4GZ5A

Crystal structure of human o-glcnac transferase with udp-glcnac
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
716
structure length
700
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 265
structure length 700
sequence length 716
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz5A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz5A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gz5A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gz5A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gz5A03
3RHZA 5C1DA 1KT0A 2AW3A 1FTWA 1QQEA 1YA0A 1P5QA 4GA2A 2XEVA 3OXFA 3MT8A 2QRQA 4UQZA 2QRPA 5KJMA 4GZ3A 1H5UA 3SYRA 3CEJA 2XGOA 2GPBA 2ECPA 3FP3A 3S27A 3UQ3A 3SYMA 4GCOA 2QN8A 2QN1A 1GG8A 4NQ0A 4O6FA 7GPBA 3NP7A 4WNFA 2PQ6A 2UY1A 4YUAA 4RENA 1J39A 2G9RA 1W3BA 2BUGA 4KYOB 2F3QA 2X0EA 1Z6QA 3NPAA 1AXRA 5DLDA 4I1AA 2XCIA 4A1SA 3QKWA 1BX3A 3KD7A 4W6QA 4JA7A 3WADA 1FU4A 2KCKA 2PYIA 1FTQA 3ZCSA 1A17A 2IEGA 3T3GA 2QNBA 2IW1A 6GPBA 4G24A 3D0QA 1ELWA 4EL5A 1RZUA 4I2ZA 1FU7A 4L22A 4U07A 1WV0A 3DDWA 3T5TA 2KCLA 3CVNA 3L7DA 2KCVA 4AY6A 4AMBA 3ASDA 3Q15A 4EL0A 5HXAA 1WUYA 3LYAA 4JL0A 2GM9A 1HXIA 2QRHA 4I9CA 1GGNA 4N3BA 2LSUA 1IIRA 3Q5MA 5D00A 1P29A 2QN2A 3TAXA 1C3JA 2MHKA 3RJVA 3GPBA 4RIFA 3OTIA 1SXPA 2C0MA 5D0QD 3Q3IA 1B89A 3E3LA 2G9UA 1LWNA 4KQMA 2ACVA 3PE4A 4APOA 3G2IA 3T3IA 3BCRA 1TJCA 3JYSA 1EXVA 3UPVA 3GW4A 3S7DA 4N9WA 2R68A 5ARFA 1HZ4A 3IAAA 4J0UA 2XA1A 3SF4A 3H4IA 1XC7A 2C1XA 2PQNA 2ONDA 1QZ2A 4N3AA 5BT1A 4HOTA 3MQFA 3MRXA 2J9QA 2KC7A 4RG6A 3L7CA 2UY1B 3NC4A 4KBQA 1FC0A 5DIZA 1L5WA 2FEZA 4CTOA 3S7JA 3VUFA 3G2JA 2PQRA 2GPAA 4YVOA 4N2SA 1NZNA 3BCSA 4EQFA 1IYGA 3O48A 4X7MA 3QKYA 3G2NA 2E2EA 2FI7A 3ASHA 4HLNA 4ABNA 3RU0A 3LY9A 2OOEA 3LCAA 2FO7A 3SZ7A 1JIUA 1VGVA 3ULQA 4MHSA 1HH8A 3MV3B 3MTAA 3RSZA 3CK7A 3LY8A 1GFZA 2QZSA 2XA9A 2FF5A 3L7BA 3RIBA 1Y6FA 5FT9A 3PDNA 4JA9A 4G23A 3OTHA 1FU8A 5IKOA 1WV1A 2GEKA 5FZQA 2O6LA 3G2LA 3AS5A 2QN3A 2AVPA 4WADA 5G05C 2V5FA 1WM5A 3LPZA 4N2QA 1Y8ZA 4WNEA 4X7RA 4G2TA 1C50A 1PC2A 2XGSA 3T7DA 3PE3A 3MT7A 3CVPA 3DD1A 2JJMA 5FJYA 3TG5A 3T3HA 3MRVA 1YGPA 1Z62A 4REMA 1L7XA 4GPKA 2C4MA 3CEQA 3NAZA 3ZHEB 2Q6VA 3LY7A 4RIGA 3BEEA 4XI0A 3TOVA 4BQFA 3DDSA 2WQHA 3ZGQA 1F0KA 2H1FA 5BNWA 3E3NA 5G04C 3BD8A 2ACWA 1WUTA 4EJ2A 5G04J 3C48A 4BT9A 3FWVA 4YNDA 2R4UA 4GYOA 3RT1A 3MEKA 3CVLA 3MRTA 1JEJA 1KLXA 4NRHB 2XCCA 4LDPA 3CEHA 4XI9A 3CX4A 2IYFA 1NA0A 2VYIA 4BFCA 3MTDA 2VCHA 1FTYA 1EM6A 3S2UA 3BCUA 4EKEA 3EBPA 4RG9A 1WAO1 2Y4TA 4BTBA 3CUVA 1P2BA 3MSCA 4LEIA 4CGWA 4WUYA 2XMPA 2IYAA 4W9RA 4J8DA 2NC9A 2DBAA 3CV3A 4HWGA 2VCEA 2C1ZA 2GJ4A 5IKPA 2HO1A 2C2LA 3TGOA 3U3WA 2KATA 3MS7A 4I9EA 4AIFA 5AYWD 1PYGA 4QLBA 5EX3A 2QLMA 2HY7A 1XOIA 5HI7A 1PNVA 1YA6A 4AM9A 3HBJA 4KQ1A 4YI3A 3CK9A 4UQYA 3ZCVA 1A8IA 3T3EA 2HR2A 3HBFA 3S28A 3OKCA 3Q49B 3FFLA 2R66A 2F3PA 2FFRA 1XV5A 4M83A 3RKVA 4B94A 4N3CA 1E1YA 1WW2A 3GZ2A 2ZB2A 2FETA 4MHOA 3ZCTA 2VGXA 5FTPA 4GA1A 2QLLA 3EBOA 4BT8A 1C8KA 1K08A 4F97A 2AMVA 2JLBA 2LNIA 1Z8DA 4CTNA 4MI3A 1FA9A 3ZN3A 2XGMA 1OUVA 4MICA 5A7DB 4AY5A 5TMDA 4ME2A 2GPNA 2SKDA 3CEMA 5GPBA 3ZCUA 2L6JA 1Y8MA 3IEGA 4G2VA 1PN3A 3E3OA 5DU2A 3RSCA 5FZSA 2R4TA 2IV3A 4XIFA 3COPA 1LWOA 9GPBA 4BWRA 4WNGA 3BD7A 2R60A 2AV6A 3S29A 1NOJA 2H1HA 4CDRA 3MBOA 3NB0A 4G26A 1M5RA 2PRJA 3ZHEA 5G05J 3IA7A 3Q3HA 1AHPA 4WNDA 1GPAA 3OY2A 4M7PA 3VUEA 1UQUA 1NOKA 4FKZA 4RIHA 3OY7A 3CKCA 3CUWA 4GCNA 4GA0A 5JTUA 1ZBPA 4RELA 4RIEA 3VTXA 3S7BA 3L79A 2BGTA 4X6LA 3CV0A 2I6HA 1WW3A 5JJTA 1IXYA 4KQ2A 1UQTA 4U0SA 4HOSA 5FZRA 3C4QA 3DZCA 2XCUA 3KS2A 3UYKA 5JTTA 3QDNA 4J8EA 3URZA 5TMBA 3VDNB 3ZPJA 4X7PA 3RO2A 1XNFA 1L5QA 3Q4AB 2FF4A 1Z6PA 1P2DA 2XPIA 1Y6GA 2PRIA 3S0JA 4MI9A 5DXFA 3NCHA 3N71A 1L5SA 3ZCPA 5KJKA 1XKXA 1V4VA 2PL2A 1E96B 4GYWA 4I17A 4GPBA 3VDMA 2Y4UA 4BQIA 2R5SA 5LCWC 2X6RA 3CUTA 3HBNA 3HBMA 3RO3A 2VSYA 2LSVA 1XL0A 2BISA 5JJ6A 2QLNA 5I45A 2QN9A 5CCMA 1JG7A 3G2KA 4WHMA 1K06A 3D1JA 1RZVA 4EKYA 2VGXB 1GPYA 2KS6A 3GUHA 5KJNA 3NF1A 4HOUA 1JIVA 3BEOA 4Y6WA 4M60A 1SXQA 3MV2B 2X0DA 1KTIA 3OXGA 1L6IA 5EKQD 1NZFA 2QRMA 2YQ8A 5KJLA 5DBKA 2Q7FA 3L01A 2G9QA 4CTMA 5M72A 5A6CA 2GT1A 2PZIA 1NA3A 3QWWA 1ZU2A 1ABBA 3ASGA 3LKUA 3FROA 4I2WA 3H4TA 2G9VA 2YJNA 2ATIA 3QWVA 2UWJG 3R9AB 3VTYA 1NOIA 1QM5A 2ASVA 4F3VA 1P4HA 5EX0A 4PQGA 5D01A 2F3SA 3AMVA 5TVGA 3G2HA 3QWPA 2C0LA 4F9FA 2FBNA 1NZDA 3C4VA 4U04A 4FZRA 2QRGA 4H7XA 1UZUA 4NESA 1L5RA 2QN7A 1NLMA 5CCLA 1E4OA 1JG6A 3ZFWA 2P6PA 3ZCQA 4GYYA 3TG4A 1RRVA 4MRAA 2P58C 4YVQC 2SKEA 2XCBA 4G25A 3WAGA 2JZCA 1F6DA 4RBNA 2F9FA 1JIXA 4GZ6A 2XA2A 4BQEA 4UQXA 3CKBA 3S7FA 5ENZA 1ELRA 2OFFA 4N5CA 3QOUA 4HORA 2BGUA 2WTXA 4UI9C 3ESKA 3OTGA 3MTBA 1HLFA 3D0RA 3TSAA 3MS2A 1C8LA 2VQ2A 3MT9A 3Q3EA 4MI6A 2C9ZA 2F3UA 4GZ5A 5HQ8A 3ASFA 1PSWA 3CK8A 4G1TA 4H7YA 4HOQA 2IF4A 5D0OD 2IUYA 2VSNA 1IHGA 3NP9A 4LEUA 5TMEA 1P4JA 4BTAA 1QKJA 3BDAA 3HYMB 2IFUA 3AS8A 4KXKB 3L7AA 4Y6CA 5BW8C 4U0ZA 4IN3B 4U0UA 3BD6A 2GW1A 4NC9A 3GYZA 4N39A 4J8FA 1GZ5A 3E4BA 2HYZA 2VGYA 1KT1A 4UI9J 3K9IA 3GZ1A 3OXLA 3AS4A 4WACA 2YHCA 3CUYA 3T3DA 1FS4A 3CUUA 1P4GA 4F96A 2QFCA 8GPBA 2X0FA 4AN4A 4YI5A 3MA5A 4NEQA 3MKRA 2WPVA 3ZCRA 3OKAA 5CHEE 3U4TA 1B4DA 4Z5XA 3QHPA 5LQDA 3UYLA 1NVKA 1FCHA 3Q47B 1O6CA 1XL1A 1GPBA 2PYDA 2IEIA 4UI9K 4JHRA 4CGVA 1P2GA 3EDTB 3WXXA 2BFWA 2VG8A 1L5VA 2IV7A 3MS4A 4AMGA 3KAEA 5JJ7A 2GEJA 3CVQA 2X6QA 3O3CA 3OT5A 3UUXA 3OKPA 2AZDA 3WC4A 5LCWJ 2SKCA 4RIIA 5ARGA
