5BNWA

The active site of o-glcnac transferase imposes constraints on substrate sequence
Total Genus 280
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
280
sequence length
715
structure length
694
Chain Sequence
PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDIYDNRIVLNGIDLKAFLDSLPDVKIVKMKNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title The active site of O-GlcNAc transferase imposes constraints on substrate sequence.
pubmed doi rcsb
source organism Homo sapiens
total genus 280
structure length 694
sequence length 715
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5bnwA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5bnwA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 5bnwA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 5bnwA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5bnwA03
1NOIA 4BFCA 1QKJA 1F6DA 1FA9A 4B94A 1P29A 4NQ0A 3URZA 3L7DA 4YUAA 4M7PA 4NC9A 3HBJA 1P4HA 3NCHA 4KQ1A 4EL5A 4XI0A 5FT9A 4F97A 3ASHA 5KJLA 1Y8ZA 2XCBA 3OXGA 4Z5XA 4G1TA 2C1ZA 2QRMA 2KCVA 2QLMA 3MT8A 5LCWJ 2FO7A 4EL0A 4M83A 3RU0A 3G2NA 1P4GA 3CEMA 3CK8A 3OTGA 4H7YA 5TMDA 1E4OA 4MI6A 2AMVA 4RIHA 3BDAA 1M5RA 1L5QA 4HLNA 3KS2A 2FBNA 1WW3A 2VSNA 1B4DA 3MS4A 3BCUA 1Z6QA 1IHGA 2X6RA 4Y6CA 1EXVA 3MEKA 3QWPA 2BISA 2HYZA 2PL2A 3NP9A 5M72A 3BEOA 3CK7A 5GPBA 3WAGA 2LSUA 4F96A 3SYMA 2V5FA 4NRHB 2H1HA 4BWRA 3CUTA 3SYRA 2ZB2A 3LY9A 4I2ZA 1J39A 3E3NA 5A7DB 1WUTA 3ZN3A 1FC0A 1JEJA 2PQNA 2ACVA 4FKZA 4GA2A 4RIIA 3NF1A 1GGNA 4WACA 3L79A 2G9RA 2ECPA 1GPBA 1RZVA 4FZRA 5CHEE 1Y6FA 5CCMA 3CEJA 2G9QA 1PC2A 1QM5A 1EM6A 2KATA 3VTXA 1W3BA 2AVPA 1B89A 4A1SA 3CEQA 3WC4A 1WM5A 1F0KA 2ACWA 4YNDA 3ZGQA 3CVQA 4AM9A 3O48A 4X7PA 3RO2A 4BT9A 1IIRA 4NESA 5EX3A 1RRVA 3AS8A 3MTDA 3CUUA 3ZCRA 3OXLA 3Q47B 4U0SA 2HR2A 3DD1A 1ELRA 4HOUA 1E1YA 2UY1B 5A6CA 3CUWA 4I1AA 3QKYA 2SKDA 4AN4A 4GZ6A 5TMBA 2XPIA 3Q49B 3CUYA 5EX0A 2BGTA 2R68A 2VYIA 3SF4A 4UQXA 2OOEA 1HZ4A 1GG8A 5FZSA 2GT1A 5DLDA 3T3DA 4EKEA 1PYGA 4LEIA 2R60A 3ZHEA 2XGOA 4GZ5A 1GZ5A 3OY7A 1BX3A 2KCLA 3CUVA 4UI9K 1SXPA 2ASVA 3L7CA 1H5UA 3HBNA 3EBOA 5IKPA 2F3SA 3PE4A 3QKWA 4CGWA 4I9CA 3TAXA 3NC4A 3WADA 4ABNA 3Q15A 5FZQA 3U3WA 3QHPA 1LWNA 4I2WA 3LY7A 4HORA 3ASDA 2C0LA 2MHKA 3COPA 4M60A 3NAZA 1P5QA 5BW8C 5JJ7A 3PE3A 1JIUA 4XI9A 4BTAA 1P2DA 2C9ZA 2IEIA 1IYGA 1QQEA 4MI3A 5ENZA 4RG6A 2DBAA 5JTUA 2QN3A 1XNFA 4RIGA 1KTIA 4YI3A 3MTAA 4KQMA 3C48A 3G2LA 1NZNA 4I17A 3H4IA 4BQEA 2F9FA 1UQUA 1IXYA 3TG4A 3U4TA 5C1DA 2IEGA 1KT0A 1L5VA 4EQFA 3LYAA 2AV6A 2QN2A 1WUYA 3MS2A 3RO3A 5TMEA 2GW1A 3WXXA 2ATIA 3ASFA 4REMA 5EKQD 3S7FA 3AMVA 3T3GA 3OTIA 4MHSA 2F3UA 3ZCPA 2XA2A 3MSCA 1Z6PA 4HOSA 3CV3A 3D0QA 3MQFA 2QRPA 4X7RA 3VUFA 3Q4AB 1Y8MA 1ZU2A 1HLFA 3E4BA 4J8EA 3RIBA 5BNWA 1FU7A 2IYAA 4RENA 1Z62A 2I6HA 1JG7A 4HOQA 4KQ2A 3AS5A 4GYYA 2UWJG 3LKUA 2XCCA 3GZ2A 4J8DA 1UZUA 2QN7A 2Y4TA 1NA0A 1TJCA 5FJYA 3E3OA 1C8LA 3JYSA 3L01A 1FU4A 2QFCA 2C0MA 3OKPA 5HQ8A 2IF4A 1JIXA 1L5WA 4WNGA 3E3LA 1NOKA 1ELWA 2GPNA 4N3CA 1NVKA 1WV1A 4WNDA 3CKBA 2SKEA 1ABBA 2LNIA 3T3IA 1Z8DA 2FF5A 5KJKA 5G05J 3Q3IA 5HI7A 5HXAA 1UQTA 3IEGA 2XA9A 3C4QA 4G2TA 2FFRA 4AMGA 5DIZA 4RBNA 1FTWA 3EBPA 4AIFA 1P2GA 2IV3A 1XOIA 3S27A 3NP7A 3CK9A 3S29A 3NB0A 2Q6VA 4RELA 5I45A 3QOUA 2VG8A 5KJNA 3UQ3A 1NZFA 2IFUA 2QRHA 1HXIA 3DDSA 3G2HA 4U0ZA 2X0DA 2VQ2A 2GEKA 4JHRA 2VGYA 1FCHA 1L7XA 4WHMA 1JG6A 3D0RA 4J0UA 3ESKA 2G9VA 2QRQA 3CVNA 3MS7A 2HO1A 4W9RA 4GPKA 1NZDA 2GPAA 4HWGA 3VDMA 3N71A 4Y6WA 3T3EA 3KD7A 4JA7A 3IAAA 4EKYA 2VCHA 5DU2A 4N3AA 3RKVA 4U0UA 2XGMA 3G2KA 4GA1A 1PSWA 2OFFA 3VDNB 2GM9A 3S7BA 2IUYA 2X6QA 4YVOA 9GPBA 3ULQA 2JJMA 4BQFA 3TOVA 1XV5A 4KYOB 2E2EA 4UI9C 1WV0A 5G04C 4BT8A 4H7XA 4CTNA 3BCSA 2QLNA 2QN8A 7GPBA 3PDNA 4GYOA 1L5SA 1K08A 3KAEA 1XL0A 4UQZA 5FZRA 4AY6A 3MRTA 3RSCA 4JA9A 3S2UA 2YHCA 3OT5A 2IV7A 2IYFA 3ZCVA 2AW3A 2QN9A 2R4UA 4MRAA 5LCWC 2P58C 4CTMA 2BFWA 1SXQA 3GYZA 2KCKA 4KBQA 5LQDA 4N2SA 4JL0A 3ZCQA 3DZCA 3BCRA 3TGOA 5ARGA 4CDRA 2R5SA 3S7DA 1JIVA 3MRXA 1HH8A 2SKCA 3RHZA 3Q3EA 3FWVA 3ZCUA 4W6QA 3CV0A 2P6PA 3MT7A 1P4JA 3BD6A 2X0FA 2C2LA 4WNEA 3MA5A 4F3VA 1C3JA 4YI5A 1FS4A 3S28A 5ARFA 2PYIA 2IW1A 1O6CA 2PRJA 5D00A 3ZHEB 3ZCSA 3FP3A 4MICA 3G2IA 3UYKA 1GFZA 1PNVA 3CVPA 3MRVA 3MKRA 2Y4UA 2VGXB 3LCAA 1WW2A 3HYMB 3VUEA 3MTBA 3QDNA 2VCEA 4N39A 4GA0A 1XL1A 4N5CA 2F3QA 3TSAA 3GPBA 2FF4A 2FEZA 2PQ6A 3G2JA 2PYDA 3UYLA 2WPVA 3GUHA 1A17A 3L7BA 4L22A 2XMPA 4G2VA 4J8FA 4WADA 2PRIA 3OKAA 4F9FA 3Q5MA 2F3PA 3MBOA 5JTTA 3RSZA 8GPBA 3Q3HA 3LPZA 3S7JA 3FROA 2PZIA 3BD7A 1FTQA 5JJ6A 1WAO1 3HBFA 2GJ4A 2NC9A 4N2QA 2BGUA 5IKOA 3RT1A 4IN3B 2KC7A 2WTXA 4MHOA 1XKXA 3BD8A 3CEHA 4LEUA 4GZ3A 2O6LA 3UPVA 3QWWA 2L6JA 3SZ7A 2JZCA 1QZ2A 5KJMA 2KS6A 2C4MA 2FI7A 2XA1A 4KXKB 1A8IA 4HOTA 5D0QD 2UY1A 1K06A 2QZSA 3T5TA 1YA0A 4QLBA 4BQIA 3OKCA 4CTOA 4O6FA 1V4VA 3S0JA 3QWVA 4ME2A 2QRGA 2WQHA 3GW4A 3CVLA 1AXRA 1FTYA 4CGVA 2YQ8A 1NOJA 2VSYA 1GPYA 2G9UA 4GYWA 3D1JA 1FU8A 3FFLA 1XC7A 1C8KA 4N3BA 3DDWA 4AY5A 1KLXA 1LWOA 2JLBA 3T3HA 2XEVA 3NPAA 3RJVA 3IA7A 2QNBA 4U07A 1P2BA 1L6IA 4YVQC 1C50A 4G24A 5DXFA 4GCOA 2X0EA 4GCNA 1E96B 2QLLA 2QN1A 2J9QA 2R66A 2YJNA 3OXFA 2HY7A 3CKCA 1YA6A 4G23A 2ONDA 2C1XA 1RZUA 4EJ2A 3T7DA 4X6LA 3UUXA 4N9WA 3TG5A 4PQGA 3VTYA 4G26A 3L7AA 3ASGA 2FETA 3OTHA 3MV2B 2GEJA 6GPBA 3ZFWA 5CCLA 4RG9A 1PN3A 5TVGA 2Q7FA 2XCUA 3LY8A 4BTBA 1NA3A 3MV3B 5JJTA 3CX4A 4MI9A 3EDTB 4APOA 4AMBA 4XIFA 3K9IA 3BEEA 5FTPA 5AYWD 4U04A 4WUYA 2AZDA 1ZBPA 4GPBA 1L5RA 1Y6GA 2LSVA 3HBMA 5G05C 1VGVA 1KT1A 3R9AB 3ZCTA 2VGXA 2GPBA 2BUGA 4X7MA 3OY2A 5D0OD 3O3CA 4UQYA 4I9EA 1NLMA 3C4VA 1GPAA 5DBKA 2PQRA 4WNFA 1AHPA 2H1FA 3MT9A 5D01A 3GZ1A 3H4TA 1YGPA 4G25A 3ZPJA 2XGSA 4NEQA 4RIFA 2R4TA 2XCIA 3AS4A 5BT1A 4LDPA 4RIEA 4UI9J 5G04J 1OUVA
