4GZ5A

Crystal structure of human o-glcnac transferase with udp-glcnac
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
716
structure length
700
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 265
structure length 700
sequence length 716
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz5A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz5A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gz5A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gz5A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gz5A03
1NA0A 3DZCA 1XKXA 1Z8DA 1NOIA 3RO3A 3ZCRA 3ZCUA 1YA6A 2VG8A 2UWJG 2XGSA 1EXVA 3ASFA 4N2QA 4KQ1A 4YUAA 2WQHA 4GCNA 5IKPA 1P2GA 3CK7A 4NC9A 2VQ2A 3HBNA 4AM9A 1FS4A 3T3IA 3ASGA 2X0EA 3FFLA 4NEQA 4X6LA 3BD8A 4H7XA 2ECPA 2XEVA 3OKCA 2NC9A 3AS8A 3T3GA 5D01A 3UYKA 1ELRA 3G2IA 2P6PA 3MTDA 2FO7A 3COPA 2FI7A 3H4IA 4WHMA 3AS4A 2IFUA 3S7FA 5KJNA 1L5WA 4KYOB 3RKVA 1FA9A 3OY2A 5CHEE 3OY7A 1O6CA 1SXPA 2L6JA 4WNFA 3Q47B 4W6QA 4GYWA 5TMDA 2AZDA 2G9RA 5G05C 1JEJA 4APOA 2PYDA 2VSNA 3RO2A 1JIVA 1F6DA 3ESKA 4EQFA 3OXGA 2HYZA 1TJCA 1FCHA 4U07A 5JJTA 2QRPA 2R4TA 2F3UA 2KC7A 1KT0A 5KJMA 3G2NA 4CTOA 2X6QA 1J39A 1JG6A 1XV5A 3SYRA 2G9UA 2GPBA 2KCKA 2IUYA 3BEEA 1Y6GA 3NCHA 2VGXA 3QWPA 3OTGA 1Y8MA 5A6CA 4AMBA 4B94A 3OT5A 1XL1A 3L01A 3C4VA 1C3JA 4RIFA 1P2BA 3RHZA 4UI9J 3BCUA 4LEUA 2XGMA 2SKCA 2F3PA 3MBOA 4JA7A 3EBOA 3T7DA 4YVOA 5CCLA 2YQ8A 3ZCSA 3CEHA 3MT9A 3S27A 3D1JA 3TSAA 3O48A 4H7YA 2FBNA 4GZ6A 4N3CA 4O6FA 2GW1A 4UQYA 3NB0A 3CV0A 1P29A 1QM5A 4NQ0A 4CGWA 3IA7A 3T3DA 5A7DB 3RT1A 2GPNA 5JTUA 3G2LA 4UI9C 3MRVA 3CUUA 3E4BA 4MI3A 3CUVA 5CCMA 5JTTA 5DLDA 4GZ5A 2ZB2A 1UZUA 4HOTA 3E3OA 3CV3A 4WADA 1SXQA 3MA5A 3UYLA 5LCWC 3CVNA 2FF5A 2QRMA 4Y6CA 1XOIA 1XC7A 3NAZA 3GW4A 5EKQD 2O6LA 1C8KA 1HLFA 3KS2A 2GPAA 3AS5A 5ARFA 5G04J 1BX3A 2XA2A 4NESA 4YI3A 2IV7A 3SZ7A 4GA2A 4GCOA 4GZ3A 3CEQA 4WNDA 1FU8A 3CEMA 2Q6VA 3E3LA 3TAXA 2IV3A 2PQNA 3ZHEB 1LWNA 3GPBA 3DDSA 2IYAA 3VTXA 4QLBA 1GGNA 2QN2A 3GZ2A 3Q4AB 1ZBPA 2BUGA 3BD7A 3ASDA 2AW3A 2LSVA 3LYAA 2QN3A 2GEKA 7GPBA 2C9ZA 4WNEA 1L5QA 4EL0A 1JG7A 2G9VA 4F3VA 2XCBA 1Z62A 3TG4A 3FROA 4RIIA 2KCLA 1FTYA 1GFZA 2KS6A 5D00A 5FZSA 3LY7A 4IN3B 1L5RA 2GJ4A 2MHKA 4GA1A 5FT9A 3OKPA 3T3EA 3GUHA 1FU7A 3ZCVA 3CUYA 4NRHB 1KTIA 3R9AB 4G25A 3MQFA 1E4OA 4W9RA 3KAEA 3CK8A 4M83A 1HH8A 3VDMA 4I9EA 4G24A 2C1XA 2HY7A 3NC4A 1IYGA 2P58C 2SKEA 3D0RA 2AVPA 4U04A 5KJLA 3ULQA 2UY1A 4AY6A 4F97A 4EJ2A 3UUXA 5FZQA 3DD1A 4HOSA 2H1FA 5BNWA 2Y4TA 4I9CA 5EX3A 4UI9K 4U0UA 2XMPA 2XGOA 2R68A 4N9WA 2GEJA 3CKBA 3PDNA 1JIXA 4M7PA 3NP9A 4BTBA 3VDNB 1K06A 1ELWA 3NP7A 1HZ4A 1GPBA 2IF4A 4XI0A 1LWOA 2H1HA 3Q3EA 1NA3A 2HR2A 2PRJA 3BCSA 3E3NA 4KQMA 1IHGA 4N39A 2QFCA 4WNGA 2QLLA 2XCCA 1WV1A 1W3BA 4MI9A 2AMVA 4GPKA 2QN1A 4UQZA 1Z6PA 4RBNA 3RSZA 3NPAA 4HOUA 1RRVA 1QKJA 5C1DA 4EL5A 3CX4A 1XL0A 2LSUA 2F3SA 4G26A 4KXKB 1A8IA 4BQEA 3U4TA 1V4VA 3LCAA 3ZN3A 2QN7A 3S28A 2QZSA 1L7XA 5LQDA 3ZPJA 3MSCA 5I45A 4Z5XA 4YI5A 4FKZA 4EKYA 3WAGA 3Q5MA 3MRTA 4I17A 3UPVA 2I6HA 1P4GA 3G2JA 1NVKA 1NOKA 1NZNA 1PN3A 1WAO1 5DXFA 1PSWA 2R66A 1UQTA 3SF4A 4I2WA 4N3AA 1ZU2A 4X7RA 2XCIA 1P4HA 4CTNA 4J8DA 1L5VA 4N2SA 2PQRA 4BT8A 3FWVA 4HOQA 2R5SA 4HWGA 2QNBA 2XPIA 5DIZA 4RELA 3D0QA 3C48A 1UQUA 4REMA 4F9FA 2GM9A 2X6RA 3OXLA 3CKCA 3ZHEA 4MHOA 3MEKA 3MV2B 4RG9A 1A17A 2PL2A 1NZDA 1VGVA 1IIRA 1KT1A 2QRGA 2VCEA 2C1ZA 1EM6A 2C4MA 3HYMB 2AV6A 4AIFA 3GZ1A 3HBJA 1FU4A 4G2VA 4RENA 2IW1A 3ASHA 2OFFA 1KLXA 2QRHA 2FEZA 4GA0A 3LKUA 4U0SA 3MKRA 4CDRA 1C50A 5DU2A 4I2ZA 2ACVA 2PRIA 3MS7A 4L22A 2KCVA 3DDWA 5ENZA 4CGVA 1C8LA 4KBQA 3RIBA 3FP3A 3TOVA 3VUEA 2V5FA 1OUVA 3QDNA 1K08A 3RU0A 3S7DA 3OXFA 3L7DA 4RIHA 3ZCQA 1L6IA 2VYIA 5FJYA 4N3BA 2IYFA 4MI6A 3IEGA 4BQFA 8GPBA 1P2DA 1RZVA 1WV0A 1XNFA 1WM5A 5BT1A 4G2TA 3SYMA 3S2UA 3Q15A 5LCWJ 3MT7A 3LPZA 3GYZA 3OTIA 2JJMA 2VGXB 3MRXA 4J8EA 2UY1B 2X0FA 3UQ3A 2QRQA 3CVQA 1NLMA 4LDPA 3S7BA 3ZFWA 3HBFA 1RZUA 2PQ6A 3H4TA 3G2HA 3L7AA 3CK9A 4XI9A 4BTAA 3CVLA 3K9IA 4AMGA 4XIFA 4AN4A 3WADA 5JJ6A 2G9QA 4YVQC 5IKOA 2C2LA 3RSCA 1M5RA 3BD6A 2Q7FA 4ME2A 2KATA 2F3QA 5D0QD 5FTPA 3NF1A 2J9QA 3L7BA 3RJVA 4PQGA 3S29A 4N5CA 2WTXA 3MTBA 1FTQA 3QHPA 2SKDA 1E96B 3T3HA 3PE3A 4GYOA 4X7MA 4WUYA 4HORA 2ATIA 4HLNA 3TG5A 4A1SA 3C4QA 1GPAA 3MT8A 2ONDA 1FC0A 2FFRA 3CEJA 3L7CA 3BEOA 2LNIA 4M60A 4KQ2A 2ASVA 2Y4UA 1WW2A 4LEIA 4GPBA 4ABNA 2VSYA 2VCHA 3PE4A 2JLBA 1ABBA 5HQ8A 5D0OD 4YNDA 4J0UA 1B89A 4I1AA 5EX0A 5AYWD 2QN8A 2YHCA 5TMBA 3QWVA 2C0MA 2QN9A 3LY8A 4MICA 2YJNA 2BGTA 2R4UA 1PYGA 3ZCTA 2XA1A 4JL0A 3U3WA 3TGOA 3BCRA 4UQXA 2PYIA 3VUFA 2C0LA 3ZCPA 3CVPA 1PC2A 3WC4A 3T5TA 3N71A 4AY5A 3BDAA 1IXYA 1QQEA 3URZA 4JHRA 2GT1A 3VTYA 5M72A 1GG8A 3MV3B 1WUYA 2IEGA 4U0ZA 3OTHA 5ARGA 2HO1A 5TVGA 2E2EA 1FTWA 3Q3HA 3JYSA 1GZ5A 3L79A 3AMVA 3LY9A 2R60A 3CUWA 5HI7A 2XCUA 3QKYA 2BISA 1H5UA 3O3CA 1L5SA 2BGUA 5FZRA 4MHSA 1PNVA 1QZ2A 2IEIA 2BFWA 4G1TA 5G05J 1GPYA 4WACA 4X7PA 1JIUA 4FZRA 2QLMA 3G2KA 1AHPA 2F9FA 3WXXA 2DBAA 3ZGQA 1Y6FA 3Q49B 2OOEA 5TMEA 2FETA 4G23A 3S7JA 2XA9A 1F0KA 4EKEA 1Z6QA 4J8FA 3CUTA 4CTMA 2QLNA 4Y6WA 1WW3A 2PZIA 4GYYA 4RG6A 5DBKA 3MS4A 5KJKA 4BFCA 6GPBA 1NZFA 1HXIA 2WPVA 1YA0A 3EBPA 1B4DA 3QWWA 2VGYA 1Y8ZA 1P5QA 4RIGA 2X0DA 3OKAA 1NOJA 3QKWA 2JZCA 1AXRA 4BQIA 3HBMA 1P4JA 1E1YA 5JJ7A 5G04C 2FF4A 3MS2A 3MTAA 1WUTA 9GPBA 1YGPA 3QOUA 3Q3IA 4F96A 2ACWA 5HXAA 4MRAA 5GPBA 3EDTB 3KD7A 4BWRA 5BW8C 3IAAA 4JA9A 4BT9A 3S0JA 4RIEA
