4GZ5A

Crystal structure of human o-glcnac transferase with udp-glcnac
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
716
structure length
700
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 265
structure length 700
sequence length 716
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz5A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz5A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gz5A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gz5A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gz5A03
4MI6A 2XCUA 4NQ0A 2YJNA 1GFZA 1W3BA 5ARGA 3URZA 3O3CA 5LCWJ 4BT9A 2C0LA 4I17A 2VYIA 5KJMA 1NLMA 1YGPA 5D0QD 2IW1A 3IAAA 3MRXA 4I9EA 4G1TA 5D0OD 1L5VA 4GCNA 1F0KA 2R60A 1OUVA 3DD1A 3BEEA 4AY6A 4Y6CA 3UUXA 4Y6WA 1FU7A 2XA2A 2R4UA 3MT8A 2UY1B 2GT1A 3CUTA 2F9FA 3CV0A 2F3QA 3L01A 5DLDA 2H1HA 4G23A 4WNDA 4N2SA 1F6DA 1RZUA 3QWVA 1B4DA 1NA3A 4UQXA 4I2ZA 3LY7A 3N71A 1L5WA 3QKYA 2DBAA 3GZ2A 3IEGA 4EJ2A 3OY7A 1LWOA 6GPBA 7GPBA 4X7MA 1PYGA 3LPZA 4ME2A 2QRQA 2FI7A 4GYWA 2AV6A 3CV3A 3MS4A 4RG6A 4UI9K 3ASGA 3H4IA 1C8LA 4WACA 4UI9J 4HOQA 5ARFA 1JEJA 2R5SA 1NOIA 3TG5A 4YI5A 3COPA 2R4TA 1FTWA 3GW4A 4GPBA 3D0RA 4REMA 3PE3A 2PQ6A 5TMDA 3R9AB 2IV7A 2XA1A 3EDTB 3CUUA 2VCEA 3BCUA 1FC0A 1E4OA 4GCOA 3QWPA 2C1ZA 3AMVA 3RSZA 4EL0A 3ASFA 2PQRA 3EBOA 2IFUA 5D00A 4AMGA 3OKCA 2IV3A 3S7DA 4HWGA 3FWVA 3MS2A 2PYDA 3GYZA 5TMBA 1QM5A 2G9VA 4M60A 4RIIA 3BD6A 3TAXA 5JJ7A 1Y6FA 4N2QA 2PRIA 4F97A 1KT0A 2QN9A 4G25A 3OXLA 2J9QA 3NCHA 1NOJA 3HBMA 4KXKB 1Z8DA 3T3GA 1L5QA 4N3CA 4BQFA 2QN2A 1WAO1 2LSUA 4MHSA 4EKEA 3GZ1A 3VUFA 3MA5A 3T3HA 2YQ8A 3MRTA 4RELA 4WHMA 3LKUA 2O6LA 4UQZA 2ATIA 3C4QA 1GZ5A 1C3JA 1L6IA 4PQGA 3CKCA 2KCLA 4G26A 5FZRA 4UQYA 3E3LA 3OY2A 3IA7A 3DDWA 2QN8A 3TOVA 1WM5A 2GEKA 5TMEA 2I6HA 1QQEA 2IF4A 2R66A 1UQTA 3T3EA 4NESA 2VGXA 3CVLA 5CHEE 3DDSA 4BTBA 2QRGA 2JJMA 3VDNB 5A7DB 2HO1A 2XGOA 4M83A 3NB0A 2X6RA 1JG7A 4AY5A 5FZSA 2F3PA 1Z62A 2GJ4A 1XOIA 4I1AA 2V5FA 4X7PA 1A17A 4F9FA 2BGTA 3VTYA 3CVQA 3ZGQA 3Q3HA 2YHCA 3MV2B 3KS2A 4BTAA 8GPBA 4H7XA 3HBNA 2F3UA 3O48A 2KCKA 3Q3IA 4BQIA 4CTOA 2ECPA 1UZUA 3EBPA 2L6JA 2FFRA 2LNIA 3RO2A 5FTPA 3UPVA 2Q7FA 4U0ZA 3D0QA 4CTNA 2HYZA 3BCRA 3E3OA 2VSNA 4MI9A 3OXFA 4HORA 3MS7A 5KJKA 2PZIA 4N5CA 5G05C 3U3WA 3UYLA 1XKXA 1NZFA 4QLBA 3CEMA 1FA9A 4NEQA 1E1YA 3TG4A 1Y6GA 4WNFA 2E2EA 2P58C 1NVKA 2XGMA 3T3IA 3T7DA 4I2WA 4EL5A 3RKVA 2UY1A 4XI0A 3MSCA 4NC9A 5EKQD 2WTXA 1GPYA 4O6FA 5DIZA 3T5TA 4GZ3A 1A8IA 2QRPA 1Z6QA 1TJCA 2VQ2A 4H7YA 1C50A 3L7DA 3MT9A 4RIHA 3T3DA 1WUYA 4W9RA 5AYWD 2BFWA 3H4TA 1FTQA 3OKPA 4BT8A 3CK9A 3NP9A 1P4GA 4AM9A 4B94A 1QKJA 1HH8A 2QRHA 3MTDA 4W6QA 1B89A 4GPKA 2GPNA 1FS4A 1FTYA 3ZCPA 2KC7A 1Y8MA 3E4BA 4KQ2A 5CCLA 5G05J 3S7JA 4HOUA 4YNDA 1KT1A 3Q3EA 1K08A 1O6CA 3FP3A 1NZDA 1RZVA 1WV0A 2F3SA 4RENA 2XCIA 3RIBA 3SYMA 4HOSA 1PN3A 2LSVA 1QZ2A 5BNWA 1L5RA 4AN4A 3Q49B 5CCMA 4LDPA 3WADA 5LQDA 5JTTA 5FJYA 1ABBA 2XA9A 3OXGA 5KJLA 3QHPA 2QFCA 4MI3A 5ENZA 5TVGA 1ZU2A 5DU2A 1IIRA 2C1XA 1ELRA 2AMVA 1BX3A 3KAEA 3LY8A 2QN7A 3ZCSA 2NC9A 3LY9A 2Q6VA 4MHOA 5GPBA 4BQEA 2QNBA 3S28A 1J39A 3JYSA 2BISA 2QN1A 3RU0A 5BW8C 2XMPA 2JLBA 3CKBA 3S7FA 4A1SA 3QWWA 5JJ6A 3HBJA 3ZCTA 1SXQA 5HQ8A 1L7XA 1P4JA 3OTGA 3S2UA 3K9IA 4NRHB 1KLXA 3NF1A 1GGNA 3G2NA 3BCSA 3BD8A 3BEOA 4G2TA 2Y4TA 3ZPJA 2H1FA 1JIVA 2GM9A 3BDAA 3RJVA 3CUWA 3QOUA 4M7PA 3Q47B 4GYYA 1HLFA 2GEJA 4RBNA 4YVOA 3OTIA 2XPIA 3CEJA 3S0JA 1PC2A 4N39A 2QZSA 1K06A 2WQHA 3ASHA 4I9CA 2VGXB 1Z6PA 1E96B 3NP7A 2KS6A 2XGSA 3ZCRA 2OOEA 3TGOA 1H5UA 3MTBA 3S27A 4GZ6A 3CEHA 5I45A 4XIFA 3ZHEB 4GA2A 2BUGA 1V4VA 1P2DA 1EXVA 1NA0A 2KCVA 2FEZA 1XC7A 2GPBA 2FF5A 2IUYA 3L79A 3MT7A 3VTXA 2VSYA 3GPBA 5HXAA 2GPAA 1ZBPA 4YI3A 2C2LA 5EX3A 2AZDA 3CK8A 2PQNA 3L7AA 4GA1A 3TSAA 2PL2A 3G2KA 4RIFA 1IYGA 1UQUA 1YA0A 4RG9A 1FU4A 4JA7A 1P29A 4APOA 3NPAA 4IN3B 5HI7A 4RIEA 3ZFWA 3OTHA 2HY7A 4J8EA 2VG8A 1RRVA 5D01A 3E3NA 5FZQA 2QLNA 2X0DA 1IXYA 4JL0A 3L7CA 1WV1A 4U07A 2G9UA 3L7BA 4RIGA 4UI9C 2ASVA 1L5SA 4ABNA 3BD7A 4GZ5A 3OT5A 5IKOA 2FF4A 3OKAA 2ONDA 4KQMA 3D1JA 1P2GA 1JIXA 2BGUA 3ASDA 4WUYA 1FU8A 4EQFA 4BWRA 3CVPA 4EKYA 1PNVA 2AW3A 1HXIA 3SYRA 2GW1A 3KD7A 3VDMA 3CVNA 3CUVA 4WADA 3UYKA 2FBNA 1GPAA 2OFFA 4KBQA 2ACWA 3NC4A 1VGVA 3VUEA 3Q5MA 2FO7A 3WAGA 2UWJG 5C1DA 2ACVA 3CUYA 3RT1A 5G04C 2MHKA 2VGYA 3G2JA 3QKWA 1LWNA 3ULQA 3AS8A 3G2HA 5DBKA 2XCCA 4F96A 5KJNA 3MEKA 1PSWA 4X6LA 1WW2A 5DXFA 2X6QA 4U04A 1XNFA 4Z5XA 2IEIA 2FETA 4J8FA 2SKEA 4MRAA 4U0UA 1GPBA 4GYOA 4FZRA 4N9WA 4GA0A 1YA6A 3C48A 2ZB2A 3HYMB 4LEUA 2G9RA 2PRJA 3UQ3A 5JTUA 2QLLA 2P6PA 3LCAA 4HLNA 3C4VA 1XV5A 5FT9A 1WUTA 2SKCA 2PYIA 3S7BA 1P4HA 3HBFA 1ELWA 3DZCA 2X0EA 2Y4UA 2JZCA 3MBOA 3ZN3A 2R68A 3WC4A 3ZCVA 3U4TA 1JIUA 1WW3A 2IYFA 1IHGA 4BFCA 3PE4A 2SKDA 3RSCA 4KYOB 3ESKA 3NAZA 5G04J 4AIFA 5M72A 1NOKA 3MTAA 3MV3B 3S29A 3AS5A 4CGWA 2IEGA 2KATA 4MICA 3G2LA 4YUAA 3ZCQA 1EM6A 1JG6A 3GUHA 4G24A 5JJTA 2HR2A 2C0MA 3FROA 2XEVA 3G2IA 4N3AA 4WNGA 1Y8ZA 2AVPA 3CK7A 4LEIA 4J0UA 3CEQA 3Q4AB 5LCWC 3RO3A 4CTMA 3ZCUA 1AHPA 1AXRA 1FCHA 1XL1A 3QDNA 3WXXA 4G2VA 5BT1A 5EX0A 4JA9A 1P5QA 3Q15A 1GG8A 3PDNA 5IKPA 2WPVA 4J8DA 3CX4A 4F3VA 2C4MA 4JHRA 2QRMA 3MQFA 3LYAA 2C9ZA 1M5RA 2XCBA 4CGVA 4FKZA 3RHZA 4WNEA 2QLMA 3ZHEA 1NZNA 5A6CA 1C8KA 4L22A 4XI9A 1KTIA 3SF4A 1P2BA 3FFLA 2IYAA 4U0SA 4N3BA 4YVQC 3MRVA 3AS4A 2X0FA 2QN3A 2VCHA 4X7RA 2G9QA 4HOTA 4AMBA 9GPBA 1XL0A 1HZ4A 1SXPA 3SZ7A 4KQ1A 3MKRA 4CDRA