chains in the Genus database with same CATH superfamily
4JLNA 2JAPA 4KYTA 1H8ED 1D2CA 1N5KA 3D54D 1K3TA 1RYHA 1L8OA 2VHYA 2D1TA 5ITZB 3GPIA 2OB1A 1DAHA 1D8EA 4S1PA 3KUXA 2JGIA 3SIXA 4R9RA 2R6HA 1T8UA 3GEDA 3DWEX 3ZHOA 4PFJA 3PT5A 3WYCA 5M72A 2HEIA 2OOSA 3X1JA 1E5LA 4AG5A 5CD1A 2YN4A 1IYZA 1NLUA 3WGJA 3E15A 3BF8A 1LV8A 3BSWA 3K5WA 1K7SN 2F0YA 3B13A 1ISIA 2WXIA 3RC9A 3C3QA 1A0OA 1TAGA 4KXQA 4AJ4A 4URYR 1MUUA 3CHYA 1GKLA 4B2LA 3ESBA 4KAXA 1RBZA 2AJTA 1PEAA 1V3UA 2VYNA 3B5IA 5ENPD 1YFZA 1CR2A 1EPUA 4NMXB 5DLQC 5K7SA 2OO5C 3DOCA 4TTPA 1O89A 5KEIA 4NVRA 5KJEA 3SFXA 2XXAA 3U7RA 1RHQA 2VVTA 1XWWA 1NBEA 3GRVA 3FTSA 4NFLA 5AJYA 2ZPTX 3ZJ4A 3ET5A 4BQEA 2FDXA 1RWQA 3KYJB 3RUAA 2I6FA 1N5JA 4EQ6B 2WXFA 1BGVA 4UNPA 4AK9A 1TM3E 3NAMA 4YEDA 3B1FA 1JJVA 2FMXA 1VPWA 2P3LA 3MMZA 4GLLA 1A8PA 3FJ1A 1GKKA 2BELA 1UJ6A 4YDYA 4QYXA 4OFWA 3FDZB 2Z4SA 1FFCA 2WIJA 2VJOA 4XFDA 3DF9A 3CKBA 2W70A 5CIQA 3HACA 5I7SA 1CJUC 2W2KB 4PZDA 1I4DD 3ZI4A 4AOFA 4HX5A 3LL4A 3GR6A 3DV0B 2PL5A 1GLNA 2X0DA 4QU8A 4QOIA 1DIOB 2FP3A 1M0WA 4B3GA 2JF0A 1TM2A 3KTAB 3IP1A 3KEGA 1ZVKA 3R0VA 2FPOA 1JU9A 1WZEA 4EKYA 4H60A 4KEAA 1CF2O 1FFAA 4NWIA 4TYYA 1N52A 3B7TA 2VQFB 4GOOD 1QG2A 1ENPA 1OI3A 2Q4RA 3E84A 121PA 2Z8XA 3L0PA 4GPMA 1QHHA 4MJ7A 2R7NA 1UQRA 2GA9A 2HU5A 5I8WA 5AQBA 2FU5C 1KETA 2AEMA 2DH5A 3WLQA 1SVUA 4D8WA 4OUDB 5LCWC 2C9BA 1GHTA 1L8QA 1M54A 1WUKS 1I7SB 4GQAA 4IKPA 3ZZTA 2B83A 4BFUA 5T4EA 4NG5A 4LNGA 1NN1A 4JB8P 4W6QA 1T0HB 2QJRA 4CQNA 3UK1A 5G4LA 3W9SA 2IJGX 1O6CA 1X7GA 3KT0A 2V4MA 4YMVA 1IHPA 4RPLA 5ESRA 2R1ZA 3URMA 2JFWA 5FINA 2J0UB 2P1DA 4JDPA 4ZU1X 3ADDA 4PNEA 4GUDA 1JEDA 1J9ZA 5IKOA 4NOLA 2R751 5DWDA 3PDJA 3RKSA 4HOTA 5JSHA 3RADC 3GW4A 1SEPA 5DM70 1QHFA 1INZA 2PL3A 3OPMA 4LHWA 4KN5A 1W0KA 1EUZA 1L5KA 4Q66C 2CXXA 1AQNA 2ZBPA 4A6XA 1EUYA 5ETJA 1ZNQO 5A5EA 4X84A 2PWYA 3IE1A 2P9EA 3HVUA 4OK5A 5LPNA 4L2LA 2Q7FA 4E46A 1ONPA 2NSDA 3FNQA 1OPRA 4LVUA 2R2GA 4RQUA 2PZFA 2OBYA 2JGEA 1W4RA 4RANA 4FLHA 1U02A 4LDRA 4I8XA 1GZ7A 3OA0A 5A5FA 3EY9A 4CLHA 3N2LA 1IQUA 1VMIA 4KKXB 1P3DA 2Z57A 5EKXA 2X6IA 1XNHA 4J9UE 1XWIA 3ITWA 3OESA 2CF6A 4K3UA 2FJAB 1HXHA 3GBVA 2I4TA 1A9TA 1G9SA 4D7AA 5BT1A 3PFBA 1NOIA 4IJQA 4U9UA 3VBEA 3OECA 2J5XA 1QGAA 2OQIA 4IHAA 3CPEA 4QUEA 5SZJA 3TKLA 2WF6A 3GJ5A 2Q5OA 1OA0A 4YMWA 4H7YA 5JPDA 5ITSA 4NBNA 4EYGA 1UC9A 4PTZA 2W8BB 5A4JA 2BKEA 1KYXA 2VP9A 3CR3C 3PUYA 2Y9PB 4Z6KA 4PLWA 4GA2A 1EAMA 3C41J 2OHOA 3GFRA 3KOMA 1S8AA 3AYXB 3NVKI 3K9HA 3TXAA 3HK2A 3A1DA 1RRVA 1YU9A 2MSKA 2GZ3A 3T1TA 3REQA 1QWSA 4P38A 4GZ6A 2X0IA 1E2DA 3A06A 3NIGB 3PL5A 3DV2A 4IQ4A 3LPMA 4IUCS 4W6ZA 2RJOA 3PE4A 1FP1D 1J2RA 4R2XA 3SY8A 4RVBA 1XCPA 2WF7A 4B0PA 4XI9A 3RDPA 5DOZA 4UM5A 4GX1A 1TEHA 3UHJA 1MT0A 5I9LA 1J5PA 1ZH2A 5JAPA 4ENVA 2WD7A 3MS2A 4L74A 3IPYA 1U2EA 2AQIA 3GRCA 3HXQA 2EFJA 3OIVA 2FWNA 3MQFA 2C97A 1EGAA 2C9OA 2ZRIA 2OGZA 3CW8X 4HD8A 2ZJZA 3JARB 3T61A 4ENTA 1KFJB 1K75A 5F4BA 1LTKA 4GLJA 3MWEA 3B1VA 3AR6A 3IOMA 3E8SA 3GLGE 1VL8A 4LCTA 3PFKA 3CLUD 3O75A 4K6GA 2AD5A 2AE1A 5AKGA 2H7CA 4W9MC 1KE1A 2NXCA 2OV8A 2BSQA 4B74A 4RYDA 3U2QA 3WTCA 5AKEA 4UZEA 3RS2A 4XD7A 1K7FB 2WB2A 3VC2A 2JABA 2NP6A 3AEUB 4WZBA 1O5OA 5LZ5A 3M9WA 4WHMA 1NQUA 5WRFA 2PZKA 3MUEA 4BVHA 4I1OA 1RJEA 1NZDA 1NVVR 4D6YA 4QEKA 3LWNA 4C6TB 2XNJA 1OZAA 3L8YA 4MS3A 4MDYA 4R54A 2NP7A 2H8GA 4GL4A 1Q0TA 3IMGA 1NKVA 1L5SA 3BD9A 4KMSA 2R8PA 1V96A 4OD0A 1Z34A 4GT1A 2BFWA 4KBQA 1EZ1A 3N2IA 3EDYA 3IYLW 4G56A 4YJHB 1OCCE 5CYPA 1GVHA 4LZZA 1QE5A 4G84A 5L3RA 4DJDC 1ZHHA 3FU0A 3U7HB 1UPBA 1L5YA 4B3RB 1XQ6A 2WAOA 4Z53A 2D5IA 4C5CA 4F9GA 5LDGA 2HSEA 3KQOA 4GBMA 4QWWA 2I71A 4CF7A 2O2IA 4H1WA 4S0XA 2OBLA 3NETA 4PSVA 2WTXA 1WZCA 3PUJA 3P9CA 1CETA 4HRVA 3D6AA 4TN5A 4QLBA 1UZLA 1Z4KA 4EG8A 2QUJA 3VPGA 3DC7A 5HSGA 4G8KA 1F8GA 3L16A 4ZJZA 4ILEA 2X40A 3PRZA 4G24A 3HL4A 4GAEA 4ZIRB 2ZYVX 3SIPA 2VHXA 4YV7A 3ASYA 4IZOA 1IHXA 4N9WA 4C1NA 3LI2A 3JYOA 3DFFA 3PFGA 1SHLA 4KLNA 3RT7A 3U60B 3KQHA 1N5OX 5ILGA 1QIHA 2QX9A 5CX4A 2GPBA 2R25B 3TWVA 1H8HD 1EE9A 4JBGA 2HMYB 2QYSA 3SC4A 1HMPA 1AZLA 1YB1A 4BEWA 1YS9A 3G1TA 2C2XA 4PZZA 3U13A 2VYCA 3TLCA 4EJ6A 1O95C 2BZ0A 4MWBA 5A4FS 3QARA 3FUCA 2J6CA 1YJBA 3S1AA 1BRMA 4TV9F 1JA0A 1HQDA 4PQFA 2GWHA 1LNZA 5ITVA 2WXQA 1PK8A 3LCRA 3EZGA 4P3XA 1UMDA 3IQFA 3DEOA 2BJVA 3NWJA 4BNGA 1WG0A 2ZB7A 1ORWA 2ZBGA 1NA5A 3AFMA 1USVA 5A7DB 1ODCA 1F2TB 2J6IA 3QSGA 2VNHA 1JH9A 1S02A 3LA8A 4LV6A 4Z0PA 4ZJYA 1XNJA 1JPJA 5FHQA 3UK0A 1PJ8A 2H2AA 4G36A 3H11B 4GMGA 2IIQA 