA 5G3YA 2X6HA 2LIPA 2H0QA 5E2AA 1ZRSA 1CY6A 1JR3A 1M74A 1Q0QA 4LN1A 3OTIA 4LY3A 3GJSA 1VE3A 5EJ5A 1M75A 5L45A 1FSPA 1GR1A 4MQBA 4H4EA 2VP3A 3UXGA 3T3PB 3LPAA 1OFGA 5A7FA 1NGSA 4P7BA 4TM8A 4LZAA 1B0PA 1RM3A 4JQOA 1PQUA 4P53A 1VKNA 5IFLA 5AXCA 2BUCA 3RC7A 2C2ZA 3NKLA 2RONA 5JRDS 3ZNGA 3DE5X 2YWBA 1QFJA 3IPLA 4IOLA 3DXYA 1N25A 4P08A 3UEOA 4CMEC 4HLLA 3R5HA 1QH0A 1GU7A 2OILA 2YJ3A 4HQNA 1ZNQO 4MR8A 5CR9A 5HHTA 3LX5A 1XXHE 2I4LA 3ZHXA 3ID6C 4PLCA 5G0WA 1NW6A 2NNWB 1KIFA 3BMQA 3L49A 4UC0A 2EW2A 2GGFA 1GTG1 4PWZA 3TQQA 3A6PC 1WXWA 1NI3A 3HBLA 1CEYA 1UN8A 1ZCAA 4KR2A 2HM7A 3C3RA 1CQJB 1M1ZA 5AW8A 1Y5NA 3QKRA 3RTGA 1T9BA 3D6NB 2NZ8A 4J8PA 3TXNA 5KOHA 3D4LA 3KS2A 5C7YA 8LDHA 3ABIA 2PO5A 1QMOE 1WXGA 2GCGA 1BE8A 2GCNA 3C3QA 3DTTA 3VNBA 4XFDA 1OC4A 3MUFA 3OCXA 3PA6A 1B8UA 3PDCA 4EWLA 4A0FA 2H3EA 2B35A 1KSGA 4EBBA 2VQSA 3DE6X 5IZCC 4UEQA 3HDVA 3LG2A 4NEHB 1H6AA 1IL0A 2AG1A 1OREA 1P39A 3DVQX 1A9XB 3IO3A 2JBHA 5LC1A 5REQA 4YJHB 3REFA 4DTIA 2DFDA 1TX4B 2HRZA 2P5UA 3R0VA 3S27A 1AN0A 4EL5A 4UNPA 1I0ZA 2EHJA 2GH1A 3NOOA 2O2IA 4P4NA 2KATA 2AF3C 3F1LA 4H9GA 3ZXUB 2WPVA 2DH6A 4BWVA 4DSTA 1G6OA 2W22A 4Y98A 3TOXA 4H1HA 4E5UA 5CCXA 2IZ1A 3OQMA 3RIYA 3TTWA 5CYOA 4PXYA 1L7AA 4MS6A 4BECA 3V2UA 4WKGA 1K27A 1L5KA 2FO7A 1E90A 3DLCA 4I4CA 4A23A 1WS6A 3KYDB 4LTDA 4XIYA 5HTOA 3MSCA 4YAEA 5F7JA 5FXMA 5TPZA 1BAPA 4I6JA 4ZP1A 3VNAA 2AX3A 4UMFA 4LHEA 3IEMA 5J3JA 2JG3A 3ZW8A 5IANA 3GUHA 4MMZB 5B2ZA 4OH1A 1TVEA 1VI6A 3FVWA 3M6MD 2BPOA 4EB0A 5B1IA 2P0YA 2VPWA 3GJYA 2J3DA 4AMUA 1TKRA 2Q8PA 4OLHA 5EZYA 2EL9A 4CKBA 4L1BA 2EINE 1HT3A 1SM4A 5A4MS 1MJHA 5J2UF 3TWRA 2DUWA 5EJEA 3B1VA 4QJ5A 3E34A 3T8KA 4KIUA 5EN4A 3VAYA 4N48A 2X8JA 2X9NA 4HTFA 5FOQA 4H7DA 3L6OO 