chains in the Genus database with same CATH superfamily
1V45E 4IH9A 4X90A 1KK2A 1H65A 1X15A 3DWEX 3E9YA 4GRAA 4L8VA 2UUBB 4TGLA 3WMWA 1X39A 2EZ4A 1K4YA 4YJGB 3ZGYA 1JDZA 2X8BA 4ZOBA 2MSWA 4PAMA 2XVMA 1X87A 1KJWA 3PK0A 4MS3B 5D2MC 2RE8A 4I9UA 1GZ3A 4MKRA 1GNSA 4B81A 2BEWB 3EMDA 1JWFA 2A90A 3CEAA 4US1R 1X19A 4LJSA 3AF6A 2DPMA 2QK4A 3O7WA 1PSDA 3LX6A 3D9HA 4MRNA 4ZOLB 1VPTA 4QJIA 4YUAA 1JEQB 1QNFA 1W3BA 2BKAA 3CG0A 4LQDA 1E99A 5EIFA 4UAVA 4ZGBA 4DR4B 3K35A 4ZHQB 1KA9H 3ADBA 1ZEJA 2HK6A 3D6AA 4TV8B 3ZOKA 1BX3A 2FH5B 1QE3A 3IUMA 1ZOSA 3AOEA 4RMHA 2QJOA 4GAAA 3T1VA 1FJXA 3NTLA 1FXWF 2QR5A 3PHBE 4DWWA 4EG6A 1YI0A 1YB2A 5DIFA 3UKRG 1FVXA 1U2PA 1K7YA 3Q1KA 3VQTA 1L4MA 1F7UA 1OXUA 4KFRA 1Q1NA 6GPBA 2OBMA 3OC0A 1C7IA 1PJBA 1G41A 3C72A 1UBHS 2V6BA 3DHYA 3E0QA 4U02A 1EDBA 1HORA 5DO9A 4CV3A 4UUNA 2QAGC 2RIRA 2LXLA 1ECBA 4FYMA 1UKBA 2DEUA 4CIYA 1PR1A 1U1FA 1XYYA 1J49A 1TIPA 1I1HA 2AK2A 3B13B 1A82A 4Q1FA 3L8DA 5LN1A 1WKCA 1GNPA 1GLGA 1GL9B 2BJHA 4G0OA 4E5MA 4J6FA 3OAAA 1N2GA 1NWCA 1RFGE 4UEWA 4Y7DA 3SG0A 4Q37A 3OOJA 2X15A 3EXHA 3L8YA 1QGUA 4LDRA 2BKEA 1BDJA 2ECQA 3ROEA 5JHGB 3KJHA 2ZJYA 3AVXA 3F6SA 4GICA 4LDZA 5FRDA 4F2GA 4WK0B 3LX8A 4OMFG 3ULEG 4J16C 2FUG1 3INRA 2HLDD 2PU5A 3EEBA 4HG2A 5D0QD 3Q3IA 3JRXA 5BWOA 4EY5A 4E46A 1KE1A 4LV6A 2DUNA 1EQUA 2M6SA 3F6YA 4ON9A 3UUWA 1PR4A 3DMFA 3TL2A 3FDZB 4QULA 1INZA 4HWSA 4HEQA 3UTCA 3CRVA 2CDCA 1ULBA 2DUUA 4J0GA 3WFZA 2VPIA 2ZZNA 4D2IA 2R68A 2W2KA 1ULTA 1M8FA 2R00A 4L5YA 4NTZA 3RVQA 5IVPA 2UYHA 3A6KA 3MEQA 4CNQA 3AEKB 2ZR9A 3QYJA 5GTDA 1RW2A 1FDIA 2A5JA 2HWKA 4JYCA 5JNLA 3F9CA 1UKVY 3UICA 4P1ZA 4EYSA 5C5DA 4G0UA 2UY1B 3NC4A 1MDBA 1W36B 3AVTA 1SZPA 3IUQA 1FRVA 1N6HA 2PNJA 5BN4A 1JDJA 3GB9A 5JZVA 2HUNA 4YJ3B 3A0RB 2Z6UA 3RRXA 2GRPB 1CJKC 1EFDN 3UXEA 1XK6A 3CLKA 2IZ7A 2P3SA 1MAUA 2WT8A 5D6OA 3D4LA 4QJ4A 1B1CA 1VSBA 4DJJA 3F3YA 4J0FA 4BB9A 3UHPA 4BNLA 4NBSA 1TYBE 2Z1DA 5IH7A 3B53X 1OX4B 3WQHA 3LY9A 3PNLA 5CFQA 2CCJA 3IC5A 1XNRB 2PX6A 3RROA 4QOFA 1Q5PA 4H60A 4Y2UA 2WMYA 2QU8A 1NQAO 2MTBA 2UZ0A 2W7TA 3AGPA 3V55A 4G0ZA 2GZDA 4Q7EA 4Q9DA 1W4AA 3Q72A 1SQFA 2PBLA 3DLPX 3IUSA 2F8TA 4KDFA 1UDBA 2QY6A 1OASA 3JVDA 3DVAA 3HCRA 4HZIA 4KI7A 3D3QA 4RV4A 4YRMA 5J5CA 2YNMA 3PQ3A 5BUZA 4Z3DA 1NBHA 4LNUD 3MK31 4XCXA 3AFNA 4L85A 1DINA 3WGKA 4JKIA 3MLAA 3ZTTA 1MO2A 2D7DA 2HMUA 1R5JA 4C06A 1MYOA 3AHCA 1ZCFA 4Y2HA 1E3WB 2CYBA 2O8DA 2H7XA 2WHYA 4WNEA 4XQ0A 2I2WA 4UVHA 2V5VA 1T0PA 4BVFA 3EASA 3BSYA 3HCOA 3IJRA 3L4EA 3O8NA 4M46A 4Q7MB 3N0VA 4OM7A 3CNOA 4LCJA 3P7MA 3MPOA 2W22A 2WUVA 1G4AE 3OESA 2PZKA 1RI2A 3MWJA 1EFKA 3GZJA 1RQ7A 2YHSA 3MRVA 2JBHA 3ZXYA 3MBKA 3UJ3X 1E79A 3EDOA 1W9MA 5FWYB 2CLSA 2XUFA 4G1BA 3GEIA 1U28C 1NY6A 1TN6A 1XDWA 1ZNZA 2WB2A 4MMZB 1U04A 3KQTA 3ZHEB 1UKAA 4H4EA 4PEVA 3ZZUA 4XI0A 5ARBA 4HB2A 3A9VA 5DGDA 1IEQA 1MB0A 1SULA 3EGVA 1F8YA 3FJ1A 2JFQA 2FUEA 4BQFA 2JA1A 1R3UA 3DEHA 5K3BA 5HRYA 1VFNA 2JJ8A 3GLTA 4OK3A 2O6HA 1VHJA 4HYTA 4KU4A 3L43A 2J5RA 2ABWA 3I3NA 4RA9A 4XCVA 3MJSA 3C45A 4FW8A 1XAHA 1II9A 2CNLA 4HLEA 5HKPA 1QVRA 4CIVA 1MW8X 1TAUA 2VZLA 2OHJA 5ITZB 1V16A 1RIIA 1JVNA 1ID1A 3GJ7A 5GV7A 3T38A 5EC8A 5FO1A 5EN4A 1YS2X 3G6KA 3RKRA 4U0KA 4BQNA 4D9IA 3KYBA 3NHSA 4BFCA 3DAOA 3RYCB 4F6RD 1T0HB 1TF5A 3KZVA 4PIVA 5D5PA 4DUIA 1FDSA 1SIOA 3HSKA 5DYIA 5I4CA 2F48A 1Z75A 1MC8A 1ZM9A 2Y4TA 3DBRB 1SBCA 1X2BA 5CFLA 4EEZA 2VDWA 1Z0FA 3H17A 2JAWA 4YCDA 4MV1A 3WIEA 1YHNA 4IOLA 4E4TA 3K70C 1UBMS 2VN8A 2ETBA 1E1CB 3TXNA 4X66B 3Q0EA 4DV1B 3ETLA 3X2SA 3SBXA 4N7JA 1A4RA 4BO4A 2KATA 4G86A 4KE9A 1ORRA 4LI3X 4L2YA 3OCWA 4BBAA 2GXUA 1NVMB 4E5PA 3ZLTA 3K7EA 5JEEA 3T5AA 4EQZA 1QIGA 4A3TA 2PH5A 2RKBA 5IVKA 1QTQA 5EX3A 3A11A 1BE1A 1EHYA 4B0PA 1YAHA 2PIAA 3VO8A 1ADBA 1BU9A 1INLA 3RRFA 5HIAA 4HVLA 5AXAA 1M2HA 4RD0A 2FN7A 2HCRA 4WW0A 1PWYE 3M5DA 4ZZ2A 3T3EA 1QHHB 1KI8A 1RAGA 2NSDA 4TYPA 2I1KA 3CPSA 2PUJA 4B6JA 1U5CA 1MVNA 2ZRCA 5T8KC 1NF8A 5TPWA 1UK8A 2ZU6A 2KM4A 5JI3E 2EIME 4B94A 5E76A 4E88A 1CIJA 5EWLB 3RC8A 5FTPA 2R7NA 3PGXA 4KOAA 5BYBA 3MMPA 4X9XA 1C8KA 1QHNA 4GZMA 5AJYA 2JLBA 1SBTA 4TRNA 4P4NA 5H4HA 4L2IB 4BWFB 1OD6A 1QFMA 2DSTA 2V96A 3ESLA 3FH7A 4LNGA 1GPJA 5HTOA 3CLTD 3AI3A 2EEZA 2JGLA 4A3VA 3A27A 5A05A 3UAXA 4GQIA 5KQPA 1NI1A 4F3RA 2OD9A 3FWHA 1KIFA 2GZRA 4RTQA 4HLUA 2Q5JA 3UM1A 1NR1A 1ZIPA 1YOVA 5EJFA 4MR7B 1ZRHA 5IF3A 3IQGX 1NUPA 1QE5A 2I99A 1SVWA 2ZI9A 3IPLA 3OZDA 4G89A 3BX1A 4I1YA 2FMHA 1CUJA 4LGVA 2JIBA 4PF1A 4E03A 5A4MS 1G66A 3ANLA 4ZU1X 2EKZA 5B1AE 3BFXA 3DC7A 3UT5A 2DTXA 2VYVD 1GPH1 3SOZA 1BKYA 2X0IA 2ADFA 4YDSA 3C3CA 1ETHA 2FF7A 3ZHRA 4CM4A 5KX5F 2D8MA 3N76A 2PRJA 4TKUA 1M34B 4AJ1A 2FJEB 1E79D 2FWIA 3C70A 3U0VA 3K6SB 5CR9A 2WNIA 4TT3A 3KX2A 1KJJA 1HKHA 4RZXA 4X62B 3ELDA 4M7PA 