3ILSA 1LB1B 3GN2A 1PI3A 3AB7A 5LKRA 3ASZA 4I99A 3NGMA 2ZXFA 3GP5A 2GCNA 4OVUA 2V9ZA 2XE6A 3OLVA 3QX7A 4JT4A 2XSZD 5CT6A 3KQPA 2WYIA 1E5VA 3U61B 1SHZA 4IG9A 2BW0A 3E9YA 1EX7A 4DVJA 3LUHA 3ML9A 3ANXA 2WJ6A 3MFQA 4K26A 4ZVUA 4N65A 1U9YA 4LWZA 3GLHB 3W05A 2JJQA 4POOA 3WKBA 4F4HA 3RROA 5IC6A 2BPOA 2O52A 3Q98A 2NV2B 4EPTA 4FDAA 1L7MA 3SEQA 3E3OA 4YRNA 1KZPA 1Q21A 1MTOA 2JLSA 1ZM2A 1XBTA 5HPYB 4DV1B 3KQVA 1SNYA 4ZFNA 1SXIA 2ZR9A 3EVBA 5GZ3A 2BF7A 5JR3A 5FA6A 1A72A 1M75A 2EV9A 1RS0A 2Y1KA 5LYJF 5EJ2A 1VL6A 5BR7A 5CBPB 3EVDA 5LD2C 1XTIA 3AEKA 3PDCA 4P35A 3TW0A 2WIKA 4LDQA 5AVQA 8OHMA 4WKPA 4KDFA 1WAMA 1W30A 2FPPB 4GDMA 3DLPX 3FHEA 3FYTA 2VPPA 5JNUA 5DWVA 3ZGZA 1WSDA 3U56A 4ZKEA 2B20A 1TIBA 1J7KA 1JHPA 1XRRA 5DW0A 4M0LA 4QFMA 5JCZA 3I9V6 5AIAA 5LUAA 3H0CA 4D4GA 3WWPA 4TV9B 2XMRA 3E37A 5KI6A 4IQFA 4L16A 5K0ZA 2HL6A 5DP2A 3DLBA 4DJEC 1WHTB 2VHZA 2W6ID 1K63A 5EXSA 5LYYA 2I67A 4HJXA 4RCYA 1B8OA 1VSVA 2A0UA 3PSAA 3SF8B 3WHIA 1Y6ZA 1L7QA 3VAAA 3DEZA 2N1BA 1DBQA 3TSAA 1ZZEA 3ONWA 1PZXA 2YINA 4LV5B 1KDPA 4UCFA 2NW6A 1DC8A 4K9RA 1RBMA 4Z9YA 1CIJA 3C3JA 5EJIA 1T1GA 1QK4A 4IN3B 2ZRMA 1AGYA 2AX3A 4LTMA 2O6LA 3V7FA 4B9AA 3OCXA 2J09A 2V7XA 5ICSA 5BPHA 4PC2A 3H2HA 5I9MA 3SJCA 5TQ0B 4ZCMA 4QXOA 1SBZA 4LRTB 3P9KA 1C8KA 3OQVA 2WIDA 1GAWA 1FXUA 1G8YA 3GAFA 4U07A 1QO9A 1N4DA 3IB6A 4Q9IA 3FUWA 1D0IA 2YR0A 3CXRA 2PZGA 3HYNA 3B7BA 2QMYA 4YRLA 2JKZA 4OI1A 4IP0A 3D64A 1DBPA 2V7QA 4JODA 1A82A 2GTPA 2FW0A 4LS3A 2Z5FA 5BT9A 2GYWA 1DIRA 4OHZA 3V8NA 4NBRA 3G17A 4MEJA 2NQTA 1JFFB 4OP1A 4B47A 3KWLA 1ENOA 1SJ9A 5J2TF 4FWBA 3SR4A 2RFMA 5CYGA 2B4TO 4UWKA 3S44A 1QOZA 2PD3A 1HLGA 5A4DA 1RC8A 1KK1A 1KSHA 3ENNA 4V0ME 1JQJC 1V8OA 4HB0A 1PV2A 2IS2A 3MVEA 3N5KA 1T9KA 2YIVX 3HCWA 4GGPA 2O5EA 3LTNC 1I0LA 3DSWA 1NONA 3AY0A 2ADFA 4BFLA 4AJIA 2W6OA 2QVCA 3BDAA 2Y69E 1L5QA 4MLZA 3QOXA 3DAYA 1U4NA 3ECCA 4YV2A 4PLZA 4M9ZA 4KH1A 2QTAA 1DL5A 3NOGD 4ECAA 1Z5NA 2YOHA 3K9CA 4RJJA 4QJ5A 4RAOA 1CEEA 1FTGA 1HZZA 4G8DA 2GBCA 3K6JA 3AV3A 2BBOA 3OZAA 4UBIA 2ZRLA 4HZGA 1OC2A 4NMHA 4C0WA 4PS8A 1EUDA 3GRPA 1E3DA 4D98A 2CV1A 4I1AA 1PW5A 3NKVA 1Y9ZA 2RC5A 2FUKA 4F4CA 1CRLA 2R60A 2L0IA 3ROFA 4YQEA 1BXRA 1Y1SA 3IUPA 4S1OA 3M5DA 3QU5A 3ASDA 5CLGA 3RNOA 1JQEA 3T3OA 3HLYA 4BTAA 4BRWA 4RTSA 2ZBRA 2WPDD 4TV8F 4LA4A 4OV6B 5JWRA 1UT6A 2IZ5A 4QFVA 1L5FA 3M1IA 3EEFA 5B6PA 1MRSA 5JV5A 5A3JA 4IIXA 3CV3A 3MAGA 1WB6A 1ISFA 7MHTA 5IVDA 3EOZA 2C20A 5A4MS 1Z75A 2I2AA 4LK3A 1I3KA 3WOHA 5ADUS 4PYLA 2D0OB 1HSZA 1GARA 2JIZD 3ODGA 4ICIA 3AF6A 4HCJA 4M9UA 1QS0A 5KJKA 1YQTA 1AK2A 5FR1A 3GVIA 4LOKA 1OXKB 4AMGA 3ZGOA 1HE4A 2FPWA 2IV3A 5H16A 3V3TA 3U7QA 4A3TA 2YFYA 1PNRA 2V6JA 1C1YA 2VG8A 3RTAA 3HCFA 1RLTA 1EIZA 3F6BX 5F78A 1EQUA 5EZYB 4JYAB 4OVKA 2SCUB 3B2NA 4LWQA 4NABA 5IVHA 3PRYA 2BTEA 4QRIA 3CRVA 3GNTA 1Q22A 1E6EA 1YRLA 5AVWA 1XVAA 2WKPA 5FULA 2BTQA 3WLAA 1MA0A 3PYMA 4BT8A 1ACLA 1ZZGA 2W37A 1QBQA 3NBZC 3GGSA 3IKVA 1SU7A 5A4AA 1U0HC 2DT5A 2F8YA 2D1QA 3TAHA 3DDOA 4BNZA 1KERA 1JNZB 1SM4A 3M9XA 4EYOA 1VJ0A 4IOJA 2R8XA 4KNWA 1RWBA 4RKRA 2R5SA 5AXAA 4Y67A 1Q3TA 2R47A 4IH4A 1J8VA 4LC0A 5JMPA 1IEXA 2CMKA 4YDOA 1SZ9A 1DWQA 2C7VA 2G4LA 1R37A 3ZHBA 4BWFB 3EQ8A 2Q21A 3VHXB 1SH7A 2Y6VA 5CGZA 2XKKA 3OUTA 4CKBA 3GLVA 2X41A 4CETA 3I09A 2H16A 5AW4A 3D5TA 1OXVA 3DCJA 5BURA 2L6JA 1MJFA 1ZKMA 4CEIA 3MT0A 5JCJA 4Q4CA 1FTYA 1UOPA 1GAEO 1JCRA 2YXEA 1VCHA 3A1NA 1WSAA 2OQVA 2Z9CA 4FMDB 1SZPA 3AUYA 2GEDA 4RMJA 4K87A 3VU9B 1FPPA 1JZSA 3AKEA 1BE8A 4YDSA 1ECLA 4TQUS 5K8LA 5DCLA 3D4OA 3M5CA 1FX0B 5E7JA 2XRZA 1UL1X 1N1GA 4TSFD 5CVTA 5CNJA 5KNBH 4NV1A 4QBTA 2GRJA 2ZTUA 5G0WA 4ZVNA 3Q9SA 1AQLA 1Z5OA 1MVLA 3QJZA 3TGPA 2AG8A 4OL0A 2CUZA 5M2QA 2GHRA 2WHPB 4AN0A 4HGQA 3L06A 2YTZA 3K8ZA 5DBKA 3I9OA 4GRIA 3FZGA 5T4HA 4UJ3A 1UJMA 2UV8A 1KDZA 5D01A 5ICFA 3H4TA 1A4RA 3UB2A 4P86A 4WESB 2VJ8A 2P9QA 3TBHA 4HLUA 4HNQA 1PQUA 3CLUC 3RBVA 1EFVB 2OHVA 2R86A 3C6MA 2B6CA 3D0OA 3GN1A 5LOVF 1FFBA 3JQEA 2ZRQA 3V7WA 5ENSD 2V3VA 1M6EX 2VI5A 1OASA 4B8ZA 1NJSA 5EVCA 3N8HA 3ZDYB 5LJLA 3MQ4A 2Q0XA 3WK7A 3J81A 4LF6B 5JZMA 5G4KA 1SVKA 5TJ9A 4CDNA 2OGSA 4GX2A 3APFA 3USCS 4NARA 2CE2X 2VPXA 2L82A 1T13A 4CV1A 1LTXA 2Z4RA 5ESDA 3PKIA 3THOA 2WINI 2BGRA 3CJQA 4YJ3A 3PD0A 2GN8A 3H75A 2O2ZA 2Y92A 3KJHA 4BZQA 3HPRA 1A27A 1P62B 2CHUA 4OM7A 3OCCA 2YHIA 3TJMA 2UYOA 3UUWA 3VZQA 1ZJJA 2PT7A 3SOZA 4Q1FA 3M4YA 3ZE8A 3T3PB 1AXEA 3KSLA 2D2EA 4I5GA 3BFXA 3JVDA 5IJ9A 3DQZA 5G1PA 4OXKA 3SDBA 2PGLA 5LU9A 4NU5A 4C43A 1MB0A 3R7BA 2B3DA 3GJYA 1TE2A 5T4YA 2VZ8A 4REMA 3FWPA 3S7FA 1UBKS 2XA2A 2NO9A 4I1MA 3QE9Y 3L4EA 1YQEA 4XKJA 1R0YA 3ZJVA 1HFWA 3EXHA 1DSSG 5BN5A 2O2DA 1YRWA 1NR7A 3T3IA 5G0VA 1N2OA 4D6PA 2WHRA 2IOQA 2FCRA 3HL0A 4EPYA 1OT8A 3WMXA 1VKNA 3QHAA 4AJHA 4DZZA 1QVRA 4PN7A 4D82A 4G1BA 2VQ2A 1K7XB 2GEKA 3QXJA 1FCHA 1YBHA 3K8OE 2NTEA 4ZV4A 5T8KC 1AOXA 1NVFA 2G9VA 2NV0A 1UOEA 1Z4IA 5TNXA 3KXPA 3H9EO 1M7GA 4LKOA 4YK7A 3QTTA 4ABTA 4B43A 3C1AA 1E59A 1E1MA 1QRAA 2Y71A 3HB9A 1K3FA 3BWEA 5B36A 1BU8A 4IG4A 3NHWA 3EUVA 1JJBA 5CRVA 1YQUA 4XUEA 1CUSA 4PGHA 3O4JA 4Z7QB 3BOSA 3FI0A 1V48A 5AVYA 4Y2VA 2GBLC 4DWWA 5BN3B 1K0FA 3CQCB 3TGOA 1CSEE 3WQRA 