4GZ5A

Crystal structure of human o-glcnac transferase with udp-glcnac
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
716
structure length
700
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 265
structure length 700
sequence length 716
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz5A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz5A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gz5A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gz5A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gz5A03
2YQ8A 4IN3B 2R60A 2FI7A 4XI9A 5G05C 3WAGA 4F97A 5G04J 4X7PA 3ZCTA 4GA1A 3NF1A 3D0QA 3OY7A 2UWJG 4LDPA 3BDAA 2XCUA 4F96A 3ESKA 1XOIA 3UQ3A 2BGTA 3MS4A 1FA9A 3T3HA 4G2VA 1GPAA 2I6HA 3G2JA 1XNFA 3U3WA 3RO2A 2IYAA 5FZQA 2YJNA 3ZCQA 1FC0A 2IEGA 3WXXA 3O3CA 5JJ7A 3IEGA 3ULQA 2KC7A 3CKBA 1FU4A 1FTWA 1YA6A 3VDNB 4REMA 3MKRA 3D1JA 4WADA 4JA7A 3MEKA 5ARGA 2IV3A 2WPVA 4M83A 3SYMA 4CTNA 2KS6A 1JIXA 5M72A 4BTAA 4GPKA 4W6QA 3BEEA 4G24A 3MSCA 2KCLA 2QN7A 3OY2A 4AIFA 3CEHA 5CCLA 3L7DA 2VCHA 1K06A 4WNFA 4NRHB 4AN4A 4QLBA 3S2UA 3AMVA 4I9EA 4JHRA 4GZ6A 4G2TA 4NEQA 5KJLA 1YGPA 1FS4A 2KATA 3HBNA 4W9RA 2SKEA 3T7DA 1HXIA 2VSYA 3QDNA 1KTIA 3Q15A 1NA3A 4LEIA 1JIUA 3LYAA 6GPBA 3UUXA 2UY1B 2XEVA 1BX3A 3S7FA 3CUTA 4NESA 3ZCUA 2BGUA 1F6DA 3RO3A 7GPBA 9GPBA 2F9FA 2P6PA 3SZ7A 3CVLA 3VTXA 3OKPA 4EQFA 1L5RA 1ELRA 2XGOA 1XL0A 1V4VA 1KT0A 3LY8A 3MBOA 1RZVA 3VUFA 4HOSA 1GFZA 3O48A 3QOUA 1HLFA 2L6JA 4GYYA 2H1FA 1A8IA 2VGXB 3CUUA 2BISA 2QLLA 1WW3A 2XMPA 4MHSA 3VTYA 2X6RA 4MICA 2IYFA 3BD6A 3WC4A 1EXVA 4KQ1A 1P2BA 4G23A 5A7DB 2QLNA 4I17A 4KBQA 5ENZA 1NVKA 4ME2A 5KJNA 3NCHA 3T3EA 4G25A 1ZU2A 1EM6A 4JA9A 4G1TA 2C0LA 3AS8A 4HOTA 1HZ4A 4XIFA 4AM9A 1P2DA 1J39A 1NOJA 3TG5A 1PC2A 2GPBA 3KS2A 2QN2A 4PQGA 4RBNA 1GPYA 4CDRA 2QNBA 1QZ2A 2V5FA 4UI9C 2LSVA 3CVPA 4MI3A 2KCKA 2DBAA 3CEJA 5EKQD 5FZSA 2R4TA 1SXPA 1IXYA 2F3QA 2R66A 3ZFWA 1W3BA 3CEQA 2KCVA 3DD1A 3T3IA 2QRPA 3CUYA 4YI3A 1Z62A 4WUYA 5BNWA 2QZSA 5G05J 3EDTB 3ZGQA 5FZRA 3AS4A 5DXFA 2OFFA 4EKYA 1Z6QA 3GZ2A 2ATIA 3GUHA 1C50A 4I9CA 3WADA 2FO7A 2PRIA 3K9IA 4MRAA 1P4GA 3CK9A 3DZCA 4UQYA 3G2KA 2PQNA 4CGWA 2LNIA 2PZIA 4RIGA 3RSCA 2X0DA 2BFWA 1QQEA 1F0KA 3OXLA 1YA0A 2WQHA 1WV1A 1AHPA 1FTQA 2E2EA 2HYZA 4U0UA 1A17A 3UPVA 3E3OA 1P4HA 4Y6WA 1RZUA 2ZB2A 4KYOB 4GPBA 4RIEA 2Y4TA 3C4QA 8GPBA 3TG4A 4CGVA 3MT9A 4RG6A 4EL5A 3UYKA 1TJCA 2ACWA 2XCIA 1WUTA 2QRMA 1JEJA 2FEZA 3QKYA 4NQ0A 5AYWD 1L5SA 3IAAA 3S27A 2AVPA 3HYMB 3CVQA 1WW2A 3ZCRA 3L79A 2BUGA 2QRGA 3T5TA 4Z5XA 1QM5A 3S7DA 2QN9A 2IF4A 3R9AB 5JTTA 3CX4A 3QKWA 2G9RA 4HOUA 3C4VA 1RRVA 4EKEA 4U07A 2VCEA 1ZBPA 3PDNA 3EBPA 5DIZA 3COPA 3N71A 3OXGA 1Z8DA 4GCNA 3RKVA 2UY1A 2PYIA 1XKXA 2HY7A 3QWWA 2GEKA 2C9ZA 2GT1A 3Q4AB 4MI9A 3RSZA 4HORA 1WM5A 2G9UA 4N3CA 2GJ4A 5ARFA 1L5QA 3Q47B 4BQEA 3FP3A 4MHOA 2AW3A 3G2NA 2QLMA 5JTUA 4GYWA 3C48A 4FZRA 3ZN3A 2XGMA 3TGOA 4EJ2A 1ABBA 3CK7A 4N2SA 5D00A 2VGXA 3ZHEB 3L7AA 1P4JA 3NP9A 2GPNA 4N9WA 3E3LA 1PN3A 1O6CA 3HBFA 1QKJA 1FU7A 4UQXA 4N3BA 2PQRA 4UI9K 5JJTA 4I1AA 2IEIA 3CV0A 2P58C 1NOKA 1UQUA 4UI9J 3BCUA 5TMEA 4U04A 2HR2A 3FWVA 1NA0A 4B94A 3ZPJA 4FKZA 4RIIA 4RIHA 2C2LA 2ASVA 2G9QA 1WV0A 1L6IA 5EX3A 4AY6A 3AS5A 3Q49B 2XCBA 4X6LA 3RJVA 2QN8A 2VYIA 5LQDA 3S7JA 3URZA 2X0EA 4GCOA 1Y8MA 1L7XA 1PNVA 3T3DA 3U4TA 3FFLA 4X7MA 4M7PA 1H5UA 3MT8A 4I2ZA 1GG8A 3BD8A 3QWVA 2PRJA 4RIFA 1B4DA 4YUAA 3OT5A 3E4BA 2PQ6A 5D0QD 5CHEE 5LCWC 3CUVA 2VQ2A 1E1YA 1B89A 5KJKA 4U0ZA 1Y8ZA 1P2GA 3GZ1A 3S0JA 3T3GA 1XV5A 1UZUA 2O6LA 1P29A 3KAEA 1XC7A 5IKPA 3UYLA 4N3AA 1IHGA 2OOEA 4O6FA 2R68A 3NB0A 1LWOA 1HH8A 2FF4A 1FTYA 3NPAA 4HWGA 4J0UA 2C1ZA 5DLDA 3RHZA 2AV6A 3OTHA 1FCHA 3QHPA 3EBOA 2Y4UA 2C4MA 3TOVA 4BTBA 3BCSA 4RELA 2Q6VA 1Y6GA 2FBNA 3L7CA 4MI6A 3MT7A 1GZ5A 4Y6CA 2MHKA 1C3JA 5HQ8A 4L22A 4AMGA 4WNGA 2X6QA 3G2LA 2F3PA 2F3UA 2XA2A 3Q3EA 3LY9A 2C1XA 2F3SA 2IUYA 4HOQA 4RG9A 2ACVA 5D01A 3OTIA 1SXQA 2ONDA 3NP7A 3FROA 3ASHA 5TVGA 4WNEA 1WUYA 4AMBA 3S7BA 3MTAA 1C8KA 4M60A 4F9FA 3LKUA 3CVNA 1NLMA 3GYZA 5G04C 2SKDA 3DDSA 5TMBA 2LSUA 2IFUA 1L5VA 5A6CA 1M5RA 2R4UA 3CEMA 1L5WA 3DDWA 3MRTA 2VSNA 5DBKA 5I45A 3LY7A 3RU0A 3PE4A 1OUVA 1JIVA 3OTGA 1KT1A 5EX0A 2G9VA 4J8EA 4BT8A 3OXFA 2QRQA 2GW1A 2HO1A 4GA2A 5HI7A 3MRVA 5KJMA 3JYSA 4LEUA 5D0OD 2XA1A 3Q5MA 4GA0A 2Q7FA 1P5QA 3ASGA 3CKCA 4EL0A 3MTDA 4I2WA 3TAXA 2QN3A 2QN1A 3ZCPA 1Y6FA 2NC9A 1K08A 2ECPA 2VGYA 3MV3B 2QFCA 2GM9A 2IW1A 3G2IA 3MQFA 4KQMA 3PE3A 2PYDA 3MV2B 3L7BA 2GPAA 2QRHA 3CK8A 1AXRA 1JG7A 4GZ5A 4BWRA 3BCRA 3ASFA 3BEOA 3VUEA 2J9QA 4F3VA 4HLNA 2VG8A 1GGNA 3OKCA 4WACA 3RT1A 1LWNA 2FETA 2FF5A 2H1HA 3NC4A 3L01A 1E96B 5DU2A 3TSAA 3ZHEA 3RIBA 3MA5A 4G26A 1Z6PA 3Q3HA 4RENA 5FT9A 4KQ2A 3S28A 2IV7A 4KXKB 5HXAA 1IIRA 4WNDA 5BT1A 5TMDA 1VGVA 3MS7A 4H7YA 2C0MA 3QWPA 4YNDA 3D0RA 4YI5A 2AMVA 1JG6A 1KLXA 4BQFA 4GZ3A 4YVOA 1ELWA 3SF4A 1PYGA 3HBMA 1C8LA 4BQIA 2WTXA 4J8FA 1UQTA 3BD7A 4J8DA 3H4TA 1NOIA 1FU8A 3LPZA 3IA7A 4WHMA 4N2QA 5IKOA 2SKCA 5FJYA 3VDMA 4ABNA 5CCMA 5LCWJ 3MTBA 3HBJA 3ZCSA 2X0FA 4N5CA 1NZNA 4CTMA 2JZCA 4NC9A 3S29A 3GW4A 1E4OA 2JLBA 4A1SA 3MRXA 1NZFA 4XI0A 4AY5A 2PL2A 3KD7A 5BW8C 5GPBA 3CV3A 4H7XA 4YVQC 5JJ6A 2FFRA 3Q3IA 4CTOA 2XGSA 5FTPA 3NAZA 3G2HA 2R5SA 2XCCA 1NZDA 1PSWA 1XL1A 4X7RA 2XPIA 4GYOA 3MS2A 1GPBA 2GEJA 1WAO1 4UQZA 3E3NA 3ASDA 4APOA 4BT9A 3CUWA 5C1DA 2AZDA 3OKAA 3SYRA 4N39A 4JL0A 3GPBA 3ZCVA 1IYGA 2JJMA 3LCAA 2XA9A 3H4IA 2YHCA 4BFCA 4U0SA