1P1HA 3L1KA 1C4WA 2PLRA 2YNMC 4J03A 5EE1A 4KQIA 5K0NA 1TT5B 3CKCA 2AS0A 1LDYA 2DQSA 3QXJA 4JYPA 4PU0A 3TD9A 4P80A 2I7TA 2BEDA 2PCLA 1UUFA 1QP8A 2X3YA 3ABZA 3S7BA 3FTCA 3GRAA 4QTUB 4TLAA 3W4IA 3ZGXA 1XQWA 2IPNA 3G0OA 4DUGA 2C2WA 4S1VA 1THZA 3SM9A 2UUPA 2VHCA 4KQ2A 3DEIA 3IQWA 3HUUA 3UMJA 3SKYA 1GSIA 1WXDA 4OA8A 1MN6A 3LL7A 1WHTA 2Y9PB 3OKFA 4P4SB 1KI1A 4RGBA 3KQQA 2Z57A 1DMSA 4QO8A 1M83A 5ICMA 1ECFA 1Y0BA 2O3SA 2VNAA 5TMBA 1B76A 4FMBB 3DBRA 3G8BA 1FB5A 5CA1B 1O95D 1XQXA 5TQJA 2HGZA 1NI5A 1QFZA 4JI2B 3HJGA 3N28A 5ED4A 4F5DA 5JDIC 3REQA 4J0QA 1T1GA 3KPUA 2HA7A 2A3NA 4XB2A 3KZMA 3EB9A 3NJ4A 3PX2A 5FTNA 3RFUA 4RTPA 5DXFA 4ARUA 3N71A 3JU3A 3ACBA 5LP0A 2FO1E 3LUCA 3B2NA 3AFHA 4TVSA 2HRRA 2IHJA 3OPYA 5I9IA 1HK7A 4MJ3A 2WXQA 3FGNA 3FPLA 4HEA1 4UBJA 5KYYB 3WXMA 1IZZA 3TF5A 4HZUB 1E0AA 4LV8B 4GPBA 1SZAA 3HHPA 4GKBA 4G1CA 4FC6A 3FOBA 1VCHA 3M4YA 5FPPA 1U8CB 5PNTA 1Y5LA 3EIFA 3TW8A 2EQXA 4JB8P 4WFIA 1G21B 2ZI3A 3O2QB 2FI1A 4QQKA 1Y8AA 2QLNA 1KY3A 1UBCA 5DYYA 3TLYA 4M76B 3TZCA 3IP8A 4WL0A 1JAZA 1LC0A 1ZISA 3NGXA 4PM4A 1ORIA 2YXDA 2GN9A 3KOXA 4KJZA 2QM8A 4C6TA 4HOUA 2Q3DA 2HTEA 4HNUA 2LRHA 1WBBA 4EA7A 1K1EA 1JNRB 1D0IA 5IMSA 3AETB 5K0ZA 4A55A 3EZ2A 4IIGA 4XIGS 2J3IA 5E6UB 1JHYA 1RNLA 4KO3S 1SKAA 3UHJA 3PEVB 2EWWA 4Y30A 5L7YA 2C3UA 1KZHA 2YQ8A 4E09A 3VU0A 4W8HA 2G9QA 3DXYA 3NRCA 3K5HA 4N18A 2HR1A 4CL0A 2ID8A 3SNKA 2W2LD 2XJ4A 2WE7A 2YINA 3QIVA 1IBCA 3I6QA 3L0SA 4PYMA 1EXWA 5CT5A 2Z6QA 1JQKA 2HJHA 2ZBEA 3DMPA 3DV9A 4RX1A 2R8RA 1OTYA 1RIFA 2ZE7A 1JHVA 1WMAA 5M29A 4BLRA 4ZVMA 1NMYA 4IIYA 4E3WA 1GU1A 2NP6A 1Y98A 3MMXA 1P4HA 2B7BA 2G04A 2Q1WA 1UF9A 1JFSA 2Z9BA 1T4DA 3RS5A 3HDXA 2QL5A 5AWFC 2B2CA 3JVVA 2WI8A 1S2GA 3QFFA 1TNOA 2C0LA 4YROA 4HNGA 2VYVA 2MSKA 3D7KA 1C9JA 2R8EA 4CGYA 3NBXX 5GQSA 1F5SA 3KAKA 4KGVA 3IUEA 2GF9A 1UBTS 1ADJA 2NNWB 3TQQA 4F4IA 5KWEA 2ERYA 3KEFA 3FWKA 2CXRA 5CCLA 2P9ZA 4TN5A 2P3LA 2QV7A 2CLLB 1Y7TA 1YJBA 2QRVB 3I30X 1VA4A 3OJ0A 4MS1A 1PE0A 4R5MA 4OQXA 4ALIA 3U4QB 1SVXA 1IMJA 2C8LA 2HFKA 2YFHA 3FKSD 1JAIA 3KSDO 4XW2A 2HRDA 1T4MA 4EG7A 5HKBA 3AKCA 4E5DA 1CZNA 2ETXA 1EFPB 1D8EA 1YZQA 2CXUA 2H63A 2WD7A 2GD1O 1JIXA 1VGRA 3GUUA 4B5KA 1M8JA 1K3TA 3KZOA 1GPKA 3E7PA 4KMSA 3WJAA 1CTQA 1SHUX 3WWYA 4UQXA 2DAPA 1X7YA 4EJ0A 3QU9A 3GLIA 4FLFA 2YMQA 1DKLA 3B70A 2EX4A 3TWUA 4LJ8A 4QXMA 1GTZA 1HTBA 4J9VA 4UDXX 3EUEA 1VMKA 3C24A 2GJSA 4XDYA 2WTXA 3GRPA 2FOIA 4WNAA 1LBQA 4Y8VA 4ZALA 3RS4A 1CE8B 2W90A 1RLTA 3CQCB 2YVUA 3RBXA 3UKDA 3CRW1 4CQNA 3ZTYA 4AD8A 4NEHB 1THMA 3BE6A 2WKWA 2QMEA 5CA1A 4B6FA 1ZVJA 2RD2A 3M8KA 2EWMA 1FDVA 3GA7A 2VXCA 4IKOA 3QX8A 4DC9A 2ECOA 4GM0A 4UM8B 3DHWC 4FOOA 3S2GA 4ARSA 2FYTA 3UMMA 4YN3A 4R16A 3H11B 3PNKA 2HHCA 4MUMA 3KKNA 3BKWA 4DIDA 4YBZA 3DFUA 1JEAA 1UMCA 5T4EA 1N2IA 2BGWA 5B57C 2NO1A 1JSRA 1U94A 3EUWA 5CVUA 3R7AA 2AFHA 3HZRA 2PKYX 1ZG3A 2HSDA 2PXAA 1NBMD 4U9UA 5LYJF 1CRZA 2QUAA 1SXJA 4M6WA 5G1NA 3W8FA 4CQJA 2VDLB 5KCZA 2QP4A 1DBPA 4EECA 4U3JA 2JD0A 4CDMA 5BOSB 3MZ0A 4XM1A 3K9IA 1GP2A 3OXLA 2AC4A 4WCFA 5GINE 2FW6A 1PBTA 1IL0A 1JKJB 1P5FA 3B1FA 3CUYA 2INGX 3DWIA 5LVAA 4KPFC 3PQ6A 3HDYA 4RTRA 2PZGA 3I5UA 5KC8A 1VYUA 4N6OA 2QFCA 1SIUA 4AN0A 2AJ8A 5EHQA 3V97A 4CKWA 3B95A 3HUDA 1OWOA 1V2HE 1NXWA 3WLRA 4NEQA 2FCRA 2ZUUA 3MD0A 4O59O 2ZM5A 3AZQA 4YO8A 4UBOA 1L5ZA 4B3FX 1YC5A 2P35A 2NYAA 3WK4A 3FUDA 1AO3A 1JEQA 2WJZB 4NYIQ 5A7FA 3QHPA 5D5QA 2C94A 2V9PA 4FDVA 3UYLA 4OHOA 3W5IA 1HF3A 1GPBA 2EZ8A 2QRZA 1CZOA 4PAGA 5TPZD 1P2GA 3WXXA 4A91A 1I2AA 2VG8A 3M4ZA 4KEAA 1E9DA 4OPMA 1O96A 4DMUB 5IT9A 4X1IB 2FX2A 3CVQA 2ZYVX 1VB3A 1KSGA 2CNWA 4OHBA 3OKPA 4AS2A 3GPDG 1CIVA 5A0FA 3QKSB 3K9GA 5JNUA 1Y3IA 1N7JA 3ONLA 5LDHA 4LF8B 3G5LA 2VAVA 1Z2OX 1IUNA 4N0PA 2F17A 2PGXA 2TECE 1Z36A 2IIQA 4H4DA 4GMJA 4HFNA 1NJ5A 1NVVQ 4PINA 1BS1A 3TQSA 2ZOSA 1YB6A 4DC0A 1CPYA 1JDPA 2ID7A 4H7HA 4MK4A 5EAIA 5FXMA 5A9SA 5B55A 3TPCA 3ESRA 4FYPA 1N34B 3ZNOA 4YI5A 3ZH2A 1FNMA 1FP2A 4LGYA 1A5ZA 4RK6A 1DIGA 4PS8A 4GBGA 1KEWA 4L75A 3SYLA 3X1YA 4BNKA 3PFBA 1NFRA 2VK4A 1Y37A 5AVRA 1QK5A 2WTEA 1H0AA 2X5NA 3LJKA 4PG5A 4X85A 5FBRB 4WNFA 3DT8A 4NBWA 1FNBA 2AGVA 1V0JA 2NP7A 1KGSA 1R15A 4KXLA 5KHLB 1ND5A 2BKLA 2HLDA 4HGNA 1UK9A 4PAOA 2J6HA 1MBZA 2PD6A 1YCDA 3KD7A 1P2TA 4MVCA 1CCWA 5AJWA 5AI9A 3WGYA 5IDYA 5KDLA 2NAFA 1E2DA 3W6ZA 1YI1A 4B5LA 1QIHA 4BB6A 3V34A 3N05A 4E51A 1FYFA 3IMCA 4EPTA 1FVHA 1ZGHA 3LCJA 2VUUA 1HL3A 1YJ5A 2QTWB 4G41A 1UMDA 2ZATA 3IVMA 4J0HA 4S1TA 1WL8A 2QX7A 1EXMA 5ALJA 1BFDA 1NBIA 2R25B 3HKCB 2G82A 3QVOA 1TGYA 4JKYA 2AZXA 1XA0A 2X9QA 3UM0A 1C7QA 5D3QA 1EWTA 4GIBA 2V0NA 5FFNA 3TNYA 1WQ1R 3NBAA 2QSUA 3BMQB 4GOOD 2O9JA 1Z7GA 4ZC1A 2PUBA 1KR5A 2FX3A 3TBKA 3MGBA 4UYKA 1LV7A 4EF6A 4CLOA 3UGTA 1RQNA 4K9MA 2QN2A 4XFDA 2MSCB 2HA3A 5FEUA 1NAIA 3E84A 4Z4HA 4BXOA 3BBPA 1KOJA 1U80A 2R6ZA 3ZKWA 2EU8A 1EWQA 3DM9B 4DBZA 3KCNA 4RIFA 1VXRA 3GP3A 2HM8A 1RLUA 2R65A 2TMGA 3A4MA 2UXBB 2AX3A 2GJAA 3DMYA 4PG7A 2VBGA 2NU9B 3RO7A 2IOSA 3V00A 3G2IA 1GA4A 2A7QA 1T6ZA 4G2NA 4BPRA 2EKDA 1DJNA 4ZANA 1UN8A 3IKJA 1T36B 2OB2A 3OF2A 3DVAB 5HG0A 4QGSA 3IQFA 2Q46A 2PJDA 2AYXA 3DMDA 