5SZHB 1HH8A 2YUIA 3JRXA 4NXMB 4BVFA 3UINC 4P08A 1PZNA 1RAIA 4IL5A 3D8TA 1AWCB 3I4RB 4B8YA 1JG3A 2IW1A 3SVLA 4FOSA 1M74A 3G9ZA 4HV4A 4ILIA 4Y0VA 4XQEA 2IU1A 1HK7A 3MTBA 3G8BA 2QRVA 1JSXA 3VSDA 2ADMA 2FEZA 4MEBA 4ETNA 2WPVA 1YFLA 3C6KA 3FPJA 1FYEA 1U2PA 3P9NA 5DXAA 3R4VA 1H42A 1TQ2A 4TMYA 3BGVA 1WCIA 2JZCA 1SVWA 2AN5A 1H6DA 4YQFA 1HTBA 1LF0A 3HCBA 2GFIA 3SVZA 3UOAB 4QOSA 4L07A 2GSDA 1QGUA 1QQTA 4YDHB 7YASA 3O8OB 1LVGA 3IESA 2LXLA 3ZWKA 2IEDA 2GO1A 4EY6A 2GJ8A 5MDHA 5J4YA 4MCJA 4PS0A 1LDBA 1ZONA 3OETA 5DHAA 2FQWA 3VYSB 4A0SA 1Y5RA 3C85A 5K0FA 3OPXA 3VPSA 4HADA 2XS1A 1ZGJA 5K3CA 3ZU2A 4EARA 1VCNA 4BJ6A 1N3LA 3UBTA 1L2TA 4PO3X 4DL9A 2J4CA 1P2TA 1NLMA 2X8BA 5IDXA 3GK3A 1NE2A 2EWVA 3WI7A 4RNDB 1R6DA 3ZXSA 2AB0A 4TPKA 5CFMA 4K5QA 1DZ3A 1Y3AA 3I1YA 4OQNA 1C1XA 1WXIA 1ENYA 3VNRA 3H2BA 3B3FA 5DGCA 2XENA 3R3SA 4CLOB 1PGQA 1RCUA 2OC4A 3JQ8A 2BHTA 2CJYA 4TUYA 4Z5XA 5IMBA 4NBWA 3KG2A 5JH7F 3O8QB 2PBRA 1UOOA 2IYWA 2HMTA 4XWTA 2EBWA 3TQSA 1RHUA 2AHRA 3SWWA 5ALWA 1T29A 2ZWIA 2A58A 4FKZA 3VTAA 1SW6A 4DZRA 8AT1A 1B7GO 5B4VA 5EZ5A 2P9UG 3BRSA 1IN7A 3JD2A 1RYMA 3L6AA 1PBTA 2XCTB 4MW2A 2B1RA 2BI4A 4RCVA 4B6RA 1DQRA 3TM5A 2BCJQ 4CHTA 3WQQA 4DR3B 3OXLA 2F64A 4HAZA 3I1JA 1XXHE 4HVTA 2G67A 4WN9B 3W2TA 4TS1A 3E7XA 4ZTZB 2EKBA 5KJFA 1CIPA 1ZIYA 1N6HA 1U0SY 1FX1A 3VSEA 2F3SA 1HYEA 3GOHA 4IIDA 4X65B 3B7PA 3X43A 3WLNA 1PFUA 1QQEA 2Y67A 1EVLA 4JZYA 2PMCA 1ANKA 3CTMA 3QPDA 4M9QA 1S0UA 2OM2A 1L0BA 1O77A 2WNIA 2P91A 3B12A 1MC5A 3VYWA 1JEAA 1SD2A 1JHUA 2FGJA 2HK8A 3RRXA 3LHSA 1MC4A 1CR6A 3V8MA 4EUFA 1GJRA 4MR9B 2NGRA 1TYZA 1S70B 2DU8A 4WPGA 2FPRA 4ALIA 1E92A 2VYVA 1K6EA 3G6KA 3IXQA 1T4DA 4U2FA 2HF2A 3M4JA 1V7QA 2PL1A 4JI8B 3GI1A 3VGJA 1LV7A 1CE8A 1P1IA 2DFVA 2PANA 4RELA 3GY0A 3CVOA 2B4KA 3HRKA 3PH0C 5LUBA 1OI4A 1Y4ZA 4EB8A 4K6CA 3UZUA 2EJTA 3KVVA 1QCZA 3SYTA 3CF2A 4V1CA 1P1CA 4KFSA 4KK4A 1UR5A 3ZWDA 3OPVA 4WZAB 2QN8A 1R16A 4MV8A 3CUKA 4ESEA 3T95A 1W47A 3KELA 3JASB 1QH8B 3UAWA 4XWYA 1FRQA 1YS2X 3AFOA 3AG6A 3WLRA 1Z17A 4RZHA 3SHWA 2P8JA 4QL3A 3UKRG 2ID7A 1ZI9A 6NULA 1DWPA 5AW5A 2CVFA 4ZMBA 5LIPA 3A2KA 5KOYA 1CR4A 3HDJA 3HP1A 5DM1A 3ONFA 5JH7B 3P52A 2CJFA 1PDWA 2Z2KA 2Z2XA 2Q5FA 1YONA 3MRVA 2FW6A 3NVMB 3TRHA 1UFOA 4RVCA 4N39A 5HM6A 1L5HB 2BE7A 3IT1A 1ZOLA 1JWAB 3OKAA 3IUBA 4YCDA 1PTJA 5ED0A 2CFCA 1G21E 1Q95A 1KHTA 3HBFA 4B4KA 4N7JA 5HS0A 1Y89A 3KEOA 3ZPXA 3EISA 1A8IA 1KFKB 4TTSA 4P34A 3ZE0B 3AU8A 4FWTA 2XZOA 4GYKA 4L0CA 1U9IA 3MYYA 4HQFA 2LNDA 5KX5F 4OP2A 4GICA 2CG3A 4KH0A 3T3HA 4AZ3B 3UHPA 2EIKE 3U3RA 2IHZA 1Z5PA 1BXKA 2B7LA 1VXRA 4OB8A 4C0AC 2HF9A 4I1IA 5IU6A 4NZ9A 1DHRA 3ZOZA 3SNKA 4DT1A 4S2UA 3TTTA 1NJGA 4G0NA 2NNLD 3FMFA 4GNRA 3BQ9A 2NX2A 1CCWA 1E5XA 1UPCA 2JIQA 1LVUA 1X7ZA 2V5QC 5GWXA 1L8LA 5L7TA 3NJRA 2HMUA 1PKXA 3W2FA 2WF8A 3FF4A 4JI7B 1Z8NA 1JWBB 5KYNA 5KHLB 5K3OA 4CIXA 4QFBA 3H7AA 2FZWA 5FDFA 1MO4A 2Q5HA 4RIEA 4BZZA 3UM1A 4RESA 5EJFA 4UTPA 1R6VA 3BE6A 3CKMA 2F48A 5J4VA 3WJAA 3JQGB 3F98A 1YBMA 2NPIA 1UM8A 5H81A 4O4IA 1ZLXA 2E87A 3D8BA 3PC8C 4UE3S 1IHGA 2G25A 5ENRD 2E3JA 2V5FA 1AHNA 4DMLA 2TMYA 3C3EA 4KITB 1U1IA 1QTQA 3TIFA 2FKAA 4J0JA 2HI0A 2P4EA 4EO7A 2ZPUA 1Q7CA 1SVMA 4HGYA 4QAQA 3BB3A 4IUYA 5I9SA 3EXIA 4J2HA 1ZUIA 2XJ4A 3ZDEA 5C8DA 2JIOA 4GX5A 2R68A 5BSHA 1KOJA 2RH4A 1OHHD 5KNGA 4A91A 2I03A 3BUAA 1E79D 3M83A 1QUEA 3CR8A 3Q78A 4KV9A 3LQ1A 3PUKA 2ZBEA 4IUDS 3ZE1B 3TEJA 4HPWA 3U4IA 4KSBA 4YQZA 2J08A 4BGDA 1E1RD 3SJUA 2SHKA 4B7AA 5DMHA 4P0QB 2ZEJA 4C0XA 2F3UA 1PG0A 2IDJA 1RD4A 3JXIA 2M1ZA 3E4BA 3AJAA 2QW0X 1HDGO 1E64A 3BRQA 3ET4A 5KX5B 1RWNA 4EKIA 3DZIA 4MARA 4RWEA 3U5TA 2I5PO 2BZSA 5JAMA 3E3LA 2HF8A 3RKUA 4MINA 5K4AA 1PLLA 1E18A 3L82B 3LU1A 2F3TA 3DZFA 2DM6A 3F1LA 3N6XA 4CQMA 1ACMA 5FOUA 3KSRA 1Z0KA 1NW6A 2WU0A 2NVUB 1RWMA 3CH5A 2PGXA 2YBDA 1R64A 1ST3A 3DSVA 2EYUA 4L73A 2A1UA 3ANSA 1YKSA 2HA7A 3M6MD 4BDTA 3KB6A 1LLUA 2RGNA 1O5IA 5DTJA 2RKBA 4GU5A 5KDLA 4DE5A 4V0SA 3RVNA 4C2AA 3JCKC 2WABA 4GNKA 3UXGA 1LXCA 1OLOA 1QFJA 4FCVA 2RKOA 2IYXA 3HR8A 2A67A 1HV8A 1RNLA 7REQA 5LBTA 1CLUA 2P68A 1H2XA 2JHAA 3WIVA 3A3YA 5FCDA 1Q7GA 1JLKA 4RWZA 5BO5A 5DK4A 3JTEA 5FWXB 1DTEA 4RHYA 1NDQA 2O20A 2ZIZA 4ZZ3A 1KA9H 3Q3VA 1C3JA 2RCNA 2FW1A 4KO1S 4N8SA 2QLBA 3ZE9A 4BLQA 4EY4A 2PPLA 2HDWA 4MIOA 5KCZA 2WDZA 1IVSA 3VR5A 1NU6A 4NFSA 5FUBA 3FBWA 2YMMA 4C0BA 4D8TA 1LD7A 3UYLA 4KSCA 2PVPA 1TTQB 4AT1A 1JXQA 1Y3IA 4L51A 5IN4A 4UREA 1FTQA 2H6EA 3N0TA 2AK2A 1KAEA 1AKMA 3TEMA 1L7RA 2BEVA 1KR2A 3W9GA 2BKAA 3FTUA 1C9KA 4CWAA 3H6GA 4OHXA 4JUAA 4BMSA 3GEGA 1EU1A 4C20A 3PL1A 5EFZA 1NMZA 4WT7A 1YFKA 2IXBA 2AHOA 3FTFA 3GJTA 2CK3D 2HKIA 2GESA 2OGUA 5KQGA 3AX6A 5D3MA 3PWSA 4PZAA 1L4EA 2XBMA 4UQOA 3WRWA 4MRNA 3NYQA 2HCFA 1Y9JA 4PSCA 3LY8A 2B34A 1LSJA 3PXGA 1FDIA 2VSOE 2Z8ZA 2J5RA 2YIJA 2P9YA 3QG5A 1W2HA 2QU7A 1L7PA 1K27A 1YS1X 3ZY5A 2XBUA 4WNFA 2PFKA 3E53A 2H1FA 2ONKA 1UBLS 4CGZA 3K0CC 5FTNA 3NOVA 1YB6A 2JGRA 3VM6A 2Q6IA 1HEYA 4N6GA 3EUWA 4MW4A 1GNLA 4F86A 4ZKDA 3VLFA 5J08A 1ZO8A 1TTPB 1PQYA 3W1VA 1UPFA 3NAGA 2ES4A 3Q75A 5B6JA 3EIHA 3F5MA 1XPUA 1FDRA 1N1EA 4PYQA 2XMBA 4CR8A 3E30A 2HJWA 1CQJB 4I4TF 3QPVA 1EFPA 2YWGA 2OCDA 2BHRA 