chains in the Genus database with same CATH superfamily
1NFIE 1LTQA 4F3CA 3DZCA 3D1LA 1M34E 1QPBA 1XKXA 4HJRA 4OUKX 2J3EA 4HTFA 4HFMA 5K51A 1RM0A 3GO4A 2P9CA 2NTVA 2FW0A 4N0MA 3PHBE 4RDXA 1EFHA 1K4KA 4J7CA 4K0RA 3UG7A 5J4YA 2IYNA 3TZ6A 3ZD7A 5JC8A 1DXHA 4X0EA 2WB2A 4MV4A 4P9NA 2VQ2A 5JSHA 1FS4A 3X1WA 1KOLA 3TL6A 4G8JA 4G0OA 1WPRA 2J7KA 4H7XA 2XT6A 3LUPA 3N58A 2DVWA 2ECPA 3GGGA 4MDHA 4ZT6A 3HZHA 1OZAA 1KYWA 1I1NA 1PNQA 3AM3A 4XH9B 3COSA 3PNTB 3L7YA 4EIWA 3NTXA 2Z2KA 4NV3A 4DK5A 1PJ8A 4DA9A 4U8VD 4EG0A 4YDSA 1EX9A 3FD8A 1F4PA 2VTKA 3C7KA 5ICGA 3CFYA 4DAEA 1BQEA 3OWHA 3O4IA 5TV2A 2VPYA 1GKLA 1LW7A 4PG7A 3WIEA 5AHKA 1N2JA 1T0IA 1MAUA 1QZTA 1CYEA 2CUKA 2VP3A 2P1RA 4HAVA 4LJSA 1USIA 1ZJJA 4D10C 4P3NA 5IAGA 3WWPA 4ANFA 4DIDA 3CHQA 1N3IA 1QH0A 1U7WA 3O2NA 5AO9A 5HZHA 2GJAA 3F3KA 2V4LA 2WSYB 4QEDA 3R6LA 3WRXC 2RGDA 2QV0A 2IYVA 3H5RA 2D0PB 4G84A 3IAUA 5EZYA 1UPBA 3W5BA 3O9MA 1AC5A 1XHEA 4GE3A 3F73A 3HN7A 1UC5B 4KLRA 4HYEA 1RC0A 4WAUA 3AHGA 4GOJA 4H0FA 2IPOA 2QUJA 2EKBA 1ZMRA 2HGSA 3ITNA 4GECA 1JAIA 1NRJB 5KOHA 4LVNA 2F43B 3LDUA 3N0TA 1CDEA 1R7RA 1U3TA 2X5OA 4WT7A 4KN5A 5BXYA 1E6MA 2NM0A 4OB8A 1H22A 3D6JA 5BXUA 3OPXA 1E5QA 4PS0A 4UMVA 3EU9A 1XTVA 3C4VA 1IEVA 1R0RE 1TKBA 5CW1A 3UENA 1A5AB 4A6DA 5IW8A 3SEFA 4HXEB 2SKCA 1SUCA 3WISA 4MKFA 2RKKA 1EGAA 1V8DA 1AWCB 3K1YA 4QJ4A 5CHYA 3VVMA 1O4WA 1RLUA 3N3AC 3O93A 3LVRE 3FF4A 3LS8A 1EVZA 3HA3A 1RAAA 1IUOA 2C8VA 4LRXA 4KZPA 4P34A 4DMKA 4EMSA 4E5KA 3O48A 2XT9A 1ZAKA 7REQA 5CG2A 4WGGA 4CGWA 1BYUA 1G4HA 1NBAA 5B4UA 1N6RA 4BATA 3DD5A 2JGDA 4L8YA 5BSRA 5IBCA 5IMBA 4ZV9A 5EIHA 4BQOA 3CRVA 4JLDA 1OH7A 1XJQA 3OZVA 1PWHA 3DOIA 3EG9A 3LQ2A 4ZARA 1IQUA 5AQBA 1BROA 1GA6A 2RHBA 1A77A 3E9CA 3YASA 4PFJA 3DAPA 5BVHA 5B1EA 1AJEA 3E3OA 4V2UA 2G0AA 1FP6A 3NYRA 4LX8A 1QTNA 2ZBGA 5I9SA 5IJ0A 1TZ2A 3H11B 3TNFA 2VSOE 2AXPA 1NM5A 3WWCA 1XC7A 3P0JA 4X85A 5JD5A 3F2IA 3VFDA 5AM3A 2OZEA 1SVIA 3ZK8A 4ZCIA 4JI5B 2RGUA 4EKGA 2JA2A 3HB9A 1DFGA 3IEUA 3QE3A 3HM9A 2FJPA 1DWPA 1Q0LA 2VDWB 3KEQA 2H2WA 4JUDX 3T12A 2ZAMA 3KOMA 1A2BA 1WAMA 2NU8B 3ZVKA 4GHWA 2FK8A 3CZ4A 3TBHA 2X9VA 1CRZA 1AU9A 2A3RA 2QN2A 1SU4A 1F7VA 1LZKA 3FFAA 4RE6A 2H4HA 2NNWB 2EIJE 4FGJA 3COJA 5I7UA 2J9YB 3HYTA 4G5RA 2A0YA 2A1UB 3OQJA 2Q0XA 4UHHA 1MRNA 1XELA 4EL0A 5JECA 2H6GA 3GEGA 3TLJA 1FTSA 1Q1GA 3QMWA 3VNQA 1NVXQ 4HH4A 3GL9A 3QV1A 4FYYA 4JC8A 1Z07A 3GFTA 4LG1A 4F1WA 3ZJVA 3FYSA 1SQ5A 4L5JA 2XUQA 4B35A 2GF0A 4BECA 1ZBDA 4IFIA 1EK5A 3T8MA 4LDNA 2RG7A 2O8FA 5MN6A 4PSCA 4WOJA 2KWIA 3L6EA 5CFMA 1XNQB 2FP4A 5A6SA 3OAAA 4DDUA 5F21A 2VNSA 4M0UA 4JP2A 3TOXA 4MUHA 5JSZB 2KZTB 2ONZA 1X80A 2IE0A 2PGNA 3CNOA 2UYGA 4I9HA 2Z9BA 4HDSA 2B35A 4Z99A 5ALPA 1GTRA 1M9NA 2I3BA 1JEEA 1YRYE 2JVJA 2WP8J 3FJOA 4IIGA 2KXPC 3G7UA 4ZT5A 4J0DA 1ZW1A 2BPOA 5BXOA 4PR3A 2ZIWB 1NG1A 3QE2A 4EHLA 5A02A 2VF7A 3OC6A 3N2GB 4PSVA 2A9VA 2M1ZA 1E2KA 3OZFA 1G19A 5EWLA 4YRZA 2F90A 3PJDA 4JLUA 3WXMA 5B3JC 4EDHA 1KFBB 3B85A 1J09A 3CW2A 3NG1A 4EYSA 4YLYA 4OXXA 3WLHA 5KVCA 3D8NA 3PLRA 1NQ5A 3PP8A 2CHUA 3GLFA 3VHQA 2QD4A 3AK4A 4EZEA 1Q3TA 2FJDB 2RSLA 4YAEA 3ROZA 1L9XA 2WIBA 3SY8A 5LPNA 2IHZA 4LY0A 1XDSA 4PINA 3FTWA 1APBA 1JHXA 3B1JA 3B38A 3BZWA 1TQ6A 4R1LA 4Y9RA 2QG4A 4A63B 3FTNA 4LX0A 4XI0A 3DQZA 4XXHA 4ES6A 1LWOA 3IT0A 3T06B 3WTCA 3PZ3A 4ITVA 5A1JA 1YKFA 1W34A 3EEIA 3FOAA 4DEVA 3BT7A 2VPPA 3I04A 3RW9A 4XVQA 1IHGA 4UNQA 3IRVA 1CHDA 4A9AA 4GDFA 3C16C 1ZIYA 1NHWA 4NJMB 4R41A 5G1OA 4EUNA 4EHFA 1H8ED 4PZ9A 3QIVA 4LIPD 1U2RA 3SFTA 3U60B 4GPKA 5CLQA 1IZ9A 4LV5B 3RVLA 5B3LA 3UPTA 3WLLA 2K6GA 2FQWA 2ZJ0A 4QPNA 1CZOA 3ZYZA 5SY9A 3ELBA 1ZIDA 1WUKS 3L4EA 1X38A 4EL5A 1INZA 5JADA 1C2YA 5B3SE 4F04A 3RWOA 1JSCA 2IU1A 4ZQEA 4QJBA 3VNUA 4V0MA 1RQRA 2C4HA 2HXSA 4G4IA 2HJVA 2X4IA 2DBRA 1PJTA 1V4VA 2AN1A 4KXNA 4U9UA 2DB3A 4B0PA 5A5VA 1UK6A 1LNQA 3OCYA 5JLAA 3DJFA 4I55B 2ZI5A 3EUAA 1G9XA 1TZKA 4Q00A 4TTJA 3HDVA 2V97A 4W82A 1V11A 4V24A 3VNAA 4B4UA 3DTVA 4BMPB 4QZVA 1PV4A 3DMHA 3GV0A 4TXLA 3MELA 3UMSA 1TYCA 3R75A 2WYVA 3Q6NA 1ZESA 4LY6A 4NMWA 4BNZA 5L3VA 3DUFB 2WSMA 1Z0IA 4HB3A 4DI4A 5IYZB 1N3BA 1SVNA 1PP4A 1EXDA 1LI4A 4JSTA 2GZMA 2A5YB 2XLCA 3MGKA 2CLLB 2FPWA 4N01A 2ODNA 3I09A 2JAUA 4G6ZA 3OQVA 4INAA 4N0PA 1NKVA 3BGIA 3DBIA 4BGEA 4OVVA 3FHEA 2B0OE 2Y71A 1OAOA 3KIPA 2DSTA 1RNLA 2O8VA 4NZNA 3B6IA 4IGEA 4E2ZA 4EYOA 3C98A 2FI1A 3AP1A 2W4IA 4WLUA 3TMKA 1AG9A 3TXYA 3WK9A 1YO6A 1NNSA 1ZN2A 3A6ZA 1RPNA 1A9SA 1GUFA 2OHVA 4BNMA 4N5LA 4EUSA 1A17A 4GP7A 3LCRA 2P11A 3ZIAD 1BLXB 3GDWA 3T34A 4R8KA 4CEJB 2CL6X 1GOTA 4YV1A 4JJKA 4J6IA 1Z33A 2V96A 1KEZA 5DXAA 4LJ7A 4QGAA 5FTWA 4GTMA 4LFAB 3KB8A 3LKUA 4U0SA 4CZ2D 1T0HB 2IDJA 3WYCA 4BZWA 4TMYA 4CKWA 1C1DB 3KXPA 2GERA 3LT4A 4GQIA 4M0CA 3TNYA 3H5WA 1WY7A 