chains in the Genus database with same CATH superfamily
2PS1A 2GHQA 3V6LA 2XYQA 3AAAC 1XZKA 1WNFA 4XX0B 3NATA 1GXSA 3ZBTA 5HG0A 3I6IA 3AM3A 1GIAA 3AXTA 1HZZA 3KU1A 1A9RA 1XBTA 1X1DA 1MXHA 1KJZA 3PEVA 2IC5A 4HYEA 4TV8A 1ZD2P 3BE5A 1ELKA 3O8CA 3HIZA 1TU3A 1M8FA 2QM8A 4F3CA 1G3QA 4R05A 1COWA 3EE6A 1VSTA 8LDHA 4QBFA 5KWEA 1KTIA 3L0SA 3PUXA 1A5ZA 1QYDA 1MVNA 5A5EA 2XB2A 2PD6A 1TKBA 3IEPA 4C0AC 3EZ6A 2Q3MA 1L8AA 4IFIA 4JBXA 1QO7A 3SHFA 3WIUA 1QVWA 1XJWA 2C59A 3SNKA 1EJ0A 3H84A 4W1RA 1H1DA 4KI0A 1N6PA 1CUYA 4Q15A 1RACA 1LS1A 3EFEA 2OV2A 2C5BA 5AUNB 5KO2A 1DADA 2BOVA 1O4WA 2FO7A 1AXEA 4JXZA 3F5QA 4ALNA 1U2GA 5D5QA 2W2LD 3CRRA 2FJDB 1KMCA 1V96A 3PHHA 4GD3Q 3IHYA 4MKHA 2K4NA 5BP7A 5ER9A 1TD9A 5DT9A 4MYUA 1GZSA 3B2EA 3NB2A 3EXHB 2HV8A 4O4LF 5F98A 2NU6A 4LZNA 4EYQA 3A06A 2CCJA 3ECCA 3GD5A 2V3VA 4ZO8A 5FTJA 4KNYA 2P3QA 2VPPA 5JVDB 4XWOA 3UAXA 1XZJA 4W9MC 2E48A 1HG0A 2AI3A 4IDAA 2VCEA 3BMCB 3CJQA 3COPA 4OI1A 3CIFA 1V8FA 4ZTZB 4FR2A 5G4LA 1IK4A 2IFTA 3R7LA 1T2AA 5JNSA 3ETEA 5AARA 3ND6A 121PA 3C1OA 2EG9A 4Z99A 2AD5A 1ZNWA 5CRUA 3HWWA 1LQ2A 2VRBA 2PQRA 2AGVA 5D3QA 3DTYA 1X7ZB 3O5AA 4UU1A 1H8EA 4KN6A 1Y8MA 1PW5A 3BXOA 5JZSA 5KI6A 2GSDA 3G5AA 1SK9A 1NL4A 2PL3A 3FYCA 3JRNA 2EZ4A 1OXJA 3PUJA 1SUAA 3PHLA 1G1MA 3T99A 4EF4A 4YJ3A 1ZCAA 4BRSA 4LQDA 1LBSA 2WIGA 2NU9B 3RHZA 1JCRA 1OIVA 5HTOA 1FCHA 3UMVA 1BW9B 2IKQA 2YWDA 3AWDA 4BLOA 3DH0A 2XNSA 3AC0A 2K7FA 3SLRA 4QXRA 1X1SA 3NIBA 2WU0A 4F1WA 2CLOB 4B35A 4GAAA 4DDKA 5DW3A 1PO7A 3BTVA 4Z2YA 3NHSA 4JU9A 3IAS1 4H3KB 4N8SA 2KZTA 1ZN8A 3IAEA 5FOVA 1B41A 3DDSA 1L1EA 2K7ZA 3LPCA 4DLBA 4NL4H 4XSVA 5TT0A 3JYSA 1SBQA 4WA7A 1JHOA 1LPBB 4IDPA 2UYHA 1L5JA 3DFZA 3I9KA 3MTDA 2V98A 2XF2A 3BCRA 2GZ2A 1DC8A 1MC8A 4RTNA 3B82A 5EYPF 2WU3A 1T4CB 4KQ2A 4B8AA 1OBVA 4ALMA 2ZREA 4HUTA 3EDMA 4BFYA 1O8CA 2EJVA 1YFJA 1DV2A 5K09A 4H7HA 1GPLA 1U0TA 3E9MA 3IJ5A 5JXWA 3DE1X 2I1JA 5LQNA 3A10A 3QB2A 4N03A 3DTVA 1I3MA 1W581 5A0TA 1P73A 4K1LA 3L0OA 4FB5A 5ESXA 1YCFA 4PX2A 4ZEOA 3EAQA 4ZO4A 3D9IA 3LSYA 1SULA 2F7SA 4X90A 4DR4B 1IYGA 3BAFA 3RAGA 3ZGLA 3CEAA 4AKEA 1MH9A 1P6QA 2DWCA 3HXOA 3B1FA 4G0WA 4YDSA 3C3DA 1P2TA 2A8YA 2FX5A 5HRUA 1KBOA 3RYCB 1KPSB 4WH0A 3ICQB 1CG6A 1W4BA 1EXNA 5D51S 4M6WB 4GPMA 4JA7A 3OPXA 4Y2YA 3VHLB 1K1EA 4JC4A 2VYFA 4W6QA 5KOHB 1R00A 4DILA 4L0MA 1SOAA 5CDFE 3S2UA 1EG2A 4DX7D 3UXYA 4S1TA 1A1VA 5JIBA 4BV3A 1V8ZA 3L7NA 2FMIA 5FULA 1IHUA 4KO1S 5CITA 4L5BA 1ATZA 2QR2A 3IUEA 3DFUA 4W1QA 2ETVA 4BNWA 4Q3OA 2MSEB 5K20A 4D9EA 5HE8A 1Y6QA 1E90A 3T61A 5ENZA 4B87A 4D92A 3OF2A 1ANKA 4DLPA 1JAIA 4II2A 5EKUA 4IAOA 4TRRA 2B6HA 3WBJA 2AZXA 2ENWA 3V4RA 4E70A 1FBNA 2B8EA 5E4TA 3CLJA 3QFCA 2VH1A 4FFOA 4B33A 2V9PA 2I99A 2XQVA 2KPOA 2ATIA 2O1XA 2CZQA 1VG9B 2BIFA 4HBDA 3SE7A 5G4KB 2D13A 4AEZC 1FYVA 2AEMA 5IF3A 5FQOA 2AX4A 3IJPA 1ZAYA 2WXNA 4BVGA 2B4KA 3P2YA 2EEZA 3G2MA 4ZO9A 2Q2WA 2OVBA 4L3WA 5AJWA 4O2BA 3N70A 5FBLB 3UFXB 3GT4A 3FSGD 3PFHA 4I3GA 2VUUA 1KYTA 3GJXC 4HWPA 1EKXA 4N48A 1B8UA 3GRRA 2VDLB 5IDXA 1E1RD 3LDGA 2WKSA 4R2LA 1QV9A 1E62A 4O5AA 1IL0A 2WXHA 4G4JA 1ISMA 3O4ZA 521PA 3I37X 2YFQA 2J07A 1Z36A 3IBSA 2CG3A 4LZZA 5KUTA 1EFKA 1OU0A 3FMOB 1S7CA 3SF8B 3HUEA 5DP2A 1C3LA 4PLVA 2QVBA 3NP9A 4X91A 1FT1A 3LIIA 2JASA 4IRMA 1Y4SA 3LXRA 3ZYCA 4TYQA 2WXPA 4LJ8A 4IMPA 4AJ1A 4PYLA 1JQLB 1GPH1 3JQ7A 4N47A 4MHTA 2QUIA 5LU9A 3HG0D 3ZNPA 1S2OA 1U7PA 3ZD8A 3VZQA 4LTDA 5G3ZA 2CZGA 4CLRA 3O8QA 2DQKA 3DRAA 2Y1WA 2WC1A 2XIQA 1FDTA 2KLBA 5LQKA 1Y6GA 1C41A 3E70C 2VSQA 3TWVA 1P0CA 1UBOS 3FDZA 1PAUA 5FI1B 1ZM3A 1YJXA 4B5LA 3NFYA 1RCFA 1S9DA 3T5MA 5BNFA 4IGKA 3KZCA 1UZNA 1CJUC 1UDAA 5T4EA 3TI9A 4Z1OA 3ZWQA 1U63A 5CIQA 5T4HA 4QHSA 5BRAA 4B85A 2RAVA 4JXXA 4Q21A 2Y6UA 3PWSA 1E8XA 3QVGA 3PH0C 1SVXA 2CMHA 5HILA 1XD9A 1G20A 1CYEA 3SX4A 2B5WA 1AZTA 1LQTA 2A33A 3NBUA 3TSAA 2JAUA 2IPLA 3M1LA 2ZB8A 3PXUA 1BGVA 2DBVO 3GK3A 4FK8A 1IPEA 1IIRA 3QVXA 4UUAA 4Q12A 3APFA 3D0RA 3ZHZA 4F5ZA 1OHHA 2JKYA 4UYJB 2GCGA 1Y1TA 2CHUA 3KELA 1FUKA 4K6KA 3R5KA 3CSSA 1T25A 3S29A 5LD2C 1KJNA 1PRYA 1FP1D 3E7DA 4B7ZA 3DL2A 4LX8A 4FEAA 4XPIA 3PUVA 4XXHA 2NZVG 1P77A 2X3YA 4ZU3A 2CDCA 3GCXA 5EE9A 4PLGA 4GP6A 1ETUA 3V3TA 3E8XA 3PPIA 2P90A 3NBAA 4GI3A 4U7FA 4OKIA 4KE6A 5A3VA 4MVJE 1IN6A 1BCRA 1FE8A 2WXGA 1C9DB 4QE3A 2J4CA 3U3WA 5IJ9B 2PK3A 3PF9A 1W0JD 1BS2A 4Q9IA 2PFKA 5IJWA 4IVPA 2H4ZA 3ZU6A 4GPIB 4WNFA 2A84A 4PX3A 2ZGGA 4UD2A 4I9EA 1XQXA 3W06A 1N77A 4KMMA 1Q83A 1V54E 4CQMA 5F2EA 3FTSA 1ZD4A 4FLEA 2UY1B 3U61B 4QM6A 1JHXA 4YT8A 5AOAA 1WHTB 2CUTA 2GLUA 2EGHA 2RK3A 3JQ1A 4IH9A 2G82A 4GX5A 3CQCB 1EXVA 3IE1A 1RYHA 4Z4GA 5KJNA 1JJFA 1QCDA 1BDIA 1C0EA 2C0LA 1XMSA 1BU9A 1ZHHA 2QYJA 3ILSA 3RJ9A 4NNOA 2FSVC 1CQIA 3CXUA 5K3CA 1UM9A 2J7PA 5EZQA 3AR7A 1K9VF 5ILQA 