4CF3A 2KATA 1SR8A 1RQLA 4M37A 5IZCA 4RORA 4IIVA 3HU1A 2PKXA 5EIOA 4Z1MA 2F17A 5H59A 1X80B 1Z74A 4J0IA 2IXDA 1KY5A 4F12A 4NS1A 5JECA 4M55A 3ZW8A 2IX9A 4DLWA 4JVNA 1G9XA 5CVUA 1WCWA 5FORA 1E6MA 1ZRNA 4DTIA 3Q15A 2GD1O 3I42A 2IZZA 3PDWA 1LWNA 4NE7A 2X5GA 3NM6B 4AIRA 1O4VA 5EXXA 3ZVNA 1IHOA 3P45A 1QB7A 4RH0A 3L46A 3WYBA 1KQGA 2AV6A 3T1HB 2J0QA 4B3TB 5JEDA 3EXAA 3JD0A 1E7VA 4DLRA 4NMMA 3PX3A 1UBUS 3L40A 3SZUA 4ZEOA 5I8ZA 4RFVA 3B48A 4QFDA 4BLWA 3E5MA 2XCCA 4Q00A 4E1AA 2WWGA 4C0QC 2RFAA 3Q73A 3K2EA 1CR1A 5FJIA 2YASA 1R4MA 3TLMA 3GOQA 3SC2B 1V3QE 2QLFA 4E11A 2JBAB 5JZSA 3UB3A 4YT8A 1VM6A 4K1LA 4H2DA 3GW8A 1E3MA 2WU4A 1Y1LA 1IULA 1EUQA 3L0SA 4A6DA 2A5FA 5T4FA 1TTTA 1T5HX 5CEAA 2V6MA 3LUFA 5CPBA 4C0SA 1MD9A 4UVEA 4WY5A 5JCOC 1NMSA 3IAM1 2D62A 3GJ0A 1F9AA 2WSYB 3L4BA 4J03A 1PJAA 5CB0A 1E66A 4Y1RB 2WJHA 1JAHA 2FQXA 3OQJA 1SXQA 3PP8A 3GYZA 1BXGA 1NFFA 1NBWB 3ML1A 4IGIA 1R0ZA 5LP6C 3KOWA 4GX0A 1SD5A 2JVJA 3AB3A 3EUEA 5CW1A 2AFIB 2I76A 4LRZA 4DARA 4O6VA 5HOEA 4JJFA 3HGTA 2HJRA 1UMKA 3AJDA 1Z4LA 1EQAA 4JQOA 4L6IA 4I4TB 3MZLB 2ZKLA 1EFDN 4FN5A 1WDWB 3K0EA 4MRMB 3RIHA 1NVBA 1Q19A 3A1EA 2FGKA 1CUVA 4MW1A 1I0ZA 1CZNA 4AZVA 4RHXA 4X62B 1U8ZA 3BC1A 4UCWA 3SZMA 2BEUB 1E9RA 4X7BA 3WHLA 2H1IA 1COWD 5HK9A 4R8KA 3GBSA 5IHPA 3NJ4A 3PXBA 1N2CB 1GPLA 1K1BA 4KWHA 2JAXA 1SRQA 4XEIG 5DGXA 5ES3A 1NVVQ 3CKCA 4G23A 4YYZA 3AUFA 1FMTA 4K9MA 2FWBA 5TS2A 5EESA 3HXTA 4A8JA 1OAAA 3W90A 1FSZA 4I1VA 4A15A 3QE4A 1WPQA 2RG7A 2EHJA 1FMFA 1QKKA 3DAHA 3SEZA 1TZ2A 4QHYA 4L5JA 3ZY3A 4OHFA 3AVTA 1TAUA 3OBIA 4ZO6A 5PGMA 2CJPA 3B9BA 2MYTA 2WT4A 2I91A 3V5NA 3JZFA 4LUCA 1HMYA 1WM1A 5DBFA 1TKBA 4RIFA 1G5IA 2HREA 4QPDA 2C2MA 3BHNA 2WU3A 4MX8A 2YHEA 4FWIB 5KSOA 3FRJA 1Z0AA 3IOYA 2I34A 3ZGNA 3OCYA 2CXNA 4DMHA 4AJLA 1XMOB 1Y7TA 2BMEA 4M83A 1PUXA 4ZV7A 4PR0A 1U1DA 4CEHB 1PR9A 4HZUA 4UTVA 1E69A 2AN4A 4MYUA 4FYVA 1F8FA 4HQRA 4LHSA 3FPCA 2FEXA 2Q2NA 3VR2D 3DTVA 3AZOA 1MZVA 1NNUA 2HHAA 5KC9A 3CEQA 1KP9A 4AM9A 1AB5A 1HE5A 2FPLA 3EQ6A 2DZOA 1H66A 3VVLA 1T2AA 1ENZA 4AZ0B 5EKUA 2QUBA 4GZ5A 1SG6A 4XWAA 2Z1DA 2J87A 1NFQA 3ZYZA 4F4JA 5L53A 1IMOA 2VC2B 3NTQA 3GGOA 2I6QA 2LWIA 3KQKA 2BOVA 5JRJA 4MNTA 3U62A 3NAWA 5C1DA 3CIOA 3AEQB 2C3UA 2W0MA 1MG5A 4WNIA 3M82A 2GUGA 4TVOA 1G8MA 4LZOA 5KQMA 3I5YA 3JALA 1J33A 1BU9A 2K7ZA 2UWJG 1N6RA 3QXXA 4K6KA 3TR6A 4S1VA 2RJNA 3Q3GE 4HAUA 1QIDA 1YHZA 1JNXX 1XEFA 2X38A 2CXOA 1XVIA 1C7QA 2DP4E 4LFCB 4EHHA 4TUUA 4UEOA 5AUQA 1PG2A 1HI9A 1XMIA 1TMYA 2DUWA 4ZQGA 1T1SA 2QL9A 3Q7IA 3U4GA 1JVNA 4NCHA 2ZRFA 2I9PA 2C4NA 3LX6A 2C31A 3GRAA 4JNCA 3MTQA 3LWZA 3ZYMA 3GQBA 2PZLA 4P82A 2WWIA 2R00C 5ERGB 5AW1A 2UUAB 1CZRA 3TW8B 1Z7GA 3HR4A 4CYMD 4EM6A 1CY2A 1ZBQA 2FPIB 4MO2A 1WW8A 2IV7A 3DKVA 4JKIA 2P58C 1C1DA 1QH9A 4ZK6A 4QU9A 3L8ZA 4IDEA 1JL3A 2R7MA 2C4HA 3F49S 1JIVA 4TWZA 2FRXA 4KT6B 2AXVA 4BSXA 4UNNA 2P6PA 2YZ2A 3NYRA 2QX4A 2XNHA 3LJKA 1ESEA 1L4BA 2IOFK 4DXHA 4CKZA 1ZRHA 1I3NA 3ZZ1A 2K7FA 3FRIA 4H0CA 1KMHA 4KWIA 5ELLA 1OIWA 3JQPA 1P4RA 2JFYA 3MJVA 5B58C 3QFRA 2QRZA 4NEGA 1B3RA 3L6BA 1ZISA 3DBHB 1N57A 2ODEA 3KO8A 4WI1A 4Q9LA 3L9TA 1ZNYA 4LJ5A 4O1MA 3ZHZA 4LECA 5IAAA 3R5JA 1NV8A 1XC7A 2ZJ0A 1LC0A 1GLVA 5E3IA 1ULAA 4NBUA 5L95A 2OSBA 2RCYA 3FGOA 5DYNA 2XECA 4ILHB 3WL7A 1VCIA 4TX1A 1V8PA 3IDAA 1WJGA 5HQJA 4RG9A 3PJRA 4IM7A 5L4NA 4O4HA 3H99A 1XZHA 3DMNA 2M6LA 1YK0A 1SURA 2QXTA 4LC9A 1KJNA 5LQUA 4ZQIA 2E6UX 2OCIA 1CUZA 3KJGA 3WS7A 5ANRB 5KVVA 4Q1EA 4FDUA 4YR7A 2HYIC 3RYTC 3OEEA 5BV8A 3ZS9A 3EDCA 5I6DA 3MFYA 1LZLA 4E51A 1VBMA 1X1QA 1VPVA 5FBLB 4K3VA 3ZI0A 2EILE 4EL5A 3RBZA 4NU8X 5CHEA 4UWFA 4XD2A 3RFVA 1OWLA 5T8IA 5HFJA 2JFPA 1GILA 3SI5A 5AQAA 1P4SA 3AERA 5CT8A 2XIQA 2QUIA 1P0MA 4F2HA 2PEYA 3KJXA 4UHFA 1XCBA 3B6MA 4YCAA 3GARA 1HT2E 2AXQA 2JASA 2IGBA 4ETIA 2WJIA 2AFVA 1N3BA 2IC5A 4MQFA 3V8QA 2PKQO 5AHWA 1QJCA 5GVSA 1C14A 3MMSA 4OJTA 3U48A 1SC4A 1NAIA 5B6IA 4KPUB 4GKKB 2BKKB 4DTCA 1FRZA 1X9HA 3ZLVA 5EYPA 2AW6A 3S2IA 1MQAA 3LDZA 5FI3A 5C5EA 4FGJA 5IKPA 1RC0A 4MDFA 3HTXA 3HXPA 1WMSA 1I36A 5JZVA 4B09A 3NGLA 2BFOA 3ROKA 4CJXA 1P2DA 2C7PA 2V4ZA 4QG3A 1U0GA 3A3OA 2F9FA 5FHRA 3GEIA 1QIEA 1SN7A 1KI7A 4B44A 5EY5B 2ZR0A 1X0XA 2PFSA 1ESZA 5L45A 4DA4A 2DXIA 4PNZA 3OQNA 1G1AA 4RQBA 2HV9A 2UU9B 4BFWA 4OBBA 3TLEA 1UWKA 5K1ZA 1M5UA 3T9BA 1V11A 1CWUA 2IF4A 3PTAA 1OBCA 4U3JB 5DCUA 3E1KA 1VA4A 3I0NA 1O08A 3I9NA 2WTEA 1J70A 4F3CA 3Q6IA 3OZGA 2NU7B 2VF2A 3EN0A 5EQTA 2OCCE 1J8DA 4FC6A 3UJ7A 4J94A 2PH1A 1AA9A 3WSTA 2WE8A 5L7YA 5KHOC 2IZ6A 1BH6A 3PWTA 1YNSA 4CM5A 3DFMA 5ENTD 3FPFA 3GUZA 1EDDA 1QBKC 3T06B 2REXB 5JWOA 1TK3A 1QG6A 3VZDA 3OM9A 1H2AS 2P2CA 4GR5A 3K9NA 4F9TA 1Z13A 5H8WA 4D3XA 2XCSB 4EA8A 1TRKA 4DDTA 2CLMB 4QDUA 3WJ2A 1ZH6A 3WVNA 4A27A 1YVDA 4ARUA 3R9KA 2XTAA 4HB5A 3GXBA 3IDZA 2IYFA 2RBEA 1U0JA 3WFZA 1FP6A 3O84A 4D8VA 1DJLA 4N2SA 1JQDA 1ZD4A 5NLLA 3UQYS 3AM4A 2CXSA 3OLXA 2PKWA 1OJ7A 2RH9B 2EJCA 4YI5A 3FP3A 2VJKA 3AK4A 3JPYA 4HWTA 2GN6A 3ZNPA 4JLUA 2B4YA 4QARA 4QPCA 4KCGA 3UCXA 3MWYW 1YCFA 3SLGA 5LYJB 2JLQA 3FYUC 4OQXA 2WRZA 4CG0A 1WAO1 2BWJA 3KU4A 3RT1A 3UH1A 3KVNA 4KI7A 4C29A 4GWLA 1X86B 1HNZB 4JCCA 3LQYA 4RY2A 4LGCA 3I61A 4DR5B 