1PGPA 4EGAA 2WUGA 3TB6A 3EUVA 1KKLA 3OPYA 4EG8A 2PHZA 3FA2A 4PNZA 1OTYA 4RABA 5KDLA 4PX2A 4R1QA 1H6DA 4WECA 1QYVA 3ZQ4A 3MHTA 2SNIE 1IHOA 2IHNA 1GCUA 4IOMA 1UMKA 2OG2A 3Q9UC 3RUFA 4K5QA 2DGDA 5JWRA 4DNPA 1QHHA 4Z6KA 1Y8QB 4X3PA 4CETA 1J7KA 1KPSB 1D9XA 4N7MA 4Z4GA 1X80B 1NIJA 2O48X 3DAOA 4FNMA 4PZCA 2OFPA 1FVXA 4QUJA 3QY9A 4JX9A 3A6GA 1M1XB 1UMDB 2KJQA 3HU3A 1C7JA 5SZIA 2D4AA 2JLCA 2PMCA 1QRDA 3K7EA 3TVDA 2AEEA 1NNUA 2A1TR 5KMGB 5AR1A 4O08A 3I4CA 5K0BA 3UJ3X 4QQKA 2ZSJA 1F4LA 5C7LO 4IVQA 1JG1A 4BAZA 1E6KA 1MJGA 1C0LA 1E59A 2MDTA 3WZMA 3I9MA 4IL5A 3ZHOA 1AUPA 4FUTA 1JJBA 1TEVA 4AKEA 5JNTA 3AEUB 3CKKA 1J5PA 3VTFA 1CZHA 2AG6A 4U5XA 3UAXA 1G6Q1 2Q2NA 3JD3A 4BTAA 2GHTA 4IXNA 2FJAB 3KYDA 4Y8VA 2G1UA 2ORYA 4EGSA 4MB2A 3WADA 1TMOA 3N7UA 3MX3A 4M38A 3UBMA 2LDXA 2YYZA 2VCYA 2TSYB 3GLQA 3NHPA 4M0KA 2WDZA 2YWRA 5GINE 2C2GA 2IF0A 5FOTA 2AZ4A 3T5DA 4DR2B 1KOFA 4EPTA 2GBCA 1XD9A 1O2DA 4BLTA 4MKXA 4KMSA 2GGFA 1WO8A 3JQ9C 3L41A 1U1IA 1J06A 2VUSA 3EIUA 4IUDS 3RJZA 2OD2A 2GXUA 2ORWA 1OKKD 2HT6A 1A5ZA 4XZ3A 3UWKA 1AV7A 2CXNA 3VU9B 3LBHA 1XTKA 3P2JA 4C4XA 2CFIA 4I4NA 4RTNA 1FFSA 3EZ2A 5ENSD 1FY2A 4FIDA 1YS7A 3ASUA 1ZSNA 1E9CA 1T3TA 2W9XA 3TYXA 1QO7A 1GEEA 1EJ0A 4WUYA 1LPOA 1TEHA 1ZXXA 2X3YA 3SC6A 4HLNA 3VKFA 2GCOA 1WDWB 1MB4A 2FSVA 4JT4A 1GPAA 4UDYX 4Q1FA 1HLPA 5JI3E 1KEKA 1EUCB 3TWWA 1T9ZA 1UODA 1YB5A 2C7GA 2C2WA 1N2CE 5AXBA 3ZNPA 2ZTHA 4H7HA 4XEHA 2QBYA 3ND5A 4DSUA 1QMGA 1PQYA 5FV7A 4B6QA 2AFIA 4O4HB 4KRXA 4OXRA 4XQ9A 4C2AA 4ABNA 2UXBB 3PZ4A 1GG9A 4UE2A 1EHIA 4GPEA 4UU7A 3JCZA 5DBIA 1FYEA 1ZW6A 3B3FA 5E7JA 1C4WA 3DNFA 2Y2UA 4FEYA 5C1OA 4C2BA 1ICEA 2YWFA 1MOZA 2Q46A 4HY3A 1PJ4A 3PQ3A 3ZUGA 3W5VA 4B3MB 2H9YA 3Q7AA 1ITZA 4XYGA 2OKGA 2VHXA 1JYFA 5EJAA 4D56A 2ZIAA 3ZCTA 2EERA 5AENA 1H85A 2X76A 1P1FA 1NW9B 3BJIC 2CFZA 3W1WA 2GFHA 2PKWA 3R3JA 3DZGA 5J2UB 3UV6A 3WC4A 2H1SA 3WLFA 4OI4A 4DR7B 2QUAA 1GQRA 1PEYA 4KH1A 1BDMA 3IEKA 4HGPA 4MW0A 2OFWA 4QEKA 2AOVA 2WWIA 1ZC3A 4DJTA 1U63A 1E4EB 1SWWA 1X7WA 10MHA 4PC7A 1Z56C 1Z12A 1TU4A 2C2HA 1WUYA 1WBJB 1QOZA 5BRNA 3EIQA 3OTHA 5ARGA 1OXJA 3GZ4A 2FDCA 1JQAA 3Q3HA 1CR1A 5ALIA 2RB4A 2ZE7A 1T4DA 2I78A 4Z2AA 1X9HA 4C76A 3GRPA 1LPSA 4YIKA 3CS3A 4IP0A 5DTQA 2UDPA 4GUDA 3X2QE 5FWXB 5FYQA 4E1VA 5BSGA 3BRCA 2A5UA 2R60A 1XNRB 2VSXE 2J3DA 2AI2A 1MO2A 1FFEA 1FTGA 5JXJA 1RCFA 1WXFA 2XQVA 3RSEG 3KXDA 4IVPA 5LQJA 3ZD6A 2PWPA 3CZQA 4DL9A 4US2R 1E7MA 2E4WA 3JX9A 5KCZA 1I0ZA 3K71B 1I3KA 1QVWA 4HAIA 3ZHTA 4DX7D 3G9UA 3C6XA 1JWAB 3Q10A 2ILVA 1K6MA 4I6EA 5ED4A 2Y27A 1VLVA 2R5WA 5TS2A 3WZLA 1ZUD1 2O9JA 1BGWA 2BKLA 4CLXA 6CHYA 3G2KA 1AHPA 3PGVA 2X4GA 3KM0A 3ZGQA 1H94A 1VE1A 3M9WA 1YDGA 3QI7A 3P45A 4G07A 4UVDA 3BHNA 4HQNA 1PSZA 2BKKB 4JI3B 5I4CA 1IM2A 5TPWA 3DHNA 4ZQHA 3ZW9A 3JXEA 1ZO8A 3HMKA 3CTMA 3BXFA 2GO7A 4HKTA 1Z6TA 4IGFA 5BXQC 2YWHA 2DF8A 2F1RA 1A3CA 3SCZA 2HQ1A 3QTBA 3QUAA 3IV6A 3BL8A 6GPBA 2XOXA 1FRQA 4W7SA 2ZKLA 3G0HA 1QYCA 2VF8A 1HU3A 1XTZA 5KHAA 1SXJB 1P5QA 1U7IA 1XSEA 5TARA 1U4NA 3H0EA 3ROEA 3U64A 2WBLC 3GJQA 3OKAA 1KQOA 4IIXA 4PLGA 3ZU5A 5BSWA 3X1JA 1Y9JA 3GP3A 1WETA 1ARZA 1F2TA 3DS8A 4FA6A 4K9RA 1UKBA 2FPIB 4OREX 6Q21A 2X3MA 3KT3A 5ALGA 4DUGA 4KJZA 4QFVA 1HDCA 5F3RA 5CT8A 4CKWB 1GNSA 2H2DA 5JQWA 1V9SA 5GONA 2IXEA 2EJVA 1OI3A 2UVDA 4UPEA 4YRAA 4O1HA 4Q21A 3NOGD 4RO0A 2XWJI 2QL7A 2R9VA 2CHZA 3N7AA 4WFQA 3S0JA 2HA5A 3ISJA 3U37A 4PZDA 4FMPA 5FEMA 3OZBA 4ZI7B 1J2JA 4E7PA 1KSJA 1FX0B 1GZ7A 2OAGA 3GZNA 3FTXA 1EZ1A 2YWDA 2C42A 2NTNA 3PXXA 4JLAA 3LXXA 4QVGA 2PWAA 2AFIB 3RQIA 4EBBA 1IQ0A 2IZ5A 4NDAA 1DFHA 4CTJA 3LECA 3JQ8A 1XTQA 4F2HA 3WMEA 3A8TA 2XDQA 4XGNA 4M1KA 4PAQA 3MWKA 2YWXA 1U0HC 1P2GA 4Y2YA 4DA8A 3LT2A 4IDDA 1UMDA 4QT4A 4NOMA 2P78A 3DCIA 4KE9A 4OMDA 2BRUC 4M55A 4A2PA 1NSTA 2GAJA 5HJ7A 2OBFA 3NLLA 1GXSB 2P0YA 3FYDA 1Q19A 5F5LA 2JA1A 3GRCA 3FM9A 2EKPA 4CXMA 4JUBA 3GH1A 5JFTA 1N9AA 2EKQA 2EILE 1I0IA 2GCNA 2QR2A 4KIFA 2POQX 4Q3OA 5LBIA 4DF3A 5CDGA 5CHEE 1HDOA 3DYVA 3IBSA 4IOLA 1TFUA 2VDLB 2NAFA 1IXVA 4F5ZA 3IEPA 4KQCA 3JVUA 3D02A 1EJ6A 4RE5A 1Z16A 2ZTUA 3EOBI 2QJFA 1U0JA 1Y9EA 2AB0A 4QOSA 5GP1A 4V1CA 4NENA 4LJRA 4G3XA 2GPTA 3VTAA 1E4EA 1LLCA 1T5SA 2VVTA 3M4NA 2HYZA 3MJDA 5L7YA 1DINA 1GA4A 5HDQA 4PICA 2W2MA 3BMOB 3CF4G 5FLEX 3OCJA 4ZPXA 5KX5F 1J9EA 3ZD8A 4P4SA 3NHUA 4ZQFA 1TAGA 2J5QA 2LKDA 4D42A 5KTSA 1OCZE 1YSCA 2ZJ8A 1WNTA 4A73A 5IVHA 2VSQA 1FUIA 2VNKA 5FNVA 3N8HA 2RE8A 4BBPA 5DHFA 3C3PA 3L92A 1NV9A 3IE2A 4MRNA 2W6JA 4WINA 1IWPB 4M7WA 1S89A 4ZU6X 1BH2A 1D4ZA 3APFA 2YOFA 1JSXA 4ZEOA 3T99A 1UKVY 3H5VA 3ZYMA 3JALB 4HZUA 3UOGA 3EG5A 2CKMA 4S1TA 4R0MA 2ZYTX 1IJFA 4KO4S 3OVMA 2B0JA 1XHFA 3P9NA 3ZE2B 3WJAA 4WBNF 3O75A 5JI2E 1A4XA 3RIMA 3PCRB 2XGMA 1WJGA 2JAPA 3I9FA 1AKUA 4ND8A 2FCAA 4BUCA 3FETA 5I47A 1Z4PX 2IK8A 3R24A 4WDQA 2PH7A 2YCBA 4F7DA 3PC4A 5EPEA 3JYOA 3K8OE 2CY0A 4N3CA 3C3RA 1B8OA 3BB1A 4MKIA 4PLVA 3JW8A 4WCVA 5A9RA 1C3XA 1NW8A 1V71A 1PZMA 4NQ0A 2QX4A 4O4JF 1LSUA 2X1HA 5B36A 2GPNA 2DLNA 3O4JA 4DLWA 4CDMA 1CJUC 1L8QA 1NXSA 1SCUB 2WAYA 2XB8A 1DDIA 4NJEB 1GFIA 2BY4A 4PEVA 4PM4A 2G0NA 5REQA 3GLIA 4AKIA 1E1NA 4IFBA 