5B1SA 3QTLA 4DJAA 4UYKB 3F73A 3H9BA 3LJNA 2SCUB 1S3SA 1GRCA 1LJLA 4WCFA 5FPPA 2OWEA 4EFLA 2LXMA 1FTNA 4CWAA 3DHWC 2F3RA 3CFYA 3RG2A 2B8WA 3LVRE 4HFNA 3HDVA 4Y6WA 2XPCA 1LDGA 4CM3A 3N53A 4HY3A 1W73A 4RK7A 3U80A 1TJ4A 5L3RA 2CLLB 1UBCA 2ZRNA 2ZRLA 4HDCA 2RH5A 5D66A 1J2JA 4J4BA 5EP2A 5IMSA 5A4MS 1HX7A 2PCJA 4N0PA 3RIHA 3MOSA 1RS0A 5EIBC 1UDRA 2E85A 4W4TA 3CTMA 1Z8FA 4NULA 4ND8A 2QL7A 3SR4A 2Q9AA 4Q9AA 5FI5A 3UGTA 4R40A 2KBXA 1DTWB 4C0BA 4U7DA 4ZRDA 2X23A 2GNAA 5MGNA 5DN6D 2TMKA 3E23A 3OF3A 2GASA 3L7KA 2BF0X 2IOYA 3NNDA 5SICE 1UC5B 3RYFB 1M2EA 2EFJA 4WFJA 1R10A 4R0VA 3ANSA 4UHDA 1EFAA 2HR2A 1PYDA 2O0JA 4QJ4A 2IITA 1IRXA 4LXXA 3P2BA 5A9RA 1M7BA 2B1IA 1IH8A 4A5OA 5D5HA 4MW0A 3RT7A 4PRYA 4OKSA 3I2GA 5M3BA 3DVSX 3PIDA 1GA4A 1CTQA 4U0ZA 2AK3A 4P3NA 3WQHA 3AI7A 3LLUA 4F6RA 1P7CA 1NYRA 3OO0A 4AWAA 3W1VA 4MGHA 3HJAA 3SZRA 4MQEB 4PX9A 3DVRX 2HMYB 2CDNA 1ULUA 2NU7A 4G86A 1CLUA 5KBYA 3ZU2A 1OCEA 5MN5A 3TX6A 3HG7A 3CVVA 2X42A 4IJMA 3RIEA 1JIIA 4YACA 4Q6BA 4WSOA 4I46A 3CLSC 2ZBQA 3CNHA 1V6SA 1N7JA 1KEZA 1YRQA 4K6MA 3PEVB 2OKCA 2WKPA 4TV8B 1DKOA 2HJGA 5T57A 3WMRA 1CJKC 5IEJA 2ID9A 5JHBA 2DX7A 1C0LA 1CQXA 5JJBA 4URFA 1NVBA 2RAUA 1NBAA 5IKEA 4DPKA 1NMEA 4JD5A 1OC2A 2XNKA 3S28A 5I7FA 3KOYA 1O3YA 2W6NA 3APDA 5H82A 1ZWLA 5FPTA 5AM4A 1KGSA 3V1TC 1SC4A 1F6WA 4NOLA 4W7SA 3CWQA 2WABA 2DKOA 3UMCA 2O5CA 1ILEA 5I9NA 3OVMA 1KQNA 3IVGA 1NMXA 3SGHA 2QMZA 1MT3A 3UMYA 1PV4A 3OUZA 3GJ8A 2F8XK 2AW6A 3WL5A 2UYGA 2GEJA 2ZEJA 1ZD1A 1J06A 1NJGA 2L17A 4TV9A 1G8AA 2FXIA 2XJ9A 2P6MA 1KI6B 1PAQA 2QD4A 4ALJA 4L15A 3PRZA 5H3HA 5ECDA 1M1YE 4E5YA 3P52A 5EJ4A 2W0SA 3UOGA 2GM5A 3GT0A 4AD8A 1DX4A 3ELYA 1LSOA 3R6TA 2EVWX 1Z5OA 3X1KA 2NU6B 4KE8A 1XMPA 1AWCB 2NUBA 3QITA 3V2IA 5GADl 3QOFA 5EHIA 2RGUA 2OV6A 2ZYGA 2N1MA 3BVPA 3A9SA 3EPPA 2QYTA 3I9JA 1ACJA 2C9CA 2Q29A 2E37A 1JKJA 1N4QA 2XIJA 4CYMA 3LI2A 5DV9A 5HUJA 3QKRA 5I4KA 2ZR8A 4F5WA 1FT2A 1OI7A 4X41A 5CNMA 3ZQ6A 5FKJA 1SKBA 4TYWA 1RM3A 3HE3A 4M1KA 4RPCA 2DGDA 3QH4A 3V7WA 2D8AA 1DPGA 1QK5A 3ZVVA 3GPCA 4QOGA 3W1WA 3TECE 2R48A 2GM3A 3PZ2A 3V8QA 4IMJB 4ESOA 3FYUA 4L7TA 4MUBA 5B4UA 4YJ3B 5DI9A 1RWQA 2IO2C 5TARA 3PPVA 5BPPA 4ZAVA 1NXWA 1TPYA 2A0KA 4OREX 1N6KA 3KSRA 4N1AA 3ZV5A 2J45A 1F2UA 3W2GA 4KTVE 2KZTB 2D1SA 4EG6A 2HV9A 3L5OA 3ONKA 4G2NA 1L5LA 3NM4A 4XVHA 3W1EA 5ES4B 1AGXA 2QD3A 1RKUA 3Q40A 2Y0DA 1U5AA 1ZOOA 2Z8XA 4UVDA 1OH6A 4MLZA 5JJ5A 2NUPA 2VJBA 2EU8A 3ASYA 2YWXA 3UUGA 3G79A 4MLDA 3LUGA 4ZVQA 3V6MA 1VC2A 1JE1A 3VU3A 3RSQA 3FWVA 3K3PA 2PGAA 5IEBA 5IY5E 1UK9A 1USWA 3FTPA 2JG3A 5M34A 3T7CA 2ODPA 2P77A 4NKRA 4EDFA 4QGAA 3O2JA 2GOYA 2AYYA 2P2DA 2VJKA 3A7EA 5LCWC 3DTVB 1UZAA 4QEKA 4NH0A 3EXFA 5JG7A 1JPLA 4E2YA 5KNHD 4L0DA 4NX2A 2ZWVA 1RMYA 4MQMA 5BQ5A 4M38A 1BWPA 1FYDA 1NN5A 5ALRA 3ZVNA 1DCFA 4X1YA 4HP8A 4LHZA 2HCFA 5DASA 4MITA 1Y7IA 5BYKA 1N8SA 1SXJE 1G3UA 2HKIA 1X19A 4M86A 2H0QA 4LQLA 3L08A 2EHJA 3X1WA 3V8NA 3BM5A 1PZHA 2Z8YM 4RXTA 5BRNA 4F5EA 3F78A 1JDJA 3SKYA 2BM1A 2LV8A 4GTMA 4P4UA 2IVZA 3OCWA 3KQVA 1TIKA 5G53C 3O83A 2HO5A 4ZDKA 4NV3A 4ND7A 3ZWPA 4JLNA 2MOWA 1R6XA 3ZCPA 1MUUA 2FQWA 5KX5F 5C2YA 1I2MA 2D1RA 2H6HA 1MMFB 3A6JA 2DHRA 3EZXA 5DH9A 3ZJ4A 4U7EB 3OSUA 1ENZA 5ITWA 1C3EA 4E85A 4LOKA 1T1IA 3VKVA 4EHBA 1A04A 2W0MA 4WOPA 1UZLA 4MQLA 2ZBGA 2B30A 2WHQA 5CD1A 1Y8QA 4EPTA 2AXEA 3ZG6A 1S9HA 4UVIA 3GARA 4JYCA 4AJOA 3ZW9A 2B82A 3HSYA 5IMBA 4UOQA 1Y1RA 2A6PA 2FFRA 3GFQA 4LGYA 3EEQA 4I4TF 4ALIA 4YT4A 2P9EA 4E2XA 1PR0A 2GN9A 3ZHVA 1UBUS 5DOVA 1NJ8A 3DV9A 4YQFA 2ZDGA 5KREA 1PR9A 4WLUA 4RQTA 5ED4A 3U3MA 3R0ZA 3OZAA 1VIVA 2DUMA 4FM9A 2JLQA 5DYGA 1XNFA 1HU3A 3HB5X 3M6AA 3HLKA 1R16A 4O2BB 1PR5A 2JFNA 3IR6A 1JJVA 4L78A 3L0YA 2R6AA 1IUPA 1TO2E 2YBDA 3MYRA 2V6FA 1JFTA 2GBGA 2GROB 1EWQA 4D0RA 2ZSBA 5CAEA 2NQ2C 2FFJA 4XCXA 3H8JA 5CT9A 4C0WA 1M67A 3PUHA 6NULA 3VSDA 1JL3A 4JB3A 3IH5A 3BFJA 4MP6A 3RKRA 4DF3A 4YMWA 3A4MA 3H8WA 3G9ZA 3ZE1B 1TRHA 2P67A 2RBGA 3UT5A 4COOA 3D7LA 1R8JA 2JLSA 4BU0A 3FVVA 2IX9A 2ZQZA 1YOVA 1H2WA 4RPKA 2P11A 4L4SA 5E2IA 5AMXA 3JQ7B 1TVEA 3GRZA 1K75A 3JV7A 2QRPA 3HA7A 1F3OA 5D6OA 3NJ4A 4CLRB 3EIXA 1WTCA 1HWYA 3O8QB 2WJIA 4G0MA 4OH7A 2X0DA 5YASA 3RFUA 2X7HA 1D2CA 4GPBA 8GPBA 1X8LA 2BFMA 2EP7A 1Q0RA 1PZEA 3FDZB 2W6ID 1THGA 4Q16A 1TJCA 5ITZF 5G55A 2GJKA 3K6JA 3B48A 2VDMB 4P9NA 2GD6A 5C7YA 4LY0A 1QXSA 4LOJA 3R9AB 1WPXA 1PBTA 2ZS7A 2P4EA 2XT6A 16PKA 2JC3A 5EZYA 1JDPA 2GKGA 1HFJA 4HI8A 2VKQA 3ANXA 1J2UA 3RJZA 3QVGB 5E75A 4BJ1A 3WYAA 4RD2A 1U8EA 1AG9A 1T13A 1G20B 5HIJA 3G2NA 5KTOA 2PWZA 3DMYA 4ZC1A 5TPWA 4MKTA 4F1KA 1FFWA 4C89A 4KQ9A 1AX9A 1DXYA 3AEXA 4IJ6A 4N7BA 2B99A 4F4HA 1WZCA 3O82A 4BNMA 2A78A 3VU1A 2OAEA 3CLRC 1UEJA 3SLGA 3T3DA 4BBZA 5ADUS 1XZQA 2EGGA 4UZSA 2WDPA 1GZUA 4NAUA 3ZKJA 5LDHA 1GGVA 2XWSA 5LB2A 4F4UA 1M2FA 3NT2A 4WASA 4KREA 4XPIB 1A7AA 2AJAA 4DA6A 5IKPA 3T3OA 1FTYA 2LZ0A 2C1ZA 5DLDA 2H2AA 5KTKA 4QYSA 1G5QA 3WK8A 1KDRA 5TJHA 1LNSA 2YXEA 3LP5A 4LXQA 4L22A 3SSMA 2XMGA 4DLVA 2Q62A 2YFHA 2EZTA 4KOEC 4K86A 4PFKA 1BCRB 1K7XB 2DBYA 2C77A 1SUBA 3CEMA 1CZUA 4J03A 3VFDA 2IS6A 4CODB 4BT8A 4QZVA 1QGED 1UP7A 4KIFA 