4GZ5A

Crystal structure of human o-glcnac transferase with udp-glcnac
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
716
structure length
700
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 265
structure length 700
sequence length 716
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz5A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz5A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gz5A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gz5A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gz5A03
1K06A 4MRAA 2QLLA 3HBJA 4HOTA 3WAGA 1AXRA 3NPAA 4BQIA 4X7RA 5FTPA 3RT1A 5EX3A 1E96B 1RRVA 3E4BA 4U0UA 4I9EA 1KTIA 3CVQA 3VUFA 5CHEE 2IV7A 4WUYA 4KBQA 3BD8A 3E3OA 3RU0A 5C1DA 3D0RA 3G2HA 3MRTA 1BX3A 2QRHA 2HYZA 2AW3A 2XMPA 4KQ2A 3CK9A 4J0UA 3CUWA 4Z5XA 3QWPA 3O3CA 2F3PA 1L6IA 3WC4A 3CK7A 3MS4A 3MEKA 3NF1A 4WNGA 4CTOA 1L5WA 5AYWD 2YQ8A 3D0QA 5D0OD 1E1YA 1GPAA 3GZ2A 2BGUA 1FTYA 3T3DA 2V5FA 1KT1A 1WV0A 4M83A 1FU4A 3NC4A 4AMGA 4CGWA 3ZCUA 3HBFA 2LNIA 3LPZA 2PRIA 5JTTA 2GPNA 2KATA 1HLFA 1Z6QA 1B4DA 3L7BA 2PRJA 2QN9A 4H7XA 3ULQA 4YNDA 2QN1A 2SKEA 1L7XA 2KCVA 5EX0A 3BCUA 4HOQA 1ELWA 2FF5A 1P2BA 3NP9A 2QLMA 2BISA 2OFFA 3MTAA 4NEQA 4XIFA 3LKUA 4ABNA 4LDPA 3S27A 2XA9A 2BGTA 4KQMA 2KC7A 4NC9A 1IIRA 4UQYA 2Q7FA 3OTHA 1FU8A 2IF4A 1Z62A 3EBOA 1V4VA 2XCUA 3WADA 1L5RA 1PNVA 1JIXA 4Y6WA 4MHOA 1YGPA 3HYMB 2JJMA 3C4QA 1YA6A 2X0DA 5I45A 3TAXA 2QRPA 3N71A 4RELA 4I2ZA 4EQFA 3MTDA 4AMBA 1QQEA 1QZ2A 3ZGQA 3OT5A 2G9RA 3OXGA 2J9QA 2IYFA 4GYOA 5JJ6A 4RENA 4MI9A 4XI0A 1C8LA 2PQ6A 4G24A 4RBNA 7GPBA 3G2JA 1Y8MA 3TSAA 3ZCVA 2PQRA 1XV5A 3MV2B 3QKYA 3L79A 1K08A 3E3NA 1O6CA 4UQXA 2ATIA 1FCHA 5TMBA 5DIZA 3SZ7A 3RIBA 2ACVA 4GZ6A 1NOJA 2AV6A 1ZBPA 3QKWA 3D1JA 2JLBA 3LCAA 4U07A 5LCWC 4HWGA 2O6LA 3C48A 1UQUA 3S0JA 2XPIA 1XKXA 3Q4AB 3U4TA 4BT9A 1SXPA 1F6DA 1GG8A 1P4GA 3IAAA 3ASGA 3ZPJA 3NB0A 3CKCA 1TJCA 3CK8A 1L5VA 4MI6A 2MHKA 1L5SA 4HOUA 5HQ8A 2F3SA 4L22A 5FZSA 4RIEA 5D00A 5G05J 3QHPA 2VGXB 3CEMA 2C1XA 4I17A 1RZVA 2Q6VA 2VCEA 4WHMA 2NC9A 1B89A 1GGNA 1UQTA 3GW4A 2GEJA 3MS7A 1SXQA 1WUTA 1QKJA 1L5QA 1EXVA 2XGOA 1GPYA 3MQFA 3UPVA 3OKCA 2VYIA 1E4OA 3SYMA 1P4JA 3T3EA 3Q49B 2G9UA 2F9FA 1P5QA 1ABBA 2C0MA 3MT8A 3OTGA 2VGXA 4IN3B 2R60A 2PZIA 4GZ5A 5FZRA 5G05C 1JIUA 3TG5A 3OKAA 3MT7A 4J8FA 3MSCA 4BTAA 4F96A 3ZCTA 2GM9A 3ZCRA 2FI7A 3HBMA 1JG6A 5DXFA 4RIIA 4MICA 