4TGLA 3RSFA 1SURA 3V3TA 4UVIA 5C51B 1R5BA 1A9RA 2HHJA 4GBGA 1C3VA 2HJGA 2WAXA 3EXHC 4GPTA 3ZS9A 4DUIA 4BO1A 4BASA 3SQNA 4XWYA 4Y6CA 4DDTA 4F71A 1M8PA 1SEVA 2OQIA 1ZISA 1T5HX 1KSGA 2YH2A 3KS2A 4OQDA 4ZZ3A 2QDXA 3SZ7A 3UM3A 1RJEA 4YMSA 4KLZA 3TSYA 2W6MA 1AVTA 4V3BA 4E51A 5BRJA 2HK7A 2IV3A 1I6KA 2UYCA 4RANA 5I9NA 4N5NA 1QH8A 3R0VA 4TMFA 3ND8A 3V8RA 3COWA 2IOYA 1TYQG 4GIBA 5E0KB 3UK7A 3ZGVA 2C7BA 1AF7A 2B4QA 2BMEA 5CFRA 2N42A 2R48A 3HSKA 3UJCA 4WK2B 2PX3A 3QW2A 2WJPA 1BYIA 4KYUA 4L5IA 3RSSA 1OLXB 2RC6A 5L45A 4DKJA 3SJZA 3PE6A 2E87A 4BV9A 5DTIA 4QU8A 1DBVO 1GZSA 4BWGA 1I5RA 4PGGA 4BNGA 1RHUA 5CDYA 2G08A 2DH5A 1YRBA 3OO1A 1Y5IA 5ECGC 5LFAA 1CUCA 1JLHA 1QC5A 1WPQA 1Z73A 4G56A 2GVDC 4HPJB 9ATCA 1DWOA 1FTYA 1ZKDA 3ROKA 1VL2A 2Z4SA 4EJSA 5C8YF 2WT4A 3AR5A 1FNMA 4EVIA 2JLUA 1T2DA 5FO0A 1KVQA 3L8YA 1T6NA 2PJZA 2VJAA 3CH7A 3HI6A 4GP9A 4OGKA 3V48A 2ZUEA 1JEDA 1C9MA 1U3GA 5FJIA 1IH8A 4G8KA 1HEYA 4QDZA 5A4JA 2RHTA 4JL8A 5C53B 1JHQA 1VJRA 3FGNA 4XWOA 1EXWA 1HMPA 4DJDC 3VJKA 1CUGA 4FGKA 5BN4A 1T4MA 3KJQA 1LPPA 2WXJA 4P08A 3BK2A 5GJWC 3U48A 4DJJA 2RBKA 4I14A 1V1MB 4YT4A 2X5KO 3BORA 4EO9A 2IYPA 4RPGA 4D9GA 2HL6A 1SEPA 3W1EA 1ZICA 2SKEA 3OLWA 4TKUA 5DI9A 4U04A 4LI3X 4R9UC 1YL6A 2FDXA 3ULQA 2RH8A 2ZBPA 3LNCA 3ZDRA 3OPQA 3G1UA 4CMCA 5IUNC 1WU7A 2Q3DA 1M76A 2G4VA 4TMZA 2QI9F 3HYCA 1M0EA 4REQB 2WMOA 3BHIA 3LDAA 4CGYA 2DT5A 1TEZA 1B8NA 4U0UA 4G8BA 4TMKA 1EVKA 4DVGA 2YY5A 2QTNA 3PHJA 4KR0A 4H1UA 1PR5A 1TNBA 1VIDA 3OZEA 1Z0JA 5E6UA 3B5EA 1QSGA 2PD4A 3I6MA 4P1ZA 2GLXA 3GD7A 3A6LA 5ECDA 4ZAFA 1Z18A 2QZ9A 5FJJA 2HU7A 2I54A 1VSBA 4KACA 4MH0R 4C48B 3JWPA 2OMKA 2BIFA 2DFKB 2O1SA 2ZEJA 4PG6A 2XXAA 1VMIA 1PSDA 1TK2A 3KQYA 4CUJA 4I1UA 2QX8A 1QJCA 1OU4A 4WNAA 3SIRA 3PHCA 2IZ6A 1KL7A 1ZN7A 2QLLA 2XCCA 4GYJA 4IX1A 1SBYA 5CPFA 5CYOA 5AXAA 5E6RB 3SD7A 3FU5A 3L0IB 1BKSB 3CNHA 3UT4A 4BDSA 5GMOA 1XJ0A 4FEGA 1B16A 3SZOA 4B2LA 4FLFA 2PUWA 4EG1A 1YU6A 3FVWA 1NUSA 2GFQA 3H3JA 5H82A 1MAAA 4BQQA 2ATVA 4TV8A 4ZKDA 4DEYA 4BMYA 2X9GA 4OYSA 4N0QA 1D2EA 1S2GA 2D74A 4CI0B 3EHEA 2E49A 1QKIA 2GPJA 5C8YA 3WLJA 4ZYZA 3LCAA 2CVHA 3NASA 5AT1A 3S68A 3LF1A 1UJ2A 4DV7B 3QEJA 3DZFA 3FCUB 3I1YA 3CWCA 4BJ1A 4EDFA 1OFTA 1N8NA 1T9DA 2DAPA 2GETA 3LD9A 4BNJA 1LS6A 4Z1OA 5CEFA 1P4AA 3UJPA 2KB0A 4BOYA 2YVKA 3EVBA 3JQ9A 5AHRA 5L8VA 3N2KB 1F17A 1JJAA 2WUFA 3EHMA 3AB8A 4XE0A 1GV1A 1QGUA 1ODFA 4IM7A 5IASA 1W36D 2FFBA 4TKVA 1EUQA 5E6SB 1WXGA 4TUYB 2VT2A 4G9BA 3KL2A 1XRJA 2FG5A 5EXEA 2A67A 1ZVMA 5CH8A 3TTSA 1I9CA 3EXAA 1ADYA 1FDVA 2A3NA 3FTVA 2GZHA 2X14A 4O4IA 2RBEA 1X94A 4WESB 5IM5A 1A5SB 5IEJA 4RMHA 3LQRA 1P1JA 3MOIA 1YZLA 3IKOB 2NO5A 1T6XA 2P69A 2XITA 3GRKA 3NHZA 1PUJA 1WZUA 2ZK7A 1LKZA 3VKHA 2QIOA 4REMA 5C4IA 3P1UA 3B36A 4S1NA 1K5DA 1PCXA 1W2HA 1A5EA 2AXZA 2OZPA 3GLVA 3NH6A 4GXQA 4Q93A 4B2IA 1OT5A 1M8GA 3EHDA 2D7CA 4YDRA 5EFZA 4XVCA 1TM7E 2YINA 3WYBA 3R0QA 3I12A 3W8FA 5HWSA 4W8OA 5I7OA 3OIDA 1ILEA 1PJQA 1Z2NX 3FCAA 4BTEA 1AB6A 1D2HA 2FN7A 1N0IA 1V2GA 5JCJD 1NRXA 1COWA 1Z5VA 3CIFA 3RS5A 3C7TA 1RBYA 3TVYA 2C61A 1RXIA 4C0MA 3O4FA 2NVUA 3BCHA 1VL5A 4ZAVA 1JHPA 1C4OA 2AR0A 2EZ8A 3QU4A 4KV9A 1RKBA 3DE6X 5DJ5A 3K70B 4DCGA 4UNPA 1FJ2A 1TADA 4URKA 1S3GA 5FPSA 4A23A 3ZHQA 1F14A 2C9DA 121PA 2R8RA 2O5CA 1JXAA 1RKUA 1ABEA 2NZJA 1SA4A 2ZVJA 3DKPA 3GVPA 4Y7CA 5EMKA 3W8EA 2BUCA 1N4DA 3GBVA 3M6VA 3DBHB 1OYYA 3KJIA 3NTQA 1GP2A 5FBKA 1OASA 3HB7A 3A1WA 3ORHA 4H3SA 2IEJA 1R8QA 3LDHA 2BZSA 2PA0A 1TUEA 2R1TA 3FUXA 3EVTA 4O29A 1SVOA 1VTKA 5A7GA 2R7KA 2NXPA 1C4XA 3Q7IA 1TDJA 1FFHA 1RBMA 1XNFA 1WV0A 2NO1A 1Z4OA 3PXCX 3UMBA 1GD1O 4RF2A 3S2UA 3U9SA 1SC4A 3AOEC 2PFGA 4CMGA 1AH2A 4W6ZA 4S3MA 1BXRB 1C1YA 4KLCA 4XD7A 4CHGA 2J48A 3I01A 3FUIA 4MUAA 4S05A 4NAHA 2V7EA 4K3VA 1JLKA 2AEFA 3U17A 1R0LA 3OT1A 2IIBA 1UOOA 2XENA 3LNTA 1NLMA 4H16A 3F4LA 4LOHA 4BVGA 2XPYA 3N2YA 3UA4A 3J81A 1U28A 1WZIA 5F12A 4YT5A 3WICA 4BXOB 3IEMA 3OIFA 4AWAA 4G0NA 4GWLA 3AJEA 3CK9A 4ZAYA 4BO3A 5B2EA 3WA7A 1RZRD 2A0FA 2I5PO 2ZR8A 1M1YE 4WVFA 3RKUA 3IOBA 1PEAA 3GB9A 1TN6A 5K03A 2XOKA 5C4GB 3TLBA 1WSAA 4GYKA 2CB0A 3VRHA 5KPDA 2Q7FA 3WLMA 2GEFA 3NANA 1KPGA 1R0SA 1YAJA 2WUWE 1FNSA 1S4QA 3LU1A 1D2CA 2FTKE 4RPIA 2QRUA 4Q4AB 3CQGB 1Q15A 2F1HA 3GG2A 4QUDA 3ABME 3RC1A 4C3OB 3SXUB 2JIMA 3MMPA 2OG1A 4N6OA 4IDHA 4Q3LA 1FVFA 3AERA 1C41A 3L5OA 4RDCA 4EHBA 5EJ5A 4R71A 4D97A 1P3JA 5LMZA 1YZKA 1J8QA 2Z1MA 4ZYLA 3VPAA 4PANA 1DZIA 4U7GA 1L4BA 1JG4A 1DPGA 1HQKA 1VECA 4FI3F 2F3TA 2VDRB 4RXTA 1ZUNB 1M72A 4ZO4A 1W7AA 3Q7FA 4JBNA 3NHJA 3TRFA 4HORA 4X64B 4XKCA 3JAMA 2BTOA 4XKBA 1HDXA 5C52B 2QTWB 4KHPB 1JYEA 2CZCA 4YVFA 1AQJA 4TKVB 4DNFA 1H05A 1ZJYA 2XAAA 4C30A 1V48A 2CXRA 5KIAA 1RW4A 4ZOLA 3QX3A 4U3JA 1P0PA 3MJRA 3W8NA 2V3WA 4NCAA 1DKOA 3DCNA 2X7HA 2ASVA 4NBTA 1U9CA 4CKYA 4WOBA 5ALSA 4REQA 3T9EA 4DCCA 4LTNA 3CVVA 5LQNA 1N9ZA 4C21A 1ABBA 4I66A 3FR7A 1XD8A 5EVJA 5TX7A 2PZAA 3R7AA 1QK3A 1YR2A 2XUDA 4YNDA 4AMVA 1W88B 3GW8A 3ECSA 4YASA 1TAUA 2EG5A 4OSEA 5JJIA 3LMKA 3VPFA 3MCVA 4RDIA 3ZU2A 4A27A 4D6XA 4WCFA 2PBZA 1Y9AA 4L08A 2OXTA 1EX1A 3B89A 1K1BA 4OBXA 5FUBA 3SQDA 3DE7X 1QO0A 