1XHFA 2PZEA 5AVOA 3ZWWA 1FFYA 3CLTC 3OZSA 5GONF 1IG3A 2VJNA 2FMKA 2HSEA 3QIAA 4J0KA 5FKJA 5ALFA 1YZVA 4PZCA 4UW9A 4HMOA 2CNDA 5C1PA 3DVAA 4OI0A 4Z9XA 4AD8A 3R20A 5E7JA 4B6QA 3E33A 3K9HA 5LBUA 3WJ2A 1DTSA 1I80A 2CVFA 2Q5OA 3C5EA 3C14C 3NORA 4M7OA 4ABTA 1TO2E 2P0EA 5J1TB 3GGGA 4O4HB 5AJHA 5ITZF 2ZGDA 3EVAA 3QMPA 4O1MA 2EGHA 1UT5A 1QK4A 1KK0A 2FEPA 3OMXA 5EJ4A 2XXAA 1QVWA 4TRMA 1A2OA 4XM1A 3PTLA 3LDZA 1FSZA 3C8ZA 3N76A 3O8OA 2Z57A 3K6SB 4IP0A 3PC2A 4WY8A 2VDUE 1AQ6A 2FK8A 5EXTA 3ZGOA 5CEJA 1GAJA 2NWQA 2CBGA 4GFDA 1Q3KA 3EYAA 2DT5A 4W82A 1VZ2A 1YQQA 4CIBA 1LDNA 2C3UA 4U7PB 5EPUA 2P69A 4HLUA 2YHAA 4N0EA 4X6UA 5EXDA 4JA2A 4AZ0B 2AYZA 3MG9A 2XV1A 3BREA 2IY8A 1FXUA 3RJ9A 4XD2A 4DV5B 1KI2A 4B87A 3LY5A 1S3SA 4LDRA 3AG2E 3R7SA 4MV8A 1XB2A 1D5CA 1L5JA 1JDNA 2ZDGA 1L4FA 1L5NA 2XH8A 4KLZA 4V0NA 5I9TA 2ZUFA 3HSKA 3AQIA 4AXBA 3K4QA 4F21A 1BOFA 3MTEA 4JKIA 3CPEA 4R2JA 3P5SA 1BS9A 1QG6A 2C4NA 5D1NA 4QRDA 3VR2D 3VXKA 5CD1A 1VSVA 1YQEA 3DZCA 4GB9A 1TA4A 2P9EA 1FNCA 1N6PA 2XMGA 2WHPB 3LK7A 3LV8A 4TTTS 3BGOS 2VZLA 2Z8ZA 1I4OA 4JOBA 1YJAA 1TN7A 5JJBA 2PS1A 2PV7A 3SXPA 3CKKA 5JMWA 3PYXA 5BSHA 1UXKA 3BUAA 2NO1A 1NQVA 1MF7A 1RMYA 4ER6A 5HX7A 3BTUA 4R8LA 3HCWA 4NACA 5I7AA 5DMHA 4WJZA 5FD8A 1F5SA 2ZJ8A 4FFOA 3L7JA 3PX3A 3LY9A 3DXMG 1G5IA 2IUSA 3M5WA 4BLQA 5K03A 3VNVA 1RCTE 2AXUA 4KNWA 3SE0A 4F4IA 2HWXA 2WIBA 3U4CA 1JTVA 1LRKA 1CYEA 1RE0A 4MITA 3RRUA 3BWVA 3LBYA 3OFKA 4HAIA 1XZIA 2ZAYA 1XA3A 1KPIA 2C20A 2CV1A 2H16A 1DUSA 2OORC 3A0RB 2OXTA 1NNSA 1Z6GA 2PZAA 2JIRA 2YIVX 3C4VA 2FLKA 5G40A 1WMSA 1YDMA 5A4IS 1XLVA 1USIA 5B3AA 1DE0A 3NC0C 4D3DA 4H0NA 3O03A 2CG3A 4LSZE 3RVJA 4L2IB 4MVJF 2OAEA 3DEOA 2V8SE 4H6XA 5HTKA 1EXDA 1YIDA 3OUUA 4M7PA 1S3FA 