3JQEA 1DTSA 2OAQ1 1C0KA 3MJTA 2BN4A 3W6OA 2XA1A 1YS9A 4D3FA 4BNDA 3NTUA 3ZE9A 2ZEJA 2ONDA 3GLHB 5BT1A 1XYGA 1YXMA 3DLAA 2JEOA 4BTEA 5J63A 3FYTA 4LUCA 3UOAB 3EZNA 4Q39A 1T5BA 2BBOA 2R6CA 3NAGA 2I3DA 3RGWS 1QYWA 1KJ9A 2GPAA 2ZJ5A 2I03A 2XNSA 3RRUA 3P9PA 3WHKA 5JISA 1U3DA 2AEEA 1JWBB 4FDUA 1U7DA 4TKMA 4BDTA 4B4OA 1M2VA 3RIGA 1UXHA 2Q9BA 4C4OA 4YLEA 1CZKA 5IXJA 1EB8A 1YU6A 2Z56A 4F7AA 1XMQB 4G8LA 3I6ZA 4HADA 5J2TA 3BZUA 4PVDA 5G0SA 3FVVA 3KR2A 3LG2A 3CKMA 5F5NA 3PF9A 3BYZA 2J5XA 4MDEA 1NX9A 4WN9B 3CK7A 2KBXA 2ONZA 4DMRA 5A3JA 5KJFA 1I7NA 5CFOA 1UK7A 2P0AA 1GLNA 4OYSA 1G5FA 1GNRA 1P17A 1C3VA 1WTAA 2FULA 2VI5A 2Z9CA 3E53A 4GOJA 5EQDA 5BVHB 3LOPA 1I3LA 4YYZA 1V6SA 3D1VA 1EUZA 4EGCB 5KNLA 3KYDB 5GADl 4GP6A 3LPZA 2RC6A 5C81A 3BOSA 2FWPA 4GDFA 1N9AA 2DU8A 3QLEA 2RAVA 4R1QA 1N2CE 4LWPA 3W6NA 1JHOA 1UADA 4JQOA 1EI9A 4EBFA 1AQNA 5AKEA 3ZZTA 1P1CA 5TGDA 1YGPA 2G25A 3ANMA 1NW4A 1PUIA 3QJGA 4JSTA 2B0CA 5CU7A 4DQVA 1PEYA 1BIFA 3A6DA 4YRCA 5EXTA 5KJCA 2I9PA 1EMDA 4H18A 5TQ2B 1XHLA 1PJ3A 4Q00A 1GILA 3O8BA 2Q7OE 5B64A 4O4HF 4PTZA 1ZOLA 1KGDA 3PFHA 4D56A 3ITWA 5A5GA 3IAS6 2VKTA 1KSFX 4Z0HO 1MRNA 3JQBC 4BEBA 2HSGA 3JQ8B 4WTOA 5HIKA 1C3LA 1R18A 2R8XA 1LXCA 2ZU0C 3C1OA 4A9AA 4NURA 1DAIA 2I4TA 4LBYA 2J1LA 1M8KA 2OGSA 4KAFA 3NYIA 4XEHA 3TOSA 5IC4A 4K9OA 1N6LA 4NECA 3EVGA 5T3UA 3AJIA 2FSPA 1PL8A 2V4LA 3J81A 1LK5A 2EF1A 4OD0A 4Q18A 3ZDRA 1NHGA 2Q8PA 3IILA 4DM7A 2IS2A 4AICA 1IWBB 2NTEA 1SK9A 5AKZA 2GF2A 2PAFA 1DUSA 5ALMA 1TVCA 2JH9A 3D3WA 2CHEA 4N54A 1RMTA 2KBEA 3VSBA 1WDWB 3ABSB 1CZHA 4JVLA 4BSXA 1NRIA 1PZFA 1VBMA 4LYAA 3U17A 3VZBA 5K3OA 2OGTA 4HB5A 2IBSA 3QE3A 5FOSA 2OEPA 3AESA 4Y1RB 3LP5A 4I81A 1IG3A 5KYXB 4HWGA 4N0MA 3KUDA 5JSQA 3JWIA 3DFMA 2PMBA 3L7KA 1BDBA 3KR9A 4H4CA 4NJMB 4ZJPA 1MJNA 4HDQB 3FSRA 4YPOA 3I62A 1QH1B 1CU1A 3BMQA 1PQYA 2AT1A 4WX2B 2WJIA 3TZQA 2HF7A 5AYVA 3AKDA 3JXEA 3VC1A 5E1OA 1R74A 4ZAFA 4EABA 1PQPA 3A6FA 1QGED 3SC2B 3KVRA 3DEPA 1PQWA 1U4OA 1USWA 3B9QA 4XPZA 3W5VA 1I4TD 4AM9A 1Z88A 5DX0A 4EATA 4C1NA 1IN1A 3FTZA 4NVRA 1P5JA 2H0AA 5L3SA 1CQZA 4BMPB 3F6EX 3N70A 4P33A 1DX4A 1UXOA 1CR2A 3JUIA 3PNVA 3F9RA 4F1JA 2WXFA 2XOKA 4EARA 2X8WA 4HEA6 4O0LA 1SKYB 1T1IA 4PZUA 4KQGA 2AXVA 2GESA 1AB5A 5CDSA 4YXWD 3HQ4O 4PLTA 2VNKA 4DRXB 5F9HA 3RNOA 1KYWA 1DXOA 1E1YA 3LEWA 3IE2A 4NBTA 2CVFA 4KX3A 4X92A 3VOSA 3AM1A 5HJEA 4CR7A 5C8VA 4P0PB 1N0QA 2EBUA 2YZ2A 4B73A 3EBOA 4PZ0A 3NH6A 1K1BA 1THGA 3SC6A 4GI7A 2QTHA 2YZKA 3Q9LA 1XVIA 4AXHA 3ZWCA 3NVKI 2EQ5A 5ENSD 3JAWB 2XJ9A 3RVRA 3TPFA 4DC1A 5CG2A 2HT1A 1SM4A 3CR8A 2BRUC 2VP3A 1SXJE 2JRLA 2WILA 3Q8XB 4N5IX 4PZAA 4RO0A 5GPBA 4JX9A 2IYWA 4KUEA 4G81A 4G2VA 2JAUA 3SJ7A 1R8QA 4A2WA 2LAHA 2PSDA 4HRMB 2CCKA 4F1PA 1PRYA 1U4SA 4HUQB 5ALVA 1DB3A 4JVOA 3WGGA 5I9BA 2P9SG 5ENRD 2C00A 3O1JC 3O26A 4HVAA 1M8PA 3HM9A 4BWRA 4J6IA 1TU0A 5KTNA 4DMLA 4UHFA 2ZUSA 5F7OA 2AW6A 1Y9JA 3EGDA 3FEXA 2BFMA 2DQKA 3FUMA 3DWLG 4RD2A 3RBZA 4NU6A 3NDBB 2C8VA 1X3LA 3EHNA 2FZEA 2X7XA 1E7SA 5B4VA 1P7ZA 1J0AA 5AUPB 1KTVA 2IY0C 4YRNA 3CZQA 5A02A 1Z4LA 1YR1A 2V6GA 3TVDA 3CBQA 3VAZA 3KCQA 1OB5A 5TS3A 4EHMA 3DBLB 1BDMA 3LM8A 1V41E 1JZSA 2PKWA 3R77A 1JR2A 4W1QA 3W7VA 3WHLA 4BNJA 3TKYA 5CFNA 2P1ZA 3ZVVA 4AMZA 2CVHA 3ZGNA 1MP0A 5ILQA 1MABB 4CLDA 5IXSA 2QX9A 4MRRA 2BHSA 3INGA 3ECCA 4YJ3A 3ZN2A 1IXYA 1ULUA 3E8SA 2I2OA 3D6UA 3TZLA 1I3CA 2OBXA 1SMKA 1BWPA 2V9ZA 5B1SA 5SY4A 4MVJE 1PLJA 1SCBA 5BXUA 2GFIA 4QICA 1LBEA 1QQ7A 5AVOA 2P0EA 4JZKA 1Y34E 4OYLA 4Q9JA 3NOCD 3AW9A 3LBFA 5CBPB 1FFWA 3FOFC 4G6ZA 1QC5A 4LFCB 2FSGA 3BWBA 4KUHA 1YUNA 1Y6GA 3RR2A 1PGPA 1FTGA 1XLUA 1E1RA 3LQ4A 1RADA 4O2RA 4YJ2F 3CVWA 2G06A 4NZOA 3APDA 1DIHA 2FPSA 2FEMA 1A98A 1Q16A 3ZCPA 1QK4A 3HB0A 2A7XA 1RKVA 1OPRA 3IIEA 1Q0UA 2NT4A 4G1EB 2H6GA 1WSAA 2ATVA 1DIRA 3AR6A 3D54D 5C5CA 5JUWA 3D7NA 3LC2O 2CWWA 4YDYA 3E3AA 4UHKA 4P6VF 4B7CA 5BURA 1Y33E 2XB8A 4FN5A 1JHXA 2PGAA 1RE0A 1YUMA 3D0KA 3CUTA 3ZU2A 3RO3A 1ZUWA 3HVRA 3ZK8A 1CQIB 3PHCA 4TXLA 1X80B 1BMTA 3G9ZA 4UBMA 4FYYA 2I6GA 4LHWA 4XJTA 2ZTMA 4OXKA 2PYZA 2UU9B 1QAOA 1C4OA 1JG7A 1K9SA 4RETA 3ZQKA 2EW1A 3GRFA 3K8YA 4IO1A 3ZD8A 1R0CA 3CNBA 4MWBA 1U2DC 3EXEA 3UG6A 1BVUA 1V26A 4ZCPA 2WB4A 1O08A 2H2DA 4PLZA 4FFOA 3RC2A 2F90A 4U8VD 1DAEA 1OYWA 4HRVA 1ZEMA 2ZTUA 3RKSA 2UZIR 3TW4A 4OCZA 3D7RA 1JIVA 1YQGA 3RBAA 5CDUA 1N2HA 1OXKB 4Y6WA 1T24A 3P2IA 2ZS7A 3FVRA 4RCZA 4RA9B 4FHJA 1NZFA 3KLMX 2GYVA 2EFDB 2QRMA 4RZUA 3A1EA 3DZJA 1K68A 1BMQA 2ZIUB 5EIEA 1V3UA 2CFIA 2Z2JA 5M72A 2DJ5A 4P98A 1WR8A 1H2UA 1L5KA 3I8OA 2A6PA 3K2IA 2GT1A 2PZIA 4B79A 4YCCA 1V7ZA 1BVRA 4JR1A 1AQ6A 4LJLA 1KAOA 3GJTA 5ELXA 2EIKE 2VH1A 1NOIA 1T1RA 2WYHA 1P74A 4YP9A 4LVOA 1FY2A 3UQYS 2O1SA 1KJNA 2OGWA 2BF0X 3IFSA 3JASA 4PQGA 1M2KA 1C80A 3EPPA 3K5IA 3MQ4A 4QT4A 3NWOA 4PZPA 4YV7A 2I33A 1LVGA 3NZEA 1GCIA 2WZQA 4GI1A 1B0AA 1RMYA 3A37A 3B1JA 3OJCA 2V98A 3HDVA 4XM0A 5ALGA 3LF2A 1ZCBA 4X54A 1JJBA 4Q4CA 4KO1S 1WSWA 2PH7A 5AJXA 1AOXA 3AI7A 4D9KA 1CVLA 2EF0A 2QTAA 3DZ8A 2Q5LA 2FDRA 2QG4A 3TG4A 3PR1A 4KRGA 1O5TA 3LPNA 3ZUGA 5ITZA 1R9GA 4HRYA 1Z2DA 3OE7D 1K7SN 2QVGA 4G25A 4BASA 1AQJA 4JU9A 