2CFTA 5TLSA 4MICA 5C80A 5JAZA 4R6WA 5EZ5A 3AO0B 4UUNA 2CCJA 3ACDA 3KTAA 1QK4A 2HYDA 5TJHA 3HCEA 3VXKA 4OFXA 4AZSA 4MKGA 1AA6A 1JSRA 1IJBA 1TYEB 2VZ8A 3ZU3A 3DC7A 1DVPA 2IYTA 2QUHA 3JD2A 4BEPA 2EL7A 3W3AD 5J2TA 3GQVA 5ALLA 1W87A 5DX8A 1V6SA 1D1QA 1JDSA 3RVMA 4AO7A 1YCHA 4KHZA 4P31A 4XFKA 3RYFA 1OH5A 2C20A 1T8WA 2AYYA 1JFRA 2NUTA 4MB0A 1JHRA 5KYYA 5M72A 1ZUIA 1POXA 3NFRA 3PQDA 4EJFA 1DC2A 1VJDA 4PLWA 5A3VA 3RVRA 3PWSA 1KO8A 1LF8A 4OFWA 4DE5A 4JB0A 4F5YA 1SKUA 2ZSDA 3IMEA 4F4HA 2BMJA 3I9NA 1QV9A 1H2UA 1NYLA 3M6IA 3A9RA 3OFNA 1Y6IA 1DS6A 3R4CA 4Z4QA 3STYA 2FLVA 4HBDA 2DT8A 4WN9A 1OX4A 2BKXA 2P0EA 4IOJA 4RH0A 1ESCA 5HI7A 1DFIA 1S2LA 1PZXA 2XCUA 3D3WB 3FMIA 3HWWA 3K9BA 2C07A 1ST2A 4OX9Y 4YXFA 3WWZA 4XTRA 4ZREA 4P4GA 3BC1A 4NZOA 1LRKA 3EVDA 4R0VA 5CIYA 2HJWA 3FUHA 2I66A 2WF5A 2PR7A 4F3NA 1OILA 4WJKB 3U5TA 4J8SA 4MHSA 5E9WA 2QYTA 1G21E 3VU0A 1QOQB 1QE5A 3HPQA 2VHQA 3DMFA 2O5EA 2ZYDA 4M76B 5E9JA 2G70A 2Q62A 3RF7A 1N7HA 1RRKA 1U0LA 5TT1A 1YMVA 4JBHA 3SJBA 1J70A 4L4ZA 1PDWA 2G04A 4DMGA 3L6DA 4GZMA 3CUEF 3Q6MA 3MXTA 3E33A 5IZ4A 1M34B 1QLJA 4KFUA 1DXYA 2DKNA 1L6RA 4PO8A 5AKIA 3P9KA 3TZKA 2V0NA 3N70A 2XE7A 3ORYA 4W1QA 3QOWA 1G5PA 2PR2A 3MS4A 1VKHA 1EKXA 3MZ0A 1YDFA 3LLSA 3UJAA 1MG0A 1YA0A 3C5WP 2UUCB 4LYEA 2VNAA 2VJBA 1XZKA 2I55A 2A4ZA 2Q27A 3MOGA 4ENSA 4R69A 5J47A 1KY5A 3KSBC 1P61B 2CE2X 2D8AA 2WR8A 4ZFHA 4NPAA 4XLTA 1T8TA 3HBMA 4DLTA 2VDJA 1DGQA 2CF5A 4HNRA 1H69A 1JR3E 1SC3A 2ZYWX 4J0IA 3C6KA 3DT9A 2IWRA 1ZVVA 5JSQA 1PEDA 2ICAA 4PFQA 1UBFA 3WMWA 3E4CA 4JBLA 4LDJA 1GSAA 3AY3A 3R7DA 4KRFA 3T15A 4F84A 1O4VA 1NPDA 1RVV1 2RHDA 1L1EA 4TN5A 2LIPA 1JHMA 5CDFE 3PC8A 1BG6A 4FFBA 2TYSB 4C7OA 5J90A 1F38A 1W5BA 1Z8DA 1NOIA 3MRSA 4NS4A 3R7FA 5DN6A 1Y3FE 3CRMA 4PRZA 1ODIA 2IUUA 4A5SA 4ZHQF 1Q17A 1VSQA 4JP5A 1CXZA 1PKXA 3DMDA 3BMNA 4YJHA 2YFQA 2HRDA 3FAKA 4ABYA 3LK7A 3CN9A 1GDDA 2GCPA 3LQQA 4PQRA 2FR0A 4GDMA 2GBGA 5KB3A 1TJ4A 1WB5A 3RS2A 3B9RA 4HX9A 1NUQA 5KKAA 5KWVA 3WK6A 2WJWA 2WZQA 2B98A 4DKXA 5A4KA 4JXXA 3EVZA 3OOWA 1GVHA 2EFCB 4KQFA 2IS4A 3MYRA 5GWXA 1UK7A 4FFPA 4MQUA 2JI7A 2JASA 1RJDA 1ZM3A 3COPA 3KAJA 4O1IA 2OMEA 1OLUA 4GOLD 4OQQA 4YN3A 4I5IA 1UDAA 1B6RA 4KLAA 4LHVA 5DWQA 3JARB 4ZOAA 2IUSA 3LA8A 3ZCXA 2R6R1 3WQBA 3BSYA 4RVNA 3QU2A 4WNFA 2CLKB 4ZZ2A 2PM6A 4GSLA 2NYJA 5GIPE 2RB5A 4GYWA 3KOXA 1RM3A 5G05C 1EIZA 1MC5A 3OU7A 3K53A 5AIJA 2JD0A 4APOA 1P1KA 2PYDA 2HB6A 1R15A 3BHMA 4KSYA 3ESKA 2O2CA 2XMZA 3USZA 1VMAA 4U2KA 3OXGA 3PFHA 3UCXA 3EHNA 1NI5A 1KVRA 4LC0A 4H18A 2OXRA 1DV2A 2R4TA 1L9KA 2EAUA 4IZIA 3QLUA 3R6TA 2A94A 2OB2A 2YNQA 4K6KA 4ZVQA 4F5WA 3DE4X 3B7BA 1Z0UA 1JHZA 4RVDA 3SNXA 4K1XA 1N6KA 3BRSA 1FUUA 3VKWA 1HL7A 4MR7B 4URFA 4CQMB 1GN8A 3S40A 2P2CP 1NN0A 5FRDA 3C72A 1B3RA 1VL6A 3REGA 3TSZA 3VR1A 4B6JA 1QH1B 1UKAA 1EEXB 1HETA 2AK2A 2EYQA 5IWCA 3D8TA 2LCQA 5KYYB 4AQ7A 4RLQA 3H4VA 3EXIB 1TN8A 5HQ3B 2VP0A 1L1QA 4KPGA 3ZHSA 3WVNA 1KFJB 1SQ6A 2WIAA 1TUIA 2C3OA 3A6FA 3BWBA 3LBNA 4LMRA 3AR8A 2FH5B 4MCAA 4MZDA 5ER9A 1Z5SC 3E3AA 4CL3A 3KHUA 3ML1A 4ETMA 3X1XA 3DNPA 3BB3A 3PNBA 4QUIA 5E2BA 3UUGA 4AZ0B 3OF3A 3W6OA 1YWGO 3EIHA 4K87A 2NXEA 4Q7KA 2O4UX 5H4HA 6YASA 3QARA 4FSHA 5BUCA 1PL7A 4P3PA 1LFDB 3OCCA 4B0OA 3CV0A 1U4OA 2G88A 3APDA 5C5EA 1Z25A 4DJFC 1VMKA 2F43A 4D98A 1HLDA 3P9YA 4DCJA 5DGTA 3ETJA 5C5CA 1NC3A 3AI7A 3ISVA 2XX3A 3CGGA 1MA0A 3TD9A 5B58T 1X7XA 5HILA 4DWWA 3KTAB 4D99A 3U4QA 4EENA 2Y1CA 5K01A 2PUVA 4J90A 3WQRA 4RLSA 1R4NA 5JYEA 2RK4A 4C87A 1GFWA 1Q5PA 2NX2A 1D2RA 2QRMA 3LUBA 4W1PA 4NNOA 3UAGA 1KMHB 3BH7A 4RMGA 4ETNA 5KNBH 2WKWA 3II6X 3FBGA 4AMUA 5FTMA 1QU2A 1H5QA 1SVSA 3AVVA 3HGQA 3P5BA 1YHZA 2PKEA 2RAFA 2PMEA 3RKRA 2BF4A 1BJKA 1MEOA 2EFYA 2Z1DA 4G86A 2G6BA 3DEZA 2WJHA 4TPKA 4C04A 3DWGA 1DQYA 4PBTA 4XR9A 2WHPB 4NE9A 1Z7GA 3MUNA 3OQBA 4JWTA 2QYSA 3WFIA 1AQNA 2IS1A 2I62A 2JCSA 2DUMA 3VTXA 1EU1A 4L1KA 2PUGA 3AEYA 2QAGC 2TMYA 1Z8FA 3ENQA 4TYQA 3BMQA 4E12A 1CJBA 4G4SP 5HDBB 1HOTA 4PLYA 1C4KA 4CCAA 1ZBQA 4Q7EA 4YDYA 1LBQA 1VSTA 2NWQA 2R44A 4H1VA 3NCTA 4KREA 5HQ3A 3NEYA 1FDUA 4NF2A 4RK7A 1LBHA 4DEXA 5JDIA 3ANMA 1X4RA 3KHSA 1ZHOA 3HKBB 2GBLA 2WAAA 2ZM6B 4I1PA 4YP6A 4MDYA 4NZPA 2IXFA 1STOA 1GSIA 3SYNA 3EODA 2GJ4A 3N6VA 1LXCA 3BMNB 4G0UA 1N3LA 3OKPA 1O97C 1UPFA 3E15A 5J2UF 3ZU6A 3I5XA 4F53A 5D5HA 4OBEA 3HEBA 2P75A 5KOIA 1PL8A 2NGRA 3S4YA 1KTIA 1SUFA 1V9CA 2P9EA 5BW6B 2ZUFA 5KOHB 2V8OA 5HE9A 5FUYA 3RJMA 4OYLA 3ANYB 4F4IA 3EOZA 4C7JA 4WWOA 1DT3A 1RAFA 2XQIA 1SULA 3JATB 1SXIA 3OEYA 4FGWA 4YJ2F 2QVLA 2FOIA 1KI4A 3IV0A 1O87A 2CJWA 2DEUA 1YE5A 1CZRA 2YFYA 1CR2A 4HOSA 3AP2A 2WVAA 4QHTA 4TZKA 3CH6A 4FZJA 4W99A 2NXJA 2GAIA 2Q29A 2PD3A 4ZRNA 3U80A 2B1GA 2ZE6A 1HDYA 3TMAA 4RF3A 2W83A 3OJCA 5HCNA 5AM0A 4GTQA 3IVXA 2NO0A 3WGJA 4DDMA 1HZ4A 3KD2A 1P74A 4F46A 2OXEA 2GARA 2FW1A 4NNJA 4ZDWA 3T4EA 4GEGA 2QM7A 1PFGA 4FFMA 3UFXB 4ML3A 1QP0A 2Y66A 4LY3A 2Y1DA 3IQGX 4IO0A 4PYLA 1EE9A 1EFRD 4UBNA 2R85A 1QH1A 1R4AA 3NC0C 1PW7A 1KI8A 4QD3A 4YDHB 2O2EA 5AW5A 3VTKA 1EGVB 1TD9A 3GYXB 1J8VA 3EZGA 4ZT2A 2YNMC 3RRZA 1ZNWA 5DLEA 3MIIA 2W2PA 4QQNA 2CKDA 2OESA 1Q7CA 4BQPA 2PIDA 