4BE9A 1QRUA 1E4YA 2D5BA 3APCA 1MGPA 3QBJA 1AXGA 4PANA 4JT8A 1T9AA 3S2ZA 1XV5A 5L4SA 4F5WA 2OM2A 3HCNA 1S8NA 4BMVA 3S4YA 3ASVA 1W49A 3D9OA 2G5CA 4Q24A 3VR3A 3GZ4A 5H7PA 1TN8A 4J7XA 3U40A 1C7IA 3RF6A 3CGHA 3RAGA 5ADWA 1VYUA 1GADO 5JXHA 2WB2A 4B5KA 2AC2A 1TN6A 1KEKA 4BO0A 2DR3A 2G72A 3E8MA 3EVCA 3H5OA 4W4TA 4YRNA 3HC7A 2AZ4A 2Q3BA 1DB3A 4PRYA 4R2WA 5I47A 3SXUA 3KSDO 2PMWB 4PXAA 1C1DB 3AO0B 5J4YA 1XKLA 3ZVMA 3I9JA 3R7AA 2UY1A 3ISJA 2JGDB 4ONEA 3MJTA 1JT2A 1MIOB 1P9NA 4UD6A 2OO7A 4BU0A 4E21A 2ZE6A 2J6BA 3IKJA 3B7GA 4UARA 1MMFB 2WWFA 2B3TA 4MUEA 3V3KA 4XM0A 2KSQA 4E3WA 2CBXA 3HI4A 4YJHA 4OSOA 4MWSA 3OJCA 5LIRA 5JT1A 1V3VA 1ZM7A 3E30A 1ISIA 3K9GA 3RJVA 1RWWA 2X22A 3EGDA 1NX9A 3JR3A 3R3SA 4Y2XA 2AOXA 2EX0A 1GFSA 1U3UA 3VKHA 3Q8KA 3M70A 2WD7A 4MVWA 4MVXA 1TO6A 5AKJA 2W43A 1B1CA 2JPDA 2WQHA 4G4JA 3LHFA 3GZ1A 4XASA 5EYLA 3OSUA 2YKGA 3TWOA 1HMPA 4J4TA 2YCLA 3I30X 4EHFA 4UOZA 1WDYA 1BCRA 2DBRA 4HNHA 4CGVA 1GZ4A 1YFKA 4HEA6 1A71A 3CVLA 1K3FA 1NPYA 4PZLA 4G07A 2TSYB 2A5FA 1CUEA 1CE8A 4JB8P 1QLJA 3GGDA 4JFAA 2IX3A 4DGSA 4UNSA 3AYZB 2XXAB 2W2KA 4BMNA 2X13A 4HF7A 3ZWCA 3S2AA 3QPCA 4A26A 3KSQA 4XVRA 1YD7A 1WXDA 4GZ5A 3JYPA 4W7HA 3V2GA 1BVUA 3BCSA 2BL4A 3OPVA 4MEJA 4XAQA 4ZQBA 5DYGA 2GJSA 1NJ6A 3KEMA 1S63A 5T4HA 1TYDE 1VL2A 1Z5ZA 4Z7JA 3DO5A 1QTNA 1GLNA 4HI8A 1QFSA 4OHCA 1K4KA 3UENA 3UAWA 4AJ2A 1EVLA 4NV3A 1IRXA 4H4DA 4BUJA 1A69A 3WGYA 1N6RA 1SD5A 4BKUA 4OAVB 4P7JA 5BPFA 1MD9A 4I1AA 1XWFA 2ZUDA 2IO3C 4BNWA 1W1IA 4B80A 2JCSA 2MIIA 2P9BA 4PLHA 3KLPX 3I6ZA 1G8JA 1ZMRA 1N3IA 3EA0A 1YR8A 3JAWB 4J8FA 1TMGE 2EBFX 2H00A 2VYQA 3OMWA 4JMPA 1ZPDA 2RCNA 2KBEA 4K6FA 3D9IA 1U7UA 3FUUA 4GPIB 1W85B 4LX0A 5K9ZA 2AQKA 4QOSA 3P2KA 1O96A 4NATA 3QNUA 