4RNCA 2XQGA 3ET5A 2GBLC 3E8MA 3TBKA 4GOMD 5ENQD 3N76A 3RS0A 2QP9X 4GP7A 2F17A 3JYPA 2GAOA 3CWZA 3ZWYA 2VZ0A 3V9AA 3LXMA 4TUUA 2J3IA 4CQMB 1XAGA 4DMMA 1TZBA 3KZOA 2XYRA 4H7KA 5AVJA 2Y1DA 4WX2B 3TD9A 4YRIA 2Y66A 2G6TA 3UMSA 3RS8A 1MZCA 2PAAA 3T5PA 4CMBA 4LXTA 3OQOA 1F6BA 2RMKA 1JKIA 3C1TA 1CRPA 3ADDA 4DLXA 4YCDA 1A4XA 5GPBA 2GILA 2ZRAA 3LUFA 4G1MB 4QDUA 5E3JA 4E5PA 3GNQA 1CQIB 1UM9B 1ZOPA 1D8DA 1AMNA 4OQMA 5IYZA 2OPBA 2A4ZA 4Z54A 3D4OA 4MQFA 4LDPA 1KC1A 4D6XA 4Z86A 1JR3A 3ESQA 5EKSA 4LAFA 3N05A 4QU0A 3VDNB 3R8CA 3ZTTA 4KQXA 1LVUA 2VJYA 3UJ7A 2WPVA 4MV0A 4IVQA 4BRZA 1Q44A 5AVXA 1ZITA 4F4IA 4S1OA 1VI6A 2VCHA 4F9EA 1TEXA 1K3ZD 3V1UA 3U7HB 4KGZA 1IVYA 3IAHA 5C8XA 1T8PA 5ENPD 4PLHA 3O90A 3KQPA 4ND4A 3Q0TA 1P1BA 1OTHA 4IBOA 1BH6A 2FI1A 3HRIA 4WUTA 3N87A 1I0LA 3FM9A 1V4VA 2ARKA 2DTXA 5B58T 1II9A 5D1NA 1GO2A 1KVUA 3FHOA 4ZA2A 3H2JA 2X6RA 2PKQO 5IXJA 3G5LA 5ERGB 3AHHA 3A6HA 3D3JA 2GUWA 1G6OA 2QVXX 1D1SA 1UP6A 1CY1A 2LPMA 4CMEC 3OE1A 4L95C 4EGFA 5D3MA 2Q5QA 2QNBA 3F4KA 1Z4NA 1XDUA 4NOMA 1ZK1A 1SXPA 1AY0A 2VQ6A 4MIOA 5EXDA 2IS2A 1ZGGA 3IJRA 1Q74A 5HZKA 3QFHA 4PCUA 4LWQA 2OKGA 2GUGA 1IMOA 1AQ6A 4JU8A 4F6RB 5IFKA 4E1AA 4A15A 1SVLA 2XZTA 1G4UR 2ZIXA 3GIWA 5IANA 1KAOA 4OQEA 2NU7B 3DYBA 1KAQA 4ZREA 4L50A 3AVWA 5HFJA 1GPJA 4BKPA 3LLCA 3D3EA 5EXEA 3R5XA 1B6SA 3BUAA 4P3YA 4QPNA 4JWTA 2A0UA 4KWCA 5JTTA 4ZVTA 2NYVA 3CSFA 4N18A 5AOXB 4MVCA 2B0OE 4Y98A 4AS1A 3B20A 3FZQA 2GEKA 1ZVQA 4QU5A 1A9SA 4MHOA 4ISBA 3PXCX 5A3RA 3HPRA 4HGYA 2N42A 1ZPDA 1NN0A 1BYIA 2Z04A 3NIWA 3CPEA 4CNQA 4Q1DA 4HH0A 1T35A 3BCUA 1TYZA 4LDRA 1QE0A 1B8OA 4ZCMA 4ZYWA 5BR4A 1YDHA 2VO1A 1BXZA 3KM0A 1GEEA 3TBFA 3B1XA 3E4BA 2M6RA 4DJJA 4G0XA 4OBXA 2AF3C 4KMSA 4UWFA 3VQTA 4TV9B 2H9AA 2VXCA 1EHCA 5C4IA 3BIOA 3UAWA 3FPAA 3HCNA 4PGFA 3NP7A 2VP2A 4DM3A 2C5GA 1CR0A 3BT3A 1K1BA 3H2GA 4R1MA 1NMQA 3RSHA 1N8KA 2VTBA 1DEAA 4MJ7A 5CH5A 1GEGA 5B3SE 1JU4A 1PR4A 1KH1A 1E79D 4CF5A 3CK8A 3I12A 1JXMA 4FA6A 2ZIGA 3DBRA 2I0FA 3KSQA 3AF3A 1RXCA 2J5KA 4JIGA 1XWFA 5FRDA 3ORQA 3OF5A 1JKJB 3W5DA 2CJWA 3I8SA 2L6BA 1SQ6A 3COSA 2VDPB 2YVAA 4GZ3A 3QKRB 2I1LA 4P86A 2EP5A 2GZRA 4UXIA 4WY8A 2VAXA 4TMKA 3CLUD 1E2IA 1U0RA 2WLTA 3MTBA 2C7VA 3T7TA 1M2GA 3ICEA 4H08A 3PYLA 2W2KA 3SQVA 4B2YA 4DUGA 5AI8A 1KE1A 4PYIA 3TNJA 1K2VN 2PPVA 2QK4A 4Z49A 2YJTD 4E5NA 1RPZA 1V8OA 1VDMA 1XMJA 3DOEA 1NUAA 3ZY4A 3VH4A 4FULA 4RYLA 3AB3A 3GXBA 4IXNA 4O4HA 3FZGA 4LFBB 2ZBVA 3FYUB 3T9AA 3Q15C 1JKMA 3AJIA 4Y1RB 3O1HB 3VKWA 3JZFA 1IY0A 1TZMA 3C5VA 5CW2A 1U94A 4YPFA 3PLRA 2QD2A 1GPAA 5AK5A 1JDBC 4P32A 2IEGA 5FTNA 3IEGA 3FPBA 1FK8A 3IKVA 1NBOA 1F2UB 2QDKA 4RZHA 4LCTA 4F92B 4BTAA 1O5OA 5U4XA 3Q7IA 5HFAA 5B7PA 4OJKA 1YVEI 2BF7A 3HXPA 4PC1A 3QWAA 3WKEA 1Y7HA 3WL7A 3Q9NC 1IDOA 5JMPA 3PD7A 4Q4LA 4IOKA 3L6RA 4TL8A 1QCCA 1OD6A 2WHYA 2AS0A 4WFKA 4QSHA 5TS3A 5BUZA 2WTUA 1YKFA 2Y93A 4O6VA 2VT2A 1RC8A 1U8AA 2K2WA 3PC2A 2JBHA 1EVZA 1PJSA 5BQFA 3IO5A 4M7WA 2HCRA 4YYZA 1F0PA 2KCVA 3EXFB 4IXTA 1PG2A 5ELXA 1M10A 4RABA 2AFHE 1ORRA 1VGRA 4X1YB 2EZ9A 3VVMA 2I9PA 1AHPA 1HX8A 1JNYA 4GPZA 5H0IA 2BLNA 3N5CA 1ESDA 1PGOA 4PYQA 3AU8A 1MR3F 3X2SA 5KPJA 3F8SA 4B40A 4UDXX 3WYFA 4P0PB 4C06A 4AG5A 1N0UA 2QN9A 4LPSA 3S2AA 2QC9A 4KR0A 2WTAA 3KXKA 2R8ZA 2ALJA 1VL6A 4V0MA 3G6WA 5DTRA 4MULA 4ZRMA 4ZHQB 3UJPA 3H1TA 4EH1A 4CCWA 3NZEA 1HE5A 3DV2A 3ZN3A 3WG7E 1A69A 2BEWA 5GY7A 4C2TA 1N2CE 1SXHA 1XWWA 1E2BA 4DWJA 4Z4QA 1QCZA 1G6HA 1EE1A 3G8BA 3RBXA 1OWOA 1DT5A 1X4RA 4DUIA 3T1VA 1XN1A 5DCYA 4OHRA 3NH9A 1SA4A 4YAEA 1Y8QB 4H31A 2GBIA 2WU4A 3SYTA 4NBNA 4C04A 4B09A 3FFTA 3OWOA 4HAUA 4D0LB 2OGZA 1NF3A 3F9RA 4AKSA 1XD8A 2R4QA 1QZTA 1ZWKA 5C35A 1N6HA 4FBMA 1VE3A 4JMLA 1U28A 3R41A 3Q78A 2B0CA 1E3IA 4IW3B 1BN6A 5ANRA 1Z8HA 2ONDA 3FI0A 4PZCA 3LKUA 4LGCA 5TMBA 1G5PA 2P8JA 1XQWA 5KQRA 1YU9A 4HTAA 4PNPA 1ZBQA 1XJCA 4FMCF 3T9EA 2R5FA 1JDZA 3MRVA 4UVHA 1NXPA 3EPKA 2E9SA 2Q8QA 2Q5JA 2XMRA 4KOAA 1L9KA 1U65A 1T0IA 5CAEB 1GGEA 1YJCA 4X0EA 1AKTA 3MXTA 2RGAA 4BO5A 4MPRA 1QHYA 1I8TA 2V0PA 4IYJA 5KVCA 5ERXA 1CR2A 3RAFC 3TIXB 1GDDA 4JEIA 1EFTA 1LZLA 3PR2B 1E32A 2A7XA 3S2YA 3SG0A 3UT5B 1HT2E 4BDSA 2IYUA 3X2FA 3MRXA 5H7PA 1I1NA 1S8AA 1GPWB 3EASA 1YOVB 3N2NA 1XU9A 4PBRA 3T5DA 3VPFA 3RF6A 1FUUA 2WB2A 3L9TA 2XKAA 2H59A 1Z83A 5I7HA 1L7AA 3A9RA 2LDBA 1O95D 1WDMA 3T54A 4H77A 2WM9A 4F97A 5K0BA 2I7XA 3LA6A 5I7OA 1BD8A 4ZCRA 4Z9XA 3C87A 4BWFB 3P96A 4JA0A 2Q7XA 1UBNA 2Y0CA 1IHPA 4Y2TA 3WBBA 1XF9A 1SB9A 1NIJA 4LDAA 2ZSIA 3FPLA 1F38A 1M0TA 4HUQA 4CETA 1ECPA 1EEXB 3C8HA 4H3HB 2E4ZA 5E1OA 2OBYA 4W9RA 2XTJA 5DEIA 1QBKC 3L1HA 2YZ2A 2NX2A 4FMBB 3WO1A 5A5FA 3ONNA 5EZYB 2VSOA 3RQIA 5D7NA 4WOBA 1RSZA 2BGIA 4JUAA 3DVLA 4IFBA 5FBHA 4BAUA 4NFLA 5FL7D 4EK9A 1DFGA 3FU3A 5AQEA 2ZUUA 5TPWB 4B6RA 1FRFS 1TRKA 1XLVA 3WWZA 5GONF 4IIJA 2O6HA 3ZJTA 2D62A 5ENDA 3TNDA 4RPHA 4MGKR 3DHVA 4NNJA 3ZS8A 6AT1A 3FD8A 5EKQD 2YIMA 4R51A 3AR3A 3AONB 1KQ3A 1OY3D 3LFUA 4EUSA 1T91A 3VR5H 2YBEA 4APFA 1N4PA 3QU7A 8ATCA 4UASA 2CYAA 3KB6A 4QFCA 3M7IA 2F1RA 4DABA 3VO1A 2XODA 2CG2A 2ZB2A 3IQHX 4PE5B 1TNDA 3UB4A 3GBPA 3RIXA 4QTTB 4KR9A 1RXVA 1GV0A 1B0PA 