2A9QA 1ORIA 1OX5A 3ZU7B 1P3DA 2W6OA 3GLHB 2D0DA 5KHLB 9MHTA 4UNSA 3NNNA 2LSUA 2QRNA 2Q28A 2G71A 3G5TA 5GM2A 3AJRA 3WKEA 3SF8B 5C5IA 1T6BY 2POCA 3ICQB 4HWSA 2Z9CA 1W76A 2ZJ7A 2GNPA 4RHFA 4RA6B 5HIIA 3L04A 4AZ0A 2OHIA 4YGXB 4MUEA 2H4FA 4Q1AA 4X91A 3MSCA 1TCCA 1GGFA 2ZWOA 2RH5A 3PRYA 3QW4B 3V2HA 1KFKB 1M8FA 4LJ9A 4R9VA 1O6FA 4EPRA 1Y1TA 3G8YA 1HGXA 4QWWA 3UM2A 3TRIA 2JJ2D 2I80A 4E21A 3CQCB 3FN4A 5I7WA 3NJ4A 3LCVB 1NVKA 1QIGA 2BONA 3F71A 1E4VA 2MINA 3UT5B 1KI2A 4OPMA 4HATA 3ADDA 4JOBA 3NAMA 3EZ6A 2VT3A 1BD8A 3DFFA 4FEEA 4EB8A 1OSNA 2VAXA 3L06A 3IVAA 3PFBA 2VLBA 5ADVA 5GAJA 4WK6A 4ESVA 1WDLA 2ZSIA 3UTDA 2V54A 4BU0A 2XCIA 5CXQA 1P4HA 1A4RA 2WVJA 2ZSEA 3KU4A 2PQRA 5C18A 1YB2A 1P7VA 4BT8A 2IEAA 3GJ6A 3NB2A 2XRFA 3IOCA 1X0VA 2P9JA 3WKCA 2P8SA 3IHYA 4CF7A 1S6YA 3QLVA 3UWMA 1KGDA 1B74A 1V11B 5HJ2A 2PX8A 4EKIA 3C41J 4BZZA 5FL7A 4FN5A 3FNEA 2OEVA 4CKEA 2E5LB 3JV7A 4GMJA 2XB2A 1Z63A 3HJFA 4K6CA 1KP9A 2VXYA 3OX3A 2VIIA 4GUAA 1TAHA 3ZWCA 2PM8A 4Q34A 4FYIA 5HZMA 5IYZA 3BMQB 1P4SA 1C3EA 1J25A 1D4FA 3NXSA 2WM2A 1PR6A 4KIJA 3JRNA 1DUIA 4GLOA 2O59A 4CKCA 1QIMA 2ZJ2A 4AB1A 1ODSA 1SQSA 2DVMA 3UEOA 3R8FA 2AF3C 4PC6A 4CDGA 3DXYA 4B82A 1A2OA 1HO8A 4Z68A 1U31A 2IYLD 1EZZA 4YCBA 3UC9A 1IIBA 2AEJA 3WLPA 5ARCA 3NHSA 3RIBA 1T5TA 1XTPA 3AR3A 5TGZA 4MW2A 3KOWA 3SAJA 4JXZA 3Q5DA 4RDHA 4X1KA 1YHYA 4CUZA 3N2NA 3OG9A 3MTGA 2GHRA 2PJRA 3IV7A 4L23A 1SUDA 4JIGA 3R6GA 4ARIA 4KSCA 5EWMB 4RIHA 1OFUA 1RKQA 3TRJA 4CEJA 3F6BX 4MWEA 3DQPA 2ZT8A 4RPJA 2OQ2A 2IY9A 3R77A 4V1CI 2Q1XA 3E23A 3NWPA 3D3EA 4I8IA 2ZWAA 3DPUA 5FI3A 1E7QA 2IYFA 5BQPA 3AHIA 3LIIA 1JDUA 3FOCA 2ILRA 2IZ0A 1WM5A 4QUKA 3EIWA 1KYTA 2YZMA 4TROA 5EKUA 2CFSA 4OJQA 1OGYA 1WVGA 3BL6A 2REQB 4WZAA 1OVMA 3DH0A 3IB3A 1R2QA 4YUVA 5C3MA 3K6SB 5DNYB 1DAOA 3OFVA 4IHQA 5CJ2A 3OHMA 3AHJA 2CJWB 1HE4A 2GPYA 4EHMA 1L8AA 2WYOA 3GROA 4TLDA 5JDCC 1NVMB 1KPHA 1PZNA 1ZNZA 2JC3A 2YIJA 3G2OA 4Y2SA 1TEXA 5K0CA 3L8EA 1X74A 1P80A 1RYEA 3O03A 5EP3A 2ADOA 5F76A 4W4TA 3UKRG 2VF4X 1PTJC 2FWMX 2P9LG 3L7AA 2J6HA 4GRIA 2FPPA 4PLHA 1XEAA 1UN9A 1N2CB 3CVLA 1R16A 3VHXA 3LHSA 1NJ5A 1GYQA 2RAVA 2OLEA 3K5IA 2QRKA 4KVZA 1DO2A 5G1PA 4IDOA 2C7VA 4ENTA 2AFVA 2L19A 3A05A 3R7QA 3AHCA 1AQLA 3TW4A 2ZZKA 2J07A 1PQ4A 1H6CA 1V0JA 3GLHA 4FBMA 4LYGA 1M5RA 4II2A 5SYNA 3UMJA 1G66A 4OH7A 4P2BA 2ETVA 1S9HA 1MYOA 3L5KA 3W34A 3O1IC 2A7QA 2ZUVA 5EZYB 3MZLB 1N5DA 4B83A 2I2FA 1YQEA 4Y6LA 3RC9A 5BR7A 1Y1PA 2CVPA 2ZYSA 5JJLA 5FIOA 3O6VA 3LH5A 2OHJA 5K3CA 3UAOA 1ONSA 2PXAA 3HN6A 1DC6A 3ROTA 2UVPB 1IQPA 1EINA 2RHWA 1H0RA 1Z7WA 3PVLA 4P3YA 2C94A 5BWOA 1JDBB 2CNLA 4A4DA 5KYTA 4M1TA 5JPIA 3KPUA 3T41A 1EUZA 2UZAA 4PYNA 3SF8A 5J5CA 4C9BA 3JD1A 2FGKA 2HRZA 3BXEA 3V2IA 1NVVR 3NATA 3AOGA 4RJ2A 2LVBA 3HL4A 1C30A 1VGRA 2YN2A 5CT6A 2X6IA 5LYJF 1JWBB 3AL0C 2Q41A 4NHOA 4QSMA 5TB5A 1MTOA 3HR4A 3Q7EA 4FOOA 4M8IA 4E46A 2FB9A 4D4GA 5DMXA 1BE0A 2GILA 1XRPA 2Y67A 3FTUA 4LNBA 4L3OA 4GR5A 3FOEC 1SD1A 1HNNA 4MS3B 2D2EA 1VYVA 4BKPA 3GI1A 4O33A 3SC4A 1X7ZB 4OLFA 5FPYA 5AW3A 2PGLA 4J3FA 5EYPF 2NNLD 4OGGA 2PSEA 4TT3A 1JEYB 3DFIA 3X2FA 5KUTA 4I1RA 1F0NA 1B89A 3FPAA 4PE5B 3SKXA 2X8BA 1KAHA 3HYNA 4HX5A 2JLQA 3C24A 3RUIA 3SFYA 3INYA 2NO4A 5E9QA 3SHFA 3CF0A 3UHPA 3USCS 3U7FB 4B32A 3NDJA 5LNK6 3I72A 2EHJA 5LXTA 5E2AA 3L54A 2BGTA 2H2AA 1C7FA 1FFGA 1HYEA 3ZHXA 1B73A 4CKBA 4ZMSA 3Q4GA 1B41A 1D5WA 1BKYA 1O95D 2Q6KA 1EFAA 1I2ZA 3ANLA 3EGDA 3Q78A 1I24A 2ATCA 1X1DA 4KBGA 4MMYB 4CKEB 3N71A 2FFGA 2BFBB 1LPBB 4Q3AA 4ZODA 4JHRA 5C7IO 1WW8A 4RMNA 3QRWA 1NRWA 1Y3HA 1MAVA 2WIJA 3JPWA 1R6BX 2ZB3A 3EW9A 3NBXX 4HGQA 3MMXA 4JP3A 3KSQA 4O1MA 5AJTA 3SMQA 2WWGA 2W6ID 4UREA 2COUA 2J5BA 5TVGA 4YUZA 4P58A 2CJFA 1GKKA 1W5FA 2EWMA 2GRUA 4D9HA 5JNUA 1W0KA 3CZ5A 3MK31 3L79A 3V4SA 3AMVA 2FHPA 4RA6A 1DXOA 3FPGA 3AEXA 4EB6A 1T43A 1RHJA 5K1ZA 2Q8PA 5ITZB 3EXG2 3HZRA 1KZ1A 3EWSA 5COAA 5F1YA 1SXJE 4V0OA 2ETXA 1SIUA 1THMA 4Y1FA 1E0KA 3TBFA 4EKNB 1ZSVA 3JWGA 1IOWA 3AUYA 1PS8A 3SJUA 5BOVA 1Z4NA 3FI0A 1P0IA 1EQUA 4ZYYA 1YZHA 4RZQA 3PX3A 3IJPA 2H0QA 2IYOA 2BFDB 3HCRA 4P84A 4TRNA 5HUJA 1IRXA 1X2BA 1DHTA 4X7PA 2C83A 5JS7A 3BMCA 5IM4F 3NV9A 3VOTA 1M2NA 1EE2A 4CEHA 3CSTA 1XVAA 5A4FS 2E0IA 3A11A 5G0SA 3HY3A 5CFZA 4MGKR 4OP2A 3TK1A 3EDRA 5BVHB 1K0UA 5KTTA 2JGJA 1F0KA 2XUAA 3G2UA 4FADA 1Z6QA 2KLHA 1HG2A 4IF4A 4R6XA 4EKEA 4EHNA 3ZXXA 2OBBA 1WW3A 1Z2AA 3K1ZA 1RP7A 1JCRA 4QATA 1Z29A 4O1PA 3WSVA 1R3DA 2HM7A 3RM3A 1PV2A 3R5HA 1IWOA 1T8RA 1Y3CE 3BAZA 3RVNA 4EH1A 4ZYWA 3AXTA 5K4GA 1T9GR 2I8CA 3LBAA 5J59A 3UMMA 4TRJA 3IVRA 4XIJA 3KPJA 1JH9A 3KOZA 2OWEA 5AJWA 1L5LA 3H6GA 4L85A 3VHXB 4I6GA 3U7IA 2HBQA 2YV3A 3A27A 2MJLA 3N75A 3MS2A 4JVLA 1M66A 3OZCA 4LBZA 2Q9AA 1XNHA 3V2UA 2NYVA 2ZI4A 2ZPTX 2JFWA 1H9CA 3OZSA 3VC3A 4XWGA 3G7SA 1PR3A 2EX0A 5IKXA 3STXA 1CQXA 1B7GO 2E55A 3SSAA 1MVOA 1Z2CA 1XKTA 1BD4A 3B9PA 1E7RA 5BNFA 4ACLA 5IKEA 1EK6A 1ESNA 4AFNA 3O8CA 2FPRA 4JL5A 2HSDA 1USKA 2OCIA 1XAIA 3VR4H 3ZCUA 3DEIA 3VR4A 1C7EA 1BMFD 2QQFA 5SYMA 4A3TA 4B3HA 4RZXA 2BGWA 4L2LA 3LGSA 5AKJA 1NUAA 4BEJA 3ELYA 2CWDA 5GONB 4AZ3A 1WMSA 3T3IA 1PKEA 4C9BB 4JA0A 2O2XA 