chains in the Genus database with same CATH superfamily
2YJNA 5AOAA 2OD9A 2HLHA 3LGXA 1FRQA 4IH4A 3SVTA 1ZKMA 3ZYKA 3FBTA 3PNQA 3O0TA 3X2QE 1H5NA 2H29A 5LNK6 2PT6A 3EWSA 2OHIA 2GEDA 4IDDA 4XASA 4KPUA 2DG2A 4KZKA 1PRYA 3EVAA 3Q5DA 2MOWA 2RGAA 2Z5LA 3G7NA 4S3MA 1L5GB 4GI7A 1EK5A 3E8SA 5FHRA 2HPAA 2CDRA 4K9RA 3IXLA 3DW3X 3W3AD 4RTJA 5ALPA 4DMHA 1Y1KE 3IP6A 2VDVE 3IHLA 3MB5A 2AC4A 1W6UA 1JQ3A 5LXTF 1JL3A 3B9BA 1TMKA 1KOJA 2K4MA 3NC0C 1W25A 3R0JA 1E1CA 2XWBF 2C4UA 2A5UA 4YWHA 4RCYA 3ANXA 4HDQB 1RXUA 1Z33A 3CUEF 3QEJA 1XU9A 1T10A 4NS4A 1TM5E 1RTKA 1OXVA 2OCBA 2ZEJA 3PR1A 1DIOB 1YD7A 2NXWA 3OJLA 5JMWA 1Q92A 2GETA 5EXXA 1JBKA 1YB5A 3OH8A 4DANA 2BHRA 2ROQA 4U7TB 8GPBA 3I9JA 1VPWA 5BMVB 4CTNA 3AHGA 3IEXA 5FYDA 5ELXA 2C7GA 2EIJE 3O47A 1ORWA 3TQRA 621PA 2ILVA 2QTNA 4CE6A 3A4TA 3ROFA 4X8MA 3ROEA 1H2RS 3E27A 2YNQA 1LSUA 1ZMTA 4IRUB 2I78A 1JFSA 2XEEA 4UYJA 3F2IA 3O91A 2IS4A 3S2AA 2ILRA 4M8NE 2G77B 3MA0A 4YC7A 5E1MA 3LCRA 1ZDMA 2VRWA 2Z4SA 3DO6A 5GPBA 5MN5A 3I2FA 4LOLA 2VEDA 2Q0HA 3AXTA 1S4MA 3AG4E 4QJIA 4WW0A 3V4FA 2X2FA 1SBQA 3TTSA 1FDVA 1NG9A 2O8NA 4NJMA 3A70A 2O2HA 3L22A 1N9ZA 4RPLA 3ETNA 4FWBA 2YDYA 2X5GA 2DSNA 2Q1UA 5K2OA 3MTBA 1T5DX 3A4VA 1ZD8A 1NKSA 3ZWPA 1UC8A 5FF9A 2CVHA 2WY2D 5B12A 1J06A 1GQOA 1HSOA 4DIMA 1VL8A 4IIJF 3I34X 4ES6A 4AF8A 4EJSA 4QU8A 3BS4A 2P6UA 2OV6A 4DNPA 4QXPA 5HMLA 1WV1A 5EXDA 2R5WA 3RC7A 4EF4A 3WXBA 3A6DA 4RY2A 3ZK7A 2ONYA 4N7RA 4RZHA 4UBLA 1PQWA 4D9MA 4J3NA 5D5PA 3VDMA 4LJ7A 2GAFA 4IVNA 3IRUA 4CIYA 3ZIAA 1TXGA 1UM8A 1CR2A 3D5EA 2QR2A 3D6UA 5KINB 2IKSA 3ZJ5A 4MUMA 3UUGA 2VH2A 1XB2A 4GEKA 3WG7E 1WSWA 5DXFA 1YACA 1IK6A 2VTVA 1X86B 3DE6X 3T7JA 1E5XA 3K0FB 4OP2A 4BFZA 2LVBA 2HCFA 4KT6B 4MR8B 1MTOA 4OHUA 4B6OA 2VJLA 4EECA 5KWJA 4R3UC 2B1IA 1S3FA 3H97A 2DBYA 4HN9A 2RKWA 1P91A 1L8AA 2YR0A 2ZBEA 1DXQA 5LIRA 2I67A 4M9XA 4G24A 1AUVA 2RG7A 1HKHA 3QX8A 3V2HA 4ASUA 2HLDD 5EJEA 3EIOA 2ZG6A 3N75A 4AW9A 1XL1A 2WXKA 1Q7GA 3WA6A 5TSDA 3WL6A 3V3TA 4JGGA 4GSLA 2JD0A 2X8AA 4URYR 4ZYLA 4HXYA 1XX6A 3R74A 4KL8S 1RHRA 2XPCA 1UOPA 3ILVA 1I4DD 3DHWC 1MA0A 4C6TB 4F7WA 4N03A 5E6RB 3VPDA 1EK2A 4KFUA 5EZ5A 5IAJA 4O08A 3ICCA 1RNLA 4ZEVA 1OQAA 5C1BA 1GG5A 4P7BA 1OIVA 3O5AA 1RRCA 2H1OA 4UQXA 4MVJF 2DK6A 1MN6A 1YI1A 1NQTA 4I8XA 4TS1A 4L0DA 1OBHA 4R8SA 2NM0A 2I2FA 3WDSA 2AR0A 4BVHA 1BG6A 1JTVA 1RCFA 2XA1A 3TLEA 3D81A 4TTIA 1F1BA 5JY6A 4NCHA 2QX4A 2IFUA 3OKCA 5F78A 3GG9A 3LNTA 2XOXA 1RCUA 1A8UA 5C7OO 4GB9A 3ZWQA 1UAGA 1DDIA 5SYNA 3H16A 3GLIA 3UUEA 2Y77A 4E32A 2LE0A 2V97A 4IDAA 2AOUB 2R6HA 4N7MA 3ZU4A 2YBEA 5FH9A 1B3RA 2WTBA 5CHEE 4FDUA 4L8FA 1BHJA 2OBLA 1TYQG 4UFOA 2VRBA 4PS0A 2CLDX 4TT8A 1VPTA 3SKVA 2DBVO 3UOWA 3KS2A 3JR3A 3JASA 1SWVA 3V31A 1PVOA 2OAGA 3KPUA 4ZCSA 5EUMA 2XQKA 1FVHA 2WHQA 4U2CA 3WNDA 4LUCA 1EZZA 3K70C 2CHZA 5IAOA 4TT3A 2ADMA 5JSZA 2DR3A 2IUFA 1ZRMA 2XWJI 3UK6A 3HJUA 1U94A 3I30X 3TKLA 2D3TA 1U7HA 1GGEA 1HL3A 4JKYA 1JU4A 1WKVA 2EJWA 4GE0A 1N95A 5LUAA 3U7FB 4HVCA 3GT4A 2PRZA 4QGFA 3U7EB 4DGSA 4QM7A 1P7YA 4P3NA 2YWDA 3LQ4A 3AHJA 4IDQA 4LG6A 1KAHA 3G82C 4F06A 2XPZA 4RO0A 1EFKA 4DBLC 1VL0A 1ZUHA 1U2TA 3LK6A 3S7TA 4TRJA 1F51E 3HR8A 1GAQA 4AURA 1V4BA 4KR6A 3F1LA 5JZ9A 4RDIA 3R3ZA 3CLSC 3QKSA 1NT2A 3QNKA 4HGOA 1Z2PX 3ZQJA 4L2IA 3DSUA 4V03A 2XAUA 2XKJE 4CM7A 1BE0A 1IULA 4FYXA 4BFYA 4LXGA 2OOEA 3A10A 2ZRMA 2BUGA 3OJWA 3QUCA 4DEVA 5HXAA 2I6SA 2E4AA 5AJUA 4LRUA 3RNOA 1PT7A 3KOUA 4NOKA 3CLRD 2QMQA 3H2BA 4DR1B 2W93A 1I32A 1HE8A 4L4YA 1UMKA 3TPCA 2HQSA 1ULBA 3AVWA 1YQQA 4V0MA 2VT3A 3PGKA 2QM7A 1NUUA 3ILXA 3JRXA 4QFCA 3NALA 2VZ8A 1H3EA 3F8TA 1E8WA 4ZQCB 4D8UA 3JQBA 1CPYA 4X8LA 4CIAA 3RRJA 2B94A 3QEMB 4BP1A 3KJHA 2W42A 1PP4A 3G2JA 1TM1E 4RNCA 4TUUA 1TI7A 1JECA 221PA 2VDOB 3C4VA 3VHXB 4C05A 1E1LA 4ZVUA 2WI8A 5LZ8A 3S55A 2JJ1D 1LDGA 3ESBA 3DBHA 2AEFA 4BFCA 3ETDA 2QPTA 5CRIA 5DE3A 2V1UA 3S29A 3I4RB 4RS4A 2XQ0A 3E0QA 4HLUC 4L23A 3NTUA 5I01A 5ABPA 3OAAD 3W5AA 2Q21A 2OMKA 3DFZA 3KPWA 1AKRA 3OO1A 2UXDB 3RUCA 3RU3A 4XVHA 4J8DA 3NH9A 2JIDA 1YRLA 3L0SA 4E5NA 2VF7A 2PMBA 3BJRA 3ROQA 5CGQB 4J7WA 2B3DA 4J0QA 5JARA 3E1KA 1OSNA 4RKQA 3AVUA 2O8EB 5EI5A 2JCSA 3EH1A 1U0NA 4A82A 2O23A 9GPBA 1A9YA 2OMEA 4GUAA 4NQ0A 2A1TR 1MO6A 4CLRA 5D0OD 4YFYA 1YS7A 4ZJZA 4XWWA 2VWHA 3JPWA 3O2JA 4DMCA 4G4SP 4XWOA 1T3TA 3LXUX 1OH6A 3CV0A 3KBBA 2RI0A 4WWNA 1GL3A 3PFCA 3PHGA 1QOQB 1H4SA 5K0LA 1QGYA 1KE2A 2GCPA 3OY7A 1PG5A 2OO5C 5LMCA 3GIWA 2BHSA 3H1EA 4TMTA 1M67A 4V2IA 4DAEA 4B4VA 1FPMA 3U61B 2Z2KA 3OVMA 3Q41A 3OU7A 3RJZA 1EP9A 3P19A 5FOQA 3R9AB 5BVGB 2J3EA 1HFAA 3ETJA 1TO2E 2JLCA 3HDHA 1MG0A 2PQRA 3JSAA 1J9ZA 1X9IA 2I8LA 2Y66A 5DLQC 3MK31 1RLTA 2ABWA 4LYEA 1Q0RA 2ASEA 3GPCA 1PJSA 2WM2A 4FR0A 1ZD5A 5KKAA 2DPLA 1RQ2A 1SK9A 3KHUA 1Z47A 1T9KA 