3LC0A 3IX7A 4ZO4A 2XCQA 4EHDA 2XTJA 1VLVA 4AY5A 3JD4A 2ETXA 4X94A 1TUBB 1K7EB 2Y1GA 3EIQC 8ATCA 1MMFB 4ZPJA 1L3CA 1QV9A 1SZDA 3H1PA 1IM8A 2ZRNA 1USWA 2YV3A 1LQTA 2MMCA 2ZUFA 4D6XA 4JVSB 4KXWA 4HAYA 1SBNE 5AJXA 1MEEA 2YKGA 3HKEB 5LA6F 5KOHA 3EDTB 3ZEFA 3R6TA 4XIFA 2WWXA 3CIFA 3F6SA 1ZAKA 1JG2A 1XZKA 2EARA 2CCGA 2C98A 2CF5A 3ZCTA 2C4VA 1T6XA 4ZV9A 3ZH2A 2ZTMA 1U0LA 3I9LA 3OE5A 3T5AA 5L6LB 2XR1A 1ZSVA 1XAGA 1TM7E 3ZWCA 3TOXA 1F3LA 1JLRA 4BECA 1NBIA 4BNWA 3T52A 4GM4A 1GZDA 1BN7A 1TNOA 1NVWQ 3MERA 3A27A 5COBA 4BFZA 3WNQA 3QU2A 3HNRA 4IQ0A 1Z0UA 5TMDA 4UHJA 4NLLA 4QYIB 1XFDA 5IT4A 4AS1A 2BLLA 1G8FA 1VLMA 1J56A 1P77A 1KH3A 4D5EA 2O5RA 2BN4A 4TV3A 3BRCA 5B30A 4DOMA 5LC1A 2VNAA 1N7GA 2YS6A 3V6MA 3BWDD 4DADA 5E9JA 2Y1OA 3FWNA 1EDUA 3O8BA 3VR1A 3CSTA 3EXFA 4K0KB 2XKAA 4OIFA 2PEZA 1M76A 4WLNA 4BBZA 1M1YA 3P1UA 5J2TB 3TE6A 4LEIA 4RZ3A 5FTWA 4TMFA 1BX3A 1L1RA 4W5WA 5IJZA 1H5UA 3NFYA 3RRZA 3WMRA 3L7IA 4CGWA 3FFBA 3L92A 5IULC 1KI6A 1DBVO 1KJ8A 4AKGA 1B41A 3H1FA 2VF7A 2VBGA 1FB5A 5FIOA 5AICA 5KNDA 5B12A 4EA7A 2EHDA 2QN2A 4F46A 4LBZA 5DSTA 3EWSA 4MR8B 2F67A 3GRYA 3Q88A 4ZDKA 5L3SB 3VDRA 4L3OA 5F9FA 1TIKA 1XCJA 1X4RA 3H17A 1OFGA 1YE5A 3I62A 2OXFA 4YCSA 3L01A 3U66A 3L22A 3GZNA 2FZLA 1BD4A 1NJ2A 1FTNA 4LJ4A 4LXXA 4YAOA 4C7OA 3T5XA 2WXGA 3WKCA 5HRYA 4YXWA 2GDJA 5ECGC 3DKKA 2ZTLA 1J2EA 3MK31 3TI9A 2LIPA 5LA6B 1YJ5A 2B69A 3T5GA 1HF3A 2C5BA 2X3YA 2PXHA 3B7SA 3NATA 3WG7E 1I14A 3KV3O 5DK6A 2IOSA 4DUIA 5BORA 2FN8A 2QMHA 3EC1A 5K99A 2VF4X 5H02A 1I4TD 3V4FA 1INLA 1MAWA 2WWVD 4TV8B 2JAWA 1ZJYA 1PFGA 3NOCD 4B76A 4WGFA 3OBBA 4PTLA 3DEPA 2HTFA 3GLIB 3OZRA 4MIYA 3D3KA 1AQ6A 4B9EA 5ARGA 4EEZA 1VJ5A 4H1HA 1W9HA 4I43A 4E4TA 3AXTA 1RQNA 4EKGA 1JHAA 3DNMA 4CZ2D 2G6TA 4EY5A 2H48A 4AECA 1I33A 1MHQA 4BHTA 3B1ZA 3ZY4A 1SCBA 1E7SA 4FEYA 5E38A 1M83A 2H2DA 4HLLA 4N5CA 1XHEA 4ABYA 3DL4A 4AS3A 3ZE6A 1PX2A 5DOVA 3JZMA 2E4YA 4LX8A 3UWDA 4GLBA 4L78A 1SC9A 4ND6A 4B73A 3H65A 4MLCA 6REQA 4OMCA 5KAMA 4DLZA 2CXPA 3ED1A 3OJOA 2CHVA 1G9TA 5K4HA 3IAFA 3KB1A 3I2HA 3UVEA 1SOUA 4QYWA 3X2FA 4MS4B 1DQYA 5C3MA 3FFLA 3R7FA 4C88A 5IXSA 5JI2E 3EHQA 3QKRA 3TEFA 1F6BA 3DE7X 4DA9A 1N1MA 1SC3A 3V8PA 1ATZA 3CNNA 1CQXA 3LNCA 1B3BA 1GPWB 4MCHA 4PSKA 1DXQA 4BPRA 2V8BA 4PHHA 2B8NA 3UKJA 1DEAA 2I6UA 3EFBA 1H3EA 3VVBA 2FZ5A 1WKBA 1UKAA 1OFIA 3UTDA 4CQLB 3JUIA 4OVVA 2AZMA 5KOJA 1WCXA 1S2IA 2QRKA 3UV3A 4C06A 2ZBDA 1A9QA 3RFTA 1PIWA 2HNBA 4IJMA 3T1NA 4Q05A 1KY3A 2GJAA 3LUCA 4HFMA 3LQQA 4KWTA 2BT4A 1OUVA 4RPKA 5JXJA 3BXXA 1XMQB 3HY6A 1WXHA 1SZCA 2FCAA 1UF9A 4TSKA 4Y6RA 3M9LA 3OXGA 3COVA 1O87A 1A98A 2J30A 4UBLA 3N1UA 3PNOA 3OTGA 1V5EA 4XARA 5HOQA 2Z8YM 5JHBA 1P73A 1P2VA 5AQ9A 2D7CA 4I9GA 1GDHA 4R41A 1DUVG 4J0FA 2WV9A 4TLAA 4BO2A 5K6AC 4Q7MB 4BP1A 2NV6A 2GZDA 3QOYA 1P3Y1 1E9AA 3LQ2A 5FFMA 5JMTA 1RHJA 3O48A 2R97A 3WA6A 5KKNB 4W5RA 3ZV4A 4BASA 4R98A 3L6RA 4V38A 3KL2A 4R1PA 2QV7A 3GLRA 5EX0A 2PS0A 5F1OA 5DLYA 2PKEA 4HX2A 4W82A 3AJRA 4QEZA 2OMKA 4WBNA 2PUHA 2C99A 3GLFA 1Y9EA 5ESWA 4YVFA 4YA6A 2BTOA 2IBMA 5EIHA 4MRUA 1X9GA 3KVRA 4Q6WA 2HU7A 2C0LA 1OYVA 3TJZA 3GJSA 1VG9B 4YFYA 1S7CA 1NJFA 1JAXA 5I4IA 1CQPA 1GZSA 2AN3A 5LOVB 5ENNA 4WXRA 1UM9B 3PWZA 1TAHA 4DA8A 2H1CA 1XJQA 1C0PA 1EFCA 2KBEA 4WCVA 3H87A 2XUJA 5FEMA 1XVUA 2QGZA 2V5VA 2PRYA 1QQAA 4YIHA 5AVXA 3LP6A 4O02B 4FGZA 5BSKA 2C07A 4WNGA 1BD8A 2DQKA 5REQA 1TMKA 4MW6A 1UKVY 3EGXB 1GUFA 2ZVPX 3SJAA 5BMVF 1DWOA 4IWNA 3GRZA 1U99A 3FYCA 4HYTA 1OXTA 1TZMA 4IRUB 3UCFA 4FZJA 5TIIA 4E3WA 4BQRA 3DZ8A 2D8MA 4AS2A 2A4ZA 1UMBA 2ZCUA 1ZCFA 3HJUA 1CFZA 7GPBA 1U2DA 4FXOA 3U4MA 3CVVA 4YO7A 1E9VA 1TVKB 1QU2A 4AKEA 2ZIXB 3PI7A 5FX2A 2WVJA 3RJMA 2R85A 1FQJA 1KYYA 3W9BA 1Z06A 4UW9A 2AL7A 5HKAA 2HHCA 3D9MA 2NO1A 2JATA 3QVXA 1ZJ4A 2GI4A 1D1TA 3H0EA 1K3ZD 5ITZA 3D9HA 4WNEA 1V2HE 5JJ5A 2J32A 4MVJP 1GTG1 1UAYA 1QANA 4Q0MA 4EHMA 1HYQA 4QBIA 1L8XA 2ON6A 4NP6A 2LCQA 3QDNA 2R7AA 5EERA 7MDHA 2O7QA 1UBOS 4DIFA 1G17A 4ZVQA 1QYRA 1SZJG 5A9SA 4HPJB 4MPRA 1RXYA 3CEHA 4GO1A 2WUVA 2FI7A 2QQ0A 3WGQA 2YL2A 3BJEA 4MVJI 1BHSA 4LWPA 3D7LA 4P4SB 2POQX 4Y9UA 4YJFB 3UXYA 4AJEA 5BPFA 1ECFA 3EGOA 2V74B 2WHXA 3JQ7B 2PH3A 3B82A 2DYSE 2C5LA 2HMSA 2PJDA 3OOYA 2RGXA 3VFDA 4KGZA 5F7OA 2XUOA 4HXGA 2DG2A 3X1XA 1U98A 2F6RA 4K9DA 3SN6A 3DBRA 1R9NA 3FVTA 1HWYA 5K3SA 1UIRA 4EQ6A 1UBTS 5FQ6A 1K6XA 2H06A 4GIBA 2X5KO 5FUWA 3SOPA 3JPWA 2FOXA 4EFDA 2HLDD 2AXEA 3PXUA 2ZUEA 1Q44A 5KU7A 3FDZA 4PO1A 4QT0A 3GGPA 4C2TA 4BO5A 1TCAA 5AOXA 3D8UA 5EJ5A 1D9XA 5TT1A 1ZW1A 4FXPA 1TJ3A 3KB8A 1ECCA 3OICA 1D6JA 1QKJA 5BMVB 4MVJH 5C7YA 1A9XB 1S9HA 3DV0A 2QTMA 4MGIR 3O74A 5AHRA 5AIJA 2F43A 3LX8A 5D3ZA 5IF9A 1Y5LA 4MBGA 3TE7A 3L8MA 4O0MA 1AN0A 2PA3A 5U4QA 1OZFA 3WGMA 4DNXA 5MN6A 3GRRA 4GI5A 1F8UA 3HJTA 1T2CA 1J8MF 2J45A 3LCJA 4E5NA 1CY7A 2ZUUA 1XZBA 4L9SA 5TJHA 4JP5A 2PZEA 4HFNA 1HT3A 4HB3A 3EA0A 5FADA 4EJ0A 2ZJ2A 2VSFA 1T2UA 2VRCA 1OSNA 2GRNB 4U8YD 5DX0A 1GGVA 3UICA 2FYTA 1GRCA 2DWZA 2WYHA 2GGSA 1GOTA 3T3DA 4FEGA 3W9YA 3I52A 1OY3D 1Z0SA 4R6WA 3AF3A 3BA6A 1LS6A 2OV2A 2FRVA 2JFQA 1CTQA 5CA1A 1H94A 3CINA 4H1TA 4JB3A 4ZN6A 4YCMA 3T1QA 3KPUA 2J0UA 3WLHA 5AOBA 4GXTA 4A73A 4I17A 