3UB3A 4BKQA 2JC3A 4P3XA 4WI1A 4A82A 5DZSA 3LCUA 3IAFA 8LDHA 1PYDA 1GXSA 3ZYMA 3GJ4A 3FCYA 3FMGA 1E18A 3DAFA 3EOZA 3ZU5A 3QH4A 3CKBA 1MOSA 4G8KA 2YRFA 2PV7A 1SRRA 1CY1A 4PANA 3WYGA 2Y05A 3RYHB 1HS6A 2YWCA 4INAA 4JSYA 1TKAA 4ONEA 2VHJA 4LYYA 2BMEA 3LUHA 1CS0B 1TLLA 3Q87B 3U6BA 1JR3D 4N0QA 5J59A 4XPIB 4DOMA 3U64A 5G55A 1A1SA 1X0VA 2FKAA 4NENA 1YZKA 3WK7A 3ZHOA 3D8HA 1JKXA 4MI6A 4W8GA 4CMEA 3QXSA 3CK8A 5EP1A 2DZOA 2BJWA 3I2GA 4RY2A 1N8NA 4L4UA 4RHFA 1VOTA 2B83A 3A6ZA 3KYIB 3Q41A 1IHGA 3HBAA 3NP9A 4PZZA 4GPD1 3O2SB 5ALIA 3O3OB 3U4MA 1YA8A 3OFVA 2WFLA 1WMEA 2YDYA 5K3CA 5A2QA 2L69A 5JXWA 4UZFA 1S8FA 4OB7A 1N0VC 1IULA 5KYVA 1WXXA 4UVGA 2JHGA 1U3CA 4R81A 2VYNA 4JBWA 4Z2YA 5H4GA 4U7EB 2OBBA 2DFDA 1MFPA 4B3BA 4P5DA 4C29A 4BMYA 2QLTA 1A95A 3RYHA 4OBBA 2Y71A 2Y66A 5EE9A 5JCJA 1RHUA 5KU1A 1RWVA 4ND6A 1CB7A 1EIWA 1HDXA 3COVA 4K9QA 2YW2A 1UP7A 3KALA 2P2CP 2PTGA 2C61A 2H1LA 2XMRA 4K28A 3TRIA 4GTOA 1IOWA 1E6LA 1JSXA 1W6RA 1P5RA 2BGRA 5IJ0B 3BWEA 4JB3A 2QL7A 3UT6A 1J33A 2DTEA 1VJDA 3LYHA 4L2IA 4MQFB 2R02A 4K40A 2COUA 4X7BA 3PS9A 3V9AA 1KRHA 4TTIA 1VPWA 3GYGA 2Z4RA 3W4KA 2CNKA 2HV9A 3L4SO 4Y0AA 5F2OA 1Z82A 3AUTA 3ZWOA 1XL1A 3ZDFA 1RKXA 2PYDA 3HLYA 3SEQA 1IM8A 3SHOA 4JLAA 2WZBA 4EHLA 4YTEA 4XZ3A 1U7ZA 2HB6A 4AJNA 4DUGD 4OLJA 2JIZA 4PTLA 1HZZA 2XTNA 2X6QA 2Q2NA 3F6CA 3OT5A 4HAWA 4HBDA 4MMXB 2J33A 1U2GA 1PZEA 2ZYDA 1YASA 4NY1A 2WU0A 4M99A 1VJCA 4WCDA 1XTBA 1MAHA 2WUEA 3RU3A 2D7CA 4G4SP 4OFZA 4QELA 1XCGB 2X41A 3QUSA 3C97A 1G3RA 2AQHA 2O1WA 3E58A 3OXFA 3MKQB 1GPUA 2F64A 3IRVA 1SOMA 1T3GA 4TTTS 1T26A 2BMFA 3CEJA 4IS2A 2XGOA 4QXAA 1KZ1A 1AD2A 1T5TA 2UYGA 2QPTA 4MS4B 4US0R 4MWDA 3S27A 3UQ3A 4ARVA 4YV2A 4Q21A 1X7HA 2DYRE 3FF1A 3OLVA 5BN3B 4O08A 1H6PA 1RBMA 2O8NA 4JIGA 5ALUA 1FRZA 3FUJA 3R3YA 2OECA 2P69A 2H1OA 2R8OA 4WZBE 2D54A 3Q9NA 1KI6B 2Z8XA 2ZYWX 2J8SD 3SK1A 3LW8A 1T5DX 1Z6QA 3IVCA 3QVSA 2JK0A 2H92A 4HCJA 2F8YA 1IVSA 2P6MA 1T3TA 2VDJA 1IC6A 4NOJA 4MLZA 4WZAB 2W6QA 1JLHA 4CYMA 1B23P 4MPDA 3WADA 1E4EA 3CGWA 2O8FA 3FPHA 1AQIA 5FHRA 4LCTA 3R5TA 4K8RB 3IR5A 4V38A 3HO6A 5DHRA 1E9BA 2IEGA 1TJ5A 4NKRA 2PFGA 4OK5A 7ADHA 2IPLA 5BSUA 1JDBB 3WYFA 2X0NA 2ZBVA 3DUWA 3ONKA 4EKNB 3P2EA 2FPOA 4JR2A 4EELA 2G6BA 1OBOA 2ODNA 3OE5A 4H7FA 2GPJA 2CXTA 4MJLA 4BFVA 5JBNA 2XZTG 1LLCA 3DRAA 1SOWA 4BCCA 4K7JA 3L7DA 3FTNA 4OI1A 4HI0E 5CBOA 2CEKA 2PV0A 2B4KA 4LQ4A 4Q1EA 5LD2B 2NU7B 1Q2XA 2JEZA 1QDUA 3EULA 3K05A 4HNSA 5BQOA 1WZUA 2VPYA 3JYHA 5ABPA 3OZTA 5ALEA 2OK7A 4X24A 4RGVA 4B45A 3DHVA 2HNKA 5FA8A 3IQEA 3DHNA 4YMIA 4YMUA 4XE0A 3MW8A 3SK0A 3QTLA 4F3NA 1TZJA 2VZ9A 1T9GS 4M9SA 4WFJA 5FI1B 4MUJA 3NHUA 1QQTA 1U0RA 2ZQYA 3CF0A 4RH0A 1XDDA 3OBIA 1G3MA 4OV6B 1AKWA 2PMEA 1BS2A 4AC9A 1U2RA 3DB1A 4AKHA 4HX9A 1LWNA 2WHRA 3EG9A 4MVJM 4J2TA 3CB4A 1ORHA 1VJRA 2ORED 1F3LA 1E61A 3U13A 3UAYA 1X7ZA 1R9MA 2GA8A 4XSVA 2YN0A 3ORYA 4HTFA 3T7RA 1DBQA 5ARFA 1MQAA 1HZ4A 2GRNB 2E55A 3CX3A 3LKBA 3SF4A 3B82A 1WP9A 4NYMQ 1XTIA 3M6FA 2EDAA 4WA7A 5CDFA 5L7TA 1TMKA 3N6XA 3OETA 3T3OA 2AG1A 4XLTA 1FC0A 4FSDA 1DE0A 2E1RA 1BA3A 2B25A 2IY9A 1E8NA 2IHZA 5CB4A 3DXFA 4GE0A 2H7CA 3OECA 2M63A 1NJ1A 2Q0HA 3D2LA 3IPRA 3IXQA 1TM1E 3GDOA 4QRIA 4W5WA 5HOQA 1QZUA 1T6NA 3DDNA 5TJHA 5LBIA 1QPBA 2EBFX 2I4RA 4Y9TA 5ILGA 4XOIA 4UTVA 1NQXA 4WQMA 1BHJA 5BRJA 2OOEA 4PGHA 3EQ8A 3UFXA 2YJ5A 2I91A 2C5GA 3U48A 4MGZR 5EGSA 2JZNA 2WHQA 4A8TA 4K05A 4AKSA 2QL9A 1L5LA 1AKUA 4I3GA 1RRFA 1SUDA 2HIMA 4J43A 4G8BA 1EJBA 1U9CA 3KT3A 5C7LO 2Z83A 3OQIB 2OCIA 3PHLA 4ICIA 5CDHA 2ILTA 2CHFA 2VBCA 4HAZA 4TOIA 4G9BA 5CJ2A 1O5OA 3ZBPA 4CJXA 4A8JC 3KJZA 5EE0A 3RIHA 2GAFA 3D31A 5F1YA 1OR8A 3GRYA 1AG9A 1SN7A 2YQ5A 3A36A 3M4JA 2V3CC 3AS5A 1DSSG 4AJ2A 3P2BA 3HDQA 3R3XA 2FMIA 2YMMA 2QYOA 3UM9A 3M1LA 1Z28A 2VWHA 2FB9A 5DPMA 1L4KA 3BT3A 3CVPA 3M5PA 3GD7A 1DT5A 5FBVB 3TG5A 3R6DA 4HQNA 2DYSE 4NE9A 3EPHA 4BYMA 2MOKA 4IQ8A 1BGXT 4FNGA 1X1EA 2Z8YM 4RS3A 2MR5A 4MWOA 5ER6A 2Z4SA 5ES4B 3BT7A 2WM2A 4O4LF 4MIYA 4NYMR 3WFIA 4C08A 3FDFA 2ILRA 1LUAA 4FMCB 1ZXLA 4OLAA 1T4CB 2GARA 3TOVA 3L17A 5BPPA 1F8XA 3IOCA 1YJQA 2GZMA 4FW9A 4KQ9A 1EE2A 3KZNA 4J4TA 1FDWA 4L23A 2D3WA 1PFGA 3IKVA 2XTJA 3VV2A 5FOWA 1LEHA 1PIWA 1RM3A 2P2YA 1YDFA 1VDZA 1V3VA 4G1MB 4QUBA 5EYPB 3K1ZA 2MSLA 4Q03A 2GXSA 4U2CA 4QFVA 2JG3A 2RD0A 2WXLA 5JSYA 2XDYA 1SQ6A 4ACLA 1JQBA 3CR3C 1JCQA 1KPIA 2HL6A 2CWDA 3HZZA 3MWGA 3WMGA 2MCFA 3C6YA 3EFOB 4ESEA 3QFTA 4KPUB 1FDOA 1JEOA 4FYVA 4EIWA 5T4BA 1FZTA 1M7HA 2POCA 5AN8A 1WZCA 2VUTA 5JS7A 3AF5A 1NYTA 1PJRA 1W35A 5B3LA 1VL1A 3NHMA 4WDQA 3LX4A 2P68A 2RH8A 3F5DA 1GPWB 3CUVA 1DO8A 1VCOA 5AM4A 1FLNA 1M73E 2PS1A 3F7MA 4CGWA 3TD2A 2IYAA 2Z5VA 3A7EA 4HP8A 4U7GA 4B3JA 1A7KA 1E64A 2V7GA 5F2KA 1Z5VA 2AG8A 3H1BA 3OZRA 4QECA 4MTLA 4O33A 4RE5A 4S2EA 5DCYA 4PONA 1O0CA 1S4QA 3HM2A 1RJ9B 1G7CA 2JGNA 4N5NA 5AW0A 3M6XA 1E5QA 3B8HA 2C2LA 4Q9LA 3U3WA 1MNAA 2XYGA 3ORSA 4I5GA 4YNBA 3N2GB 2O7NA 4R2KA 4BMDA 4HI8A 2AMJA 2W6OA 1LTHR 4U2FA 3ULKA 4BVGA 1S7GA 2OM6A 5KVAA 4RTJA 3ZVNA 2R3SA 1M6EX 3EIUA 3BG5A 4Y2GA 3G13A 2JKZA 3DTNA 1PNVA 2X5XA 3V4LA 4PR3A 1MD9A 1SEVA 5JAQA 5AH0A 4EZLA 1BCSA 