2QN2A 3FP3A 1LWOA 5G04J 2QRGA 2C0LA 5FT9A 2FETA 2BFWA 8GPBA 1FTQA 2X6RA 3OY2A 4BQEA 3FWVA 3OXFA 4NESA 2X0FA 1NZNA 2WPVA 1Y8ZA 4WNDA 4PQGA 3ZCSA 2KCKA 1PC2A 5GPBA 3RSCA 4YUAA 1EM6A 2XGSA 4N2SA 4O6FA 3QWVA 3Q47B 3S7BA 3CEJA 4F9FA 3WXXA 4N3AA 2R4TA 3ZCPA 1WAO1 4UQZA 5A6CA 2G9VA 3E3LA 3CVLA 4X7MA 3CUYA 4G2TA 2WQHA 1C8KA 4Y6CA 2VGYA 2VSYA 1IHGA 4KYOB 3OKPA 4KQ1A 3LY9A 1P2GA 3GZ1A 3FFLA 3HBNA 4HLNA 4G25A 3TG4A 4N9WA 3T3IA 3S7JA 5FJYA 2IYAA 1AHPA 4N3CA 3VDMA 4RG6A 4CTNA 3DDWA 2IV3A 5M72A 4REMA 2PL2A 4BT8A 2KCLA 1H5UA 4EKYA 2AZDA 5D01A 3ASFA 4GPKA 5CCMA 3QDNA 4N5CA 5ARGA 4RIGA 3JYSA 4H7YA 3UQ3A 3DZCA 6GPBA 3OXLA 2F3UA 1GZ5A 3ZN3A 4A1SA 2ECPA 4AIFA 4W9RA 3OTIA 2YHCA 3QOUA 1VGVA 3RKVA 3EBPA 4M7PA 4NQ0A 3MRVA 2HO1A 3BDAA 3DD1A 2XCCA 3CEHA 4AY6A 3PE3A 4JA7A 3NAZA 2QRQA 3KAEA 4J8DA 2LSUA 2JZCA 4I9CA 3AS5A 3AS8A 1XC7A 2FEZA 4CGVA 2QFCA 1A8IA 2Y4UA 5HI7A 4XI9A 4BWRA 5KJKA 5JTUA 3PE4A 3KD7A 5DBKA 3LY8A 2IFUA 1NA0A 2XEVA 3G2KA 3EDTB 4N2QA 4RIFA 2C1ZA 4GA0A 1NLMA 2SKCA 4W6QA 2FO7A 3S7FA 4M60A 3FROA 3CX4A 3COPA 3NP7A 1J39A 4JL0A 3RO3A 3CV3A 1JG7A 3MT9A 3CUVA 3VUEA 2AVPA 3ESKA 4AM9A 2GEKA 2IW1A 3GUHA 5D0QD 2KS6A 3G2LA 2QN3A 2R4UA 1GPBA 2C9ZA 3NCHA 4NRHB 2R66A 4LEUA 2G9QA 3BD6A 5A7DB 3URZA 4G26A 3K9IA 1C50A 2ACWA 2ZB2A 3OY7A 3CUTA 3GYZA 5BNWA 3R9AB 3CEQA 3ASHA 3Q15A 3G2IA 4BQFA 4YI5A 4RIHA 3BD7A 3H4TA 4G1TA 9GPBA 4GYWA 3S28A 2YJNA 3GPBA 2IUYA 2GPAA 2XA2A 5IKPA 4GZ3A 4F3VA 4LEIA 2IEGA 4GA2A 3G2NA 1P4HA 5ARFA 3O48A 4G23A 2VQ2A 4I1AA 4EL0A 3ZCQA 3BCSA 2I6HA 3LYAA 4UI9J 5ENZA 4BTBA 1XL1A 2H1FA 2X6QA 3UYLA 4F97A 3CVPA 5TVGA 1NZFA 4JHRA 1W3BA 3AS4A 3CUUA 2IEIA 4AY5A 3ASDA 1P2DA 1LWNA 3MS2A 2QZSA 1WW2A 3L7DA 4X6LA 2SKDA 2XA1A 3T3HA 2PYIA 3LY7A 2AMVA 1ELRA 3TOVA 4EKEA 1PSWA 3Q3HA 1HH8A 3QWWA 5BW8C 2GT1A 3ZFWA 2GPBA 4RG9A 1HXIA 4YVOA 4CDRA 4UI9C 3ZHEB 3U3WA 4YVQC 1UZUA 1PYGA 3PDNA 4G2VA 1C3JA 1WV1A 2C2LA 1ZU2A 5G04C 1XNFA 1FTWA 2P6PA 3CV0A 2FBNA 3TGOA 4FZRA 1NOKA 1A17A 1WW3A 1Z6PA 1QM5A 3T5TA 4U0ZA 1WUYA 2ASVA 3BEOA 4ME2A 1Z8DA 3SF4A 3DDSA 4WNFA 3ZHEA 3CKBA 3H4IA 5KJNA 5KJLA 4MI3A 1IXYA 2UY1B 2E2EA 5LQDA 2BUGA 1FU7A 2R5SA 3S2UA 2C4MA 2HY7A 2PYDA 1IYGA 2OOEA 1KLXA 2XCIA 2PQNA 4B94A 5KJMA 4N39A 2P58C 3T3GA 4WADA 2VSNA 4GA1A 1FS4A 3KS2A 3MRXA 2WTXA 4HORA 5TMEA 4UI9K 3SYRA 3S29A 3AMVA 3Q3EA 2FFRA 1FA9A 3C4VA 2VCHA 4CTMA 4JA9A 3Q5MA 5IKOA 3RJVA 1NZDA 4I2WA 4WNEA 