3R75A 2WK1A 4YHBA 3KKQA 2ZUCA 2IOQA 2BT4A 3A4YA 1H3EA 1TNUA 1V6CA 2RFAA 4QREA 3OZXA 3MMPA 3TM5A 4AIRA 2XBUA 5FBWB 4DANA 5JJKA 3K2IA 3EC7A 3QYJA 2WEKA 1MAAA 1NVXQ 4RZ2A 5DIZA 3RRYA 3CJRA 4IH4A 5KKCA 2O5RA 4Q03A 5CXUA 2EDCA 5F7OA 1MHPA 3SFVA 3QPBA 2ZIWB 2NMVA 2G9UA 1XXLA 1AGYA 4H4DA 1DQSA 4ZK2A 1XVIA 2WSLA 2FZVA 1TYBE 3GQBB 4KUHA 3TQHA 3K09A 2NT3A 4UI9J 2JIMA 2VYND 1ECCA 1E5LA 1IZ9A 1VB5A 5DBOA 4Y2VA 1SUEA 3S7JA 1GDHA 3CB4A 3N2GA 3IOYA 4TXLA 3DEAA 3A1NA 2ZJ8A 5C4MA 1UXOA 4IIHA 4BUZA 3ZIDA 4RUKA 4QODA 2AE2A 4DI4A 2IQ5A 5CLFA 1RW2A 5A3JA 2AKAB 1NLFA 1SCUA 1Q1BA 2VI5A 4LRSB 2P2ZA 4XKJA 5GVSA 1XTQA 3PHJA 2XY4A 5CXQA 3M5PA 2WVAA 3ZXIA 4OHYA 3JRWA 3UG7A 3AB8A 2Y4UA 1V7ZA 5AK0A 4J0HA 4MS3A 2V7XA 1XQ6A 3NHWA 1WXGA 5IYZB 5KDDA 4RULA 3FBGA 1S3GA 4MQFB 3HN7A 3I9FA 3C7AA 5JS7A 4B8WA 1QE5A 4MTCA 4YDYA 4OHZA 3JD3A 3AFGA 2D0DA 2XUKA 1FMLA 4FADA 4MNTA 1BXKA 3CQ9A 4RJ2A 4GA0A 3WA7A 2JIDA 1CRZA 1QG4A 1WOYA 3NTOA 1F5NA 3P7MA 4WERA 1CB0A 2QPOA 3LPNA 4GKAA 1JDUA 3P0HA 5FJJA 2Z2IA 4DYDA 3HUTA 4WBNA 1A5EA 1OT3A 3MMXA 1G55A 1MZPA 2CHZA 2Y1EA 3VR0A 1ZGHA 2FF7A 5DLQC 3OQVA 3VYUB 3CWCA 4OHWA 4D9NA 5CCMA 3D3NA 3TH5A 3DCNA 2E0IA 4XUCA 5H4GA 2P9JA 2NAPA 4LCJA 3NHRA 3JQRA 4FCVA 1A76A 3PNSA 2P9FA 1SC6A 4CTOA 5D3MB 4FC8A 4D98A 5K0GA 1AQYA 4ADSG 2C96A 3KT6A 2ICAA 1PE0A 4JAVC 1G5IA 2HBZA 1XEFA 3VYWA 1NP3A 3HJUA 4J0EA 1SCIA 1YBFA 3T35A 1LI7A 2FN3A 3ESKA 1F3LA 1NC1A 1NBWB 3I4FA 2L19A 1L4KA 3DE2X 2VOJA 2ZIXB 3GZSA 3T4UA 4D8TA 1RWXA 4IGAA 5JASA 2OLKA 2RG1A 2JFVA 5IJ0A 4BC0A 4FX5A 4XAQA 5SYNA 1AP7A 4NRHB 4AP5A 4BP9A 4YAGA 3E81A 5A62A 3QBJA 5F51A 1IBSA 1VA5A 1W0KA 3BTSA 1VE1A 3K70B 2V7QA 3SDZA 2Z5LA 2F9FA 4FFSA 2VK2A 5K8VA 5A6VA 2XLBA 1Z25A 1QHSA 5EJEA 2F55A 3DQPA 3MUFA 3LF1A 2O14A 5JT1A 1OBCA 4KDCA 1ZH6A 3F3SA 4R8RA 4G25A 3RDPA 2GCEA 2DQZA 1ODTC 3AS8A 4AIIA 1HQKA 1N52A 4R81A 4E5MA 2NAFA 4DSOA 1MGOA 5HZGA 4H7DA 3ENNA 1V5WA 5EE0A 2WMYA 4ISCA 4ND1A 2VJMA 4AKIA 4MYCA 1I3CA 2XRYA 4RFSA 2H54A 4UE3S 5JS2A 3HN6A 1B8VA 5E4FA 1DHRA 1Q7RA 2VAPA 4CQJA 4BQPA 2YASA 3CK9A 5DWDA 3C6XA 2FRVA 1W9MA 1MRNA 4FFRA 3AR9A 5TE9A 2EFDB 4X60A 1U81A 3PFCA 1XTSA 4L8YA 1G8SA 4Q05A 2W2XA 3JARA 1OIWA 2YV2A 1YR7A 1WMDA 5C7LO 3K73O 1N4SA 2VPTA 3QKYA 2C8VA 5DWQA 3CVQA 1NV9A 4QRDA 3EARA 1W5TA 5CA1A 4DY4A 4KV9A 1ZK0A 2VTBB 1M34A 1GT91 5B57C 1E6LA 4FFWA 4CM8A 1SHKA 3PEYA 1GR0A 3WKAA 5LZ4A 4CGZA 4EBFA 4DG8A 5LWHA 2XYPA 3DNPA 1TN7A 4NIKA 1P3DA 1J25A 3DBRB 3FPKA 2ZUDA 3UQYS 2ZAYA 3O4GA 3R8FA 5AHKA 2CJWB 3AW8A 4D9KA 1RAIA 4B7CA 2YJGA 1YZ3A 2HPAA 4M9SA 3AS5A 3G1UA 3G0HA 2EW8A 2W2KB 2J0EA 3RGGA 1UC4B 1Z0UA 4FINA 3PWTA 3D6JA 5B1DA 2BPOA 3TSYA 1BU5A 4LFCB 2TRSB 1D2NA 5LP0A 4RY8A 4BLQA 4I1RA 1FJ2A 5LXTF 1H2RS 3GFPA 1FFEA 3SSAA 4BNKA 3OLCX 1MRSA 1C14A 3HACA 4O4HB 1Z6AA 1TK3A 3PQ4A 3CO5A 5HQ8A 3UIEA 1X80A 4LIPD 2IXGA 1JQ5A 5HS4A 1DBQA 4WNEA 1W36D 4TXQA 2V5UA 1JUQA 4CKEB 3BF7A 4N0DA 1T5SA 2VHCA 1RCTE 4PR0A 3QOXA 2HHJA 4JSRA 3RU0A 1TCBA 2L0XA 1VLZA 3HZRA 4BNZA 2M1ZA 1OILA 3KC2A 1QS0A 2JCBA 4QASA 3EMVA 1SKUA 1YJ5A 3AHIA 4JP1A 3UHJA 2VRWA 1R4MA 3U0BA 5F52A 4NCKA 4UNQA 1EFPB 1SUFA 2WB4A 1W1UA 5DO9A 4MGYR 2Q0XA 3TS1A 4RE5A 3ZIAD 3I61A 2WICA 2AW5A 3W8EA 2CYCA 3KEFA 4JT2A 5FHRA 4URWR 4IZHA 2UKDA 5F5LA 2OAP1 3B7PA 4XR4A 4JUCA 5BW8C 3AZOA 4BXOA 2WAXA 1CF2O 1N2JA 1VYHA 1IJEA 4ZQGA 2BE9A 4DM4A 3CUWA 1F4LA 3R5FA 1MB3A 2C07A 2C3YA 4X65B 4CQNA 1EU1A 4HAWA 1QB7A 4NS1A 2WYVA 4G0NA 1RIFA 3HWX1 3NF1A 3DEKA 3JXEA 1NJ2A 2YHAA 3P2IA 3S4YA 4YRKA 3DPSA 3OJXA 4UNNA 2PUFA 1QV6A 2VNSA 2Z43A 3F7OA 2XZLA 3URMA 3CVWA 4Y2GA 5M72A 2XNCA 4KFUA 4XPZA 2VK1A 5CLIA 4GW3A 1XXHA 4JBGA 1M6YA 3IKLA 1C8BA 3WLHA 2CCKA 5L4LA 1PTJA 1WQ3A 4FE3A 1ZEMA 1DJQA 4WLEA 2KX7A 4N5MA 2Y1LA 5C80A 2GN0A 1DQYA 3IQWA 4LISA 1RZVA 3GD7A 5L8VA 1PT6A 1RLUA 3UIPC 4PEVA 4YBRA 2BEWB 3D64A 3ZEFA 4PYMA 4BKOA 3NGLA 2FJEB 2H2FA 1N9GB 2REOA 2RFLA 4A2WA 1H0HA 4O4LA 2H3EA 3STWA 1G2PA 4DR7B 1YB4A 2WSSA 3VDRA 2Q99A 1X74A 3DDOA 2NNWB 1PJ3A 1W5EA 4L2IA 2RGGA 4FNAA 4AP6A 4CW7A 1A4UA 1GQOA 1I6LA 3M5CA 1Z38A 1BFDA 2BGLA 5BNTA 1KS9A 3M2TA 3TQTA 4R2KA 4DNQA 3JVEA 2BFWA 4IULA 1WDYA 3EOBI 4M8LA 3O2SB 5IVIA 4L74A 2IIQA 4OATA 5KYNA 1K6EA 1Y98A 5ANRB 1XPOA 1J0BA 5LBTA 5HJ7A 4D80A 1GXSB 1VDZA 1C5KA 1SMKA 5DGCA 2O2SA 2AVPA 3ZCRA 1QOPB 3SYNA 3PX2A 5KKNB 1AS2A 1T43A 4UPEA 3C4VA 2VXOA 2RCNA 3TKAA 3UATA 2ZZKA 3BWCA 3U13A 3IDZA 4NDNE 1BKSB 1WM5A 4LRQA 3LKDA 1Z3IX 2UZ4A 3E61A 4FVTA 3UX4A 3R9KA 3C41J 2NYRA 1TAUA 1H6KA 4M0MA 2ECFA 1FU7A 2INGX 5IHPA 5AK3A 1LH0A 2JW5A 4A73A 3GYGA 2I1QA 1HLGA 1OXMA 3ZYZA 5D84A 3CUVA 4G5XA 3ED1A 5DYWA 4DDWA 5FBZA 4MWBA 4DYVA 4BTLA 4YP6A 2WP8J 2IPAB 3TRDA 4JI4B 2G4LA 4DMRA 2B7BA 4OHVA 1RBZA 1TECE 4IIXA 4F53A 3DKRA 4AQDA 3NFRA 2WXKA 4PN7A 4JROA 1FQWA 1WDLA 2HM7A 1LDYA 5JAUA 5EYPA 4BHTA 2AJCA 2XYGA 2WM9B 2HXSA 4B3RB 2Z9DA 4CMEA 5IH3A 3W7BA 2JLCA 3PYMA 1YBAA 2CUNA 2FOLA 2GBPA 2HYIC 4WCVA 1QP8A 2DKNA 3CPHA 1WXQA 3SAJA 3EK2A 3WWCA 3DD5A 4N7MA 4HGNA 4HX2A 2QN1A 4FOTA 2GDZA 4HUQB 1Z4QA 1V35A 4RETA 2YRFA 3AX6A 5ESRA 1NVGA 4JPSA 4BAZA 4ZK6A 1BHSA 3TNYA 2ZBFA 3W3AD 1EXMA 4HNGA 