1CS0B 1PF7E 2GKOA 1O9BA 3KOXA 4WWNA 1FPMA 4J75A 3G02A 4V3CA 5ALZA 1QJ4A 4AJ9A 4IJWA 4BTLA 2RBGA 5CU7A 4M99A 2QGNA 1DO2A 2G4VA 4K05A 1C8LA 3GWGA 5AKJA 3IUNA 3LD9A 4PZLA 4AL4A 5HQ8A 3OTNA 4WKBA 5JC1A 5FWYB 2VAXA 2DFPA 3RV3A 2L17A 3CZMA 1GUZA 2I1QA 2B5VA 3QLJA 1ECJA 4EW2A 2VTEA 1IZZA 1XOIA 4GKVA 3ADKA 1FNMA 2D7DA 2ZJ7A 5K9ZA 4FYKA 4BP9A 3LLVA 2GFHA 3ZXIA 3B38A 4LF7B 1UPUA 2FWIA 4UFNA 3PQ6A 4F53A 5AUOB 4BRZA 3R7SA 1VLHA 4CM8B 1KF0A 4AI6A 5ABPA 1ZMBA 2XX3A 4RZQA 4XLZA 3QEOA 1VYVA 1I32A 9GPBA 2QSYA 4UOZA 3M33A 1WXFA 1P17A 2XOXA 1QSGA 1TA4A 3I01M 9LDBA 3AU5A 5FUMA 3T5DA 3LOUA 1NT4A 2GXAA 3SICE 2FZCA 1GPH1 5LWHA 5F64A 2BJWA 3P0IA 4RDXA 2ZATA 3ULKA 4L5CA 1I3OA 2B4QA 5E1DA 3Q8WA 1CUJA 1NMEA 4UM9B 1Z9BA 4MWZA 1I4EB 4Y0AA 1UJBA 1QRUA 1NRWA 1SBHA 4RE5A 1U2GC 4INAA 1ABEA 3UT6A 4E09A 1HF8A 5IWAB 2VRBA 2W8BA 1AX9A 1E2KA 1R1DA 2RAUA 5EJ7A 3RIYA 3V9AA 1KMIY 2PQ6A 1KOLA 2O1SA 4FYHA 4MKHA 4Q18A 5H9VA 3B1JA 4WCFC 2G8NA 3AIOA 1YK1A 1JU4A 4INOA 4D74A 3BTVA 2PTGA 3F4BA 3KJIA 4XDHA 4XYEA 2IX3A 4YJ2F 5CNIA 3GEBA 4F6RD 4ZI3A 1JLMA 3U6KA 1Z2OX 3H3XA 4BO4A 4IXMA 2Q5QA 1A5TA 4LRYA 3L1UA 1BMFA 4U00A 5AI6A 3FOEC 2V7GA 2AZ4A 4JGGA 4W1SA 4F72A 2Y1FA 2WKSA 3OWOA 2PGOA 3CRMA 1OH8A 1I1OA 1CUIA 1TMOA 3IP9A 3F3MA 3R7NA 2DFKB 3SX4A 1IDOA 4PQGA 4M3OA 1EK1A 2VP5A 3TTVA 4ZYVA 4TL6A 2X4LA 1XQXA 1ZJ6A 5CVVA 2BFEB 4DXDA 3ZHRA 1PYOA 4U04A 3V8EA 4KAFA 3JARA 2ECKA 1X9IA 5ALSA 2VAMA 3L13A 4MQ6A 1KYZA 1NVDA 3FMVA 1YWGO 1RMTA 1J0BA 1BO6A 3VAYA 1C9NA 4DLVA 1M73E 3EYWA 1JHOA 4NG4A 4OB7A 1C0EA 3UMFA 3A9RA 2P3OA 4ESVA 5M29A 2XA9A 4CG2A 3G8CA 1K8QA 4S35A 4YMHA 1WO8A 1E3IA 3T8YA 5AD1A 3HBJA 3UT5B 4TN1A 3GJ6A 3IDFA 4HMOA 4GH5A 3G2NA 1HX8A 4RSYA 2ZBVA 3WK6A 4XE0A 5FF9A 3W8DA 2GJ9A 3I0MA 3RE1A 4C6TA 1I5RA 4QELA 2Z8YA 3WB9A 4KNYA 2VK1A 4B40A 5K2MA 2MYUA 3KKLA 3RVOA 5ALKA 1QZTA 2HSJA 1O97D 4H4DA 3II6X 4OTZA 1N1DA 1QX3A 2P9IG 4GUAA 2CEAA 2EIXA 3AUTA 2FZVA 3CVQA 5DYWA 1N78A 5EWMB 3SQOA 4XASA 1MOQA 5SZIA 4ND3A 1A8QA 2AKYA 3SKYA 1OBHA 1ZKDA 4GQBA 2V97A 2P5YA 2OD7A 3DOOA 4PX2A 4L76A 2GKGA 5F23A 2QL6A 3HJNA 1BFUA 3MILA 5EXDA 4BO8A 3ZZ0A 2MHKA 3O9MA 4Y2SA 2R79A 4J16A 1D04A 3O4VA 3OCZA 3VPCA 3WDKA 4UYKA 4C5AA 3N59A 3M2PA 5IG2A 2LKCA 3RSFA 4YJ2B 3P32A 3TZHA 4ZK2A 1Z26A 5JS6A 2HQRA 4HI9A 2VUUA 4CNQA 4M8KA 2ZS7A 5D85A 2QN7A 3LKUA 4Q21A 3QLTA 1AMUA 4RFSB 1L5WA 4MO9A 2OGWA 3ZU3A 5HI7A 3F90A 3NBFA 1KWGA 3H5WA 4QM6A 4RQTA 721PA 4TWIA 3FYDA 4AIFA 4AV7A 2CHQA 1KXJA 1Y42X 4DLSA 2WSLA 4UQLA 5DTMA 3QUCA 2ENWA 1C3OA 3RV4A 4QRHA 3D6VA 5F12A 2XCLA 2A5YB 4PLHA 3LKZA 4IYRA 4V39A 1AQYA 5G55A 3C5EA 4QHTA 2C54A 5BR1A 4Y6WA 3QJYA 4ACLA 3BREA 4D9IA 4LJSA 2BZ1A 3ZDRA 1B26A 3IQXA 5E3JA 2LDBA 4FFBB 4R8SA 1PT7A 1AC5A 5ALQA 2Q5JA 5INTA 2AF3C 2PGAA 1Y8CA 4H9GA 3PK0A 5EC8A 2YIDA 4QPJC 2R4UA 1E0JA 3H7IA 3ONLA 4JITA 2WT9A 5A62A 2BCGY 4HWKA 5JAQA 2ZXWE 4LOLA 2RB4A 1JIJA 1QK5A 3LW8A 4ARZB 5E6UB 4KQCA 3WWOA 4IHJA 3CKKA 3DEYX 2QAGC 2WSIA 1EG7A 5D3QA 3WLLA 3PGMA 1GUAA 3OCVA 2F3QA 2OD2A 2WJJA 4V0LA 1U2ZA 4S1NA 4B6QA 1PQWA 2E1PA 1QZ3A 4ANXA 1T6YA 4BEBA 1YBFA 1ZK0A 1PEDA 3W5CA 2P9CA 2P9LG 2AJ8A 1OTYA 2VXYA 1O9GA 4LCEA 1NP7A 1PDVA 5LQRA 2C4MA 3H11A 1ZOPA 4UWHA 4PAQA 2AN9A 2QB5A 5L3QB 1Z22A 1E6KA 1EX6A 4RSMA 3EGEA 4URKA 2GZ1A 3ZHVA 3RC1A 1JPLA 4BV8A 3HCAA 4XW2A 1Z5GA 2A59A 1NM5C 3CG4A 2YJNA 4WFQA 4BESA 2IHJA 1ZUNA 2CBGA 1KSGA 4JP2A 4IS2A 2VJLA 1JLLB 3LDGA 4CMEC 1A1VA 3HBMA 3K0FB 4UTOA 3OU2A 1J9GA 1IMJA 1OFHA 2PZAA 1MOSA 5THQA 3W5UA 4GE3A 5HIIA 5GM1A 3K6KA 1PK9A 4ENWA 1L7DA 3GYXB 3RQSA 1GFWA 1FBTA 4F7AA 1I2CA 3F7TA 3AONB 1HGXA 3WYAA 2Y1CA 3E7DA 1R4AA 1R6AA 4FJZA 2BD0A 1K89A 4OSEA 4C4ZA 3IC5A 3M34A 2W22A 1JPUA 2ECQA 1SVIA 4QWMA 4OA8A 1MAHA 1FYVA 5JSUA 1F1JA 2QTFA 2PPVA 5JMWA 4O1HA 4AX8A 5A5GA 1HPLA 1CG6A 1M6VA 2BY4A 3UA3A 3KDAA 3CHMA 1J8QA 4OSOA 1SOMA 8ABPA 1CT9A 3BFKA 4WACA 3TGWA 2XGJA 1WR8A 1FFSA 3T12A 2EYQA 2DWOA 2QE7D 4KGXA 4LK2A 1JSZA 5ER6A 4CM4B 3K09C 4Q9AA 1NZJA 1Z83A 4I55A 1ADFA 1KPHA 4J4BA 4LYEA 4IICA 1WHTA 5FA8A 3RRMB 4NMWA 4PPFA 1JA1A 2VHWA 3IJ5A 2IIVA 4I9FA 4UVGA 1CF9A 4L9WA 3HKCB 2DSTA 3H84A 3SZOA 3ABSB 2VEDA 1IHDA 4NAVA 4FMPA 4PAGA 1IYGA 1KQFA 5KIAA 3U09A 1XRJA 1DBIA 2FLVA 2XY4A 3GVCA 1RSZA 2YVKA 3FUXA 3RUHA 1X94A 3DTTA 3CLHA 1WNTA 3HYLA 1T4CB 2TMKA 1QP0A 1ZVMA 3U17A 3E05A 1RTKA 1W1WA 1KNQA 4G1CA 5IKXA 3X1DA 4X8MA 4J8DA 3R6GA 4BJ3A 4BLRA 2BRUA 2GD0A 1E8XA 1NVKA 1AGXA 2AOUB 1JDBC 2IEYA 1KC3A 2XB4A 1TECE 4NX2A 4KIJA 3ILHA 1D0VA 4WWHA 3RVDA 2OTCA 4IZ6A 3WE7A 4ZP1A 4KUEA 1FTSA 2BFDB 4U2KA 4Y7DA 5LDDC 2WPNA 4OK3A 3EU9A 4RFLA 4DIBA 4YTEA 4V0NA 5E0KB 3D9OA 1Q50A 5CDFE 4JUDX 2CLFB 3A6LA 1VYUA 1JFFA 4C21A 4XX0B 1E8YA 2P0YA 4M1YA 5U4XA 2C3OA 5GAJA 2NXNA 2HM7A 2X1LA 1TLTA 1H0HA 5EXEA 4ZOBA 3FBTA 3VTFA 3LOQA 4PLFA 2JLUA 2QSUA 3I01A 4G5SA 2D2VA 4MKZA 3B6KA 5T4BA 2ZUWA 5BW8A 5EMHA 2GJSA 2ZJFA 3ECAA 1JTFA 3ZCQA 3LE8A 1X1DA 1F48A 2R6GA 4REQA 1GQQA 3H18A 4LUNU 4RH3A 2W4IA 1V5GA 1F06A 3RANA 2VSQA 1C2YA 2FE4A 4GWGA 1N5RA 2A9FA 4G2NA 3SFVA 1UFVA 2X8LA 1Z2PX 2CYBA 1D3AA 2JD2A 1PJQA 4DQUA 3R3WA 2DHRA 1FYXA 2KE5A 1VJTA 4GRAA 1D2NA 4OQYA 4Q9KA 4J0QA 4IDFA 4X1OA 1JZTA 1LPPA 