3GR6A 5D66A 3D6VA 1J97A 2QZ4A 3QUCA 1KY3A 4PS8A 3R5JA 4TRMA 1KZ9A 4FC7A 2HF7A 2RGBA 1GAEO 4HC4A 4RQAA 4WSOA 5JG7A 4OXKA 2NU9B 5K3EA 4ZANA 1OPRA 3QOXA 4PN3A 1U7HA 5KJNA 4Y2PA 3PZBA 3ZDYB 4N76A 1SBTA 5KC8A 2AUNA 4GRDA 2QMOA 1RZ4A 2NV2B 4OP1A 2VPXA 3CM0A 3NAWA 4X20B 1Q7TA 4ZD6A 1JIVA 3M89A 1FYDA 3RO7A 3S70A 4F85A 4ZU3A 2O7VA 2I7XA 1V26A 2AI1A 1RYZA 3HY6A 5ALFA 4XDHA 1PD1A 3SX2A 4DRXB 2RI1A 1VRWA 2KC7A 2WFZA 2ZBVA 3IUJA 3R3YA 4FFRA 3ETLA 4IDAA 4EBFA 4XYLA 3U4MA 4YWHA 4M1MA 2Z9DA 3LPDA 2BFEA 2B5VA 3H65A 1NMQA 3HXPA 1ZNQO 3EQ6A 1DTSA 2KCKA 2X42A 3CR7A 2TRSB 2IOLA 2ZQZA 4DLRA 3ZWOA 5EHXA 1I7PA 2JGKA 2GN9A 2XWPA 4GZCA 5ILOA 1Y6GA 1XA3A 2BF7A 4LMPA 5CNKA 1RXVA 1SZDA 3MILA 2G8LA 5D2MC 5T3RA 1N0HA 3U62A 4CIXA 3SHOA 4E07A 3LC1O 4RJTA 2JBAA 3OT5A 2R87A 5EE5B 4H6PA 1GW6A 1CD5A 2WWVD 5AIBA 3MJHA 4EB6B 1B0ZA 2DX7A 4X65B 1XI2A 1BA2A 3ZIDA 2Z8ZA 3K9QO 3LWZA 5HE8A 4D3XA 2IX3A 2RAPA 3VR6H 2FJ0A 4J3NA 4KPEC 4Q9HA 4BC0A 2VQ6A 3K9LA 5JJKA 1V7PC 1G291 2J85A 2FW7A 4X1OA 3AU5A 4IKOA 5FNZA 4RK0A 3AVQA 1GRCA 1MQ8B 2WNIA 2R5NA 3AETA 1BZYA 2VPIA 4LRTB 3DTVB 2OBMA 5SZHB 2BSXA 2K2WA 4YCLA 4FNGA 2BFAA 4HDRA 4JITA 4CFSA 1I2CA 5L95A 1JLRA 1QPZA 5JS6A 3DOFA 1PNOA 4AJ4A 3LO5A 3TECE 5FOVA 3RK1A 2JRLA 2UZIR 1W0JA 2ZB2A 2GRAA 4KL8S 1SXQA 2OZLB 5G40A 4EJ0A 1ZJ5A 5CB8A 4Q01A 2O3RA 5HOEA 2ZETA 4R2HA 1KS2A 4DLZA 3KKZA 3WYFA 1H0HA 2O6LA 4JXTA 3PFNA 4ZQGA 5ARFA 4IQGA 4L3VA 3B9QA 3BTOA 4QTTB 5HRCA 3K20A 4GA2A 3KSZO 4N41A 3GLKA 4OHOA 3V2GA 4WNDA 1Q92A 3FHOA 1K75A 2IY7A 2KW5A 1DKLA 4HLCA 1W75A 5JD3A 3JYNA 3PICA 2J7PA 4HQ0A 4BETA 1ZRMA 1CQIA 2I6SA 4IMIB 2Q50A 1X8KA 1GGNA 2ADFA 4CMEA 3HJUA 4Q3CA 2HK6A 1VPEA 1ZRHA 2BUGA 1SUPA 2EG9A 5G4LA 4GSKA 1KIMA 4EZJA 1O7JA 2ZR9A 2IO3C 3A2LA 1FSGA 1E9VA 3C6BA 3DP7A 4PRYA 4X7BA 5AQEA 3O2QB 4CN9A 2B5WA 3AHDA 1ZD9A 4WNEA 4J0GA 1T29A 1VDMA 4BP3A 4K8OA 4F3VA 4PPQA 1VPWA 1CWUA 2HD4A 1DLJA 5CVDA 5E7MA 5LP6B 1X0XA 4JY7A 1ZCBA 2CXHA 3C85A 4O0MA 4PHFA 3HJGA 2NZ8A 3IAHA 1SZ9A 2YY6A 5EIEA 2CD7A 2RGEA 3KJZA 2FZ4A 3DO5A 2NU9A 3QTLA 2HEGA 4BMXA 4IN3B 1YQQA 1YBVA 3DO8A 3SQVA 4GMDA 1N5JA 3RPEA 4CU2A 2J49A 4PWZA 4FC8A 2R65A 4ZDKA 5B4TA 1T9BA 3WNCA 2Y1LE 1A4UA 4EFKA 5AK0A 2IIVA 5AVRA 4RK5A 4CCWA 4NRHB 1E79A 1FFCA 1XZQA 3JD0A 3MQFA 4PAWA 1S8FA 3HI4A 2DPGA 2P3OA 5JXWA 5MN4A 2HLHA 4DLUA 3IAXA 3JYPA 1Z5PA 2JZOA 3G2QA 2R8OA 1CJVC 1J42A 1PJSA 2P9IG 3AFMA 3DPIA 1MIOA 4LF6B 4FDVA 1SW6A 3BWEA 4EPZA 4J1SA 1ZU5A 1IE3A 3IPRA 3SZGA 4C2TA 3TGWA 5GM1A 1FMLA 4PX5A 5HBRA 3FFBA 3D2AA 1N9KA 3D8BA 4FE7A 3ZI7A 3FNGA 3CCBA 1RJ9A 4OGLA 3C6YA 4EHKA 4TSKA 1Y3DE 5LN1A 1INLA 2V6BA 3KKEA 4YFYA 2AWIA 2V7PA 4KB5A 3IQFA 3U49A 2JI6A 4QDOA 3UK0A 3L6AA 3VR3D 1J2RA 1FP4A 4KZCA 1L4YA 1NL4A 4UARA 1Z82A 1SCIA 2CLIB 4GNRA 1ORTA 4NECA 3WGTA 1G59A 3PI6A 3WLEA 2KM4A 2HR2A 1COWD 1PQWA 5DI3B 4LZOA 2VSFA 3WMGA 5FHRA 2FG6C 1AUXA 1NUTA 5BYAA 1MGPA 3BIJA 3S1AA 4FU3A 1ZITA 2JATA 5HTKA 4HDQB 1WV1A 2GBIA 1FQJA 3UAVA 3IQEA 4TLAA 3D7RA 3TUIC 1ZM9A 4AXXA 4NBLA 1MHQA 3SS7X 4AZ3B 1KQPA 3M6XA 4A26A 1PTJA 5EMHA 4MQEA 2EBUA 2VJKA 4TS9A 1AMUA 2EWVA 2V9ZA 1LNZA 4Z86A 3L1JA 1CNMA 1NFFA 3TEJA 4OHBA 1RTTA 2LP4Y 4RZ2A 5G0UA 3NYWA 4OQYA 4CEIB 4GKJB 5L3SB 1TUGA 5CAEA 4BQEA 3FYUB 3NBUA 4F6CA 4Z9FA 4BNNA 4EOGA 2P9HA 3G5LA 1VBMA 4V0LA 4EBAG 2V7QD 3QENA 1W6UA 1SAYA 3G8AA 4YP9A 5K0NA 2PUCA 4TRQA 2YYSA 4IJQA 4GLJA 3A4NA 2NT4A 4NE2A 3KLPX 2F67A 3B3AA 1IFXA 1GPUA 3B20A 4FWIB 4KQKA 1TZCA 4JI6B 4BFZA 3MRTA 4YJ3B 1H4TA 5FOUA 2VP9A 4Z53A 1SOWA 2CB9A 2TECE 2DH6A 1Z4JA 1FFWA 1E2JA 3FZEA 3HXMA 1VCMA 1IJKA 3AQIA 3E1GA 3WJ2A 1LRLA 4B43A 3SMVA 2PZGA 1NY6A 4ZP1A 2AMFA 2G1AA 3UKOA 4P33A 3DOUA 5JVDB 1UQTA 5LX8A 2D59A 3HYSA 1ZU2A 1CY2A 3AZPA 1JLLA 3S2IA 4GAEA 4F6RA 5TPWB 4J91A 3WE7A 2C0QA 4HB5A 4HOQA 1VSVA 1ZOOA 2CF6A 4TXHA 4E5MA 1E9EA 4C0WA 3UK1A 1DJPA 3TSCA 5JFGA 2O8CA 4ZVPA 5JYDA 2VHYA 1CP3A 2WYIA 1K0FA 1OZ0A 4Y0NA 2GA8A 4HRAA 4LV6A 4IKPA 4ND2A 3W9GA 3QWBA 1EX7A 3Q5GA 2R6DA 2P9UG 2DRIA 1HOXA 2IYRA 4XX5A 2RIRA 3HBAA 4L15A 4TYPA 1LF0A 1VGVA 3FFXA 3LA6A 3LPMA 5CLFA 1WSWA 1GCIA 2EJWA 2GTPA 3DLCA 2CYAA 5IHXA 1E94E 2EP5A 1SR8A 1PVDA 2ZUUA 3OQHA 1ZK3A 4JBXA 3M82A 4QECA 2GLTA 4PC3A 3IA2A 2ACVA 5BSFA 2BYTA 3ETGA 4QAJA 5K0SA 1FBTA 1PD0A 2VBGA 1I7LA 3T7AA 4DZRA 4EVQA 2XT0A 3R40A 5DIFA 4UVGA 1DV1A 2G1PA 4BFRA 3VV3A 1DOAA 3V4PB 1IXZA 4WZBB 4BN0A 2WOJA 1UM9A 1M1YB 2CWWA 1X7GA 3V46A 2PSDA 1P2TA 2I2AA 4C43A 3JQAD 1V8ZA 1PVVA 4UAUA 1ISMA 3EF1A 3G17A 4U9IS 5JE8A 2IYEA 2QTVA 5KNDA 4OLAA 1ZMTA 3WG7E 3WHKA 1HG0A 3AYXB 4LUCA 2WYUA 3HO6A 3RK4A 2J9FA 3MWEB 1JF8A 2BE7A 1RLTA 4FBGA 3RODA 2V5QC 3UCEA 4D81A 5CFNA 4RQIA 5I9LA 1QR2A 1BWRA 3DSTA 1PV1A 2PKYX 3MT0A 5ECYA 3R9KA 5LQMA 2FN3A 4OA8A 2VGXB 3KL4A 1IDN1 1QYDA 1DARA 1Z4QA 1E8ZA 2HQBA 2JJ1A 2VATA 3PUVA 4FINA 5G41A 1VLZA 5LLSA 3VSDA 4C4PA 4BJ3A 3O47A 4WLEA 1Q91A 2FJBB 1RZUA 5HFNA 1ZD4A 2PQ6A 3CLRC 3UMYA 2WNSA 5C2JB 3NWEA 1OF1A 4OAOA 2IYWA 3PHHA 3KZCA 1E20A 4ZGGA 3I37X 1TK9A 3GMDA 3IUYA 3RF6A 4NMLA 4ESHA 2ETBA 1B14A 4TSRA 1Z2DA 4YVQC 1KI9A 1NYTA 4G5FA 4D9KA 1E0SA 5K3OA 3KPVA 1YOVB 3ZXSA 1M7GA 4TL6A 5IT4A 1KSFX 