3RCBA 5H0IA 2NO7A 4J1TC 3HDXA 4BP3A 2J33A 1W4BA 4WFKA 2X6RA 1DHTA 4KR2A 4MLZA 4DN6A 2C7QA 2FEWB 5IMBA 4I4TF 1CKEA 2J0VA 3JXEA 2WIJA 2CL7X 1NYQA 3KJZA 2WWGA 2ZBFA 4YRRA 3QENA 2LNIA 2Q3EA 4ZKDA 4QT0A 2WMNB 4UZEA 5KIAA 3H0CA 1E3MA 3ZBTA 1GZVA 1EX1A 1NW5A 3ROMA 2VDWB 4X6YA 5JS1A 1ILWA 4IIDA 5DJ5A 1KYIA 4MKGA 1JEOA 4QDUA 4XPZA 4OP3A 4R8LA 4B6RA 1L1QA 1M6HA 3AFGA 1U28A 4E88A 1GAJA 1IAQA 2F3SA 3W2EA 3R7SA 4M54A 5AM2A 1V5FA 4RVBA 4JEUA 1R0WA 2GLTA 2ZSJA 3TEMA 4YRIA 3QHPA 4ZCMA 1J99A 4TV8F 3EGXB 2AMVA 3KAEA 2J87A 3EXG1 2P9TA 1A5BB 1SCAA 4FWIB 4ETWA 2AKEA 3UO8B 2J4DA 3MLBA 5ANRB 5BNZA 1GL6A 1WQ4A 3OZAA 1K5HA 4NU0A 1O96A 4WBXC 2ZB7A 4HH3C 2GEJA 5KTPA 4HYYA 3TSZA 4ZRDA 3HRIA 3DPYA 1HYHA 3WZMA 3KB6A 5BOVA 1YR7A 1UK8A 1ZJWA 1THTA 1R8YA 4F6RA 1NVAA 1OYWA 1OC2A 2VP4A 4GXTA 4RK0A 4W5JA 4CM5A 1FP2A 5HI7A 5A6SB 2RHHA 3C5HA 3PFFA 4PSUA 4JBYA 4CKBB 1TF7A 1DSSG 3WNBA 3AG2E 2Y6VA 2YHEA 3N53A 2CB9A 1JR3E 1Z39A 2PXXA 2ORVA 1JG1A 4I9HA 3JAKB 1BCSB 5B55A 5JWHA 1AB5A 3KD7A 2CMKA 2O14A 1QDUA 2OFFA 1OXKB 3CHRA 2QZZA 5HJ2A 4MEAA 3VPCA 4RF3A 1UJ5A 2MHKA 4G6ZA 1WZNA 2E85A 5AK5A 5CBOA 4CJXA 1O3YA 1RPZA 5FORA 1VYUA 3ZHCA 4HGZA 3WL7A 3TNYA 3FI9A 4FA6A 3TLZA 4KZCA 4NPCA 1YJBA 2GQ0A 3GLQA 4HTFB 3KZMA 4OQFA 3N3BC 3F49S 4CPDA 3JAWA 4DCNA 2P40A 4UYKB 4B6PA 1YQXA 4B17A 3MLAA 4PZ0A 4NG5A 3CE9A 4CTMA 2H5LA 1H2FA 5DDIP 5IKPA 3K94A 1I2ZA 1I2CA 3CCCA 1PQ4A 2YIJA 3OMLA 4TXQA 1X70A 4RZ2A 5CEEA 2P8JA 3T7EA 1T9AA 2C7RA 3DMNA 1KVQA 4FGUA 1SIOA 1HV8A 1E5TA 1D6NA 1XCJA 1JJIA 5BN1A 3TOZA 4BX8A 2ZAYA 5I7VA 5TGZA 2DPYA 1YHYA 3CQGB 2UZAA 2F3QA 3GJ8A 3UGJA 1BMFA 2LBPA 3K6SB 2W2LA 3IP5A 5F1KA 1J7KA 3L02A 3IL2A 2CYAA 3LCJA 2RONA 3VC7A 3I9OA 1P81A 4IQGA 4Q66C 1DFGA 1LBEA 1WAMA 5BSTA 2LWIA 4PU0A 1TU0A 4LNGA 1RWWA 2W6JA 1AGXA 4EVSA 3SX4A 5T6BA 4KQJA 4G25A 1H2BA 2CVPA 3VRHA 4ND1A 1MB2A 5JXHA 3FCUB 1VCMA 4BGUA 4PXAA 3L7MA 5ALZA 3HE3A 2AJTA 3I52A 1QHFA 4MKXA 4L8WB 2AR7A 1EPUA 4K81B 4EIWA 1JU9A 1G7CA 2O2YA 1CVRA 1OV4A 3ZHYA 4PNEA 4YP1A 2JJ2D 4JQZA 5BXYA 2O8CA 5BN4B 2Y9MB 4KAXA 5CXUA 4GAEA 1Z3XA 2G8LA 3GUVA 3UIOC 4X7PA 2EIXA 4GTRA 3DDHA 4LSZE 1W6RA 1H2EA 3VGJA 2O52A 1YDMA 4N5MA 2A59A 3AJIA 3D0QA 4B9EA 1V1RB 5JSFA 2FMHA 3VJLA 1O5TA 3C3YA 1PIWA 2IWHA 5G05C 4BVFA 1W85B 1SC6A 2JFYA 3ANLA 5LOVF 5BRNA 5IH7A 1IHDA 2UY1A 2BGWA 2BUAA 2XS8A 5PGMA 5C7IO 4RF2A 2YV3A 1ULZA 2UU9B 5ICCA 4QNMA 3MTGA 1E8NA 2OCPA 4YT2A 5AXBA 1PN3A 4HDMB 3AUYA 5CBNA 4E0BA 3B1ZA 1WXHA 4NCNA 5TVGA 3BD9A 1BRMA 3CWQA 4CF7A 4RQUA 2HJWA 4GL4A 3K53A 3HU5A 4BVGA 4H16A 1P1FA 3CX7A 3LBHA 1DT3A 3RRMA 4OFXA 3VVCA 2CNOA 3DM5A 1I4OA 3ZPJA 2O48X 5HK8A 4MYCA 2ACEA 2BEUA 1A5ZA 3LUJA 5ED0A 2I2XB 4MS4B 1TYCA 3A6JA 1JBQA 1NYTA 1WVIA 4L72A 1PHRA 3QFRA 4A16A 4CMAA 5JSQA 4GZ6A 3N76A 2BLLA 2ORYA 2WP0A 1QUFA 2OHJA 4B6EA 1HX8A 5HJ5A 4Q39A 5IF3A 2C2LA 3FTZA 3I0NA 2ZRIA 3HACA 3HO6A 2A58A 5IJ9B 4UWGA 4LXXA 3AU5A 1TYAE 2JBHA 3GZTB 1ZBQA 2DHEA 1KH3A 1E2JA 3BWVA 1Y5LA 3DL4A 4I50A 4LG1A 4X71A 5C0OE 5CFMA 1I80A 3BQ9A 1T5OA 1FNCA 2GOYA 2KZTA 4W5TA 4GPIB 3TDNA 3I3NA 1OILA 1OHHD 3RT1A 3I5UA 3G2HA 1D2HA 5CTAA 5LSAA 1EDOA 4F4UA 1Z4PX 1G18A 4HDRB 2FZWA 1G3IA 4JR1A 1SQMA 1XZNA 1MDBA 4BNHA 1R15A 4IV8A 4OQEA 1TNOA 1K7SN 2VHCA 3C7KA 3OEHA 4PHCA 2PX0A 4G97A 3FTVA 3QKTA 4JVNA 3UB3A 1HQYE 5U4QA 3I01M 4WBNF 4G63A 3KUUA 1N7HA 3TRHA 4OMDA 4Y2RA 4E5VA 2XJ4A 1PS0A 1FFXA 3DMPA 4M7OA 1UFRA 5JJTA 3DBLB 2JA1A 4LPKA 1CB7A 1RWVA 5LLTA 3TCKA 4GGOA 3NHUA 4JSYA 2UYQA 5CLFA 3HXBA 3NZEA 4PWZA 3BXHA 4QRDA 3M4JA 3UQYS 4U9UA 4HPWA 1VE6A 3NRBA 4TKZA 2C4MA 2I34A 5IDYA 1EFHA 4BQSA 1CUZA 4E5PA 2QVYX 2VAMA 1AY0A 1THGA 4OU5A 2AXUA 4DAOA 2EZ9A 5BWMA 4GSKA 2QAGA 3P9SA 3OBBA 2CFCA 1GNTA 2WKSA 3F67A 1SHUX 2WM9A 4GPTA 5AJLA 3T5BA 2XENA 3NAGA 1QH8A 4LYYA 1ACLA 5DM4A 3V8PA 1EB8A 5EP4A 1KDPA 1UBFA 1RJEA 5CDUA 3B1XA 4LC0A 1M2VB 3FNEA 1O6BA 4LGMA 3WIEA 3GLHB 3A31A 1X7GA 3QLVC 1PJTA 1OI2A 4UEJA 2RB5A 1SA5A 5CXQA 2Q1TA 1Y6FA 4RWZA 2OEWA 4YMTA 2RBKA 3N2GB 3T3NA 3UF0A 4NY1A 1RPJA 2QE7D 4MHSA 1PR0A 1EE1A 3BX1A 3MRTA 1P33A 4K3UA 3VTAA 2C5BA 2IZ6A 2WFLA 4BRUA 4CUZA 3K71B 4ZU3A 2HCTA 1DAPA 4CLOA 3IUYA 4I1RA 5IYZB 3L17A 4ZCIA 2OV1A 1T5LA 2FEKA 3QOFA 5C1OA 5KWIA 1Z4MA 1PJBA 2HO1A 1U0HC 3I23A 3IMGA 1U0JA 3ZVMA 4DSAA 2QD1A 3EIEA 3HXTA 4BXOB 2AYZA 1X81A 3ADPA 2QDKA 2L6JA 4PGFA 1I1HA 5KU1A 3RYCB 2MYTA 5B64A 1N2IA 1VJ5A 1MJGA 5GIOE 4P4LA 1XJQA 3OZSA 2XT0A 3BYZA 2LDXA 1RLIA 3LFTA 4MCHA 4D0GA 4Z8XA 1UEXC 3MT9A 4U7JA 2H1SA 3L41A 5F9MA 4YMSA 1NLYA 1T6BY 2OWDA 1JFFB 1ZK4A 4ZQGA 4YDSA 5JO0A 3HDYA 3M4XA 3RUIA 1IC6A 1GEEA 5TPWA 1E79A 1U1GA 3NRCA 3OLYA 1NRIA 4HZIA 2GRAA 3ZWDA 5EQFA 3FCEA 4EG1A 5A3JA 1I9CA 2PTHA 1YQUA 3KPJA 1BX3A 4NI5A 3V7UA 3MM4A 4OXYA 5K3FB 4QEDA 1MAUA 3EHRA 4CKEA 2G9ZA 3U56A 3TWWA 3FTQA 3T9KA 4WE3A 2PQ0A 3LE8A 4OMUA 2G63A 3CRQA 2GROB 1FMLA 1GFSA 2FPIA 1FE8A 2YOHA 3ZHTA 3BTOA 1Z6PA 2DJ5A 4MWTA 2GPBA 1XC7A 1PZGA 4XKCA 4FX5A 3HZOA 5A4FS 3ZHBA 3I6IA 2ST1A 1PWEA 3TSYA 4URZR 5DHFA 3D9QX 2B5WA 3X1DA 4LRXA 1II8B 1YRAA 4LDQA 2B4RO 3JQ6A 4C3VA 3J81A 1QH1B 4MUKA 2K2WA 1RCTE 2FF4A 1T2UA 1W4RA 5SY9A 3DF9A 5KNGA 