3NIDB 2RE8A 4IFTA 3GZJA 5J5VA 4G8BA 3PUZA 4TMTA 5C18A 5FRDA 2XGGA 1CDOA 2OWEA 1SVSA 5TS3A 3FKSA 1KZHA 2FG7C 4GR9A 2JFFA 2FX5A 2HYDA 3KPYA 5CBNA 4D92A 2IL1A 3ZWNA 1YRQA 1RKQA 3KQLA 1SXJE 4J7XA 2XS8A 1XDUA 4DEYA 3IJRA 1P2UA 1QX4A 2A4MA 2ZRHA 3TTSA 1R8JA 2EJWA 2FPKA 4ZC8A 1YZQA 4EW3A 2NAFA 1BKSB 1QZZA 1Y7LA 3PS6A 2BI8A 2GN2A 3R9AB 3IODA 2LCFA 4EZJA 5JO0A 1KBZA 3O3CA 1EB8A 4H3VA 3QI7A 3RS8A 3DM5A 2WSMA 1GQFA 3LHDA 3U3MA 5KKCA 4RU1A 4NEQA 1GQYA 2YZKA 4OHYA 3WNCA 5HCNA 3VO8A 4UDXX 1ZL0A 2BZGA 3QVVA 4EKDA 3L7DA 3QA3E 3TXNA 3CE6A 4KQ1A 1H23A 4J1QA 3IB3A 4IY1A 5EZYA 1U81A 3S4YA 5HTKA 1G55A 2SCUA 3ASHA 3NIBA 2BF4A 2EF1A 2JIBA 3U49A 1PLJA 5LCWJ 3IIMA 4HI0E 3E81A 3HQ4O 2I1LA 2ZVDA 3ADCA 1AKVA 3WDMA 2J3HA 4GM1A 3PYXA 2D2XA 2P2GA 1C5KA 1UAAA 1M72A 5L4LA 3MHTA 1J42A 3TSYA 5JXIA 1TJ5A 1FDUA 1J49A 2R6ZA 3O8RA 2HCJB 2H1RA 3CEJA 1W44A 2M98A 1QCYA 3OJXA 3NRJA 1OLSB 3SHTA 5HG0A 3RVJA 1NW9B 2CB0A 2XUHA 4DSAA 4G0VA 2P65A 1FF9A 4AN4A 4ZZ1A 1E89A 2HAEA 3ND7A 5FQ7A 1FDSA 4B71A 3JZDA 5C5IA 4N3GA 3OZUA 1RPNA 2O2EA 4YONB 3NASA 3IERA 2QPTA 1Y7HA 2A9PA 2EZ9A 2Z95A 3VHXA 5JD5A 4UUOA 3N7AA 2YXLA 3SHQA 1NBMA 2ZPAA 3TG4A 3MCWA 1L5VA 1AMOA 4ALJA 1VBFA 1XDGA 1M2OB 2O3TA 4D10C 2IUUA 3UNXA 1W19A 1YIAA 2WMNB 3AI2A 1T9GR 1JG7A 2GZSA 3TLAA 4RK4A 3GCXA 1W5TA 1UWCA 2QRNA 4D4IA 1XCMA 2C0MA 1IRXA 5EWJA 4FMCF 2FQ1A 2IW3A 1WU8A 3RVKA 3FLAA 5AH0A 1FJ2A 3VU9A 5CERB 4BP3A 2KW5A 1ULSA 1TU4A 1BJTA 1I1NA 3B8HA 1OREA 3HDXA 4HQLA 2AI1A 1ULBA 1FX0A 3DSXA 1RJWA 1EH5A 1F2DA 1VPTA 1CUHA 1QYVA 1LK7A 5K0LA 2WIAA 1G0NA 4NCJA 1MV5A 3E9QA 4REOA 2AE2A 3SMVA 2FV8A 1EUCB 2AR7A 1EFLA 2FJDB 3Q10A 2BMWA 3BT3A 2JJ1A 3MTJA 3SHFA 4UVHA 4HK4A 4UVIA 1EFVA 5D7NA 1MO2A 4W9NC 4Q96A 2OZLB 1XCGB 1X7XB 1CY0A 1KFBB 4XZ4A 1N2JA 4QYTA 4X3OA 5D3KA 3P20A 3ETLA 1B8PA 1VP9A 1P4JA 5DE3A 1MVOA 5BWBA 3RVMA 3DXKG 1G20B 4XOUA 2NTJA 4QXQA 1FMJA 1SRRA 1QMOE 4JP3A 2C9CA 5K6TA 2VCEA 5DV9A 1MO3A 1UMCA 4LFBB 1K1AA 1I8TA 3GPBA 2I1KA 1ODFA 4GPIB 3C3CA 4DGSA 1IG0A 3RVPA 3ENWA 5E3HA 3EHMA 1VL5A 3A25A 4UHBA 2FEKA 3L8GA 1O97C 3UW3A 5HCIA 1EP3B 3ZVVA 2B78A 3SZ7A 1GNPA 3LVRE 2C04A 3V34A 3G13A 3Q9NA 2GPTA 3I04M 3NWPA 1T1JA 3Q5DA 3L1IA 5TF4A 1NURA 2PT5A 1N2XA 3PQ3A 5B1HA 4YVQC 2AF4C 2PVCA 1QDEA 1KS9A 2ZJ6A 2QMZA 3QPUA 1UPAA 1F4LA 4FCWA 3IV6A 1E61A 5I47A 2M32A 4KB5A 4RVNA 1MN6A 3TH5A 2AJDA 4B3FX 3L1VA 3ITNA 5DF1A 4O1PA 2Q8QA 2D0DA 2F9LA 4JMLA 3VR4A 2COUA 2O1EA 4NK4A 4LZWA 3G68A 3I34X 2WQZA 2Z08A 2QYJA 3DUFA 3MWLA 2ZK7A 4IDPA 3EOAI 3TGLA 1YI0A 2OV4A 4D26A 3WNVA 1ABFA 4IXTA 1E2PA 4D9HA 2ZSKA 4KQHA 5K3FB 2C0PA 2PGJA 4W7HA 3K31A 4PX9A 4BB5A 2EZTA 4NSNA 3W3AD 5CLJA 1LDMA 4NC9A 1XJ5A 4L28A 1ZL2A 1LSOA 4GECA 2WIFA 1USIA 3CEMA 1JTVA 3IQWA 4YASA 4EGJA 2AMVA 1XF9A 3IURA 2ZBQA 2DKNA 3FSGD 3DMYA 1GSAA 3L8DA 1UBHS 3BEOA 3WX0A 2JBHA 1OAOA 4R9VA 1K5HA 2C4WA 1WUTA 2YJ3A 2DJ5A 1R12A 5JD6A 3LYUA 5SY9A 2VSXE 2AZTA 4OQFA 3DSSA 3U44B 1XAHA 2X86A 1IIRA 4H3SA 4G4IA 5AKXA 4C22A 4FBMA 4KPGA 3CONA 5IH3A 1H4SA 2VP0A 1Q1BA 3AUSA 3U9SA 3G2MA 3OM1A 3MPUA 4D8UA 1SQGA 1MW8X 4FHKA 4IOKA 4FGSA 3BZBA 4OHKA 3A0RB 3D3WB 1Q17A 3TUJC 4I2WA 3SSMA 5JJ7A 1L4GA 2WXJA 4DCOA 1J90A 3NHBA 3QFFA 3OMSA 2PUJA 3K0AB 1Q20A 4I6EA 1SA0B 4NJEB 5AI0A 4L57A 3CWZA 4HBDA 4UZFA 3Q4AB 4FQ7A 2XYQA 3PPYA 4DANA 4HOQA 4O1OA 3Q6NA 4TZKA 3NAZA 1FFYA 3VI3B 4QLOA 4PDXA 1ZMRA 4M0KA 4MIKA 2H6HA 5ALHA 1KZGB 2IYOA 1CLEA 3HKBB 3ZIAD 1B73A 3O8OA 4IQGA 5DTQA 4WXPA 4L23A 2R1VB 4V0RA 1U3UA 2AD1A 2V9PA 1X81A 5ALOA 1UJCA 2AQKA 5FQOA 5KJNA 3TZKA 1XIVA 1JHRA 3S2ZA 5FJJA 1B6GA 4ER6A 4NZZA 3WLSA 4PU0A 4LJRA 1MPXA 3RKVA 3BMCA 1LH0A 2OFFA 2DYRE 3FWHA 4EF5A 1RLJA 2QV0A 3I9JA 5FNVA 4L7QA 4HJRA 3RF7A 3HI6A 2GOYA 3FCOA 4EG6A 4Q01A 3O8NA 4XZ3A 1KZOA 3G6WA 1LJLA 3JUEA 2ISCA 3ONNA 4UCXA 2KCKA 2BKXA 2XB2A 3TZLA 4CLOA 4R7ZA 4WW0A 2C2KA 3B95A 2FP4B 5A6SA 4FINA 4JYPA 5BW4A 2Q3JA 2YNQA 1NNI1 4IEEA 5LCXA 3CV0A 3CKYA 4GOJA 1MRZA 5JYBA 3O8QA 3VJLA 1ISJA 1YVEI 1SC1A 4MYTA 3S28A 1Y34E 4HP8A 4CLRB 4JXZA 1U8CB 3CSSA 2HBZA 3HA2A 5H3LA 3AGPA 4I8DA 3CX6A 4H16A 3THSA 2XWBF 1B1AA 3IKLA 3A2NA 1AQJA 1PJ4A 3QWAA 3HCRA 3K05A 2GM4A 4FULA 2QTVB 3ZWPA 1FP2A 1AGRA 3R3UA 4JVMA 4G4JA 1CUYA 3ASNE 3B7RL 2GEUA 4WAUA 3ABLE 4N18A 2B8WA 4WN9A 1VSQA 2OUIA 1BWRA 5E76A 3IBCA 4J43A 5I5EA 3ESYA 2IITA 2EL7A 3UXMA 4E85A 2KX7A 4AUMA 4A3SA 3C7KA 1N9GA 3TW4A 3WYDA 1HE1C 4V0KA 5AM1A 3PHIA 2P3SA 3IQHX 5JFTA 2FFQA 3CXUA 1PHRA 2CFTA 3AUXA 4M1ZA 3DB2A 2BGMA 3RVBA 2FSUA 1II8B 3F5SA 3SLRA 5IFKA 3VH4A 1S96A 3L7KA 4M49A 4NTZA 3DWGA 4EGQA 2ZBFA 1VGVA 3LXXA 4MR9A 3THXA 2V1XA 4E13A 2X2EA 3OY2A 3S55A 2FW8A 3C6XA 4MJXA 1HL7A 3MJEA 3LK7A 4D99A 1J25A 2QG9A 1IXKA 4EG5A 4A1GA 1KR5A 3KR2A 4B7UA 1HDXA 4AWAA 2IXEA 1OI7A 3F6RA 4E14A 4OAVB 5CG2A 2OMEA 4WK4B 4UAGA 4HZIA 4LDJA 4OYSA 1KS2A 4PFSA 3AHDA 4J7CA 3W6ZA 2IYZA 1XEAA 3RYCB 2HJ9A 3MT8A 5IFLA 4EHAA 1N77A 1EK5A 1SKYB 2XDAA 3FW1A 1KK0A 4B1FA 3NGXA 4F38A 4KE6A 3STYA 1MX2A 4FX2A 3CKLA 4WZAA 4EOGA 3TWTA 4MVJF 2VA8A 4TTRA 5LMUB 3E1SA 4RIIA 4CLXA 1XZFA 3N0XA 3RO7A 1O0CA 2YJ6A 3QWFA 1JCQA 3S2SA 1H5NA 4TRJA 2IYEA 4O5OA 3K5IA 3ZWOA 2ORVA 1E4EB 1U04A 5IDQA 1R6UA 4KZ0A 2N3ZA