1JEJA 2UY1A 4X7PA 4FKZA 3VTXA 4U0SA 2VG8A 2HR2A 2QLNA 1HZ4A 4GYYA 1NVKA 5FZQA 3L7CA 1F0KA 4EL5A 4GCOA 1YA0A 5LCWJ 4AN4A 5JJTA 3L7AA 3CVNA 3L01A 5BT1A 3IA7A 4GPBA 3BCRA 2QN7A 2XGMA 5JJ7A 2XCBA 4N3BA 4APOA 2L6JA 2LSVA 3MA5A 4WACA 4GCNA 2X0EA 1FC0A 1GFZA 1XOIA 3UYKA 3Q3IA 3S7DA 3T7DA 5DU2A 2F3QA 4MHSA 4EJ2A 1JIVA 1RZUA 4QLBA 1Y6GA 1PN3A 2H1HA 2GJ4A 3IEGA 3MBOA 4HOSA 3RHZA 3RSZA 5EKQD 3MV3B 3MTBA 2ONDA 1NOIA 4BFCA 2FF4A 2QN8A 3VDNB 4KXKB 2QNBA 3UUXA 1OUVA 1KT0A 2R68A 3BEEA 1Y6FA 2Y4TA 3VTYA 3RO2A 4J8EA 4YI3A 1NA3A 5DLDA 1P29A 5CCLA 5HXAA 2UWJG 1WM5A 1M5RA 1XL0A 2GW1A 5TMDA 3MKRA 4U04A 2QRMA 2DBAA
chains in the Genus database with same CATH superfamily
4N49A 1J24A 2QRJA 2OZVA 4A27A 3FVTA 3H9QA 3ZW9A 4HGRA 3GX1A 5E4TA 4NBNA 4H0NA 1G20A 3GQBB 4WUYA 4U00A 5C7YA 1C30A 1UJRA 2LAHA 4FU0A 3VHQA 4OA8A 2IKQA 1Q14A 3EWAA 5L45A 3I39X 1T4CB 2H06A 2YHUA 4C87A 3ML9A 3QYFA 3ZJVA 5LQCA 2QROA 3FTEA 1CUIA 2WJGA 2IX3A 3UPUA 1W85A 5H68A 5M2QA 4RSRA 3L13A 4TKLA 2ZYWX 2D2FA 1W96A 1Y1TA 2D5AA 4B82A 3KAPA 4E32A 3KZVA 3LSYA 4J16C 1VLZA 4WK2B 2CLDX 4ZCTA 4RH0A 3F46A 3IT1A 3MILA 4GMFA 3ZNGA 1CY7A 2FPUA 4BPBA 3TLXA 4XASA 4WZBE 1C0LA 3N2NA 2ADOA 1NIJA 4LHVA 1SKBA 4LXGA 2VSOE 1NVMB 4II3A 1M2NA 3LBFA 4RIEA 3Q9NA 4L7VA 3I3NA 5IW8A 5DP2A 5BW4A 3DTNA 1WXFA 4DLSA 3ZBUA 1GT6A 1KSHA 3IMFA 4K9RA 3QARA 1T8TA 3MT8A 3G2WA 4JD2G 1G6OA 1GTRA 2E87A 1AIPA 4RJJA 4RS3A 3GJ8A 5DXFA 1LW6E 3HG0D 4BMDA 3FP3A 1AQLA 3LKBA 1IKND 3CIAA 3L9WA 2PNFA 4GE0A 3GIWA 3AAAC 2AKYA 2OOSA 2VPIA 2Y1XA 2OFPA 3Q7AA 2A0YA 4R1TA 3OX4A 3L18A 4W1RA 3C1OA 5KC8A 3NB2A 4N82A 4U6QA 1ORIA 5AVJA 3PGXA 4IX1A 3AGPA 1YJAA 5HUHA 4H7YA 4DARA 2CL7X 2BBOA 1ZM3A 3UHOA 3D6JA 1ULTA 3QVXA 3QUCA 2IYTA 1XZAA 1JYSA 3OKFA 2ZUWA 3ND9A 3E1SA 2F90A 5K6RA 1J21A 3P45A 4HVTA 2P4HX 3NJ4A 2CUZA 2YHSA 3AP1A 1FX0A 3FGNA 3E0QA 4NYJQ 4KJZA 2RGNC 3IBCA 4JMLA 1W6UA 4LEUA 4E94A 5T4FA 5IJXA 2AR0A 2DUMA 3AR3A 2FUEA 3GCWA 4BQFA 5LA6A 1AGYA 5B64A 3FPGA 2XNDA 2YASA 3GFQA 4LRWA 3HADA 5IKPA 2C9YA 2OC9A 5AKKA 2GBPA 2O8CB 2ZUDA 4BNHA 3UWKA 3PC6A 3L8FA 1E6LA 1P2DA 3QBTA 1W4CA 4BETA 5HKAA 1IXZA 1ENYA 5TVKA 2ID9A 3B9PA 4TMTA 2GM3A 3FMPB 3PDNA 1KOGA 4FJZA 3NUGA 1JR4A 5B1EA 5FJIA 2BEVB 1YZQA 3GRKA 4JJEA 1ZR4A 2XUFA 3GY0A 4P0PB 2HPVA 4AF7A 2WHYA 4HNGA 1FU7A 3VNBA 4F85A 1I7DA 4LOKA 4C0BA 3MRXA 3IMKA 1OB2A 5A3QA 3E48A 4BY6A 4U7GA 3WHIA 3GMTA 2SBTA 4BLQA 5DBHX 2PH7A 