1YR3A 3SR0A 4DPMA 2HD4A 3TN7A 2X4GA 1IM8A 2C2HA 5AKGA 3N58A 1E2UA 5LZ7A 4DBLC 3FJOA 2R5NA 3MSXA 2ZIZA 4IIJB 4DKJA 4B3MB 1C9EA 2ZSDA 1D9XA 3H05A 3Q7EA 5NULA 1J8QA 2ZBPA 5AVKA 3DMNA 2Q21A 3NBXX 2VOEA 3TDNA 4NYMQ 3GHHA 1TE2A 1FS5A 1A7KA 1JQEA 2PGNA 1YOBA 4Y7CA 1DKMA 1Y9DA 5LDDC 3TRIA 2X0IA 1FLDA 4XB1A 1W34A 2YQ5A 1NFRA 1TUEA 4OLBA 3TQIA 4UHJA 3DEJA 3S3TA 3WBKA 4TN5A 2YNMC 1FP7A 3RLIA 3NIFB 4IVRA 1FSSA 2A9PA 2DF8A 5JJ7A 2FMFA 5T6BA 1I80A 1KWGA 1XZIA 5GMOA 2XQ0A 2VDQB 4F8EA 4MV1A 4M53A 4MUKA 3E3MA 4L02A 1QJCA 3VLDA 1K4KA 3MCUA 4CEMA 3SJ7A 2BFNA 2ZRMA 1WSBA 2JABA 1XTIA 1YCGA 2XTNA 4YJFA 4YJGA 4NCBA 1RRGA 3F67A 5GIPE 4B3IA 4BX2A 1C81A 1ODJA 3LNCA 1C1DA 3QYPA 1JE0A 3I04M 5CFNA 2C2BA 1QPGA 2FSHA 3OT4A 1IN8A 2OUKA 1YI8A 1T0BA 1R8SA 4O4JF 2RJ3A 3OIWA 3TX2A 1OWLA 3N2GB 2JA2A 2NTYC 1NJSA 1YULA 1G8KA 3IOMA 5SY4A 1XTRA 3ZY6A 3KJGA 3IAM1 1SCUB 3KO8A 2BONA 4WXHA 3H17A 1F9EA 1M1NA 1IULA 1PJZA 3NDIA 5K9ZA 2IBSA 1L5KA 1OFUA 4Z4EA 1SG0A 1TT7A 1KOLA 5K3FA 1Z18A 3E58A 3ICWA 4HWTA 4GYJA 2IHBA 2ZE7A 4UTZA 5JMTA 1FYEA 4R1OA 1GPUA 4HXFB 2ESRA 3ESXA 4U63A 4NPAA 4FHGA 5CM9C 3PJDA 3BKXA 4YWJA 3I0ZA 4Q9KA 4GMDA 4YJHA 3Q9UA 3DWFA 5PGMA 1YH3A 3BSYA 2VN8A 1YO6A 4KPYA 4H4EA 1D2AA 2D3WA 4NU6A 4WBNB 2HDWA 4X3CA 5KS2A 1ZH8A 4ESVA 5FHQA 5AVYA 4AF6A 4F6LA 3WG9A 2MMGA 4KX3A 3QVMA 1J99A 2XI4A 5KYWA 2H00A 1QMOE 5ULLA 4MGIR 3KZVA 5BWNA 2YMMA 3TZQA 1U8UA 2VWGA 4KO2S 3WO0A 3IUMA 2J32A 3Q9NA 4B2LA 5F7ZA 4BGUA 1FFCA 3SVZA 5HKBA 4M1OA 3JQAA 3D4BA 3PNOA 1KR5A 5FI0B 2V5VA 2RC5A 4ND6A 1RPTA 2VLIA 1UP4A 1SRRA 4KK4A 3MD9A 1WJGA 3AM1A 1LPPA 2IUYA 5HUHA 3K1ZA 3NEJA 3ASHA 2XZPA 3DE3X 2YL2A 3ZLJA 2IFUA 3CZ4A 1JKXA 5C51B 4HBGA 4BVBA 1KT1A 5E9JA 1Z17A 2ZJYA 3ZWDA 5IJ0B 1JR6A 1OAOA 5KNGA 4AYWA 1MHQA 4UMEA 2RH8A 3G2IA 3MB5A 1C9MA 1MX5A 2FDCA 4HRYA 4I14A 1QCYA 2WF9A 1Z56C 4G1VA 5KYTA 1JBEA 1UBEA 4RHFA 5CXSA 5F35A 3PCRB 1NRIA 3V48A 2YRXA 3NKVA 1KEEA 1VMAA 4YRCA 3X1JA 2QD1A 1NYTA 4IIDA 2C5FA 3N74A 1E5TA 3JQBA 4YCJA 1XCJA 4UUMA 1MEEA 4J8DA 3ZCSA 2X0FA 3BORA 2BD0A 1LVGA 2CF5A 4ANVA 2ZCVA 2CZCA 3UA4A 3KXPA 4Y2XA 4XJSA 3R23A 2ZM6B 3UZUA 4V2IA 2FFQA 3ZYMA 1XNGA 1XR3A 3LC2O 2QNIA 1DX6A 3ROQA 4OUDA 1LV7A 4RFSB 4LJAA 1JZTA 5K0ZA 1ZD5A 1IC6A 2IEZA 4DGQA 4GEKA 3PT5A 4P38A 3WAGA 1RHKA 2ACEA 5FUQA 2XB6A 1MAVA 4ETIA 3S1AA 4AULA 1XOIA 4Z7QB 2GRPB 2YN4A 3RO2A 4O63O 4CV1A 5DDIP 2QX9A 1NBMA 1TQ2A 3HNRA 1CU1A 3JARB 2X9QA 3LBAA 1KJ9A 1J9EA 3J7TA 2RIRA 1TFUA 3AKYA 3FUEA 4TOIA 2H08A 1FY2A 3Q7AA 2IKSA 2VDWA 1ZH4A 2A5UA 5CA1B 4EO4A 3BZWA 1Y80A 2JJ1D 1M34B 2CHFA 3LHKA 2LWIA 5CGZA 3ZHSA 3ROXA 5AOVA 4ZQEA 1PWXA 5L7WA 5AJTA 3G9QA 3GFFA 1VPVA 4UPDA 2APJA 2ETCA 2DHDA 3JVIA 4IIVA 2FCRA 5F77A 1Q91A 4G23A 4D9JA 1F8YA 5JI2E 1TJPB 1JJ7A 1OWPA 5C8YF 5LKRA 4TMWA 3GDGA 1P8AA 2R6FA 4Y6LA 2PKRA 1MZVA 3BG5A 2HJVA 1WEKA 3LQRA 1GPYA 4CDRA 2AR0A 3CONA 3AOGA 3RBVA 3GUCA 3TTWA 2DLNA 4WKOA 5IG2A 3DDHA 4YDRA 4XDZA 2G8NA 2HJ9A 2X4DA 4CXMA 1JDTA 2BP7A 2W6JD 1U0BB 2CLKB 3K9HA 3DLAA 2Z3VA 3RF7A 1NU8A 3KE8A 1E1KA 1E59A 1HDCA 4LCEA 1X80B 5G40A 4ENUA 2GZDA 4HH3C 1C2TA 4ANFA 4R7LA 3GO4A 4OPMA 4TROA 3TTUA 1GQRA 4PZDA 4YAWA 2ZULA 5AYVA 4M3OA 2WYIA 4JI3B 5FTLA 1FTGA 4RVSA 1JRLA 4FYJA 1TTHA 2WNHA 1SKYE 1VZ3A 3Q4AB 1QS0B 1QFYA 1EDOA 3H19A 1ZCBA 1EDDA 2IZ6A 5DNWA 1YS1X 1G7RA 4C0EA 4YRLA 3ABZA 2OAQ1 2UYQA 4ZMBA 3DEFA 1R4MB 4J8SA 3HKDA 3IX7A 2P78A 5EG5A 4AJLA 3EIUA 1FP4A 4JLVA 1E5XA 5JJTA 2BTQA 1P44A 1WKBA 5KYXA 2DCMA 5KU7A 3CBGA 3EISA 1KOJA 4HN9A 2AN1A 1DMSA 4H6VA 4OX9Y 3EMBA 3CUSA 4RZSA 5HWSA 3RS2A 2JI9A 3X1YA 4RTSA 4UUBA 5BSWA 4LUCA 2NZ8A 3ZBQA 2GZMA 5CLLA 4GMKA 4DMGA 4BXOB 4LJ7A 1KH2A 1RKVA 3R5JA 2R68A 4EHNA 1E4YA 2W93A 3HCWA 3GJZA 3D6UA 2CHWA 5K7SA 4F3KA 4YP9A 3ZJVA 3WFIA 5CEAA 2XR1A 3R9IA 2YDXA 4GBGA 1PW7A 4WCFB 5LPNA 3REGA 2FUKA 3KL4A 4C4RA 2PJDA 4DTCA 2OV3A 1AKMA 1TO6A 2XCQA 4RPJA 1KZ9A 1FDRA 3BB3A 3UAGA 1T0JB 3CS3A 2A5YB 2PPLA 2AQIA 3TAXA 3EH1A 2JCSA 1K7CA 1XXHB 3FB4A 3PE3A 2PSFA 1DARA 4AYTA 2MSWA 4RGYA 4TTRA 1XMOB 3IRUA 4I5IA 2C99A 4ND8B 1PKEA 3RSOA 2IZZA 5CLHA 2WA2A 4PCAA 2VR1A 1XHFA 3OTWA 2I6GA 4G1EB 2HHHB 2FP4A 2BFAA 1RQLA 3EQ2A 4PZYA 1YK0A 2CMKA 3OHSX 2H2DA 1HQYE 5T8KC 5COAA 4KN8A 3ONDA 4GMGA 2JNWA 2X9LA 3I9V6 4I50F 5KTNA 4RY9A 4O4LB 2SECE 4PYKA 2RG7A 4XD7D 2C4KA 1GGFA 2IA5A 2ZRPA 2CW5A 2RBEA 3KQHA 5CNJA 4KLZA 4L7QA 4UVGA 3G9TA 5GOZA 1PP4A 5CM2Z 4L2IB 4MLPA 3V1NA 3BDIA 1BTOA 4OX9B 5EFOA 5ALMA 3FKSA 5J1TB 4AN0A 3ZOZA 2WHXA 4XEHA 2QWXA 3NTXA 3PDCA 1J8VA 1FUYB 5IBQA 2J6HA 4BCDA 5J5CA 1NBEA 1U9ZA 3UJNA 2BKKB 4IDEA 3MM4A 1A95A 4D3FA 1EESA 3PFNA 4G0YA 1Z22A 3B9BA 3NBMA 2P6NA 2VNKA 2R8PA 5G0TA 4NMMA 5E7JA 3CEHA 1TYQG 2O3SA 2AG0A 4LC0A 4OMCA 1VPTA 2CBZA 4RTKA 1FLNA 5FPHA 5LCXA 4JK3A 1JLKA 5LN1A 2RB4A 5JROA 2QT1A 2W6OA 3V8MA 3FMFA 1UW4B 2IP1A 1SQMA 1D4OA 4HOSA 1ZI6A 2H1FA 4EMTA 3R9XA 2HHLA 3KWFA 4MICA 3DLTA 4D57A 3W78A 1DKRA 5AK6A 5FIOA 5K3BA 2OEPA 3BL8A 4KIUA 3A3OA 3UT6A 4URUR 3HJHA 4EG4A 3JUIA 1NOJA 3CSDA 1TQ8A 4H7FA 2R66A 4ACLA 3OMWA 3DD1A 2VPIA 3R0IA 4FONA 1MX6A 4KDFA 3WIDA 1T10A 4OLHA 5CVVA 3DMPA 4NFYA 4REQA 3C72A 3ONEA 3K72B 