1CFJA 4CL2A 1IBSA 1JIKA 2PXAA 4C0LA 3KWJA 2AX3A 4CKCA 1JV2B 5E8JA 1MC5A 1OTXA 4BX9A 2C9YA 2R8ZA 1WU7A 4NL4H 1XK6A 3NASA 2VLIA 3Q6MA 3ORQA 3BT7A 3NIWA 4E33A 3WY9A 3COJA 2PXHA 2JFOA 4MKHA 3PLNA 3LDHA 4HAOA 4GUDA 1C3LA 1EJ2A 2IYFA 5FWQA 4CUJA 2CZGA 1UFKA 3AS5A 4ZQHA 1CZUA 2P0AA 3F5MA 1L0BA 4ZN6A 4AAYA 3INRA 5FNZA 1WU8A 3CIFA 1TEXA 4MR7B 3U4CA 3WXXA 4DMUB 2OKGA 4Z4GA 1UH5A 3Q7EA 5EIBC 3FPEA 4C2TA 1NUAA 1TZBA 2IH5A 3H2KA 1LJUA 2O8DA 4G36A 2QZPA 1W87A 4OI1A 1PS8A 5JSUA 3QVKA 5K5EA 5LCWJ 1PFVA 5KJMA 2FSGA 4F56A 1R5JA 3RSGA 3C3MA 4G0NA 4ZVTA 3D9KA 5E3IA 4GPD1 2JS7A 3GRKA 5T3YA 3B89A 2X58A 2V6FA 1YBMA 5FUWA 2VJCA 4D74A 4BNGA 4E3WA 5KB3A 1PBTA 3OFSA 2AJCA 5BQOA 1A5EA 1IEQA 4C7KA 1DBSA 2IV7A 4K1XA 3UHJA 2DLNA 4JPSA 1KRXA 2NN3C 2EBUA 2SCUB 4XGQA 1DOZA 1N32B 1XCLA 1YYHA 4CTKA 4DTIA 2WIDA 3A3YA 3FF4A 1KZYC 3VH1A 4P1ZA 4M1OA 3VUFA 4M9UA 1EWTA 3DEPA 3UI2A 3GEPA 4OCZA 3PQ4A 4R3NA 3FNBA 4TTRA 3RVRA 2GK7A 1D04A 4CEHB 4CLEA 4G07A 1BSVA 2NU7B 1E2QA 4RW0A 4KDCA 4B45A 1UBCA 4TSKA 3QUSA 2BH9A 3KLMX 3GLGA 2UAGA 1SCNE 2A57A 3LBIA 3PS6A 2JGRA 4OQDA 3W6UA 1QAQA 1FK8A 3R1IA 1G21E 1LPMA 3S8MA 1DO0A 2PKWA 4RDCA 3R4VA 1SMKA 4JENA 3DE4X 3IX7A 4BO7A 1FIUA 5FADA 3R7NA 3T1HB 2AA3A 3GUYA 3T7DA 1E66A 4EZLA 4EL5A 1SKMA 4FYYA 4MUEA 3ULEG 4Z3OA 4KNWA 5K9ZA 2QRPA 5CMYA 1EX6A 5GONF 4J16A 5ENNA 2AFIB 3LNCA 4Z0TA 1SXJB 4IDCA 1SVUA 3X2SA 5HILA 1U02A 4PH4B 2Q0SA 1O6CA 3MW8A 3KTAB 1QVWA 4O1PA 1FNSA 2UVPB 1J21A 1P5HA 4D9IA 4CTJA 3X0DA 1TQHA 1J90A 4K2HA 3NVAA 3S8EA 1V1JA 3TQHA 1F8UA 2FSIA 1ISPA 2GEUA 3HFGA 3GDGA 1Y7PA 5CCEA 3C97A 3GBVA 4FX2A 4B3JA 1ZKDA 2KJZA 2ZJ2A 2H6IA 3VVLA 1LPBB 4K26A 1PWYE 2ZTUA 3S27A 4DXDA 1E8MA 1H1LA 4Q0MA 3H2HA 3AM4A 2W6NA 4L6CA 4ZHQF 3N58A 2AN3A 1U2RA 1R9GA 5HRUA 4K9QA 1BFUA 1NMXA 5K3OA 1LC0A 1PT9A 2ZVPX 3YASA 4MR9B 3L7CA 1V71A 2CBGA 4CT0A 2ZUVA 3JALB 2JRCA 1PEDA 1AUXA 1N3LA 2I7XA 1QO0A 4LXYA 3Q9NA 4P35A 3T94A 3NHZA 3BB4A 4D41A 4X60A 4C20A 3Q5MA 4MKZA 1TMYA 1Z2NX 1LI7A 4FJ0A 1ZR2A 2VJQA 4QATA 2ZUBA 1T0HB 1MVNA 3VI3B 4K9NA 4WESA 4F1JA 2GXQA 1I1OA 2CV0A 1K3ZD 1M33A 3OQIB 3U48A 2EZTA 2HA0A 2H00A 2H2AA 4YJ2B 4NSNA 3A9CA 2XX3A 3W1WA 1IZYA 5C2JB 4YUAA 5JDIC 3N2ZB 2B1QA 2DBZA 5FBZA 4KU4A 4M6WB 4LBZA 1QF6A 2VAXA 5AK4A 1Z6TA 1S02A 2VKQA 4B3FX 2QLBA 1I0ZA 2R8YA 2GHQA 4JWKA 4BFLA 4P33A 4C1BA 2Z3WA 5BQ3A 3MWFA 2ZYRA 4PGAA 1Y4ZA 3ZI0A 2XNKA 3S1LA 1LVGA 2IA5A 5JCJD 5TY0A 1YMVA 3GARA 1I13A 4CLDA 1A77A 3HR7A 1P72A 1GA4A 1S6YA 4MRRA 1YL6A 3PXXA 2BR4A 4LZOA 1VHJA 1REQA 1VLZA 5C5DA 3IEGA 2O7VA 1HBJA 2QTFA 2ZUFA 3T4XA 5IJ0A 4AF7A 5HS6A 3M9XA 3ITEA 5ARFA 1DAEA 3DONA 3C1TA 3MOIA 4OUDA 3JCZA 3W5CA 1BQEA 3BTVA 2CNKA 3CJQA 4U63A 4D4GA 3FUWA 4KHZA 1E1KA 2CLOB 3NORA 3LVFO 2BZ1A 2BY4A 2A4KA 1CNMA 4B3GA 4B7XA 3QFCA 1GQ2A 2W48A 3S40A 3R8CA 4URHA 3C4QA 4YV7A 3DYIA 3CKCA 4OH1A 5HOQA 2D7JA 4HN4B 5D5QA 1R0BA 4M9CA 3ZU2A 5LOZA 3IV0A 3SQXA 1EFRD 1CCWA 1YR2A 4N82A 2IUUA 2OKCA 4L76A 4E31A 3QPCA 2NP6A 3R9KA 4B75A 5AI0A 2PS9A 4DBVO 4KHPB 3OCUA 4QG3A 3OCCA 2A5GA 4N5LA 4NG4A 1RXSA 4W4TA 2BBSA 2H52A 1HSZA 5FX2A 3MHTA 4UKDA 2HNBA 2PLFA 3HUTA 3PVSA 2Y4OA 3ZNGA 1AQJA 4TXNA 4YDYA 4MAFA 1TW2A 5HR5A 4UTRA 2FKAA 1POXA 4NC9A 4HO1X 1Q57A 1G6OA 4DW8A 5AVJA 5CIQA 3T3DA 2YIMA 1XR3A 3FGZA 4BO5A 1W59A 3D8UA 3AQIA 1QO9A 2FHSA 4IICA 3K72B 1DCQA 3FNIA 4D9FA 2ZJYA 2I91A 4LCTA 1I36A 4M1EA 1G4HA 2FN7A 2R84A 1N6LA 1U0OC 5LQDA 1MEOA 4Y2YA 1FRVA 3PB3A 3ZCSA 4Z1MA 4WDQA 4EUKA 2FPLA 2UYCA 3P2OA 3O92A 1XYGA 4N7BA 1U0TA 4HX2A 3PR2B 5EHQA 4MWOA 3NDBB 3X1MA 4WCVA 4NJEB 4K5QA 3ZW9A 5IKEA 4QREA 3VO2A 2X1LA 4HNGA 1KH1A 1W19A 5KNBH 3NVKI 3HHEA 3QLEA 2HLNA 4K5CA 5AVZA 1J07A 4B80A 1YQGA 5DGDA 3LT0A 1M1YB 2Y27A 2FMTA 2X0RA 3FHCB 1GQQA 1LDMA 1LUAA 3FUVA 4EBAA 2NOAA 4MDFA 1QTIA 1JDSA 1QVZA 3QJZA 1IXVA 1HLGA 2H1CA 2KB0A 1UJ6A 1ZOPA 4WY2A 4ZTBA 1V6SA 1ZMOA 4TUMA 1DGQA 3B5IA 3GCDA 2P62A 5FA6A 5JR3A 4YRMA 1EG2A 3RANA 5BR8B 1SQGA 3I5MA 1BGXT 4LXIA 3N8DA 2AE1A 3PQ7A 2VWPA 4OHKA 1Q12A 3P0FA 1Q1GA 4KQEA 5C1DA 3EEQA 2CLHB 1E2HA 3RVJA 3DV0A 3LHIA 4XX5A 1L8LA 4TWIA 2QUZA 4DLXA 3ZWOA 3M8KA 5T4HA 4A5OA 4HB4A 1VIDA 3S68A 1VKZA 2P69A 3B53X 4EENA 2Z1DA 2IGBA 4E5SA 3ZTWA 1VJTA 3D2BA 4BWGA 2PBRA 2WT4A 4ENRA 3IVAA 3SI5A 3K9GA 1KSFX 2ZR7A 5KREA 4A0QA 3GDHA 3OU6A 4C6HA 3ETEA 3DLTA 2AIRA 4Z2AA 2DLCX 2D1FA 2VT7A 2OLKA 4HN2A 3SOPA 1OY1A 2I1QA 5A3VA 3OX1A 2ISSD 4LEIA 2WPNA 2BGLA 1ARZA 1N75A 4K03A 2J9ZB 3SX2A 1JEAA 4URWR 5LQJA 4KO2S 2KBXA 3KKOA 3PDHA 4P3OA 4F2GA 3HB4X 4W82A 4EG7A 2DAPA 2PL5A 4PYKA 4UBJA 1BEZA 2GEBA 2OB1A 1W3BA 4JB3A 4A3VA 3ZI7A 1L5VA 2XNDA 4RGQA 1G3QA 1QE3A 2Y1CA 5JAQA 1JDJA 4GLJA 3ZU6A 2QSZA 1JCQA 2QMHA 3U4IA 4YMWA 5SZKB 1N4PA 1JLLA 3BC1A 5I6DA 1PYGA 5CH5A 3CONA 2CYBA 1S2LA 2IY8A 4AY3A 2M9MA 4PYLA 3EEFA 1HUQA 3RBXA 2DWQA 7AT1A 4YQZA 3WWDA 3HNOA 4HCJA 3W2HA 4MUNA 1IN5A 2QD3A 4OSPA 4CMEC 3R3XA 2BFEA 3SFVA 3DCIA 3HPRA 3U3OA 3T3GA 4LOIA 1UMBA 3L4SO 1ECLA 3L8ZA 2VLBA 4OFZA 3G2VA 1QPGA 2I8CA 2Q2VA 1TE2A 4N5HX 4X8QA 5AO9A 1WM5A 16PKA 5BW5A 4U0JA 3BTSA 1XCOA 1I4LD 1FFDA 2OCYC 4Q7EA 5JPCA 4IAOA 1LX7A 3VR3A 2FOLA 2FX3A 1MV8A 3DMRA 