4O6VA 4GYYA 2QY6A 4CKYA 1VECA 4GSYA 4YRKA 4UW9A 3DMYA 4O2BF 3N5KA 1CUAA 3HNRA 3LPLA 4GTPA 2HQSA 4GWGA 5ALVA 2XE8A 1KR2A 1DV2A 1GXSA 4DV2B 3QPBA 2ONDA 3QG1A 2RGBA 1KETA 4JWKA 3RGGA 3I23A 3B1WA 2VDWA 1W5BA 5CCLA 5FHRA 2B0CA 3ASVA 3EG9B 3UM0A 4UNNA 5IUNC 1G1AA 3CM0A 3CC8A 1TPYA 5J4LA 1UJ6A 1XO1A 1V5GA 4QUKA 1JHYA 1J20A 4YJ3B 1EWQA 3C98A 4RTRA 2D2EA 1VLJA 2V6GA 3QWPA 3OAAD 4BFZA 3DBOB 3K9GA 3R9KA 4OJNA 4GRIA 3V2UA 3I9MA 3EEBA 3LDUA 2FX3A 1JQKA 3K0BA 5JXGA 4DLZA 1Z2NX 2HFKA 3PE6A 5BR7A 2L0XA 1BEUB 4XYLA 1UT8A 3LW7A 3UT6A 3U0BA 3U1TA 3DEHA 4AJEA 4LZWA 1WDMA 3A3YA 4OGGA 5DDIP 3BXZA 1A9RA 4Y6OA 2BVNA 4F6RB 4H08A 4UM8B 1TIPA 3Q1LA 2O9JA 3FWHA 2I7VA 3SE0A 2CD7A 2CBXA 1C1XB 4P2GA 3KVNA 1Z47A 2XZDG 3OZWA 2DYSE 5L9AA 3DEFA 2X4GA 3CF4A 2FH5B 3BUSA 5ALXA 4EX7A 5ESRA 5HDQA 3GUCA 3ZK7A 3BF7A 3CH7A 3ZU7B 3OQ6A 3L7YA 2OCYC 1U5BB 2BBWA 2L42A 1ZL0A 3BWDD 3FOAA 4MW6A 1GAEO 4B4WA 4RK1A 4XR4A 2HFJA 5FOVA 5IH7A 1UQTA 4ZQCB 1T3GA 1ZM7A 2VJCA 4BQOA 1PT7A 2F9FA 2W6MA 3PQFA 3H17A 3M6XA 1U9ZA 2CDAA 4CFSA 4DEYA 2X3FA 1PTJC 5H3CA 5IZCA 1JCQA 1UM9B 3BCHA 1O54A 1YVDA 3IV9A 2Q3JA 3OQNA 5K0EA 5AHKA 3IT0A 3UJCA 4BS9A 3GLTA 2C31A 2NU7B 1OT5A 3VPAA 2HSGA 4HAVA 5JNSA 4ZHBA 3P32A 4GL4A 1KHHA 2JLYA 3O2QB 4Y1GA 4IIJF 3WO0A 5FQ4A 1QAOA 2JAPA 4IEIA 1FFYA 5ECYA 3HU1A 1GVNB 3ASZA 1WB4A 2CN1A 3B78A 2XTAA 2PR2A 3I5PA 1ZCZA 1TNBA 3S2IA 5JYDA 3H1BA 2QOEA 3VBCA 2BRUC 5JO9A 5H7XA 4IMRA 4D3SA 2YOHA 1ZPDA 2WF8A 3AVOA 3VPFA 4R2JA 5ICMA 3QKRA 5I9MA 3ZHYA 3OZEA 2B83A 1AUVA 5F9MA 3VC1A 2PAAA 4PLCA 1W36D 2BKLA 3TRHA 4UM9D 4B6RA 1D2MA 1JA1A 1UXGA 5HBRA 2DRIA 3DZFA 3UB4A 4OQFA 3UJ3X 3Q7IA 4MV5A 2Q9UA 2J7PD 4AJIA 4FZVA 1KYZA 2QV7A 1R4MB 2I22A 4Q3CA 3DZKA 3G88A 1O94A 2N46A 1P4AA 2ZOSA 4ZO7A 3P27A 3O2JA 1B8VA 1EFTA 1VLHA 1XTRA 3D5EA 3V4OA 3EF1A 1LX6A 2IU3A 1LRLA 4BKOA 1WWKA 3NVMB 4G4SO 1G2IA 1ZBQA 2Q5QA 4F97A 3QPCA 5AM5A 5KPDA 1NZFA 4G01B 1R0RE 1YRYE 4BO5A 3KEGA 1I7LA 4IQ8A 5EP3A 2G4CA 3ND5A 2CKDA 4BO6A 1RHMA 3GEPA 2RAPA 2KBFA 4A1OA 2XTNA 3U3WA 4ZO8A 3V4LA 3GD7A 1MEEA 2HK6A 3KOMA 2ZPUA 3MYVA 3GVIA 2DQKA 4H4DA 2CYBA 3LC2O 3IAM1 1HNWB 5G0UA 3ZWCA 2PJRA 3FWKA 4R51A 4I1IA 5G4KB 1RRPA 2OP1A 3GAMA 2WM8A 3KBBA 1E9SA 1FUUA 1MX3A 3BFPA 2HA2A 2GYUA 1V71A 2D1YA 1AS2A 1HX8A 4DA8A 2QKYA 4OHCA 4NAHA 4Q7JB 4XQ0A 5IF3A 4DRXE 1L5HA 2XOEA 1IFXA 1U2TA 5KSWB 5JASA 2ZIGA 1UBTS 4F6CA 2XCBA 3K2EA 4WW0A 4M0UA 3P2BA 1NRJB 