3OCJA 5HEKA 5DBGA 1KPIA 4DR6B 1SKQA 2VNAA 4OBEA 3UPVA 5EYPB 4KNWA 5L3ZA 1B0UA 2I2BA 4FJ0A 3B51X 4OFBA 2DPXA 3M3HA 2DQYA 2R8BA 2WI8A 1EP9A 2JFOA 3IOBA 2I4NA 3O95A 1R64A 3ZVLA 4PCLA 1OYVA 2B7LA 2HZ7A 3IXMA 4MPJA 4RWZA 1Y89A 1TM7E 4PPNA 3WMEA 3JZIA 1PJQA 2P9BA 3LK6A 3LIPA 1DIBA 5AENA 4RZXA 4TQGA 1L7DA 3SU8A 3OFNA 3M89A 1EHIA 2HFJA 3BDVA 4J07A 3EJ6A 3RV3A 2O07A 4OA5A 2PGOA 4Q7MB 4UAVA 3IQIX 2BMJA 4UEJA 1UUFA 4B32A 1X5BA 1NW4A 2JJQA 3TR6A 3RJVA 4RD1A 1U4OA 3DSVA 3UF0A 1P45A 2XDYA 1T0PA 1FS6A 1S02A 1YSCA 5IDYA 2DZOA 3ISVA 4Z4HA 1XB2A 3LOPA 4RZIA 2RKOA 2HZBA 3ZV7A 5KX5A 3GA7A 4V3BA 4CTKA 3TOVA 2P9PG 2E55A 2OPHA 4ZVKA 2OZPA 3NALA 2OECA 2PZEA 4QM7A 3V8PA 1DCQA 3BXFA 3M34A 3BRWD 3OTIA 4FEEA 4DLRA 2G36A 2PKEA 4B75A 4X44A 3J80A 4FS8A 4IQ0A 2PZBA 2QR3A 5JZBA 4R8SA 3NTVA 3A28A 4DWOA 1WBDA 4JDPA 4EG5A 2FMTA 5EP1A 3Q5MA 1GGHA 3RU3A 3AT1A 4CUZA 4A16A 4I4TA 3HR8A 2EKBA 3HH8A 3NOXA 1Z7WA 3G5MA 5KTSA 4KXKB 4YJFB 4YJGB 1DG3A 4Q3LA 3U40A 2Z1DA 1RYFA 4L8FA 1U0LA 2Q49A 3D5QA 1EYZA 3QEJA 2NUPB 5DHUA 2VPYA 1MTZA 1HDGO 1C1DB 3ES9A 3W5BA 2J1LA 3DFFA 1HDOA 7MHTA 4RACA 4UULA 3LZCA 4JJ8A 2DYRE 5GP1A 1W44A 2J8ZA 4QBIA 2GM4A 2RC6A 4NP6A 2Z98A 4PNEA 2BKEA 1SOMA 3EWIA 4JJAA 3U09A 1D6NA 4M8SA 1RJDA 4YMIA 4AL4A 2UWJG 4KVFA 1QB8A 1OAKA 1JDSA 4XARA 3DLIA 5K3FB 4FWBA 3P94A 1ZUIA 4KPEC 3OEEA 3V4LA 3KPUA 2FN4A 5DHFA 2HDHA 4X8QA 1RLOA 4AIFA 4IG9A 3JD4A 4HGOA 3VR6D 1MC1A 4F72A 4AW9A 2WSMA 1ZKDA 3L04A 3AJRA 1J7KA 3GNSA 4YJHB 3OKPA 3COYA 4UHKA 5ALXA 3VUFA 4W5WA 1E3SA 4M1ZA 3D9JA 1V1RA 3OC6A 2VYVA 1SIWA 3FYTA 2Q0QA 4BKRA 3IR5A 3HXCA 5A7DB 3SNXA 3R3UA 1NVKA 3ANYB 4ZEMA 4YMLA 5KYWB 3E8SA 3HCPA 2OGUA 4UUPA 5ITZA 2ZUVA 4WK6A 4CRWA 2LSVA 2YRWA 1VKHA 2GKOA 3L1KA 2P91A 1E9BA 2G80A 3BOSA 1J2EA 1E9DA 3JAKA 1L4GA 3E9YA 4UE2A 2G67A 4UPVA 4F60A 3HWRA 3L9WA 3CNQS 2YWEA 1LRJA 3FPGA 4LE0A 4LCBA 4FGSA 5EMKA 4F45A 4HHEA 2A4MA 4DRXE 4IUYA 2QZAA 1ARZA 4W8GA 4WNCA 2OP1A 2I34A 1KEKA 1EK2A 5FR1A 3PNYA 4P5EA 1BA2A 1SBNE 1V43A 1AS0A 2OK8A 4ZGWA 2JLVA 2FSVA 3NGMA 5KVQA 2WXOA 2WUGA 2GVNA 1G3MA 1YF3A 3AIMA 3QPUA 3ABOB 3ULKA 3HRHA 1XKXA 3PIRA 2B4AA 4Y0AA 2PBFA 4KPGA 3CGGA 1QP7A 1SNYA 4HF7A 2WNSA 2H18A 3ZQKA 4DT1A 3ZI7A 1KEEB 1S6YA 1QIGA 2X6JA 1RJ9A 3FULA 1E9VA 2JCVA 4MVXA 2PL1A 2ZI7A 2CVPA 3RE1A 1U8TA 1T6YA 4FE4A 3IESA 1GHTA 3OMSA 3MTGA 4P22A 2H0AA 4ARBA 1KC3A 1UXGA 1MO3A 1NDQA 2HB6A 2VDVE 4XKCA 5KNDH 4Z0PA 3MWDA 1K92A 1IOLA 3LWZA 2GA9A 1Z5SC 5CW1A 1HG2A 4RVOA 5L7YA 5A4KA 3QM1A 5DMXA 2C04A 1CY6A 5EE5B 1PR3A 4OUDB 3QY0A 3VAZA 2PS9A 3TLBA 3ZJ5A 3MELA 3TNLA 1MB9A 3KEMA 2FR1A 1YQ9A 4E7OA 2IWRA 1D3AA 3LVBA 2HSDA 3DOIA 3S1AB 2FW1A 5I7RA 1Z5PA 4V03A 4FHEA 1E6MA 2J4FA 3EXAA 5AVVA 1EAMA 5A5DA 2NV2B 4G01B 4DV7B 3TVTA 3OX3A 2VDWB 2NC9A 1CEEA 1MB4A 4MEAA 2Y77A 1QIEA 2ADMA 4F38A 3RT1A 2H1HA 3NBKA 3SKXA 3VM6A 1Y9ZA 4G0ZA 4C0MA 4CV0A 3CZAA 4NH4A 4NOJA 3U3OA 4DJ5X 2JIZD 4MUIA 3H4TA 1K63A 3MMSA 2X5GA 1N2EA 2JFGA 3VSBA 5F5NA 4Q1AA 4LHWA 4EPVA 1NMSA 2IQIA 3SOZA 2WTMA 1BMDA 3C3OA 4CI9A 5A05A 3PEFA 3NHBA 4ABTA 1PEAA 3TQFA 1NZDA 3Q7SA 2V96A 3WLEA 5J63A 2PZ8A 2HREA 4PZPA 1KO8A 2PNJA 1SU6A 4N39A 2UZ3A 4CPDA 3FE2A 1DC7A 1NJ1A 2XA9A 2A5FA 3LG2A 4NZ9A 5IARA 3BGWA 2H48A 4RL4A 3G88A 1V47A 1SVIA 3RBAA 5TF0A 2BP7B 3UQ3A 2BCJQ 2QOEA 2A0FA 1AKQA 5JA4D 1O9GA 3QEOA 3DXZA 3SQNA 2A9OA 3C8UA 4Y6GB 1V71A 1FXWF 5IPFA 2ILRA 2JDID 3CTPA 2ZI9A 2UXDB 4ML3A 1OXKB 4GLLA 4HAXA 1XK6A 3U17A 1HE8A 5JQWA 2HA7A 1Z2AA 1FTSA 1XMQB 2PUGA 1Z4PX 3DLBA 4LYAA 3OCYA 1M8GA 3FOBA 2ZRCA 4BYMA 3HKDB 3VR5A 5JNRA 3QOWA 1X3SA 4BECA 1FP4B 2Q2NA 4OQXA 1ISRA 4TYPA 4YB8A 3P2KA 2BTQB 1XQ1A 3L8MA 1QONA 1BVHA 4JLKA 2DJIA 5DLYA 1EFRA 2RGBA 5KYXB 4MGEA 3JAMA 2OILA 2HPHA 4MW9A 1GYQA 2A1IA 2DPLA 3PQ8A 5REQA 3H2SA 2JCYA 4QPPA 1AQNA 3T0GA 3LT5A 1KU6A 2F8SA 4G5QA 5EJ2A 3ABRB 2EERA 4OV6B 3LLVA 1UM8A 3Q72A 1U7OA 4TV3A 3ELUA 2QA5A 3NTRA 1MJ0A 2XYHA 4F4FA 3ZDBA 3PXAA 3QU5A 8OHMA 4UHFA 1OSNA 1KFKB 1V5EA 4ASUA 1YZTA 2ZWMA 2XBMA 3QEMA 3WYEA 1ABEA 4K5BA 2HLHA 1OI4A 2OHHA 3KIPA 4JX9A 1K8YB 4QFDA 4B84A 4C43A 3U4CA 5AI9A 1E0DA 2PYZA 4DIKA 5F21A 4HDRA 5K8JB 1EVJA 4QDTA 3D8SA 2JHAA 2P4SA 4KXNA 1SA5A 4W5OA 1XTJA 3NX4A 2WJWA 4M0DA 2SNIE 3VJLA 4N65A 4J1NA 2B3TA 2X5KO 1Z5ZA 2GT1A 2IIPA 4CM6A 1N6NA 2GRJA 1DEXA 2IW3A 3HDXA 2NO1A 4JSYA 1QAQA 4O4IF 4GYWA 4HVCA 1JU9A 4KXQA 4CHTA 5IU6A 1P7PA 4GM0A 4X8HA 4DSUA 3E3LA 3D9HA 2FPIA 3QU9A 4XWAA 4ACBA 1YRWA 1VI2A 3QHAA 2AFVA 4C7VA 2FP4B 4IQFA 4LWOA 3UJCA 1GSHA 4RDHA 1Q0HA 4FFLA 3OQPA 4H0NA 3K5PA 4J6EA 5HFNA 4R2HA 2AC4A 1E3LA 2GAJA 4BB0A 1LI5A 3TVDA 1H85A 1OV6A 3AKCA 4Y2JA 2X8JA 4DQXA 1P0FA 5HUQA 3S44A 1XZPA 2O6LA 4LYHA 5AJYA 3T5CA 1OFHA 1ZUHA 4XEUA 1JG4A 1BGXT 4UTXA 4ARVA 3DL4A 1YAJA 5I8WA 4LVUA 4RF3A 4TTJA 2OLJA 2AUTA 2NVUA 3MHPA 3BC1A 2ZYTX 5AVZA 1JA1A 1G8GA 4AMBA 2IPMA 4M89A 3LFTA 5DTJA 2EJCA 3W7VA 3F71A 4EMSA 4F3NA 1U04A 2H1CA 3LCRA 4G9GA 2JGFA 5FQ6A 3BK1A 4LBYA 4YPVA 3HDYA 2Z2JA 5FOXA 4ZXPA 3U3RA 2G1KA 4E1VA 3U19A 3OOYA 3INGA 2A5LA 3TLAA 4ZYTA 4MCIA 1AC5A 3LUPA 2AOWA 4HADA 4RHEA 4M8KA 1Q7CA 1CZOA 4EG7A 3TMAA 1Y3HA 2CMFA 1QDLB 4M7OA 1NXTA 2PZKA 