3F67A 4UQYA 4MYSA 4FLMA 2ZXEA 1RXYA 2R5NA 4NF2A 2BFBB 2AJDA 5IK2D 421PA 4YUXA 1DHTA 4NI5A 1H9CA 2CFZA 4YP5A 3E9CA 4AG3A 4GYJA 4MUKA 2RONA 1N1EA 2ZAIA 2B34A 2R2AA 2ALJA 4K1XA 4FIZA 4FXOA 4RHYA 2RFMA 3O31A 4FUTA 1C29B 1THTA 1E6CA 4PYRA 1KFEB 2WXJA 2JD1A 4JJ4A 4QOIA 5CYOA 5LDGA 5BUCA 4O2BB 4R05A 5KAPA 1ODTC 1PU2A 2WY2D 1MB9A 1PUXA 4TMYA 5JD5A 2OL4A 1XTUA 1Y6ZA 3BFPA 2FN3A 3MGCA 1BO6A 4C04A 5EP2A 2SKDA 3PHJA 4JKOA 1J25A 4L2LA 2UYQA 5AKGA 4W5QA 1ODCA 1PNTA 3IEGA 1EQ2A 1CRQA 3S2SA 4Y6OA 5DU2A 3M81A 1Z0ZA 4G1VA 4EFDA 1D2NA 2E4WA 2RARA 3PWSA 4XIFA 4K6CA 2VQ6A 5LZ5A 1V35A 3BSFA 4NH0A 1N6NA 2A9JA 3ML8A 1R50A 1YFLA 1Z6ZA 4NHEA 1JG1A 2QP9X 3E9EA 2C92A 1YR9A 3CINA 2ZBUA 4WZZA 3V7UA 2OV6A 3K9CA 2AE1A 3VH4A 2XH8A 2QAJA 4ZP1A 4PHTA 5G05J 2JFZA 1UWCA 2CF6A 2YV3A 3RSLA 1CUHA 4DLQA 1AHPA 4Z4EA 4LGMA 4XKJA 1AKQA 1UQUA 1UOQA 1W5EA 1IZ7A 4PO3X 4MMYB 1ISMA 1LPBB 3SVZA 4F7WA 5DDIP 2QZPA 2FVYA 1R8XA 3UMYA 1M0EA 1I36A 1FJ2A 3U3OA 4LQCA 2QZ4A 3DE1X 3R7RA 2WVHA 3O1IC 3S6JA 1EX9A 3THRA 4CG0A 2QZ9A 4CIBA 5F98A 4AJEA 5DNUA 2XUOA 3S68A 4QRHA 1G8KA 3QYAA 3ZS9A 1J2TA 1QAQA 4M36A 2HLHA 4HFRA 4A0FA 2RGBA 1UC4B 1AS0A 2AQKA 4FYJA 1CJCA 3EG5A 1CVRA 4N40A 1TR4A 1J5XA 2F8MA 3LUBA 4MW9A 1K98A 2AMLA 4DEXA 4ESOA 3CW2A 3Q11A 5AW9A 3RK1A 4LW8A 1KEEB 4PLCA 4YJGA 4DHEA 5JAPA 1Z6PA 5ERXA 2XT9A 3USCS 1E3IA 3W9UA 4W9MC 4LFBB 4C4YA 2WPDD 4D97A 3D8NA 3F74A 5JNVA 4Z99A 3UC5A 4DT1A 2E82A 1V55E 2OA0A 5EJ2A 1IRIA 4DLLA 3TFOA 3B13A 1Q12A 4KXQA 3KTDA 3QVUA 1HI9A 1JJAA 5EXXA 1W19A 3T35A 5EE3A 1BS9A 5KJKA 1V47A 3KYCB 1KI4A 5EQJB 4B7ZA 4REQB 1N4DA 2QM3A 2VHTA 1ZW6A 1NV9A 4R01A 1VLMA 4C4AA 2WD9A 4I17A 1NKTA 2ATCA 4MV9A 3UPUA 3BG0B 3EXAA 5KWSA 2R5SA 2EGHA 5JNTA 1XN1A 2GPWA 4LJAA 3BUAA 5FQ6A 1XAIA 3I28A 4K86A 3RVSA 1YR7A 1Y9EA 2E89A 2ET6A 2OYCA 2PKEA 3V7WA 3WV5A 1VHLA 2H8KA 3LDFA 4F2WA 4MP6A 4JWKA 4I1PA 4DIKA 4JH0A 5KTTA 2DTDA 2NUTA 1BW9A 1NUHA 2JH8A 1TMYA 1BWQA 5ALPA 3UT0A 1P0CA 4ZYYA 5HQTA 2J4DA 1IZYA 2GAJA 5JQWA 1JP7A 4QUJA 2WXOA 1Y80A 1BEEA 1UMKA 4CF5A 4HDRB 3HP7A 1A4IA 2JF0A 3IJPA 4B7UA 4N76A 3PT9A 4OX9Y 3USES 1KBOA 2EJWA 1G64A 4OI2A 5KVCA 3IHKA 4BFWA 4KVAA 5E7IA 4E32A 4D9CA 3ZU7B 1KYXA 3T1OA 3RC7A 4N6NA 2Q7FA 1HE3A 3NO4A 5DNDA 3HY3A 1KDZA 5KJ6A 1TM2A 2J3KA 3R6GA 3UA4A 1PEKE 5BV7A 1P9WA 3CZCA 3X1WA 3ZE6A 3M6AA 3BN3A 3WOVA 3T34A 4ZTZB 1QMOE 4YVFA 2IPOA 3BL6A 1TVKA 3FROA 4DEVA 1FQKA 2GPSA 5IP5A 5AVKA 2CVPA 1XVTA 3HWRA 4BVBA 3E61A 4JVNA 1Z73A 1GNTA 4OXRA 3ZE2B 2BGJA 2JLQA 3GFVA 4FFLA 4QTZA 2FWNA 1PFKA 2LO6A 1QIFA 1ZH8A 2GRAA 3QWPA 1D6NA 3TG2A 3THOA 4ZU3A 1KZ4A 2GBFA 4IG9A 2C59A 4BIMA 4XWKA 1ZQ1A 1BFUA 2QXTA 3K8ZA 1F7VA 5AIJA 2PO7A 4IM7A 3HB5X 4HNHA 4XCQA 2W6PA 4D41A 3ZFWA 1EK2A 4YHHB 1KR2A 3V46A 2WG2A 5T4FA 1GEEA 2HPZA 2ZCJA 3F7NA 3RVNA 3HUEA 2CJFA 1N9ZA 3AY6A 3QTTA 5ENVA 2BT4A 3GJ6A 2PSFA 3E48A 1BJKA 1CT9A 3V8QA 2R751 1EVZA 2OCDA 4EJSB 4P38A 1DO0A 2ZIGA 4KE8A 1NY5A 3YASA 3RVKA 2XAUA 1FRNA 1U90A 1DRKA 3QF4B 1EDDA 2OFFA 3B7UX 3A3KA 2VP5A 2WLSA 4UI9C 3RS8A 2XGGA 4K8OA 4KLZA 1T9AA 2IYEA 5HUQA 2BIFA 1X7DA 5F9MA 1HSOA 4A0RA 1X1TA 1NNI1 2H2WA 3DOUA 5ALQA 4F71A 3HWSA 4UMVA 5CIWA 3SZGA 4ZK6A 1OFUX 1RI3A 2XAAA 3GNSA 1ZCAA 3AILA 1ISFA 3UIPC 1GPDG 3RFTA 1WB5A 3G7UA 4LX8A 1WNFA 1NQVA 2I6SA 2X58A 4PO1A 4URWR 4P81A 4EJ6A 1CC1S 4P0TA 1Q2UA 3MD9A 1QP0A 2C7VA 3II6X 2WYWA 3H2HA 1EB9A 1P7PA 2WV7A 1KAQA 1HYHA 2EILE 3FDHA 3VZSA 3OPYB 3WLQA 1WUJS 4KXKB 2M1XA 3NAWA 4EG3A 4UM9B 4YUZA 1G3QA 2G67A 3R0IA 4W4TA 4Z7OB 2WAOA 2HNBA 1TX4B 2BM9A 3IEPA 3LUPA 4MINA 5T64A 2PMFA 3A9UA 3TPZA 2IYQA 2ZW9A 5EY5B 4HI9A 3ZD9A 3ZD7A 1OYVA 3CVVA 1HFKA 2GNPA 5K8VA 2UYCA 3E33A 2IDZA 4PS0A 4WEOA 4BVLA 1T9DA 4ZAYA 3ZU4A 2IYOA 4UHBA 1HG1A 3H7AA 5K8CA 4EB8A 5IAJA 5JBQA 2D0OB 2V7BA 4HVBA 1OHHD 1WCIB 2MSEB 2W2KB 3GELA 1WW8A 3N2ZB 3CVUA 2FPMA 3MGGA 3P97A 1E6WA 1USGA 3OKAA 1B00A 1E2MA 2PLFA 2PRKA 1I3KA 3EVAA 3HJAA 3NBZC 1KQ3A 1Z56C 3OIVA 4G0WA 1NDQA 4MIEA 1E7YA 5IVDA 3OFJA 4YJDA 3ZX5A 1FCHA 1O6CA 3PGMA 2H85A 4GTPA 4GPMA 1UKEA 1C8BA 2OO5A 2OTCA 3C5VA 4AP5A 1RAFA 3C74A 4YCJA 3NIBA 5KTMA 4I1SA 3V1UA 4IUBS 1GW6A 3MS4A 5DM60 2VUSA 4QBTA 3LP8A 3NC1C 3HU3A 3OQVA 4QSMA 2OEVA 5DYNA 1N4AA 2QGFA 4BNHA 4F06A 3OF5A 1B42A 2AZDA 3TLJA 3GJRA 1E0SA 3DEOA 5JTUA 1CX9B 2XDAA 1WTCA 3SHQA 1EK6A 5I9MA 3EWIA 1ODFA 3B5EA 2WJWA 3C3RA 3LOUA 5DXAA 3A2NA 3D3MA 4HDNB 1MTZA 1HTTA 2AYYA 3UHOA 1JFLA 5TEVA 5JJ5A 2H3EA 2PSJA 2OBYA 1N92A 2A5EA 3RYFB 1JXAA 4BJ1A 4C4SA 3L6BA 5KTPA 3PGLA 1N8SA 1O4VA 2WKSA 3L7LA 2Z8YA 1SCAA 3SJAA 4AK9A 5CB8A 2XUKA 5IUJC 5AIBA 4L0QA 5NLLA 4NCNA 2HZBA 1WB9A 1QH8A 5FBQB 5DXJA 2IX3A 3H5RA 4NR0A 4JUDX 3ZPXA 4IGKA 1DKPA 5DLDA 4BKPA 2AUMA 4KK3A 4QU8A 3R6TA 2ZG6A 3MCXA 2ROQA 3GVHA 3H05A 4JA2A 5JSHA 1YOBA 5A06A 1ZM4A 4JA7A 2A14A 3VXKA 1D7OA 4BSZB 4FR0A 1E94E 1CUYA 4WUVA 1O6BA 1K6IA 2J3JA 3VTZA 1EP9A 2BF4A 4MR9A 2FJ0A 1TCAA 1QYDA 1FMLA 1Y4SA 3D8UA 4PLPA 4BV8A 3D3JA 5IT4A 4G24A 1CV2A 2JFNA 3BREA 3DO8A 1QRRA 4HAYA 1T2FA 1HG5A 3I2YX 2X9GA 3GWZA 3PFCA 1QCDA 5IF9A 3DHEA 4HDMB 2PWPA 4R1LA 3IBEA 1NV8A 3OURA 2JL1A 2GM5A 4MPJA 2NYVA 3E7FA 2R1ZA 5FA5A 