2JGJA 1TGVA 5KOHA 4LFBB 4OBWA 1XTKA 2RFAA 2GUWA 1JUDA 5K6TA 3UPVA 5LXTA 4W7SA 3ZGZA 1X1AA 2Z9BA 1P5FA 4NEQA 1HDZA 1GZ4A 1CRQA 4URFA 2NVBA 4TKUA 3OF3A 4EYOA 2FGKA 5IAEA 5EIAA 4EI7A 2CWWA 4IVQA 2GNAA 4LK3A 5FTMA 3MTQA 1DC5A 5J4VA 3PEVB 1I2DA 4N6GA 4Y9UA 3A04A 1G16A 1W5EA 3VC3A 4Z7JA 1Q14A 3C45A 4F3TA 2WHEA 3N2EA 1RZVA 4HAIA 4DILA 3BZBA 1GIAA 4AN4A 1G5TA 4TKVB 1C7FA 4BZZA 3WADA 4C0WA 5DIFA 2BEKA 2V4MA 3HXCA 3AR5A 3W7VA 4LY6A 3UMYA 1SOUA 1PFYA 3GLFE 2FFJA 4IEEA 5EYPA 1P4JA 4H1TA 4F8EA 4XJXA 1OYVA 4HTAA 3MFQA 3QFTA 1EXDA 1RR6A 4LE0A 2FMIA 3AERB 3WL3A 3BPSA 2XUZA 3PQ8A 2NV2B 3JQAA 2IRWA 4ZFNA 2G6TA 2AK2A 4IHJB 4QQRA 4ZGGA 3TLCA 2FEZA 5K3EA 4KYUA 3BDVA 4C3OB 2OEPA 4YI3A 4JJGA 4GA1A 1U2SA 5CIWA 4D0SA 4EDFA 4CNBA 2QXUA 3OTHA 5AUQA 4TS3A 1RRVA 1JEQB 1VKHA 3HUFA 1H8ED 4XEHA 2TMGA 2EIHA 3HXEA 3OKAA 3IUNA 1RWPA 3B5EA 4QTUB 3WBFA 4RTPA 3I28A 3KL2A 1BA3A 5TX7A 3K9QO 2EG9A 3HCFA 4MEJA 4EY5A 1ULHA 5FOWA 2BT4A 1QIKA 2QIOA 3KAJA 5B7NA 3EVTA 4JOSA 3L82A 5DOZA 4LZWA 4DZZA 3HBAA 3GFSA 3HP4A 2PM7A 3ECAA 2XIJA 1A97A 1LU9A 1NWHA 2P6PA 3EZ6A 1EHIA 1Z4NA 4R2LA 1LZLA 1NI5A 1N2CB 3DDZX 1S9HA 1GFIA 4P81A 2AR9A 2JGDA 3NOCD 3WKCA 1NIPA 3OPNA 1B23P 3CEQA 1N6HA 4CL8A 2I87A 1OWNA 3P2YA 3GFBA 5C18A 1N4RA 3T4UA 3VVBA 1V54E 1HURA 3DTYA 4N01A 1H2UA 2RHDA 3F5SA 5IAGA 1YQTA 4B2LA 1JNYA 2CLSA 2P91A 5FQOA 3PXUA 1A1VA 1ZIPA 1OBOA 4LJYA 5AJZA 1YZLA 4U4AA 4KLNA 5G4LA 1O6GA 3FYDA 5T6MA 4ND5A 4NP6A 2Q45A 3PF8A 4ND7A 4Q4HA 4DLPA 3MWEB 5D2MC 3SEAA 4COOA 5FWXA 1Q44A 2Q9BA 1K75A 4IRMA 1XZKA 1BFDA 3B38A 5E9QA 4J9VA 3LRXA 4V2UA 4YPFA 2P67A 4KQCA 2XPYA 4MAMA 2ZBVA 1XZBA 2Q6OA 4U7EB 5KYGA 4D8YA 3C8ZA 2CV1A 4A8JA 2E5WA 3I09A 1C2TA 2CJFA 1JAHA 1SHJA 3ENVA 5TNXA 1A9ZA 3JYPA 2XVAA 4QO7A 1THMA 3W77A 3TTUA 4RK6A 2AOTB 4B85A 4OQNA 3ZPXA 4Y67A 5IUKC 5KHOC 3NUZA 2B82A 1HLPA 3ZCXA 1L5QA 3G0IA 4BNDB 1RAGA 4MQMA 1GKIA 4TN1A 5AJXA 3BSYA 4MVJA 3HRHA 1XA3A 4L8VA 4NU6A 1Z0DA 1OXXK 1HT1E 4GOND 4U7GA 3T1NA 3QMPA 1OZ0A 4LNUD 2V4HC 3H6KA 1XDBA 2XTJA 5EJGA 4UWLA 3AEKB 4HZGA 4JFRA 3ZD7A 1PTKA 2C54A 1MOPA 1N3YA 2IX9A 2I4MA 3L4BC 2CDNA 1RWOA 3RO2A 1Q0TA 4RKRA 3IAFA 1QB7A 3T9BA 5A4KA 4CV3A 5JEEA 5G2NA 4CKWA 4H9GA 4U2GA 3MCZA 1Z8HA 5B37A 1VI2A 1QFSA 3ZE9A 3W8NA 2G9NA 3H2ZA 3UMCA 1ZC3A 1Y9AA 1IOWA 1L7RA 1R12A 2QUBA 4GO1A 1DXHA 3GNSA 4NKRA 4FYKA 1OVGA 2HA5A 2XCQA 4Q01A 4MKTA 1W88B 1ZUNB 3MGKA 2VUTA 3B20A 1H4QA 3NT4A 3D1VA 2IYRA 4ZT2A 5F73A 4XVUA 2JFHA 1WB9A 1AURA 2B78A 3LGAA 4O0MA 4I19A 2E0IA 5I8ZA 1IFXA 3FU5A 2WD8A 2A9VA 1S63A 3HY6A 4IVPA 3Q2KA 5CW1A 2A6PA 4IDGA 3EGWA 4BIIA 2ETCA 4PZZA 4NBNA 1E9SA 4DNQA 3II6X 4EPVA 4IILA 1Z7EA 2BONA 4JQCA 3M2TA 4YVOA 1A88A 4KMSA 1MZVA 5KNCH 2YXEA 2DCPA 4Q1VA 1EYZA 1YZUA 5LP6C 1X39A 3H5LA 4PYQA 4FINA 3UTDA 3GJQA 2GPJA 2K6GA 4ZYYA 4J8EA 4N5QA 1XFAA 5AHRA 3WHLA 1S2IA 3FTCA 1BVHA 4QOJA 2J5BA 1SELA 1FP4B 1C7JA 1KVSA 1QKIA 2GCNA 5HFNA 4OB7A 3FVTA 2PL3A 3T5DA 1KERA 1BROA 1XEAA 2FO1E 5EKDA 5F5XA 3UYKA 1Q17A 3A1DA 5DH9A 3KP1A 1FYEA 3QE3A 4FR5A 1RYZA 4PLCA 5AW8A 3CUSA 3EYWA 5EZSA 5DBHX 5HS0A 2FLWA 5ALKA 4XA8A 5CFQA 3K16A 4PZYA 4B44A 4LRTB 3O84A 4MQFA 2PS1A 3I72A 4XM1A 2D4AA 3KXDA 2LPMA 4HWPA 4YONB 2RBEA 5E2IA 4P7KA 3SKYA 4GZLA 3RSCA 2JEYA 1K3TA 4RADA 2WD9A 5AOXA 3DMYA 4LF4B 1JSZA 1E3SA 4GLFA 3VOBA 2Y0BA 5ERGB 1NI4A 1P0QA 2J8ZA 3Q15A 3GRYA 4L57A 1WXFA 1NQXA 2YWXA 1HU3A 4LBWA 1WSAA 1JU3A 1IZZA 1UPUA 1JYSA 1HFJA 4WUVA 3WP0A 1T29A 2GD0A 1NVFA 1YB2A 3ZGLA 2ZUWA 2W22A 2GKOA 2ZRGA 5JOQA 2YRXA 2QC9A 2C0LA 2R60A 4DKXA 3U60B 2PJZA 5FLXA 1JEYA 1NN0A 2HXGA 3D54D 2X15A 4JLKA 4I66A 4QHSA 5IC6A 2AH5A 3P26A 2CHWA 5F3DA 4DIKA 3GZ2A 4TL8A 1UZNA 3LQ1A 3DE0X 1WSDA 3U4GA 3C16C 3GH1A 4UBNA 4W9MC 1TD9A 3D1LA 3GQBB 4OKIA 4PX9A 3QWPA 2I8AA 3KLBA 2NUBA 3SLKA 3TBHA 2YZKA 3LC7O 2GRNB 3HJTA 1ACMA 3R7WB 1JILA 2XWPA 1JSRA 1U0RA 4BASA 4DLSA 4GZMA 3I6QA 1Z08A 4K9SA 2SECE 3CINA 3AG6A 2CLMB 5EWJB 1QV9A 3ABIA 4HDNA 3GZ1A 2J6HA 1U7TA 5LQRA 5GGXA 4EP1A 2IFTA 2IPOA 4MS6A 5K0GA 5GZ1A 3V32A 4D92A 1FX1A 1NBEA 3INTA 1UG3A 2K2QB 2IYXA 2E9SA 1U11A 4YDWA 1T0BA 4PSDA 4CM8A 4LY9A 4JLJA 5J90A 5IVDA 4O4HF 3I0ZA 3ADCA 2FPPB 5EYLA 2XDAA 3ZU5A 2YHCA 2CW5A 3EGIA 4IKOA 1O77A 4RSGA 4F3CA 5BSRA 1XXHE 5EHXA 2F1IA 3ET5A 4EMBA 3CFYA 2MSDB 2O57A 2YN0A 1NULA 1ZSYA 2HAEA 1RZ3A 1M8FA 3Q9UA 4KO1S 1U5CA 2AOVA 4E2WA 4HWRA 2WM8A 5AYWD 2HCBA 1LVHA 2OBMA 1VE3A 3BFXA 4Q4AB 9LDBA 4R2WA 3Q3CA 4ZT5A 4MW7A 1ZU5A 1Y6QA 1PWXA 2H9IA 4I4TA 2CLEB 3ZDXB 3SYMA 1T6NA 3Q6IA 3E84A 1GA1A 4U8GA 4BV8A 1ZU2A 3OCVA 5EHNA 5SY6A 4UTPA 4NBSA 1EXMA 3W2IA 1NFRA 4GRAA 3VAZA 5HJ7A 2RK4A 4WKCA 3S2UA 1RPNA 3I4CA 5LX8A 3LLMA 3UOAB 1KZ4A 4IQ4A 1PUXA 3HKEA 5AHKA 5GQSA 3OTIA 1XGWA 5ALTA 1PC2A 5EWMB 3EJNA 4D9GA 4M0FA 4ZT4A 3H1PA 1FS6A 1TK3A 4OJTA 1EE2A 1SOWA 1T4CA 5HFJA 1HYEA 3SMVA 3T52A 1E7RA 2W90A 2QTZA 1X1SA 1RBZA 4HUQA 4XLZA 5BV2P 4RG9A 1ZW6A 2DFVA 2JARA 1W5AA 4FC8A 2Q4DA 3EW9A 3UJDA 2X0DA 1NLUA 1V3VA 4MNTA 4Q48A 3FU6A 5K4GA 5CLIA 3CCFA 2FB9A 4J43A 5J23A 4JUIA 1OPRA 2L17A 1GDDA 1I3CA 1WXIA 2Z3VA 2XLBA 1DC8A 3EGVA 4WADA 4LGVA 4XX0A 4ARVA 3EDCA 3ZEAA 4DB4A 1QR6A 3AY7A 