4PDXA 1XEXB 1UBEA 4IBOA 3ILSA 5L7WA 1KL7A 2WXRA 3KWMA 1CUFA 2LD4A 2BZGA 5L4NA 2W83A 1OUVA 4MQ5A 3KOWA 2C8KA 4D4JA 2EWWA 4J6FA 2GUWA 1KDRA 4AG3A 1SHJA 1F48A 2IP2A 1BDIA 2CJPA 2FEAA 2Q6KA 2V7TA 5B3AA 4IDFA 4F7DA 3BILA 1WZCA 2J5BA 5F51A 4C0WA 1E9AA 4UARA 1VG8A 4H7KA 4BHTA 4M6WA 1UPTA 3B7WA 4M46A 5K4GA 3A26A 4JR2A 5JNRA 2RKKA 4M89A 3ORQA 3GNLA 2QMZA 3GLUA 5G0SA 3BCUA 3HYSA 2EJWA 2I2DA 3BAFA 3AKZA 2ZBPA 4PSVA 4DJFC 3SR4A 1G21B 3WGHA 4PHGA 1ZONA 2EKBA 2LDBA 4Q1CA 1BDMA 4GT1A 4IVNA 1YGPA 5JCZA 2F67A 1O57A 1F8UA 4YJGA 1QZ2A 1T6YA 4JI4B 3BUAA 3STUA 1U02A 3MYYA 4TXPA 2APJA 2PZ8A 3IUSA 1TNDA 2M32A 4KPUA 4ND7A 3RO7A 3OWHA 2I1LA 3I34X 4ONEA 4PYIA 2O20A 3AM3A 3IQGX 1KEKA 4BBZA 3R9IA 5FUVA 2ZSBA 1M2VB 3HVIA 1HY3A 2WIJA 4MWZA 2IHJA 4M1EA 5TB5A 1V54E 1I2CA 3EGWA 4IFEA 5EJEA 2IPLA 1B89A 1ZVJA 3AUTA 1EXVA 2YWEA 1AZTA 3UPVA 1J0AA 1E4OA 3PGMA 1PAQA 3SSAA 1CULC 3DEZA 3B1JA 4MQEA 1DZIA 2JI6A 3DZDA 2HQBA 3KTFA 1EAYA 3NM6B 2VBCA 4N12A 1A8SA 2H17A 4TYQA 4BO3A 2FJ0A 4AZVA 3MGCA 4Q3AA 1AN0A 3PZ2A 3ZUVB 1N2IA 1SWWA 5EWJB 3FCOA 4PH4B 5A0VA 1GSAA 4QVIA 3GWZA 4FYXA 2A1IA 1U8TA 3RYFB 4ZGGA 4MV7A 4I9GA 3MZLB 2ZP1A 5G40A 1ZUNA 1KSFX 2BEJA 3K0AB 1F60A 4Q4CA 5I7OA 4KN9S 2SICE 3EX7C 1AE1A 1IDN1 1HZZC 4G1EB 3UPTA 2QAGB 2V45A 1RAGA 1O4WA 1SVOA 5T41A 3PC7A 4FU3A 1XLUA 2YZ2A 3K0EA 2DECA 3TLJA 2BM9A 4RVFA 1ZZEA 2X2FA 1W1UA 3DD1A 2XCCA 3MWFA 5E6SB 3BXXA 4YB8A 4FCVA 4Y0AA 3OG9A 2XUPA 2RKWA 2ST1A 1CUYA 4TRMA 2O2CA 3J80A 1XU7A 4JEHA 3D4PA 2ZJYA 3V8PA 4D3DA 4JC4A 1KDPA 2F43A 4WK0B 2B3TA 2J67A 5KNGA 3C7TA 1ZSNA 1KOLA 1YS4A 1CJKC 4YN3A 2A90A 3FPAA 1KC3A 2C03A 3ZWBA 2PWBA 1P31A 3AF3A 3ZKWA 4NIKA 4MR8B 1XE3A 3OIDA 1Y1LA 3RKSA 5CM9C 3KYJB 4KJXA 5JR3A 3N28A 3NAQA 2Y3AA 1XLTC 5GONA 2O6HA 4AY5A 2Q3MA 2BKVA 2PR7A 4U2DA 1EINA 2PEZA 1RWMA 3R8FA 5FKJA 1UODA 2VJMA 1UZUA 3QMVA 1PG5A 2B8NA 3D64A 2WIDA 3IEMA 1DC3A 1VSUA 3P71T 1S02A 2R8ZA 4J76A 3NEYA 2YZMA 3JQAD 2ODEA 4YP1A 2ZSFA 3TWOA 5FQ6A 1NR7A 3NONA 2P6NA 2RH8A 3LWBA 1C9NA 2ZGGA 1NONA 3PUIA 2GZ2A 2K2WA 5K3AA 1LA2A 2R11A 3COWA 5B57C 5B2ZA 1AF7A 3O8CA 1MGOA 1PG0A 3EQ6A 3GJ4A 2WDPA 4QVGA 3USES 3JQ1A 4QASA 4BX2A 4LF8B 4XB6B 2XB6A 1LF8A 4M36A 4MHSA 3IE1A 4COKA 2XUGA 2FR0A 3EGCA 2OV3A 1SH7A 1Z3IX 4G2NA 2OCDA 4GLJA 3VKWA 4ER5A 3I2IA 4BNMA 3GEHA 4G0QA 1THTA 3HHMA 4OATA 1NA3A 2ENWA 2WXQA 1VM6A 1HFJA 1HE1C 3EDYA 4N5HX 4D97A 4WTOA 4ISCA 5E6RA 1AGNA 