3RODA 4A8JA 3IIEA 1T2FA 4JBLA 2J5BA 4PO9A 1AA6A 5AUNB 5H80A 1P0FA 1ZUNA 2VP0A 2W0SA 3RU7A 4I5IA 1I7NA 2PGNA 3ZD8A 2J5RA 1UWCA 2ZETA 3BHJA 4LPSA 4OGWA 2WYVA 1YMUA 5CCEA 3PR2B 4RPGA 3ROTA 4DUZB 2PUWA 2C5LA 3IX7A 4HG2A 1K5DA 3KDAA 3LZCA 4HQ6A 3KJZA 4Q16A 2BBSA 4R5HA 3NU1A 5B55A 3GUCA 2J6IA 3WV5A 1CX9B 2I2XB 5DX0A 3UICA 3UBMA 4ENQA 2CE2X 3IP5A 4LDQA 4DMGA 4KOAA 2A3NA 2X6TA 5AJWA 3PQ8A 1PR9A 3T61A 2R48A 3HYSA 3L8FA 2XYRA 4WXEA 4YQZA 2PGLA 3W1WA 1TXGA 4AS2A 4PNEA 3DKKA 5IJ9B 2QAJA 5I7WA 4TTSA 1NYLA 5FP0A 4OJQA 2NU7A 3BK1A 3U7QA 4HBDA 4I1VA 1OCOE 1YQ9A 1CLUA 2H1LA 3WGOA 5JJ5A 4EYKA 2YFKA 2C9MA 5JV5A 2Y4TA 2C7RA 1ZX1A 3LRXA 1R8JA 2EG5A 3TGWA 5T5QA 3QARA 4LNAA 5HQJA 1A7UA 2QY6A 4E4RA 2OGSA 4ZOLA 2WXFA 3JQFA 3OIUA 1DWOA 5ALNA 3UOAB 3OXGA 1AM4D 1W4ZA 1E94E 3OLYA 4IH4A 3QELB 2X6IA 4ER3A 5G05J 2X38A 1MR3F 2V7PA 1U65A 5H1YA 3RFUA 4OQQA 5F5NA 4G4IA 4QATA 2J5KA 2RK4A 4XI0A 3NT2A 1QXSA 1M8PA 1AGYA 2P4EA 5TE9A 3WLFA 2G5TA 1JDPA 1GNVA 2J9GA 4HXGA 4QIHA 5F9MA 1U7PA 3RRZA 4UXHA 1CB0A 1YBVA 1KO4A 3DEHA 4GAEA 4JGGA 4AVYA 4WNFA 5TF0A 3TNFA 4KODA 2X5NA 5B7PA 3TQIA 4YREA 4CLOA 1L8OA 1QCYA 2OYSA 5FBRB 3JXEA 1KF0A 3Q47B 2A5DA 3FWYA 2PXXA 4N5IX 3FHJA 4C04A 1TYQG 1AB5A 3D9QX 3RM3A 3E3MA 1QHHA 4DG5A 3A36A 4L2IA 1KZPA 3ABOB 1L5YA 4MKXA 1U28A 2Q5JA 1RAIA 4O8ZA 4YI5A 2NO0A 3FJ1A 4AJEA 4D4GA 4EZJA 3GAMA 1Z35A 2HZBA 4HXFB 4C5BA 4F2PA 5H82A 2H6FA 2O4CA 1IY0A 3FSGD 4FZRA 4LF6B 1IN5A 3LYLA 1DAFA 1VI2A 4CV2A 2N47A 2FW8A 1F48A 4HDQB 1IC6A 4M0MA 2WG0A 1O2DA 2FUKA 4L85A 3EHNA 1DBRA 2Q5LA 5FUMA 4LPKA 3IAM6 4RGBA 1VFPA 4C6RA 2DYSE 3QF7A 4P36A 4REMA 5DIZA 3R44A 3GZTB 2PMEA 1BEUB 1JEQB 3O93A 3W2HA 4RORA 5FR1A 1CUCA 3HP4A 5HJEA 2LCIA 2RGCA 3AM4A 3CY6A 3X44A 