2N1BA 3QNUA 3HJTA 4YREA 4INOA 3ZEIA 1A9XB 3ED5A 3W5HA 4ILIA 3QFHA 5JWHA 1VYTA 3AG5A 1TJFA 3C5VA 3FYUA 2E85A 3ACCA 4MWZA 1M33A 1T9HA 4HLEA 1MC8A 1OC4A 3ZNQA 3ZWNA 3TM5A 3I23A 4D9FA 3PE3A 4KWTA 2WQZA 4PYJA 4Z51A 3BH6A 1CE8A 5KU7A 1Y5MA 2J45A 1EYZA 2BDUA 1RFGE 2XHZA 3AINA 5B6IA 2XUZA 4LWPA 4LF7B 5FUWA 4IHAA 2E4VA 4A1SA 1YL7A 1KH3A 2H59A 1K98A 3H2KA 1P1CA 3URMA 2ZYUX 1SIOA 2QDKA 2FX3A 4ZVLA 4HYTA 3VPXA 4QWMA 4UDOA 3QXJA 1UEIA 2JLZA 1I8TA 3AERB 1HDZA 3CG0A 3FKSA 2VSYA 3ILYA 1W4ZA 5AI9A 4B6FA 4HVLA 5GIOE 1LK5A 4RZSA 1B8UA 3MJWA 2E4AA 2QTRA 4NEGA 2FPXA 5B1DA 5I3CA 3I9JA 3F90A 1W4LA 4G0XA 4YFVA 5EE1A 2QAJA 3A3PA 2DUNA 3BQ9A 3GN1A 3MSXA 4V0NA 2O8CB 4J0UA 2WI8A 3RYIA 4LWQA 4BUZA 3WWEA 4MROA 4NH4A 4F21A 3G89A 5TC4A 4D4LA 3N2ZB 3SOPA 2ZIGA 2EYUA 4ZVSA 2HA6A 4QBKA 4IG4A 2X23A 1IC6A 2XCQA 2ZATA 4RVCA 3D2CA 1WDTA 4AO6A 4R83A 4CBVA 1DL5A 1OT8A 5ARDA 5TPZD 5KSWB 1EVYA 2PZKA 1S7GA 1G21B 3EVNA 4IV8A 1J5XA 3VUFA 3CVPA 3OEHA 4FKBA 4XCQA 3MW8A 1EBFA 1S0UA 2B1JA 2CDBA 1LW6E 8ADHA 4D8YA 5D3MA 3SWWA 3TTXA 3WGVA 1DSSG 2NTJA 4RKFA 5EOVA 3ZIUA 4E22A 3V9AA 1MA3A 4A3SA 5KTOA 4DCMA 4RV5A 4BEBA 1WHSA 1Y8RA 3RJ5A 1LRJA 1FYVA 3SR3A 1I1QB 1V54E 3EF0A 5KNDD 2DHCA 4ENQA 2L0TB 1SOMA 1PWZA 1TA0A 1VJ1A 1LX7A 5BQFA 2WXIA 1VKZA 2FEKA 3VAYA 5IVIA 4KTVE 3TZHA 3E05A 3SSNA 3T1QA 3E03A 2BOVA 2OC9A 3FRJA 1C1HA 1M6NA 1FK8A 2PEYA 2DY0A 3ML9A 1IZZA 4S24A 5TMPA 1E8XA 5H83A 1AE1A 1MEEA 1U0NA 2IDMA 3D2BA 4Q7LA 2CMHA 4RJJA 1ZUHA 2HREA 3C8UA 1OQAA 2PMDA 5DYWA 5BSMA 3L84A 5BOSA 3LOQA 4WACA 5IX8A 5IWAB 4KXQA 3PPXA 1VBNA 1T3SA 2IIQA 2AD5A 4D57A 1HPLA 2CEAA 1W1WA 4HTAA 4UKDA 2WJ6A 1QLHA 1GZUA 4R81A 3PENA 1SXJD 4YB8A 5LOVF 3T3NA 1OX4B 1F0PA 2GESA 1Y6FA 1G2QA 3CN7A 2D54A 2XA9A 3Q8LA 3VPBA 4J8FA 2H9AA 1UN8A 3KELA 5TJ9A 1G0OA 2RD0A 3ZV6A 3ZX5A 5A4DA 1Y1KE 1WY6A 4MVJA 4XYEA 4D74A 3R6WA 4X9XA 4BFLA 5DBKA 3DM9B 3UTMA 1NHGA 1XPUA 1QFZA 1CW2B 3D7LA 2V1XA 2TMDA 3KBBA 3OFJA 4ITUA 5DK4A 5AW7A 3S81A 5FBVB 3P27A 3H1PA 2NVOA 3ICVA 1YI1A 2IPAB 4ZT3A 4EB0A 4JIMA 4URYR 2IRWA 2VXBA 2HRBA 3TRHA 4URZR 4F5DA 4PZYA 1E1YA 1Z13A 3DC2A 1VB5A 1EUDA 5EIWA 2DM6A 3EOAI 5KWSA 1LQTA 2A5LA 4HDOB 2KYRA 4PR0A 4B3IA 1T1SA 1PL6A 1JT9A 2R7MA 1ULUA 1C1XA 1W4RA 3QPWA 2NP7A 3LC7O 5FH9A 3R5FA 4YRFA 1D7AA 2PX6A 4NG5A 1BMDA 1T15A 4BWRA 1U0GA 2GS9A 5A3RA 2IBTA 4JUCA 3ZGZA 3GFQA 4M89A 2Y9PB 5ICFA 1A9XA 4I2VA 4IFTA 3EZ7A 5HK8A 2C5EA 1IXSB 3FF1A 2H8KA 3NYQA 3K16A 2IQCA 1GO2A 2HAEA 2A8YA 3HRKA 4NV1A 1N5OX 2PVSA 2YWCA 1T6ZA 3HYLA 1HE1C 1LDNA 1DQSA 2WWXA 5H3CA 4K05A 2DZDA 1FFAA 1HSZA 3RYFB 3M2PA 4ZICA 5FUQA 4HDKA 2PO7A 1MB9A 1GL9B 1U65A 3L9TA 2G83A 1A88A 3HB4X 3O95A 3QXSA 4FVTA 4MVYA 1FNBA 4R8SA 4TSFA 4YH1A 2O5RA 4DG5A 2A14A 3HGMA 2XCOA 4M86A 1UPAA 4IBOA 2O0JA 3GFGA 3QKRB 4QREA 4J49A 3RYCA 1F5SA 2XEVA 3L7JA 3SI7A 3WYEA 4B1FA 1LD8A 2YUIA 1SFRA 1TMYA 3JZFA 4WLVA 4MV5A 4EELA 4NWIA 5K3SA 3K6KA 2ZSKA 5C8YB 1JB1A 4JYCA 5FR1A 1XDZA 3FPHA 5FA5A 2FVXA 2O8EB 3GGOA 4M37A 2J08A 1SPBS 5JAQA 5FWYA 1QAMA 2XJ9A 1H65A 3B1WA 3G0OA 3JSXA 1XA4A 2OKCA 1GPNA 2Q49A 1WMEA 4HAYA 3Q47B 1SXPA 4E5NA 4MR8A 4TKMA 1QTRA 3TLYA 3E7WA 2IPXA 3Q85A 4R2XA 1B76A 4URWR 3IS3A 3LWBA 2IU4A 5H8WA 3CPJB 1G1MA 2NQ2C 3DR5A 4LSZA 1GY8A 1MJGM 4N54A 2JFPA 5A62A 1XLTA 4ZFNA 5KQMA 1SQGA 3EXFB 3K9GA 3QPVA 3QVTA 5CURA 4KPFC 2B8NA 2X2EA 3ETDA 1HH4A 5E76A 2BEKA 3DW1X 2CL7X 4CIWA 1QF6A 1N1MA 3FAZA 3SEAA 1H6KA 5HKLA 1ECLA 4CLOA 4RCVA 4JLSA 4JJ6A 3GMIA 3RKSA 3B1XA 4EARA 1D1TA 3O26A 3PIDA 3ZWBA 4F6RD 1DX4A 1WHSB 1Y8RB 3B82A 4P81A 1PJRA 5HS6A 5FUXA 3RHSA 4CIYA 3D4NA 2RK6A 3C3KA 1KKUA 5EN5D 4MYDA 4AMBA 4KR9A 3TOZA 2V7VA 3D6FA 4TV8B 1NQUA 5B1AE 4X1IB 4OQ4A 3RHZA 1N5KA 2FWIA 3UT6A 4EUFA 1P2SA 4PLCA 1QO9A 3BBLA 2A35A 5J1TB 5FR2A 3EBOA 1DQNA 2PZBA 3I9V1 3MOSA 3PFKA 4MR7A 3PEWA 1BRTA 1LBTA 2OHFA 1JPLA 3UMVA 3CEHA 2C77A 2GK4A 5KSPA 1JQBA 3OIYA 2FR1A 3RU3A 4UUCA 5JMTA 5KWEA 1FLNA 3CWZA 5EP4A 4L6IA 1AKWA 4LCJA 13PKA 2HMVA 1RPAA 1RABA 4LXGA 2GZ1A 1PGJA 2VF5X 4UI9C 2WD7A 2GAOA 1C7IA 1GEGA 4QYSA 3EC1A 2XE8A 4UXHA 5KJEA 4AX8A 2P9SG 3E4BA 1IZ0A 4LF5B 5AQ9A 2BKAA 3UUEA 2C0PA 1ZKMA 4GZ5A 1KY2A 3V4LA 1UZUA 4KEAA 1TO1E 5EUQB 4BX9A 1GNPA 5KS2A 1E8MA 1ZZGA 1KPIA 3PU6A 4P3XA 5EJ9A 2FF5A 4WXYB 3T1VA 1ABFA 1R00A 2AQ8A 1OWLA 1MW9X 2NVBA 4W8GA 4E08A 2PV7A 2VQFB 4NESA 2XEEA 1Q0HA 2WE7A 1U0EA 3FSGA 4BP8A 3D0OA 2NUAB 1D7OA 4H6WA 1G2PA 5CLGA 1KDVA 2AOTB 4XB2A 1H0KA 2D5IA 2PQNA 2P0AA 1CB0A 1BVHA 4KQ6A 1F2UB 3V33A 1V7CA 3BZUA 4U2DA 5GVSA 4PVDA 2MR6A 1SA5A 3QPBA 4HS9A 5ALEA 4HNAA 1DT5A 2QC9A 1UBHS 2VWQA 3RVSA 2AOUA 4X5OA 1M10A 3OQNA 1XRNA 2VT7A 3E81A 3G79A 1VL1A 2LUHA 2GRJA 3LKDA 1VXRA 1NXVA 1FDSA 1WLYA 5JY6A 1A8PA 1HDIA 4D4HA 1NW3A 4DSZA 1X1QA 4YRSA 1EDZA 4AZTA 2ZBFA 4P83A 1CPYA 1LVUA 3D6HA 3O2SB 4U7JA 5EWJB 2ZCVA 1F9EA 4GKKB 2BEVB 1X7YB 4IQ0A 5FFMA 3T3EA 2IU6A 4AAYA 1F2VA 1QIFA 3M8KA 4UQPA 2C9MA 2JJ2A 1W1UA 5DPMA 1ISJA 2Q4TA 3NEAA 3HXKA 4WZZA 1I6LA 3KUDA 4DG9A 1LJ8A 3LI2A 3SOZA 4LZLA 1VG0B 4L4SA 1SD5A 2CV2A 1UT6A 1Y42X 3A6KA 1M0TA 1KEUA 1E1CA 1RBZA 1KQGA 2BBTA 1F6WA 2HY7A 3O4GA 1IYGA 3QE0A 4HAZA 2P58C 4X93A