4B8WA 3BL6A 1H0SA 3EPHA 1L9KA 1DTEA 2IP1A 2H1IA 5FEMA 3FCXA 2Z2YA 5IEJA 4C4AA 3R3SA 1B8PA 3SQMA 3WX0A 5GADl 4S1TA 2B8EA 3RUHA 4I4CA 3V1KA 1Z6XA 4YO8A 5F21A 3R7BA 2QTAA 2RIPA 5TLSA 5KYVA 3MWDA 1V6AA 3UXMA 4QUGA 2Q3CA 1W4AA 2IOYA 2DY0A 4BBPA 2H08A 1J1UA 1SZJG 1BLXB 3A7EA 1XCPA 3AAAC 121PA 5FL3A 2B0JA 4ZCTA 4TVOA 3K7EA 1JN0A 3GW8A 2PGOA 4AJKA 2BMFA 4Y2QA 4G8DA 3A9UA 1YQEA 4CQMD 2HIHA 2ANBA 1AXRA 5A9TA 3S2IA 5FFMA 1AHIA 4BQRA 3PZ1A 4PBTA 1M1NA 2DOKA 1KTIA 1GTJ1 4WNYA 1V1MB 2HNKA 3RU9A 1QONA 4XDYA 2P11A 4QTTB 1EJBA 2HD4A 4W8OA 1N25A 3I0MA 1PGJA 1MABA 3UVEA 1GPKA 4R2IA 5SZHB 3HMKA 3A6PC 1U4SA 2XRZA 1EGAA 4XM2A 5DLDA 3ND9A 5T3UA 4N2SA 2BEDA 1ESZA 1K4MA 1KDTA 3ILYA 4CM4B 1C81A 2XMQA 2JIOA 5ALIA 1R4MB 2EJBA 3UCEA 1JKFA 4M1WA 3IB6A 4FI3C 2DFNA 2NNLD 3F97A 2VWQA 2V55B 1Q1BA 2UVDA 4XVRA 3BCUA 1KC3A 1ISJA 5CDYA 4PCAA 3MMZA 4LMPA 1AF4A 4EHIA 2OWEA 1JHAA 1G8HA 1WCIB 2J9QA 2BMEA 3RAJA 2VUHB 1ZJ5A 2C4VA 3AFNA 3KDAA 4IIVA 3THYA 3KZ1E 3COWA 3NMUF 4B74A 2H2WA 4G4JA 3WIVA 4EKEA 1FDTA 3OZDA 4XQ9A 3E37A 5K0TA 3V4VB 5LU9A 4MPPA 3LYLA 2ZDGA 2H9YA 2G08A 5BR4A 1NVEA 1CS0B 3QUAA 4JI2B 2FPUA 4I4LA 1GDHA 1N2SA 2Z58A 2BHTA 5CW2A 4X1OA 5LZ9A 1MJ5A 3K0SA 5CLJA 4Z2YA 3EBPA 4JJIA 3OQNA 2Q2OA 1YZGA 3K05A 4NU5A 4PLGA 1VMEA 2J6CA 3H9UA 4N12A 4HMOA 5E0OA 5KKNB 4MQ4A 2FZ4A 1EA5A 2C7OA 1AGRA 3VPFA 3FDHA 2VRCA 2DT8A 4I2WA 4GOLD 4EMTA 3IUBA 2YWBA 1QPZA 2KX7A 3DG9A 4X91A 4GMHA 1Z5PA 3CG0A 2AXVA 3FOZA 1U98A 3WK6A 1J2YA 3H2IA 2NMVA 4ZPJA 4X1KB 3GZNB 3Q3EA 3PJEA 2GJKA 1H85A 1PFWA 5F7ZA 4BFXA 2OCCE 3WISA 4KK4A 5LPNA 4PQFA 1TJYA 2BSAA 3B52X 1PR1A 4D3FA 1I0IA 2COUA 4QPJC 4QBHA 4A0SA 2G0TA 5LOVA 1SXQA 1U0EA 5DN6D 3AOEA 3GLIE 1ANKA 5C3UA 1KOGA 3HNRA 3EIHA 1VBNA 2FW8A 2WWRA 5KMGA 4KIWA 2IPMA 2GILA 2NXCA 2PZGA 3FU0A 3TGWA 1VLMA 2V74B 4MUBA 1QIDA 1S89A 1J42A 1AKQA 3DF7A 2VNSA 5KPDA 1C30B 3VCXA 4KKXB 2O2JA 1KI8A 2PUVA 4J1SA 2ZITA 4GZ5A 4O2AF 5DK6A 4HYEA 3ICOA 2UVQA 4CG3A 2Z09A 4DQ0A 4IULA 3LEWA 3JQ7B 3MYYA 2HUNA 3GFGA 2BFMA 1QZXA 1SCJA 4EFDA 5JZVA 4Q9AA 3MXTA 2VRNA 2OSVA 2APJA 1CY7A 2FCRA 4R01A 4UAJA 5JNTA 4FOLA 2I2CA 1ITZA 3IEIA 2A5DA 3VR2D 5JJ5A 3PFBA 1ZZGA 1HC7A 1Q84A 1F8FA 2H4YA 3I73A 2GAJA 4MWCA 1PV2A 1E69A 3D2CA 4YT4A 4N48A 3H1AA 1L5KA 2P9EA 1UBRS 3T4EA 4YB8A 4OQPA 2ECFA 2V96A 3OLZA 1KI1A 5EKTA 1JJVA 4C48B 3ZNQA 3AVVA 3B6EA 5HCUA 1VRCA 1U8ZA 2DCUA 2HR2A 4WVLA 3P96A 5KDOA 5TGDA 2XEVA 1E6UA 4CYMD 2REXB 5CVTA 3RRUA 3A3PA 3QAQA 3LBNA 1RHJA 1MD9A 4U3JB 2IUTA 2R96A 3VH3A 1CZNA 2ZRAA 2FN3A 4YMIA 5D51S 4HRAA 2H65A 3ORRA 4NTZA 2Q5OA 4XQ0A 3K09C 1T3HA 4XI9A 4B32A 2O1XA 3H42B 3EXIB 3KJNA 2NO0A 2Z83A 1YQDA 3SZ7A 5AW3A 6PFKA 5TQ0B 1NVBA 4WBNA 1IWPB 4MS1A 3RWBA 3E9QA 1ONNA 3W05A 4G1UC 3IAAA 4F4IA 3WICA 3OSUA 2PSJA 3RRYA 1U63A 3JU3A 1N0IA 4N1AA 4H7DA 3OOSA 4BPBA 3A3OA 3EZLA 4V0ME 4IIHA 3V8EA 2I9CA 3TL5A 4KWCA 3C8MA 4D8XA 1TAHA 3NVDA 3BZWA 3PPIA 3SIWA 1H2ZA 1W36D 4ZVVA 4O4LB 3UMFA 4F3KA 1NJ2A 4GPBA 3ZV7A 3WLQA 2PSSA 5KOJB 3RFXA 2UYOA 3UANA 5FV7A 2H1VA 3ENKA 3NVMB 1T9HA 4LRYA 1GG2A 2ODEA 3STTA 1XTSA 1IYZA 4ZAFA 4ZP1A 2GDJA 5G4KA 4CGYA 3E58A 2LCQA 3ZH9B 2KCLA 4EMSA 1XU4A 5DZSA 5KO2A 5FYQA 3COYA 4NESA 4BATA 4RVFA 4YH1A 4D25A 1G19A 1LBSA 4M83A 2V54A 3GRRA 5HUQA 4R9VA 3AT1A 4IYPA 3MILA 5LP1A 2Y99A 2ODTX 3RUFA 1SBYA 3ZYLA 1RC1A 1ZNZA 4ARZA 4EATA 2ZYVX 1WMDA 3A11A 2JGFA 3WTBA 4BO9A 4GE3A 2C82A 2R751 3DCJA 1T8RA 2QUHA 3DB1A 1OA0A 3I2HA 2IZZA 2FXVA 5I7EA 3PLRA 1C1DB 2R8PA 1OWLA 3ZQKA 3V6MA 1J0CA 5IJAA 5J2TB 1PR6A 2YJGA 2FR8C 3GCGA 1BU8A 2EGGA 3PE6A 1C4WA 2WXOA 3IIMA 3MJDA 1BXGA 5KNHD 1CY0A 3DQPA 2DFTA 2YVLA 1NUTA 4C4RA 1Q0SA 4B6GA 3H5WA 4PX2A 3UG7A 1KYTA 1OWPA 3H87A 1UM9A 5J63A 4P4NA 5B3KA 1KLXA 3R3JA 2D1YA 4IMRA 4RPCA 2EVWX 3QW4B 3NXKA 2WXRA 3U4AA 3AP2A 5I9SA 5KTRA 3NEYA 3TTYA 2ZR0A 1D2MA 2VJ8A 1UKZA 3ZHXA 3CGGA 4RH0A 3RHFA 1WHTB 1DIRA 5EE9A 3C5RA 1N0RA 4YAIA 2VG8A 4QYSA 3TBFA 2IDKA 1MIHA 1COZA 3WAKA 1MB4A 4MS3A 2YWHA 1X8JA 4G4SO 2XF8A 4EQFA 1IONA 4JELA 1MH1A 2BM8A 3BFKA 1CDOA 1RTTA 1N4SA 3B7SA 5G3ZA 3N0VA 1CUBA 3VUEA 5JYCA 2R5FA 3WL5A 3HQ4O 4X0EA 3K70B 1R16A 1YT5A 2ACVA 1WG0A 4DCPA 4YRDA 1V7QA 4AMYA 3ZYMA 4Y2VA 4U0UA 1Z83A 2GBFA 1GUDA 2HJSA 3QHQA 1E98A 2IF2A 4DA6A 1KI7A 5CURA 3UXGA 5AKLA 3WLMA 4DNFA 4EQ6A 4FYIA 4KWIA 4JFAA 4AIFA 4YJGB 3WP1B 3SQVA 3P9PA 1V39A 2ESRA 3AHFA 4JUDX 1CIPA 4I1YA 4KLCA 2KHZA 3AGPA 3SNKA 4C6SA 6ADHA 4QPZA 2CVZA 4IJQA 2VDPB 4FEGA 1JXMA 2WKRA 1RE0A 3M5WA 3L7KA 3H17A 4FMDF 3JD2A 2ZS7A 5AVOA 1KAEA 1LDNA 2OVBA 1ZJYA 4PZEA 2DPGA 2OAQ1 3EEIA 5THQA 2XZTA 4MTLA 3L6EA 4F8JA 4G0UA 1QK4A 5GJVC 5HA5A 4AL4A 1HZZC 4LBYA 2XA2A 4PQYA 4CQJA 3N0RA 1KDRA 1OV6A 2PX3A 1JUQA 3HY4A 3U6BA 3N71A 3IP3A 2XHEA 3CQCB 3T9FA 4CM1A 3IUPA 3ZQUA 3LDFA 1H6PA 1P9RA 4U7FA 4C7XA 5A3RA 2OP1A 5BT8A 1UP6A 3D3WB 3QKUA 2QD2A 3S7DA 2X22A 2NXPA 2CLCX 5AQBA 2WJGA 4ZT7A 2AZTA 3ZYQA 2EP8A 1U2PA 3CHOA 2IXAA 3KT6A 2W71A 1XHLA 1W0CA 2W6OA 5TEVA 1FOEB 1FJGB 4DUIA 1ZD2P 2OCAA 4D3DA 2IYNA 2RI1A 4BJ5A 1UBEA 4WMLA 4Q1CA 4RF5A 3D7NA 2CCGA 4QG7A 3SXUB 3N39C 5IM5A 2ZDHA 5FNVF 2XGOA 1R4AA 3JWHA 1XRMA 3EB9A 4CN9A 3B51X 