2BMAA 2VNAA 4ZZ2A 4N4AA 4QYTA 5C37A 3SSOA 4FCVA 3KJEA 4GKBA 2EX4A 5C3MA 3IQXA 2RBKA 3NGXA 1GPWB 2R751 1Z2PX 1VKRA 3OFND 1MQSA 3LLVA 2R68A 3O1HB 2IOSA 1MAWA 3F1KA 5HRUA 1DC6A 5DYTA 1JRLA 2WOJA 4ANFA 5E95A 3K5WA 2CJWB 4LFAB 4NURA 5ALLA 1OTYA 1T5OA 2A0KA 3WA7A 2UXDB 3HZRA 3FZYA 721PA 1IEQA 2LW7A 4XA8A 3RYIA 1CUIA 1YZ3A 2Q99A 5FOSA 2AFIB 4JI0B 3EXHA 3BD8A 3AY6A 1HU3A 1V37A 4I4TA 4TKMA 4A0HA 4DV7B 5CB6A 5EZYB 2ZRNA 3THRA 1UXHA 2EDAA 5CAEA 1JDVA 1CIJA 6PFKA 4MQFB 3UW1A 3AEYA 3ZNPA 2D2XA 1IQRA 1VSUA 2FUCA 3MBKA 1NXPA 2FJ0A 2J31A 1UQRA 2PO7A 3QY0A 4B6OA 1C50A 2PKXA 3RTCA 4EG1A 5HS0A 1ML3A 5AQ9A 3EPPA 4GX0A 2WF7A 3HBNA 3OCJA 2FCAA 3UK6A 2GTPA 3WMEA 2BGGA 4MCHA 3U81A 1W5FA 5LCWJ 1JT9A 2W00A 1XMVA 5JBNA 1X8XA 1UJJA 4NCXA 2W2XA 5KDLA 2DZNA 2NN3C 3ZBTA 4D9BA 1M34A 5KJMA 4ZAGA 3RTEA 3UHFA 2CFIA 2G71A 2Y6UA 3GPDG 4N1AA 3NDJA 4GMHA 1PQ4A 2X86A 3WGVA 3ZHTA 3PL5A 3OP1A 3DWGA 1OUVA 1WB6A 1KVQA 2BR5A 1B8PA 2RAPA 1N8SA 5ADUS 3DOOA 3PCRB 1CZRA 4X64B 1N77A 2HWYA 2RC6A 4GH5A 3QU4A 2H8GA 4NCJA 2JFHA 4DX7D 3GDOA 2O8FB 3UQ3A 3ELUA 4HX2A 4U4AA 3H1PA 2VA9A 1GGJA 4XYEA 1B26A 3PWZA 3HRAA 2WNSA 3O4HA 1OBHA 5G4KA 4ED9A 2HJVA 1AMNA 2G8NA 5C1OA 1RWPA 3ZPXA 2M1XA 1ZU5A 4K40A 1RIIA 3K70C 1JU9A 3GGPA 4AZ3B 1X92A 4RZXA 3FKSD 3OTNA 4QBGB 4B93B 2BKUA 1R0WA 5I9MA 2VP6A 1WHTA 1X0VA 2ATEA 3C1AA 2QR3A 1HG0A 5A02A 1VJ1A 1P1CA 2BDTA 2Q4BA 1S4MA 2SKDA 3DW3X 4EL0A 2BSXA 1YKFA 2CFRA 2DCMA 2ZBFA 4RELA 3CX8A 3DOCA 3W5DA 2DC1A 3PLRA 4HLEA 2YHSA 4ACKA 1KE2A 3S5JA 3DBHB 1NA5A 3ZR4B 1A4XA 2JEOA 1JG3A 3CUUA 1RAEA 5G02A 4X95A 2F8SA 2PSSA 1P3Y1 3VR4H 2WLSA 5U9CA 1TUEA 4GX1A 3MA0A 1WEKA 4JJGA 1MG5A 4Q9KA 5DCWA 1RQ2A 3B1JA 4AULA 2XCQA 1NQXA 4N2QA 1MJNA 3USES 4L57A 5AKEA 1M66A 