1I80A 1U4NA 2XMPA 5ALGA 3TVDA 1IZ7A 1EK2A 1DBQA 3DV2A 1WX1A 4L72A 4HFGA 3W2IA 5AI8A 3UK0A 5DBGA 1KEEA 1TU0A 1Z5PA 4CMAA 4AZTA 3W2GA 4HFRA 1MD9A 1AY0A 2YWXA 5KX5B 2VTBB 3UAOA 3U3DA 3PXGA 4E6PA 3H84A 2V3VA 1XD2A 4QA9A 4I1OB 1GUBA 5JCOC 4TV9B 1SULA 2W2OA 2GI4A 2YY7A 1GZHB 3J5QB 5BQPA 3VDRA 4F5WA 1Q95A 5IDWA 4DVGA 3CR8A 3FRJA 5H02A 1AP7A 8MHTA 5CXUA 4B83A 2IU6A 1NNEA 1FF9A 4HWRA 4UTPA 1E3SA 1LBHA 1LDNA 4X3CA 4HBGA 2Y71A 2XPCA 2VK2A 4IDQA 1GA4A 4Q96A 4A5SA 2HZBA 3AF0A 2I4RA 1N6NA 2VL7A 1MORA 1L5KA 3B52X 1J7KA 3CHRA 3W7AA 4CTJA 1GADO 2FEWB 5D5QA 4CKEA 4CDMA 2VJLA 3F6RA 4B3TB 4R84A 3KU4A 1Q12A 4D25A 2PS9A 3H83A 4QPJC 1IXSB 4DZTA 4BO2A 2YOFA 3MELA 1AA6A 4K6MA 3P8ZA 3HJFA 3ROKA 2FOLA 3NHFA 4F46A 4RVUA 4Q24A 4RTJA 4KI7A 2JJ8A 5LDDC 1ZZGA 2OCIA 1MAAA 2GEVA 2GCOB 3BWXA 4Q9HA 3A6KA 1T15A 4H0FA 2JLWA 4K26A 3M4XA 1E8WA 4MV1A 4ZYZA 1LPSA 4EIWA 3QVJA 3LO5A 5F2EA 5DTJA 1NZJA 1EB9A 3FUEA 3GRAA 2XXBA 1CJSA 4GF5A 3LJNA 2BE9A 3SXPA 4PBRA 4TOIA 3IHKA 4LXQA 1EVLA 2JFNA 5B37A 4FN5A 4G0UA 4Q3NA 1WBBA 3U80A 3H2YA 4I6JA 3JYLA 4B85A 4U2KA 5B2EA 1UMDA 2N3ZA 2ZSHA 2D62A 2Q2QA 4RV4A 4H7PA 2J9FA 1I5OA 4CKXA 2AX3A 4BWRA 3IP8A 5A23A 3JQBC 1T4MA 2CSUA 5DGHA 2CHGA 2O2HA 3F6EX 3F9RA 4R8RA 2CZGA 5AVKA 2GZDA 1PWXA 3THWB 1NQVA 1Z8NA 4B3FX 3M3HA 5LP6C 1I13A 3KKKA 4HGOA 3KLPX 1TFRA 4YY3B 3LKVA 4OHZA 2BMAA 3ZWMA 3JAWB 1XJCA 4LKOA 1NM5C 3OLVA 1MFZA 4U7TB 5AUPB 1XTJA 2O8FB 1U4OA 5KKNB 4R1PA 1B26A 5BW8C 1R0ZA 1MG5A 5DBIA 5BSEA 1UBHS 4QODA 4C5CA 2CFIA 4G4GA 3BIJA 2B6CA 4BFSA 3TIVA 1K6EA 1VKNA 2VHEA 4KGDA 1W4LA 2JK1A 2YNMA 3LC7O 4GXQA 1QVRA 3BIFA 1GR0A 3BIXA 3L7OA 3ZE9A 4JA9A 3WB1A 1IHXA 4NS1A 3W2FA 2VSXA 2C54A 3OCJA 2QLNA 3RUHA 2ZRIA 2PM7A 2GK4A 3LEWA 3F5FA 3PKIA 2WB2A 4Z99A 1B93A 4W8OA 4UWFA 1K4KA 4RUKA 5DCYA 3OPXA 1DG1G 3AL2A 5B7GA 1SUSA 2H8GA 2XI4A 4JNCA 3OCYA 5KI6A 5G3ZA 3EA4A 3PVZA 4RM3A 2QENA 1MC5A 1W5SA 1SZPA 3DBHA 4I50A 4HQOA 1UOOA 2OV4A 1CUEA 1IULA 3R1IA 1KPGA 3FTVA 3HBAA 3MTQA 4I9FA 2HA5A 1M6HA 1BCSA 1GYQA 3SKYA 1PK9A 4PEVA 4EAAA 4PGGA 4ZAZA 3DB1A 1E96B 2R5WA 1PFQA 4MYDA 4JSYA 2BMFA 5BURA 4E88A 4FHGA 4YDSA 4Z68A 4KNVA 5EWLB 4HVCA 2F1KA 1KFEB 5J5AA 5F7OA 3DBLB 5MGNA 3N6VA 2I66A 2QE6A 4LAFA 1RQGA 1M0WA 4X3OA 3L3BA 2D54A 2Z43A 1LTXA 3PZ4A 4ZV4A 4ZTZB 1L1QA 2EFGA 3K53A 2J3DA 2IBMA 1XRQA 1QGZA 1YASA 2G5PA 1KY2A 221PA 4ADSG 4K5QA 2IV2X 3O2SB 5F5LA 3M3DA 4UDNA 4DXHA 4IP0A 4NLLA 