5C7LO 4P9NA 4OQMA 3VJMA 4CTOA 3CLJA 3CNBA 1E2NA 2EEPA 1YS2X 2FFRA 4DMLA 4L08A 4HZUA 4P32A 3MCXA 4XAQA 5IZCA 1UWLA 2JBAA 5A5DA 3G23A 5H16A 3WMWA 1I4EB 2WTXA 1H23A 5JXIA 1ISHA 1ODTC 1HETA 2BMJA 3TWTA 5ECGC 1ORRA 3TGLA 1EX7A 3QVGB 5CH8A 4HLCA 1LRLA 2YFYA 1WY7A 2AG1A 1K7XB 1UDCA 1PTJC 3OG9A 5L7TA 3U26A 1P0PA 3O7WA 4M9SA 3K5PA 3BVPA 4RGYA 2DFLA 2EYUA 2CMFA 4FHDA 4OHYA 1CD5A 1QQ6A 2MSWA 3RSHA 3WNZA 1OXJA 2F67A 2H1LA 8ADHA 5FEUA 3VNVA 3BEDA 2MINA 3IJPA 4C76A 3MC1A 3UGKA 3DOJA 3ICQB 1C0LA 2XMPA 4KVAA 4C4TA 5AHWA 5K8TA 2XLCA 5EPEA 4F9EA 2OORC 3OOEA 3TR5A 3IJ5A 2D0DA 3PI6A 5I7AA 2H85A 5GONA 2O8FA 1LRKA 1BWRA 1QHSA 3NU1A 4YCNA 4M98A 4XW2A 3DRAA 2QX6A 2VNHA 3N6VA 3QYAA 1IHOA 3A37A 4NDAA 3WE7A 3B6KA 3A1TA 3AF6A 4B3SB 1C0KA 2IYWA 2RHJA 3L8HA 3CVWA 3W6PA 1BKSB 3RG8A 4KAAA 4Y9TA 1JHPA 1BXKA 1O94A 1MUUA 2IXTA 1F0YA 2GBGA 5DHTA 5DF1A 2XQFA 1BXRB 4GTSA 2FKNA 3KZKA 4RD4A 2NZXA 5F3WB 2V8BA 1K6IA 5CVUA 3R0ZA 1M8JA 4KG7A 1XUOA 2R7LA 1VGVA 2PQMA 4DV1B 1BMQA 2VHQA 1SK8A 1KO5A 4BV2A 3UMRA 1L7EA 3C6ZA 2ZAOA 4ZHQA 5L3QB 3GYXB 4G09A 4Q1EA 4QSHA 3AB3A 1BI8B 1BQ4A 2FMUA 1M66A 4XH9B 5HTOA 3P2EA 5CT5A 1VI5A 4KIGA 4AVYA 3CW9A 1P1KA 3P2IA 3LPLA 4L9RA 3KKMA 4AI6A 1GRCA 2C2HA 5AI8A 3HCEA 1AQ6A 1K92A 4IXTA 4BO1A 2XB4A 4XVQA 5IT4A 3R4CA 4WY5A 1VJ0A 3I37X 2WAAA 1JG6A 3V97A 3JWGA 2J07A 3GGDA 4OK5A 2R1UA 1BTOA 3EH2A 2BBWA 5IWAB 2XR1A 2WE7A 2C3UA 2HZBA 1GGJA 4XX1A 1QGOA 2XYRA 5JAIA 1G59A 3MAGA 4DLUA 4OUKX 4KLZA 2C1EA 2RAVA 4KO8A 4EVRA 1YDHA 4YVFA 5HOEA 2CJWA 1JHUA 3ESXA 1SXPA 4XWGA 4CI9A 3NYRA 5AKEA 3STYA 2AUNA 4UE2A 4HG2A 1Z6YA 3LX8A 4G0ZA 4Y6OA 1YQWA 2ATCA 4Y6CA 4EG6A 2B7LA 3CPJB 1DC4A 3BRQA 4ME6A 3MT8A 3GD5A 4Q4LA 3QJYA 4ANUA 4UMVA 4C0XA 2HMYB 4GWLA 4EY7A 1UWVA 2I4LA 2ZRLA 3O8OA 4WZAB 1KKUA 1LF0A 4RVCA 4UUNA 2C00A 2EAUA 2WT8A 2Y76A 2R8OA 3SZOA 3Q1LA 4JBIA 2BR5A 4YIKA 4RJTA 4R16A 5CFLA 2OUIA 5JJLA 5CGZA 3NYIA 4TXJA 1PX2A 3KSUA 4FU3A 3AKEA 1QJCA 3PXGA 4ZQFA 3W78A 3IC5A 2O4CA 5AWFC 4Q94A 2EZ8A 1MO2A 3VO9A 1R8XA 3L84A 2PR7A 3VQTA 3ZTYA 3D2LA 3T3MB 3AR9A 2XSZD 3UJNA 1SKQA 1XK7A 4W5WA 4C4YA 3DLPX 2ZE5A 1MPTA 1AIPA 3RB8A 2VGXA 3EDRA 3QFHA 3FWKA 5KWVA 3NNSA 5CNKA 5FLEX 2CSUA 4BV9A 4LYAA 3HU2A 3RNLA 5BSFA 1G3RA 1ZMBA 2WJJA 5KYXA 1S70B 3V2OA 2E7ZA 3VR5A 2YCLA 1NMEA 4CL3A 4S2EA 1ILEA 5JJBA 1XO1A 3CZ5A 3WLEA 2WICA 3OM8A 1K2VN 3JQ8B 1RIIA 1B16A 4FKMA 4YR9A 3IOEA 1D0SA 3EULA 3ZDZB 3D5TA 3DZ8A 3VPSA 2QN6A 2EFYA 2WKPA 4DM4A 1B73A 3T7TA 5FI1B 5IK2A 1S8AA 2QUIA 4RVHA 2YQZA 5EPUA 2JAPA 2ZR8A 2EDAA 5F51A 4BO3A 3DJYA 1KL7A 2O59A 1LW6E 4D10C 1JHOA 4MAAA 2X5HA 1E9EA 3PIRA 2WQZA 2V8SE 1LVUA 1KA9H 2H8KA 3Q98A 1VGQA 4G37A 1DXYA 4G5RA 2QFCA 3P5BA 2FOXA 2FR0A 3RDPA 5H3HA 5LQNA 4KR0A 3NI2A 3CLHA 3EDYA 3P9XA 1M8KA 3SFTA 3PNKA 3HBJA 4H27A 3GBPA 3KEZA 4O4JB 3SFXA 3ASZA 4KWEA 1NR1A 2VXOA 1V41E 3TQIA 1T0PA 3WOHA 4GT1A 4GYYA 3SHVA 5JW6A 3KD2A 3VSDA 4R05A 4RV5A 3LU1A 5I48A 3EZXA 1ZOSA 3X3HA 5FO1A 3PFHA 1OBCA 1M6NA 3WQSB 4FHJA 4FS8A 2QVLA 2VTKA 3N2NA 1E7YA 3O2NA 1CNEA 2HSDA 4OXQA 1RXWA 4F91B 4AZWA 4M7WA 4Y6RA 1E4EB 2W2KA 4LWPA 3AEUB 4I4IA 4MITA 1NJ1A 4BEBA 1W4LA 1R0KA 1NW3A 1Z0SA 1IZ8A 1YDWA 5HIMA 2O2IA 2PZ8A 1G5HA 4MRSA 3TF5A 1T9GS 1G98A 8ABPA 4BB9A 4MWZA 2EIME 1Z45A 3WTCA 5B3LA 4QDKA 4JNKA 4M38A 4AS1A 1GGVA 2Y0EA 4M22A 3M6VA 4IRXA 3PUKA 3AUSA 1WPXA 2F1HA 4PG8A 1NA5A 4H1HA 3L77A 3AR7A 1C9JA 4R2MA 1OX5A 2NU8A 9LDTA 2VF2A 4UAUA 2J3HA 4HLNA 4HK4A 5E6UA 4HMPA 3S5UA 2IC5A 1XEFA 1JI3A 4RD2A 4EGSA 3ZD6A 6REQB 3SSNA 3S5JA 3THOA 2W43A 1O0BA 2J3DA 1TVEA 3HUUA 1KI2A 1R3UA 3P9ZA 3FROA 3PGA1 2ZXEA 4M21A 5IDQA 4B7ZA 2IITA 1L4NA 3QB2A 2VQ3A 1RM3A 4EYEA 4TMVA 4EYSA 4J8SA 3OT4A 4N49A 1GM5A 3JQRA 1H1DA 1X1CA 3OOYA 3APDA 2OAP1 2OQRA 4R3WA 2W2QA 3AG3E 4Q03A 2XDWA 5LB4A 5I9NA 1NLMA 4TL9A 2VAWA 4WAFA 4F5DA 1UBOS 1UW4B 1F0KA 1L7QA 1YGYA 2VDUE 1A7JA 1Q83A 1URPA 5ALFA 3WGGA 4OYLA 2YZMA 4DCVA 2P41A 3OJXA 3VDQA 4RD6A 3WQQA 1YB4A 4J0GA 4Z4QA 4TRQA 3IAM1 4BNVA 3P9KA 4WRRA 3P2BA 3ENZA 5JJIA 3FCSB 4RZ3A 4P08A 4IY1A 1LXCA 5KI6A 2JD1A 2VCEA 1WW8A 1B0PA 4PSVA 4IXWA 4WOKA 4CG2A 1HORA 3VYTB 4PHHA 3MJVA 4RIIA 2YVUA 2JH3A 3BSFA 3ONEA 3NCHA 2A1UA 4LY3A 1D2GA 4QAQA 2NQTA 3HG7A 4QXRA 2ZJOA 4A6PA 3RD5A 1UBUS 3QELA 3ZW8A 1VJGA 4HVLA 1A9PA 3S2YA 4LCJA 3HCCA 2YS6A 4CZ2D 4PXYA 3MTJA 3IOBA 4P3XA 2OL4A 4V0KA 2QRGA 4EPRA 5IASA 2AGVA 1XLUA 3GFVA 2ETXA 3O03A 3TB4A 1CR0A 5DB4A 1D07A 1SBNE 2JK0A 4Q9KA 3H4VA 2R3SA 2MSNA 4H60A 4BTAA 1ZX1A 3IE2A 5E7MA 5DHAA 3VKHA 2RJNA 1U2GC 5G0UA 3IDOA 5DM2A 1JPLA 3C3OA 1VFNA 4BFWA 1M2OA 3AYZB 3PVZA 2ZJ7A 1A8PA 3GOQA 1Z07A 3RS7A 4H2DA 3NHSA 2JW5A 2EQ5A 4J94A 3RFVA 4DVGA 2YRWA 1A1SA 1VB5A 2V4ZA 4GOMD 3C43A 2VNAA 3FSEA 5G05J 4FMCF 4WK0B 1KWGA 1A4RA 4LTMA 4RH1A 1R0LA 5IU6A 2YTZA 4V0RA 4IIJA 1TYEB 2VI5A 4LMRA 5ENZA 1DBRA 2M32A 4M53A 1PVDA 4Y2SA 2PWYA 4D4IA 2AJAA 4N7JA 3ML1A 4CI0B 2CMDA 5JD4A 1OGIA 2IIQA 5TQ2B 4ZO9A 1J8MF 1D2CA 4YJ3B 4H59A 1CT9A 3MGBA 3CEJA 4YJHB 1MJ0A 1E96B 3RSEG 2I1WA 2QP4A 4E85A 4F2WA 2AOWA 5I45A 3G88A 4A26A 3KSLA 4TTAA 2EC5A 2HRBA 3UT6A 1JYEA 4I2NA 2WE8A 3ZUPA 4O8ZA 1U81A 4GAAA 3AO0B 3OQOA 5U4XA 