3U40A 4BX2A 4FXPA 5LR6A 1KVRA 5JJIA 1QNLA 4P3YA 1Q57A 1JR3A 1UK6A 2WIKA 2GM9A 1T9HA 3TSCA 5HZMA 3ROKA 3S1AB 3UJAA 4BMNA 5IDXA 3THWA 2UKDA 3NVDA 3OOWA 4IF4A 3KQUA 4JLKA 3JWHA 4IHQA 3Q5MA 4PN7A 4JJ7A 3JD1A 3W5SA 4LWOA 1J22A 3UMCA 1C3JA 4K03A 3KR1A 4HMOA 3FPAA 2YJ3A 2AI1A 3JQFC 5C4GB 3RTBA 2JD2A 3KJGA 3KOOA 4LRUA 4BQSA 3AK4A 3BUSA 1GGJA 3OQPA 3HCEA 3P71T 4RL4A 5H83A 1B89A 4CPDA 1DCTA 1F2UB 2H17A 4M1QA 4KVOA 1Q1ZA 1UIMA 4RL6A 2HLPA 4WJKB 3AVWA 2GDZA 4AV7A 3BAZA 3VKFA 3CO5A 2B8TA 4KZKA 4YWJA 4AF7A 2FWRA 1LF0A 3T9CA 3V6LA 4PBTA 2WJYA 1MJ5A 3UAGA 1FSSA 1WCXA 2ZWOA 3DPUA 5I9NA 1HEYA 2YV5A 1Y7IA 4GPEA 5IDVA 1NC1A 3D5QA 5MFPA 1N1GA 4HOTA 3KJIA 4RY9A 3BIXA 4B7AA 4ND8A 1T13A 3R9IA 3L7CA 3WYCA 4A6PA 4YCNA 3UT8A 1V5EA 4FQ5A 1I0IA 4BMXA 5D3ZA 3RSGA 5JVDF 3ABIA 3O4VA 1I4LD 3F3KA 2DQZA 1NZNA 1AK9A 2V0CA 3JSAA 2QIPA 3ZEIA 5ADWA 5C3MA 2QRLA 3G0BA 1KDRA 4TXMA 2FI7A 2QT0A 3UW1A 5JNRA 1WHTB 3D9KA 3BCHA 5MF6A 1SKMA 3KFXA 3VJLA 3EJWA 2P40A 2X42A 1U7TA 3OZVA 5AKHA 5A3VA 1T15A 1SC1A 2Q5FA 5IBRA 4ER5A 3GLHE 1K8KG 4QPPA 3E5NA 3GRUA 1GAWA 4HGOA 5MHTA 4IQGA 2QTNA 1N57A 1CS0A 2JIZD 1HH8A 1FYVA 1PK9A 4HL6A 3GFOA 4DIUA 1QBKC 2A8YA 1QYXA 5FFFA 1CSEE 1GFZA 3OCCA 1G5IA 3LL4A 4UZEA 2VF7A 4LOKA 2I55A 4FHDA 1CJTC 4KVZA 1XJWA 2ZJBA 3GF4A 4M8KA 5F4BA 2JPDA 5IKOA 3RIMA 3P4XA 1U5BA 2O6LA 4IZIA 1UEXC 1A5SB 1WMDA 1PWHA 1U2QA 2A92A 4RVCA 2QY9A 2QN3A 2ZSKA 2J32A 4QEKA 1KAHA 5EWMB 1S70B 3AL3A 1R6BX 2I4OA 2M1ZA 5GY7A 4KYVA 5THXA 2V5FA 4KPUA 3WTBA 2A58A 1KYIA 3IMGA 4WH0A 2O23A 4GL4A 4Y18A 1BKSB 5CMLA 1ZHFA 2FEPA 5BSGA 2IU6A 4LDNA 2BJVA 1KEVA 1Z4KA 1P5HA 2PKCA 3X3HA 5L6LB 2P62A 3LPAA 4E33A 2FUNB 2ZRNA 1OZFA 2GTHA 3IP3A 1CRPA 3GLRA 4L28A 1J0XO 3AEYA 3AR7A 3MJVA 1V4BA 4FD2A 3AL0C 3P1UA 5K3SA 2PJZA 3L84A 2FWMX 3BXFA 4KZCA 1EJ2A 4GR5A 3WWCA 1D4AA 3UJ6A 1ORVA 2WT9A 3SKXA 2O14A 1TZ2A 3N8IA 1QZTA 4GFDA 3LGSA 3D4PA 3VZRA 4EFLA 3CURA 5G02A 4M9RA 1X3SA 1V3TA 4DUPA 3ZWDA 3KQKA 2OCYC 5IDWA 4PH4B 4LXQA 3SR0A 1RHJA 3AQ4A 3OQ6A 4DLVA 3VGJA 3DDOA 4ENQA 2VSOA 3EGCA 2HSWA 4AQ7A 1XP5A 1ZVMA 3KTAA 3FOZA 1ML4A 1WS6A 1CUDA 2OQ2A 1JU9A 2DR2A 3EJ6A 3ILXA 1BD4A 1LFDB 2FUKA 1DQNA 3EWSA 4IIXA 3RT1A 1QMPA 3C3WA 3Q5DA 3WSWA 1E77A 1UXJA 1OBHA 2GOYA 3GMIA 3K72B 3OQHA 4EG4A 1LQUA 4DMFA 1GDDA 2P9UG 4RUKA 3I64A 3TCXB 1T35A 1VRCA 1DXYA 2G1KA 3L7YA 2JIQA 2QOEA 3HYNA 1VYVA 4TV9B 4DIEA 5EUMA 4TMFA 1DFIA 3GRKA 4KK4A 4CF7A 4UDOA 2J0UA 2IU4A 4J8DA 4ZT2A 1GGKA 4XH9B 1WSDA 1ESCA 2VCEA 2FJDB 2Q1XA 2QIOA 2Y68A 4YJ2A 2GJ4A 3QVJA 2XKJE 2YZGA 3EY9A 4N7RA 5JYDA 5L3QA 3VJRA 2HCFA 2HF8A 1HUQA 3WE7A 3NAQA 3T4PA 4YMGA 1F48A 5GVRA 1TPZA 1RQRA 2IOQA 1PYGA 3FB4A 1FP6A 2DJIA 1V8DA 2C3OA 2KJQA 2JIOA 2QMOA 3H65A 2P67A 3V2XA 5ETJA 3R6WA 2OQVA 1UPBA 1KPHA 2R05A 4TUMA 1XTSA 3A6EA 1PO7A 4YJHB 3WP0A 3V2HA 1J8QA 4XSHA 3SXPA 1JNXX 3JQFA 5DGTA 4E94A 3F98A 2QTFA 5EZYA 2QTVB 4WNAB 4RY8A 1D1SA 4YMSA 4E1BA 2JVJA 1J42A 1DCFA 4IJWA 5CH5A 3VU9A 3BIWA 3T7SA 3RC9A 1C14A 2G0NA 3H3JA 3VPHA 4ZYWA 1Z7BA 3U81A 3WVNA 1RKUA 2ZRLA 3O1HB 1OF1A 2Z5GA 4J0EA 1M0SA 2GQ0A 2YN4A 2VGXA 2PFKA 3K9LA 3UA3A 3KOYA 3SDSA 4ZOCA 2NT3A 2XNJA 4JASB 1UT6A 2AMVA 3O8QA 4CCYB 3BQOA 4GTTA 1KIMA 1ZXXA 3I9FA 2IW3A 3LPCA 4ZDKA 1IY2A 5LXTB 3GLFB 2HYIC 3B12A 2Q5CA 3T0GA 4IVPA 1T5OA 1U1EA 2D5BA 4JP2A 1HC7A 2SECE 1XMPA 4GI2A 4F21A 1G4UR 2IFTA 5ICFA 4TLBA 1I4EB 1FNCA 2NXNA 3CR7A 1GSAA 4YRFA 5K0TA 4YJFB 4B6SA 2R5WA 3I1IA 3ZCUA 2MSDB 1Z5SC 1VRVA 3AUKA 3AHGA 4P36A 4P35A 3GOQA 1CF2O 1H5NA 3L82B 3B3JA 2ZPUA 1TKCA 3C8DA 2GN2A 4JUBA 3JWJA 4M53A 4TWZA 5ICGA 2ZI4A 3GW8A 3KRTA 1IUPA 1NM5A 4JUCA 4PR0A 3V8RA 4WNGA 2AV6A 5BXOA 2BTOA 1HWYA 3OIDA 2H1HA 1RWMA 3NW9A 2Z4TA 2ZYAA 2X86A 2FP4A 3EIWA 4UHCA 3JQ9C 4TUYB 4KFSA 3G7NA 2CLIB 1K6EA 3GWGA 4NRDA 3TB4A 1MO5A 3R3UA 3U4HA 5A5EA 4N0EA 2BTDA 5KTOA 1TA4A 5KKCA 1RLIA 3IVRA 2JCSA 1I6KA 4HEJA 5DCUA 3VVBA 1H6CA 5A3RA 1EFLA 2HMYB 5K8IA 1XCOA 4LOHA 3TO5A 4BLPA 5JXJA 1Y5IA 4N5DA 4S0XA 3PJEA 2IQ5A 3OUUA 3WGOA 4MPRA 1FW6A 3N74A 4X64B 3BS4A 4BS9A 5AMXA 2QL6A 4Q9IA 3CSTA 3GJSA 3V7FA 3MELA 5CD9A 5DGCA 4O60A 4KHZA 4L8FA 3MOGA 1DC7A 1YDEA 3KELA 1OI4A 3BMNA 3VSAA 1XA3A 3WB0A 4F6RA 1A7JA 1JFFB 1D2HA 1GQYA 1PGNA 5JJTA 2HH9A 2CG3A 3G2SA 3PXDA 5AW2A 4NZMA 1B6SA 2C1EA 1WKBA 2JK1A 4G5QA 2V7EA 1GQFA 1JT9A 5IARA 3LS8A 5CFZA 1NLFA 2IKQA 3UMGA 3ERCA 3PZDA 4DX1A 5CX4A 2OCPA 4DLSA 1XTZA 3U7QA 1MJFA 3N7AA 3URZA 3K2QA 4G5FA 3ZHQA 4ZHBA 2QTTA 4HDSB 4RHCA 2G72A 2GCEA 4W5HA 3A9RA 4X7PA 4YUYA 4JP1A 5LJLA 3NWPA 4R1TA 4H2DA 2WDPA 1C1XB 5DHFA 4J8SA 4TM8A 3RT9A 4BUZA 1DI0A 4BWGA 4J3JA 4LKRA 4PTYA 1A8UA 2FRDA 4RKFA 4HFGA 1T2EA 5CCDA 2IKSA 2PG3A 2QRJA 2VT6A 1PS9A 1V8ZA 1Y4UA 4NJMA 1MO3A 3I5MA 1P75A 2IU3A 2M9MA 3IPCA 4IDAA 3N58A 3W79A 2CHUA 4GTMA 4YRDA 1GU0A 1NKVA 1UC9A 1OIWA 3SQXA 1VLLA 2RK6A 3DTTA 3ESQA 3K92A 5F3DA 4EGJA 2WMNA 3WIBA 2I6TA 3O8OA 5FLYA 3AM5A 1SG6A 2FK7A 3C3QA 1YZYA 2IZ0A 2NU8B 3WNCA 1ZICA 2P9EA 3EY4A 4OH1A 4INZA 1XJCA 1XRMA 3OZUA 1DAHA 1Y1TA 1YYHA 3QPAA 2UVDA 1EYHA 2YVKA 5DBIA 5F76A 3DSWA 1L1QA 4AZWA 4RM2A 4ECEA 5JZOA 3WL5A 3K0SA 3ZWWA 4K3UA 1WDLA 5EWJA 2WUFA 1KXZA 3AVOA 