4P2BA 2HA3A 2G9RA 4ZK2A 2IYFA 4TPKA 3ND8A 1JHOA 5J08A 3KAJA 4X63A 5L4LA 5EE3A 1OQAA 2K4MA 2CY0A 2DQ4A 2Q1XA 4EPRA 3KZOA 4WESB 3H5VA 4GRAA 2QW1A 4KT6B 1NF3A 2EL7A 2EEZA 4PLTA 2H16A 3K9QO 4K1LA 5LLSA 4CXMA 1YZTA 3Q3CA 3NVDA 5AJLA 2G1PA 2FDCA 4JB8A 4JJ6A 3R5HA 1PO7A 4NHOA 3B1ZA 2AI3A 1PD0A 1ODFA 1TVKB 2UZ4A 3D7SA 2WOOA 5D3KA 3ZHXA 2ZYVX 4ID9A 3FUKA 4DM3A 1UOHA 5LLDA 3BFVA 4B3GA 1G59A 5KYWB 4UUOA 4JYPA 1NZNA 4DMRA 3LX6A 2IBSA 3SDBA 1QX3A 2WU4A 2I3DA 4NCKA 2XVXA 3PBKA 2X76A 2ZAMA 1UMKA 1ZI8A 3LUCA 4EW6A 4RK6A 4EKYA 2VRWA 1NWCA 1N0IA 2O3JA 4GSKA 5IRCD 2EJBA 2HWKA 3CB4A 3LLSA 1WKBA 4V03A 1JWGA 1X38A 4W9RA 4CMIA 1G7SA 1ILEA 1U0OC 2Y1FA 1DHTA 2OPBA 3PEVA 4A0RA 2NO1A 3OIYA 4U1RA 4WUVA 1QU2A 2R00A 4I9CA 4L8VA 3KFVA 4DR4B 3P4UA 1D5CA 3NAGA 1N9GA 5L3RA 4QYSA 1KAQA 4N01A 2P2SA 1C50A 5J2TA 5B1HA 5EJ9A 2FE4A 1RFLA 5DM70 1GZ6A 2H51A 4MKZA 1YR3A 2BGKA 3AONB 4TWJA 4KZKA 2J4BA 3DEOA 3N8IA 1YB6A 1P6XA 3GUUA 4XPIB 3CTPA 3WLQA 1M75A 4HI9A 3PXBA 5TIIA 1Y98A 1AC5A 4KVZA 2J0EA 5BVGA 2HJWA 4G8KA 4NU8X 4E6HA 1Z6AA 2XWSA 1ZD5A 3G85A 1W4RA 4XWAA 2E1RA 4BMPB 1JLSA 4A91A 4TVSA 1SHZA 5AOCA 1B16A 3WDKA 4Q9DA 1PR6A 3LF2A 1M8GA 5CW2A 3JYHA 1R4AA 4DSZA 3CRQA 4BSZB 4Q39A 1E8MA 4PG5A 1V35A 2ZRLA 4AJWA 2GWRA 2A92A 4APOA 3PC8A 5FV7A 5CH3A 1RI5A 5FQ8A 5KJ1A 1V96A 2IOQA 4HDSA 4O2LA 4JX8A 2NM0A 4DWVA 2IYEA 1IBCA 2ZAIA 1GNSA 4XGKA 3GARA 1HDIA 4M1SA 1W2WB 4ARBA 2W22A 3AR5A 2BI4A 4YRZA 4N5IX 2AX4A 1EDDA 3PD7A 4MS1A 2RH4A 1PVOA 1JI0A 3VSBA 4O1IA 5DNWA 1H3FA 1V2HE 4B6FA 2XJ9A 3DW1X 1T2AA 4D4GA 1AKQA 3O4IA 4WNGA 4F92B 3UAVA 4MGZR 1IN8A 3EDRA 4ZTUB 2H9AA 4E5MA 2MR5A 4DIDA 5DVZA 5T4BA 5HKKD 2DBQA 3FYTA 4BV3A 4OAPA 4HOQA 3CBQA 2AR9A 1M2WA 2Z4TA 3RS8A 4EA6A 1NBHA 1Z62A 4A5OA 4EH1A 3K92A 4L85A 2VZ9A 3WRWA 3NHKA 2Z2XA 3TRIA 4BO9A 4I99A 3ROFA 1Q6YA 4A6EA 2PX8A 1IOLA 3BWCA 3H2JA 1UK7A 2HEIA 3P0IA 4IW3B 1O8BA 1RWPA 3RAJA 1ISGA 2AG5A 1Q57A 2WMOA 5ANRA 1X1RA 2AN4A 2O4CA 2GKSA 1W5FA 3W9FA 3AR9A 4UAVA 2A57A 5CD9A 2YV2A 2V0PA 5LA6F 5I7UA 4MR7A 1WVMA 4DN6A 3OPYB 3UMCA 1Z0AA 4ZMRA 3HCRA 1DJMA 4KAFA 3DR3A 3KQSA 4U8YD 3A6HA 3NYWA 2P2YA 4P8RA 5CK4A 4PPQA 1NYTA 2VGXA 2HU7A 3ZWOA 3KT0A 5L3QB 5DI9A 3UNXA 4GOOD 3R5JA 1QCDA 2C29D 1NMEA 1GN9A 3Q8KA 1DBPA 3IE0A 3NVKI 3VTZA 3I4RB 1B0ZA 3M0EA 4PHFA 5FNVA 3OXFA 4L5YA 3OCUA 2XTMA 2ZBRA 4Q94A 4JDPA 4M38A 1LVUA 3BJIC 3QQPA 4AXXA 1RVV1 1TT7A 4PX3A 1A2KC 2W6ZA 5HKOA 