2GETA 1Y1QA 3P2MA 1LF8A 1L7RA 1E5QA 3L7IA 5FQ8A 1KL7A 3AFGA 3II6X 1NYQA 3MOIA 4PW0A 2GPAA 2XAAA 4LK2A 1FL9A 4BVGA 4MVJD 1ZGBA 1E69A 4UTVA 4UWHA 5BN5B 1P2TA 4P6VF 4OX9B 1Z83A 3CVWA 3FF4A 3HBMA 5FA5A 3E7WA 1QHGA 3A26A 2DWPA 2K7FA 1QLHA 3H5LA 3L6UA 4RVFA 4YJFB 3TIIA 4D3ZA 4B3TB 3CHYA 3ASGA 3TAXA 1DJLA 2QRMA 3M4XA 3SJBA 1I7PA 2M1ZA 4XYLA 2BMVA 3NWBA 4R31A 1BVHA 3CG0A 3CYFA 3H2ZA 5JVDB 3ML8A 2YFQA 3I4FA 4UATA 4V0KA 5FQNA 3IVMA 4J0DA 1FLNA 1Z22A 3T5CA 1I3KA 1GZ3A 1YB7A 4MUFA 4U0ZA 1R2QA 5CGZA 3BQMB 3SZLA 3I42A 1G7SA 3M9XA 4FVTA 2Z08A 4OFBA 3WB2A 4HC4A 5JRJA 4UJ3A 3V46A 2FRDC 2QD3A 3TTXA 1SC9A 1MEJA 3R1IA 1QYRA 4OO3A 4RMIA 3BXPA 5LB2A 1XZGA 2ZM5A 3ZNQA 2EILE 5T41A 5LR6A 4KYIB 1H5NA 1JG1A 3FUVA 2HHHB 1KHTA 2O5VA 1E4OA 3T38A 2NU9B 4EELA 1US8B 3A9CA 5AN8A 3PZBA 2FPIA 2R4TA 2QA5A 5A5FA 2AS0A 3H9BA 4NESA 1ENPA 1DRVA 5TEWA 4XWTA 2OO5A 4EX7A 1HLPA 2RKWA 4G8BA 2WE7A 4NNOA 2JHAA 3WYCA 2G9ZA 4FDTA 4RYDA 4MWEA 4DABA 4IGKA 5IPFA 1L4UA 4LI0A 4NBLA 1NMQA 3R9XA 1U3DA 4FKZA 3Q8LA 3I8XA 1NA3A 3N2ZB 1ACLA 4CM3A 1AQUA 3L8CA 3KPVA 4EO9A 1OY1A 1JKXA 2VNKA 3EIQC 3UINC 4OREX 1P0MA 3AW8A 3RJ5A 1ZHOA 1NF3A 3V1LA 3N8GA 3M5DA 3K0SA 4HH3C 3CVOA 4RKYA 1DWQA 5D5HA 3TLAA 3VVLA 4CIXA 3CF6R 3V7YA 2WD8A 3K71B 4M1EA 3MRVA 3NHYA 1OCZE 4APOA 2BFBA 4EX6A 5GINE 1NDHA 1ZU2A 1R9NA 2P9QA 3UV7A 2L42A 2FFAA 3JV7A 4ZK2A 3MZLB 2UYYA 3F2VA 3CKMA 2FUNB 2JGJA 1V4NA 2IELA 4MVJG 1JFSA 2IIQA 3KVVA 4CODB 1KI4A 3EOBI 3KK0A 4KYTA 3EGOA 2JI6A 3DEKA 3E9CA 1PY1A 1L4BA 4B31A 4BV2A 4COKA 4EKNB 5HKAA 4DDVA 5KSWB 5CX4A 5E76A 1OFUA 2QVCA 1A4RA 2VNHA 1P0CA 3ECCA 4N3CA 5CVJA 1Z13A 4MQLA 3AG4E 1FP2A 1TZCA 3O8CA 2ZSKA 2ZTVA 1UKYA 3CSSA 4OL0A 5IAKA 3U3MA 1Z4QA 3OAAA 3V4FA 3T8YA 1E2IA