2ZSEA 1EZZA 1E3WA 4M22A 5ALQA 4M9UA 4YY3B 3T4PA 2X5XA 4PHFA 4NENA 2QDXA 1VG8A 3G8DA 4DUPA 5E0KB 3K9GA 4PSCA 3KEZA 1P1CA 3ZCVA 1CJBA 4LF7B 4REQB 3CY6A 4ER7A 3HY3A 1UWVA 2FLKA 4HGZA 3SQWA 1G7CA 3A4VA 4LPKA 4P1ZA 4U8GA 3IT1A 4DBZA 3Q1KA 1FC0A 1SHTX 1KZYC 2DR2A 1JWGA 3NW9A 4LYGA 4UZEA 4M83A 3AF5A 1FX0A 2O1EA 1R5OA 1XRPA 1E1QA 5J9FA 3CNBA 3X0DA 1E0KA 3FBTA 3MAGA 2VHTA 2X0NA 1QO9A 3B95A 3FHJA 1N5OX 4YUYA 3U64A 2UVPA 4EFNA 4GTQA 5EJ5A 3DSUA 2DPYA 6GPBA 2VK4A 4TT3D 4OXIA 4MO2A 3UAZA 5CA0F 4GRAA 2V8SE 4PX5A 3PXDA 3JYLA 1NUUA 3BGIA 2P4UA 1WSAA 1VMIA 1B6RA 1JAYA 5IT9A 1SHUX 1TVMA 1TMGE 4LJSA 2RHDA 4C0XA 3MBIA 1YI0A 3IL2A 3VPCA 2PH7A 1OFTA 2FTKE 1QIFA 1CWUA 4B4OA 3N2LA 4ZZ0A 2KCKA 1I51A 4EY3A 2R4TA 2Z6AA 2BZGA 2AN3A 1KI2A 1E7QA 2WF6A 3AM5A 1VL1A 3LS2A 3GFGA 5JCJA 2EOAA 4RVDA 2AF4C 1UKAA 3EW7A 3K6KA 5EVCA 5KX5B 4EZKA 1W5BA 3ZZUA 1R0WA 4X61A 3DLPX 1NUQA 1Z35A 3LPMA 4L0CA 2Z5VA 4PU0A 1GITA 4LSGA 3WNDA 3CZPA 4YQZA 3VHRA 1ZM2A 3RSLA 1RAFA 3E53A 3JU3A 2E4VA 3L22A 1J5PA 3TTTA 3ZTYA 2CE2X 1U8XX 2F59A 3JVVA 5F9MA 3ZUVB 3BWVA 4NAVA 3V2GA 5IH7A 2XCSB 4WL0A 2BRUC 5K3DA 2X6HA 4D4MA 2IYOA 3LL4A 3UG6A 1CY8A 4I4TB 3FUCA 2AT1A 3QNUA 3WICA 4WKCA 3WL4A 2QZZA 1ZNXA 2B8TA 2LUHA 2Y3AA 2BY4A 3H9EO 2DVWA 4PZLA 1ZS9A 4D0GA 1VSQA 3NTLA 4H1HA 2QI9C 1JECA 1TU0A 1GZ6A 3LA8A 4L57A 1PQPA 4XWGA 2WVGA 4ZI5A 1DXHA 4CL8A 5B5SA 2FPKA 2NO7A 4A2CA 1Y8AA 2JBWA 3VDXA 1AK9A 3P0EA 1DQPA 3SZ3A 4EYKA 4OYHA 5KJKA 5E2AA 1QRTA 1JCSA 4Y6QA 3EIHA 1UN8A 5FOWA 3C5WP 4L23A 3KUKA 4KLRA 4DA0A 5EJIA 4DG5A 4F4JA 5A1JA 2IT1A 5KAPA 4LSZA 4BRUA 1VLMA 5GINE 2P3LA 1SQFA 4MIYA 2Q5FA 1CY7A 3KU4A 1YFZA 1N7HA 3ZZ0A 2Y99A 4RFVA 1FEZA 3DOCA 1EX9A 3UUEA 4A3VA 2KXPC 1IYZA 3IKJA 3VU9A 5KBAA 5FQNA 1PT5A 2RD2A 1OTYA 5LD2B 1T1SA 4LEUA 1ZH2A 4CM4A 1QBQA 4C3VA 2JFUA 1RRKA 3GGSA 3SHTA 1H6DA 2ZJBA 1TAGA 1UFOA 4LJ5A 2AC2A 2B2CA 5AW0A 4JI8B 1GTSA 2FETA 1JAHA 3T7AA 2CVHA 3RVQA 3FU0A 5E9WA 3GC6A 4JC0A 5CCBA 1LJUA 4BNXA 2IUSA 4HSGA 4H7YA 1VHQA 4OH1A 3GLRA 3H9QA 3PSAA 1U2PA 2ZAMA 1LNQA 1V1RB 1GU1A 4OYSA 3SP1A 3PPYA 3KPYA 3WNQA 2J3EA 4Z8XA 2C54A 1WVGA 3T41A 3HXTA 2GBLA 4QJIA 4MWCA 1MEJA 5ITZB 3EULA 1XJ5A 1G98A 4G0OA 5HVNA 5LJLA 4CRWB 2IY8A 3Q6IA 4NBKA 1UFRA 2I33A 4KGXA 4IWYA 4COKA 3T8YA 3HCRA 4GXQA 4IHJF 4RJLA 4M0UA 1X2EA 1VL5A 2BFOA 4PDXA 1JILA 4GC5A 2YCBA 3ZCXA 2BDUA 1N1EA 4BCBA 3GVIA 1ZN9A 4KDRA 1EWKA 4IHQA 5GIOE 4DIDA 5AKYA 5GONA 1DKNA 3G3EA 1OIXA 3GWGA 3JQ9C 5HKOA 2H1LA 4PBTA 2I67A 4TZ6A 3CKKA 2DCUA 5DEOA 5JAMA 4B89A 2P5SA 3PQ2A 1S2MA 3MZLB 5CTJA 3DOOA 3H5OA 4NLLA 3FUNA 1QUFA 2DH6A 4ZPJA 1F9AA 4RA6A 1W76A 1DFIA 3E37A 4DT1B 4U00A 821PA 3EA5A 4INZA 2PT6A 1RJ9B 3NC1C 1T9CA 1R4ZA 4OHKA 1J9GA 4GR5A 3VCXA 2OCDA 1ZDMA 3O2NA 1SKMA 3CVPA 3MGBA 2IYWA 4NBUA 2P0AA 1HNZB 2VH5R 3L4JA 2X14A 5CDYA 3UWKA 3MWDB 3PXXA 2WJAA 2OE2A 2PX3A 2Q3JA 1Q16A 2F1IA 4UNSA 1TM5E 2PQNA 2PJZA 3LQ2A 1AGRA 3QFFA 1W2GA 3DZFA 4JLDA 5IULC 5AW2A 2GF2A 3OA2A 1Z4JA 3CVOA 1TK9A 2VBCA 4U4AA 5KCMA 1PQ4A 2ZVJA 4HXYA 1K89A 3ASUA 1IZZA 4DEVA 2EAUA 3HYSA 3QJGA 3IKOB 5THXA 5L3VA 3FVTA 3L6DA 5EC8A 3I1JA 3E9CA 2W5UA 2ZIEA 4YLGA 4RV9A 1T2DA 2FP3A 1U8CB 1TC2A 3IV0A 1O9BA 4NACA 3I2YX 3QVSA 3RIMA 4LOLA 1DJMA 3OZGA 3CIAA 1MORA 2ZAIA 4LJ4A 4F5YA 3TGOA 1KRHA 1QLHA 4XJXA 4YCAA 3HBFA 3V46A 3TJRA 4R1UA 3FLEA 4M9CA 3MG9A 3Q5GA 4YP0A 3BEDA 5HM8A 1MGPA 4BE9A 3SGLA 1K68A 5C2JB 1VSBA 2PBZA 5B3JC 3QE3A 3FTQA 4JVNA 4GPTA 1RJWA 4JUBA 2Q3BA 5FV7A 4GQBA 3EF0A 4J7XA 1UFKA 3HYLA 4F3YA 4M0EA 5EWJA 1YTUA 4M8NE 4N3AA 1HH8A 2FF4A 2Q3FA 3QTTA 3KHTA 1YAHA 3MTJA 5CVCA 3I52A 4TKLA 4A0QA 5H68A 2C2ZA 1BKDR 2JFQA 1GZ5A 1K86A 2GD1O 3B7BA 4Y2QA 2GDJA 4WESA 2XA2A 1ZL0A 4L7VA 1ZZGA 2QRVA 3I9OA 2PX0A 3OIFA 1JMKC 3SF0A 1WRBA 4OFZA 4EF6A 1E2KA 5DCLA 1N5JA 3OZDA 4AXHA 4YCSA 2GVZC 3MGKA 5T64A 3EIFA 3OLYA 3CKCA 5AW1A 2R25B 3O91A 4UUQA 3EBLA 4LHVA 1KZHA 3CX3A 4YT2A 1HE8B 4P0TA 1Z6TA 4O8ZA 1U90A 4UOZA 3IQXA 4PYJA 3A31A 5EAIA 3AY7A 5FAKA 1JEYA 4OYRA 3EUEA 4AU1A 4UQPA 1G2QA 3SZLA 1M66A 3GW8A 5JYDA 4B4UA 2WM2A 1PR6A 1ZLYA 4MWOA 3HDJA 4AECA 4OJNA 3P9SA 2HF8A 4RAOA 1AB6A 1BFUA 3EFBA 1I1HA 3GRPA 2GVDC 1YRAA 2V6IA 2YV3A 4QOSA 3EPLA 1H4SA 3O4FA 3N3AC 4Z53A 4L2YA 3P2OA 3I04A 4PLZA 4ER0A 3Q3IA 2V9CA 5REQB 2I4OA 1H42A 4H27A 3GLQA 4J3JA 1WW8A 3ONFA 4BV8A 4KXYA 1Q12A 2FRDC 2G83A 1CIJA 3RFXA 1ZSYA 5DNDA 5CLQA 1NASA 5AQAA 1KHHA 2IEBA 4XFDA 4KRFA 4MS3B 3QEMB 5HA5A 1GQQA 4PZEA 3EHNA 4FMDB 5TEVA 4GBJA 4HDRB 3L84A 3QARA 4UQOA 3H86A 3A6ZA 1HF3A 5CCEA 2D7JA 4CJXA 3DA8A 3L7DA 1L4BA 4DEYA 2A1TS 1FL9A 2E18A 2IP4A 3RK6A 2NGRA 1S0PA 1UFVA 3Q15A 1JEEA 2YW2A 4GF5A 3GT3A 2Z8YA 1F7VA 3LBFA 2YV1A 1WY7A 2RH4A 5BSMA 2EIME 5A4DA 5IM4F 4FOOA 3UXMA 1D03A 1E1CA 2GRRB 2FPIB 5T8IA 3G6KA 2QMHA 3I42A 3IJEB 2VUHB 4AP9A 3HXEA 3V8VA 5AHXA 221PA 4GNRA 1AZLA 1DWOA 5AI0A 5ECYA 3OE5A 4C87A 2HSJA 1E7UA 4WN3A 4JZKA 4PFSA 4OYYA 3OUTA 3MD0A 2X8JB 4GVXA 4ZANA 4MRAA 1V9LA 4HMQA 2OUIA 5KYVA 4TMFA 3H9GA 1L5NA 5ENRD 4NS4A 1GNRA 1J1ZA 1UKEA 1NF2A 3OWHA 3O93A 4C01A 2NVUB 4UTPA 2K6GA 1E69A 1CIVA 3C8DA 3FTYA 3ZHQA 1Z9BA 2EGUA 5DRYA 5JAQA 1YJQA 4NICA 2IU4A