3BFKA 3QPCA 3S3TA 1Z68A 4GLBA 4EGAA 4RQAA 4FE3A 4DRXA 1OI7A 1NPDA 2XKBA 3L6CA 4FWTA 4AG6A 3EEIA 2HJVA 2O8EA 2B3TA 1H8EA 4IGFA 4NACA 3E1KA 2X5JO 4BN0A 3HEBA 5ELLA 5HS0A 2FE4A 1KTIA 1N77A 4HJRA 3M4XA 2Y0BG 1JN0A 3K09A 4LPKA 3OXGA 3U7EB 2HXGA 5IJWA 2RIPA 1O4WA 1LW7A 1P6QA 5FYQA 3COWA 1E4YA 1OZAA 4CIWA 3L01A 3N0TA 1FFYA 2GN4A 2FU5C 2ZGDA 1QBQA 2OAEA 2DSNA 3MJWA 2GN0A 2QPLA 4U8HA 2G71A 4KAXA 2R59A 1XQVA 1U8TA 3QTBA 4KFTA 2P79A 2R6FA 3NDPA 4X8HA 2XB6A 3DUFB 1E1KA 2LCIA 3RJZA 2RKWA 3TKLA 4M9UA 3OEYA 5DBGA 3BQMB 3AWDA 3CJRA 3H8SA 5K1ZA 1F06A 4EH1A 5KBYA 3H04A 1U2VG 3CA8A 1Q77A 2A0FA 5C51B 5J4KA 3AMVA 1ST3A 4MQEA 1JB9A 3EF1A 4XYGA 3PNMA 2WYIA 1LNZA 1TQ8A 1ZD4A 3DAHA 3QEOA 1UJ6A 1Q0ZA 4MR8A 2BUAA 2DPGA 4XB6B 1E9FA 4XUDA 3WHIA 5KC9A 3PQFA 5GZ3A 1IN8A 3CZPA 1A2BA 3I0ZA 3GQVA 3MWYW 3O73A 4DIFA 4F86A 5CLJA 5I48A 1U11A 3HYTA 3KJNA 1NLMA 3ETNA 4FHCA 4KXWA 4NNPA 3MCVA 3FSEA 4DI4A 4MDYA 4TKLA 1G63A 5G0UA 1QQ5A 1CK4A 1GCAA 1CDDA 2LW7A 5AVZA 1BGWA 2BGKA 3K1AB 3SJCA 2A2ZA 5ENTD 1ST2A 3GH3A 3PGVA 3HA7A 2IHNA 4B34A 1GPLA 3BMOA 2HA5A 1P7CA 3FF4A 3FUHA 1EFRD 3LRPA 5T5QA 4BRWA 4KDRA 5E3HA 5HZKA 4E85A 3TBHA 1WXWA 4BV2A 1Z22A 4H27A 2K5UA 1ELRA 3TZ6A 1FS5A 4UUCA 4QJBA 2JDID 2G83A 5EXSA 1DG9A 4MW4A 2VOEA 4DQ0A 3OIYA 4GOMD 2E49A 5AQAA 1P6XA 1JEEA 1L4YA 3QFRA 2NU6B 2VLIA 4M1ZA 3ZQ4A 1AHHA 4DN6A 2VJMA 3MTGA 3AI1A 4UWHA 4MWZA 4Y6LA 4KBYA 4UASA 2AI2A 4WV3A 1U6JA 5DI9A 4YP6A 5UKDA 1PSWA 3NC0C 4M1WA 1AGRA 5BNZA 3VMMA 1J4AA 1D8DA 3D4BA 5CIYA 2W2PA 4QHYA 2EJBA 3AINA 3TXMA 4LRYA 1Y82A 1ZS9A 1LPAB 1OX6A 1MIOB 2VWPA 3ET5A 3I6BA 4L6CA 3TUIC 3KD2A 5ISMA 4DJEC 4RCYA 1P0QA 4JLVA 1YS4A 3PUXA 1ISGA 2H7YA 3VDXA 3H8JA 4PQYA 2I65A 2JNWA 4BWYA 2IV2X 4G8JA 3AJ9A 4NC9A 2FSUA 3VKWA 3C5WP 2IEAA 3L22A 5AQEA 4Z2AA 1KRXA 2A9RA 4ZVLA 4DB4A 2PUFA 2NXJA 3GZ1A 1KO5A 4HDSA 2C29D 4RE6A 1MX4A 3NJRA 5E8RA 3K9NA 4ASUD 5JJBA 1QTIA 1XMOB 1FBTA 3PDHA 4IXNA 5IY5E 1XQ6A 2IEBA 3M34A 4JXZA 2QD2A 2BUCA 4NYIR 3I8SA 5B1YA 1WIWA 4U9IS 2FRDC 4J76A 4CLRA 2NTNA 4LC9A 1N5JA 4GX0A 1H94A 1ZZEA 2Z43A 4B3CA 4CFSA 3PUJA 3A26A 2L19A 1LTKA 1J23A 1ZIYA 3GJQA 3OEEA 3QLUA 1QO7A 2JJYA 2UUOA 4V03A 4S04A 4Q6WA 3AUYA 1T5HX 2P9GA 1ISHA 3W9BA 1NLUA 4XUCA 2O7SA 3QJYA 4E2FA 2H8GA 2Y77A 2XZPA 3P20A 5DBFA 1VJ0A 3D3WB 5AKXA 5F2EA 5G1OA 4YIHA 3C1TA 4EYKA 4J49A 2VJCA 4CI0B 1VE7A 2DF8A 4EY4A 1LPSA 2PGIA 5FWYA 1FXSA 4FM9A 4JJAA 4HAIA 3E9ZA 3CU5A 4AUNA 4IGAA 1ZLYA 3OSZA 4IRMA 3K9HA 1RM5A 2JABA 1VE1A 4UQZA 1WDTA 1Z3XA 3BGOS 1LBIA 2I2DA 4YASA 5AM1A 3K9QO 4XLZA 3KHKA 2TMDA 2O3QA 2PX0A 3DFIA 3KQVA 2MIIA 4N5HX 1Z29A 5BV1A 3S2EA 4GCOA 4XUGB 1X94A 1XQ9A 4F7DA 3CONA 4EM6A 5IWCA 2WPDA 3ER9A 4UUPA 4UZSA 3TSOA 5FB3A 1FPMA 3D0OA 4MHTA 2DM6A 3FCXA 1G55A 4M55A 2PNNA 1U8YA 2QUHA 4LHZA 4X97A 3G79A 1J39A 5KYUA 2AVNA 2P9JA 4UWGA 5D3KA 4Q02A 4A26A 4FLEA 1AXRA 2R62A 4UYJA 1HY3A 1KZ6A 1R5OA 5FBWB 1E1QD 2PZEA 1YVDA 2IYYA 2OHVA 2RAFA 3HCCA 1X7YB 3N7TA 3QKWA 4OF4A 3DPYA 2RI6A 4TV8F 1K27A 1P1KA 3ZV3A 1QOQB 1NQOA 3DUFA 2FZ4A 4C20A 1F8FA 2OFXA 2ZBQA 2FMXA 2ZIZA 4IOJA 4WY5A 1JKFA 3Q9SA 5DJ5A 1R5NA 3HNOA 1E3DA 1WVGA 4QDOA 3TGWA 4BNZA 1IEVA 5EJ5A 5AKJA 2DXIA 3OZSA 3LWNA 5E6SA 2IHTA 4MIKA 5HE9A 1VYHA 4OIFA 2QB5A 3WKDA 1AKTA 1Y1RA 2J67A 3TGPA 4KC0A 3I04A 4DV4B 2I3ZA 3PX3A 3AERA 2X5HA 3AONB 3LBIA 1YZFA 1AZSC 4LOAA 3SIRA 4AY6A 2J3DA 1L4BA 2J5BA 4EL0A 2P6NA 3B2EA 1XEWY 4GXQA 2ZPTX 4L5IA 3ZHUA 4ZI3A 4A5SA 1NN1A 3MUFA 2FR0A 3NTVA 5TQ0A 3TX6A 1E5XA 5DK4A 3ORQA 3KSLA 2QLFA 3SO8A 3WLNA 5JWHA 5AOCA 4EUKA 3JYPA 5LQKA 3FZEA 5IJ9A 4JHJA 3FPBA 4H35A 4XZ4A 3JYQA 2H9AA 2WIAA 2REOA 4R68A 1MQSA 3KQYA 4XYMA 5IYZF 1WBDA 3QSYA 2ZKIA 1RJGA 2AJBA 4K6HA 2I9CA 1OTHA 5BR1A 3PE4A 3FFXA 4UTPA 2C78A 1XX6A 2AUNA 1H8HA 1LY1A 2NUTB 3MOSA 5DHAA 1NUAA 4JT8A 4N9WA 4Q7QA 1B26A 1UCFA 5CMYA 1L7RA 1TW3A 4FHZA 1G1MA 4MKHA 1RW4A 2RAUA 1HA3A 4N3AA 4HDKB 1PG2A 3A1VA 3PCXA 3JPWA 5GZ6A 1FCJA 1VIYA 1IHXA 1SUAA 1II0A 5IANA 2EL9A 3A6LA 4DKXA 1BMDA 1JB1A 1RZRA 1MPXA 4MGKR 1QV9A 4MYHA 2W4MA 3DV0B 3BCSA 4IOMA 2ZJ0A 1R37A 1YULA 4KYTA 4BEJA 2PLNA 1IYGA 4C3OB 3GFFA 4ENVA 1QLWA 1YIAA 2CHQA 2CMDA 2JEYA 2G09A 4UM9D 3UCEA 2Y8EA 4GX2A 3GLIB 3HRHA 1EGHA 1T10A 1SXJC 4ZKEA 5CERB 5SY9A 2SHKA 3KC2A 1SRQA 1X80A 3OM8A 5D6NA 4B4UA 2PNFA 4L4YA 3W9YA 1XU4A 4KQKA 3ROTA 3RDPA 3Q8LA 5ENQD 2C54A 5EILA 2HZ7A 4EB6B 1EK1A 3GLGE 1G8PA 4HLQB 2EGGA 3LW7A 4D4MA 4EZKA 2VP0A 4CMKA 4RJKA 2P2NA 1EG2A 3DH0A 4GM1A 5MDHA 3L7BA 2FHPA 2OCAA 1M54A 3SD5A 4YP7A 1HRDA 1FSGA 1Y5RA 1XMVA 3PH0C 2BKUA 2BSAA 3F8TA 4L7TA 4NNOA 1LBTA 3EFEA 4L50A 2DIWA 1F17A 3ITEA 4FYWA 4QHSA 1B43A 5CLQA 2LXMA 5AJUA 2OYSA 2QAIA 3L4BA 3TBFA 1ZI6A 4Y2JA 1JPVA 4LSWA 1V71A 4ZYVA 1MVOA 2QPAA 2XUQA 1OU4A 3P2OA 5C80A 1NFQA 1KHHA 1NHWA 3F6PA 2ZSDA 3P9NA 3GPCA 5MN4A 1Y8ZA 1OFUA 3J7AC 2IE8A 4O29A 4HC4A 1F3OA 4UCWA 3GIWA 3WRXA 2QRUA 5TXGA 5GOZA 1NL3A 5LP6F 3DD1A 4G5SA 2JJMA 3VSEA 2JS7A 3WQRA 5DRYA 4NCHA 1IZ8A 1W44A 3ZJYA 2ZR0A 4KAAA 5EZYF 2RCYA 1AWCB 1FFBA 1MHPA 2Y0CA 1RHMA 2VWGA 1WWKA 4DCCA 5K6AA 2RGEA 4MQ4A 4RIGA 4QE3A 3LRTA 2P2DA 4KE7A 4LRSB 3FNGA 4EG1A 1X7WB 4ZREA 3F78A