1V16A 4Z6KA 4NZPA 1U6JA 5ALYA 4PZDA 2PYZA 4D5GA 5BWBA 4DA8A 3D59A 1L7DA 2GN0A 5LLSA 1Y80A 1JAIA 2AW3A 1UXOA 1EFDN 3CUVA 3PIDA 1J4AA 1C0PA 1JJ7A 1WEKA 2AFHE 4BFRA 4B3TB 5FJIA 3LQ2A 1IHUA 4HQOA 3RVKA 3UJ8A 1HDGO 3I9MA 3U4QB 3ZIUA 3KQOA 3L1JA 4DSNA 1Z2CA 5EZ6B 2BEVA 4EJ6A 1YZKA 2RGBA 3QXSA 4G1EB 3U5ZB 2OXFA 1JIIA 1TADA 1JIUA 3THXA 2QT0A 4QVIA 1DQSA 3ICPA 1ZBDA 1MO5A 5KJFA 5DNUA 1Q7BA 3RTEA 3JY6A 3SF8A 5C3MA 4EO4A 2P35A 3JYNA 3UA3A 4P98A 1KOLA 1UEJA 3I2YX 1F06A 2GN4A 3VLFA 4AFNA 1UMCB 4PRLA 1DPFA 3ESLA 1NRWA 1M3SA 3FEYA 1O54A 3ESCA 4A6DA 3T7IA 4HSEA 4JVLA 1T26A 2HSGA 3DOEA 3L8CA 3DVLA 4B2YA 3UFXB 1SHLA 4R54A 2QORA 4GMFA 4GKKB 3HKCA 4MZDA 1MR3F 1MRNA 1OYOA 4AYWA 4V3BA 2WTNA 3G1TA 1RJ9B 1TCUA 2PCLA 3ZXSA 5KYWA 7GPBA 1JVNA 4B31A 1WVGA 1G8KA 4JT2A 2N46A 2YFQA 2GCOB 2O7SA 3UAZA 4PIPA 4ATNA 3FB1A 4HUTA 1E3EA 5K0ZA 1P7ZA 3EE6A 4F97A 2HU5A 1Z15A 5EJ7A 1AB6A 1U3VA 2ZTVA 5L4LA 2MT9A 2QXYA 2HEIA 5AMXA 1HX7A 2FOIA 3K5WA 1M9NA 1N5OX 1L6IA 3OC0A 1FQJA 4MI1A 3U4HA 2BFDA 4LQDA 3U62A 4MBGA 4PQEA 3SY8A 4EFNA 1N92A 4IF6A 2JI8A 3DDSA 4S0ZA 2XXAB 3EQZA 5TIIA 4S12A 3VDNB 1A2BA 2CJPA 1L3IA 2HQBA 3LQRA 3NFYA 1AA6A 4QWMA 2R6AA 4I6GA 3OLXA 3UOGA 4RKFA 4FFLA 2EATA 3RYIB 4BMZA 4GGPA 5JBNA 3PUHA 2BEWA 1OAAA 3IIJA 2DVMA 1X7ZA 4MI9A 1TIBA 5BPPA 2HHCA 3DZKA 5KNDA 4ZC1A 4AJ1A 3TQQA 4A5SA 3PPWA 1ZM7A 4R8KA 4PR0A 2H51A 1S2NA 2R6CA 4NK5A 1GKKA 4KGXA 1Z0UA 5LA6F 2RHMA 3PNLA 4LJ5A 4EFLA 3JATA 5CRUA 4OYYA 2J3QA 3U1VA 2WAMA 3KVOA 2JJ1A 5HQ3A 1Z5GA 4D0NA 4YNDA 2JLRA 4Z3KA 2MWMA 3HCDA 1ZN9A 1X80B 4LV5B 1S01A 3PZDA 4Y2XA 5A5GA 1NQ5A 1G55A 3AIKA 1ZVVA 3ABOB 3OAAA 4MHOA 2W6PA 3AHHA 4EGCB 5JUWA 5AK0A 1AG9A 3GEIA 1JYFA 5DI9A 1BDMA 1I2BA 3D3MA 2FFBA 3DMTA 3UTCA 1W5BA 4FSDA 3G2NA 2XGJA 5EMLA 2IVZA 3QPUA 5JT1A 4B7AA 4EI2A 4LXQA 1ZXXA 3WBJA 1QAMA 3FYUA 3D6TB 1F2DA 3C0KA 4PE5B 3E9MA 3G5MA 3QLUA 4YXFA 1FDWA 2GYUA 4UU7A 1FU4A 5DTJA 2M6LA 2XQJA 3IHWA 4N18A 2C42A 2FPKA 3DPUA 4TGLA 3TMAA 2YJ6A 1SQFA 3LVBA 4LSGA 5PNTA 2IY9A 1I7NA 3K2EA 1O9BA 4E30A 1M2HA 3M6MD 4CQNA 2O9JA 2Y05A 4PLTA 3N6XA 2VNIA 4WCFC 3HUEA 3KYDB 5EFZA 3USES 2B7CA 1ZCFA 1LSOA 1PJCA 5K45A 5ALLA 3RABA 4UHDA 1M6WA 4N0DA 1JHRA 3KQPA 1L4EA 4H3HB 3K9FC 1GPBA 3RYFB 4MCAA 1CQJA 3D8RA 1O4VA 3SJCA 5FOVA 4XR9A 1OT8A 3NJRA 3WSVA 2HADA 4CF5A 3CZ4A 3K9LA 4LAFA 1E64A 4JLWA 5L3VA 1NMSA 1NQVA 1WUTA 1W4ZA 3L2OB 2GN9A 1P7PA 3NAMA 2NUTB 1P2TA 4I9UA 2I9KA 4LF5B 4MVYA 4C6RA 3MV3B 3RS9A 4XCXA 1T2NA 1Q1EA 1G6Q1 1N6IA 2YV5A 3DEFA 4J07A 3C87A 3PNSA 2XMSA 1UUFA 1OXUA 4UEKA 2XZDG 4IGKA 1ZICA 3NHJA 2C7VA 1YHZA 2QLMA 2VVTA 3WRWA 2ETAA 3B48A 4GQAA 1CUAA 3A4MA 1LW7A 3CF4G 2AXPA 2Y3AA 4BT9A 3I1IA 4OGFA 4AJ4A 5GM2A 3HO1A 4XUEA 1WMSA 3NHBA 3ROTA 1Z5SC 5A7FA 4NCAA 3G8YA 3EF1A 3ZR4B 3SD5A 2IXBA 3BMCB 3FPBA 2A84A 2GRLA 4QXQA 2X4GA 4D9HA 2ZRFA 5JISA 2B9VA 3AW9A 4O3FA 4QQ8A 1DBVO 1UOHA 1L7NA 1YZ3A 3NJ4A 3LHSA 4MGKR 1US8A 2GZMA 3GNLA 2I6UA 4OA5A 3R5KA 1X1TA 4CKYA 2DIWA 2ZQ5A 3BWYA 1L5HA 3FJ1A 2QRVB 3OMXA 4RK7A 5KQGA 4MW5A 4FGWA 1DAIA 3ANYB 3OLCX 2L2QA 3WB9A 1SUSA 3RC3A 3UT4A 1MT3A 3DLBA 3IBEA 3DC2A 3DHNA 2OCXA 5BUQA 1C1HA 4L5IA 2HWXA 3M6IA 2JFPA 3GZSA 3I4LA 3H7IA 1TF2A 1K7FB 2WSMA 4A0GA 4G84A 2GHRA 4HI0E 3M89A 2SNIE 1WKBA 4URKA 4TV8A 3B95A 1ELOA 1DI0A 3CEMA 2O4UX 4EYKA 3AONB 4G0YA 5JA4D 4BGDA 2FRDC 1JP7A 3FDZB 4Y1EA 4HVBA 1OLUA 3GPDG 2FEAA 3DXYA 3STWA 3WGIA 4UWHA 2VQ2A 5SZJA 3RKRA 1WE2A 5SZIA 1R8JA 2B30A 5JRZA 4NIKA 3FNHA 2MYOA 3G1WA 3B1YA 3ZVLA 3ZHUA 2C3MA 4O4HA 2X1VA 3DBRA 3FDFA 4OGGA 3O4IA 4ZVOA 2PZAA 4KI0A 5HUJA 1C1XA 1KJQA 1Y7TA 1L5LA 4XJVA 4AJOA 2ERYA 1KZGB 4TWAA 3G7UA 4CMIB 4A1GA 1UDXA 2G5PA 3NGXA 1GO2A 5J5CA 2PX8A 1VE1A 3D9JA 3LKVA 1PDVA 4I0WB 4LXTA 2FWBA 3DXKG 1JZQA 3E1GA 3HKBA 3ZOKA 4Q37A 5KNBD 3SJ7A 1H6OA 1XDUA 1TLTA 3UCXA 3PH0C 1O1TA 2VIIA 4H6XA 2NQ8A 1BHO1 2C2MA 2D0OB 2EINE 2J5KA 1Y4DE 4UI9C 3V7YA 2RHRA 3N05A 1AE1A 1H6KA 1DXOA 4M55A 1DIHA 3F7OA 4XGIA 2WZQA 1IM5A 4GKVA 3RJMA 1ZD9A 4I81A 4M9RA 5IRCD 1UBJS 3TIVA 4B79A 3FVRA 1NX9A 3RIMA 4B93B 3TVDA 3MLEA 4OG2A 4RLQA 1QHHA 5B3JA 3O8QA 4ALKA 2NV0A 1WW2A 3GRUA 1NU6A 2W0SA 3KT8A 3UB4A 3K2QA 3C48A 3UXEA 4TMWA 4D3SA 2OQVA 2QYJA 5IZ4A 1QCYA 1WMEA 3SIRA 1T1SA 5IWCA 5CM8B 4O4IF 3AUJB 4O2LA 3IH5A 1I30A 2O3UA 5TPZD 1KDYA 3ELYA 4IH9A 2JJ2A 1D9SA 5A3SA 3HY3A 5KAMA 2ATVA 2IEGA 2RSFA 1CIJA 3QKRA 4P2GA 4RC9A 1CEXA 1MVLA 3LIIA 2ZJAA 2WVGA 3KWFA 2BD0A 2SBTA 2DY1A 3CZ9A 4ONEA 4GG1A 1YA8A 5E75A 5E38A 2PHZA 4E51A 4O5OA 3MQFA 3W9FA 3R5HA 2BKUA 1XA4A 2QR3A 4C0BA 1KAMA 3ONLA 4NBWA 3V6LA 3DL7A 3DSXA 4G1FA 1VKNA 3HCPA 1E4YA 2R7NA 4CF4A 1YGPA 3GT3A 4QDZA 5CUQA 4BE9A 3G13A 4GMKA 2M6SA 3QU5A 1NM5C 1I2AA 3RFCA 1VXRA 4Q9NA 3LPDA 3F6SA 1O9HA 3M2PA 1SQ5A 3A9SA 2NU6B 2QX7A 2D5LA 3L5KA 4A03A 2KLBA 5IVIA 2Q1SA 1VDMA 3CRMA 2ZYDA 5F5NA 3D9NA 3V8RA 4FNGA 4F72A 3BFJA 1XDGA 2PQ6A 3NTVA 4G65A 5CX4A 3JQFA 3AF3A 2HW8A 1PFUA 3LCCA 4ZIRA 4X64B 3WVNA 3V30A 3A1FA 1AN0A 3I6YA 2PSHA 2YH2A 3EFOA 1N11A 3Q78A 1QBKC 4GXRA 2QWXA 2XB8A 3OQJA 2UYYA 1IBMB 1SU6A 5ALUA 1QQ5A 1EWVA 3E9EA 4MIYA 3LI2A 1WETA 4PQGA 5FZRA 3PXCX 4U5XA 4L8YA 3T9AA 2I4OA