5G0VA 1YBMA 1BQ3A 2YXDA 1SUAA 2GKGA 3CRZA 5EYLA 3VSDA 2P90A 3GAAA 2WVGA 2WKSA 2VTVA 4MVWA 1NIPA 1HFAA 3QPUA 2ZUSA 3I3SR 2ZS9A 3LSTA 4WFJA 1U9IA 2EF0A 2RGXA 2DJIA 2QE7D 2H1VA 1OFIA 4V2UA 5FLYA 5JD6A 1ZNWA 3HSSA 4M9UA 1S3FA 3PE4A 2QTVB 4KGZA 3TRJA 3EDTB 1NW3A 4BKUA 1I7NA 3AETB 5EKUA 1KEUA 5FCDA 3I01M 4QGHA 5KTPA 1WOYA 2CNWD 2WMDA 1XU9A 1X19A 5ECWA 3HFGA 4RPHA 2PT5A 4NICA 5F4ZA 2VKTA 4RQAA 5H9VA 1VXRA 3LYAA 1VKZA 3X1ZA 3F4BA 3W8NA 3PI7A 4BAGA 3JCZA 3MBKA 4CG1A 5EIBD 1BE1A 2YZ7A 3VO2A 3G8YA 5J9FA 1U3DA 3IEUA 1TPZA 4G1VA 4EENA 1HNXB 4WWHA 4PVDA 5D84A 5LNK6 3I6YA 4UPEA 3T5TA 4KQIA 1DP4A 1C7ZA 1J0BA 2R6CA 1TA9A 3SXUB 4A0HA 3HHPA 4JC5A 5KJNA 5C5DA 1CQJA 3IUYA 1W34A 4IIYA 4KCGA 1GAJA 1FNMA 2P8SA 1ZMOA 4F3CA 2VDKB 4WZAA 1FQKA 1VG1A 1TOAA 1MA0A 2W6CX 3AVQA 3BTOA 1VJDA 2QUIA 3CT4A 3TEFA 3KPJA 4Q3BA 5DGCA 4ER7A 2IXDA 1ZYUA 1S7CA 3WWCA 1EFVA 4MP3A 4P34A 1QP4A 2FW8A 3QYAA 5DTIA 3Q7EA 3SKVA 1Y4SA 1N2XA 2DUUA 2JCVA 3K5PA 4G89A 5CT6A 1RSZA 3PEYA 1VA4A 4C6RA 4DHEA 3ROTA 5LU9A 4TXRA 2QMQA 4J4HA 5T7BA 4C0EA 1TD9A 1ESNA 2BLNA 3OOHA 2WKRA 3SEAA 3QYJA 1WXWA 2J0UB 2CFTA 1Q1BA 4ZJZA 4I46A 3LUHA 4HADA 5DNDA 3ENZA 3IC5A 4OHPA 2NXNA 4D02A 2BBTA 1E69A 2F8SA 2PLFA 1BPOA 3WYCA 1FMFA 3D9PA 3U60B 2GETA 3H75A 4OIMA 1SZDA 1IATA 1QHSA 1T2UA 1DCEA 4GC9A 3F3YA 2IDZA 3SF8A 3ZY2A 4ZRMA 1UKZA 3V3LA 4A7PA 3GUYA 2I8LA 2YYSA 3A05A 1EFPB 1IE3A 4YRRA 2W2KB 3STHA 1HDZA 1QO7A 4EQFA 1Q0SA 1GG2A 1TKAA 1SMKA 2H59A 2CJYA 1G6KA 4V3IA 3B3QA 3QX8A 5REQB 4MAAA 4MW2A 1TJPB 2P7IA 1C4OA 3ZC3A 3ISJA 4MO2A 5CLIA 5FWXB 4YRBA 2XKAA 4F3YA 3EZ9A 4Y30A 4IJ5A 3LLUA 4B3XA 3TUJC 3SFTA 4AJOA 4TKMA 2CHWA 4NDAA 1OWMA 1Z74A 3L04A 3TTUA 2WTAA 2JIPA 4FFVA 2X4IA 1ZITA 1GGNA 2H3EA 2BM1A 4KQXA 3ZRHA 3Q3JB 4JI0B 5SY4A 1DAEA 3EIOA 4UHHA 4II7A 1XF1A 4PINA 4ZDJA 1HFWA 3RK4A 1LPMA 2JGRA 4I9UA 5A5GA 1IN4A 1ZK3A 4X8HA 4XQ9A 2XLCA 1JIIA 5C81A 2P4EA 3C70A 5IC5A 1U0BB 1KDZA 4O6FA 1WMEA 2RJ3A 3E3LA 3ICCA 3JASA 2P9NG 4DV5B 5A7GA 4MMXB 4MUIA 3U4QA 1MF7A 2H0QA 1T26A 4OJMX 2JCGA 2BI8A 1W59A 1A27A 1CKEA 2VYNA 4YAIA 1HQDA 1DAIA 1HYEA 3NZEA 5E3JA 3ND6A 4MJXA 4U7EB 3QB2A 4ASUA 4F8YA 3ZQUA 3FOWA 2HPZA 3MMXA 5EIBC 4F1KA 3KUKA 4ANXA 3A1VA 3SCZA 4CUKA 3C74A 1U8ZA 2IY8A 3O0DA 2Q2WA 5KAPA 5K8TA 4DREA 1WS6A 2TMYA 1RYNA 5C5CA 4PF1A 3ZWQA 3CX4A 5JSUA 4YRDA 4KEAA 4YCCA 3A3PA 4XVUA 5CITA 4DIEA 2JFZA 1P7VA 1PD1A 4EMUA 2R02A 4Y9RA 3DTVD 1OGIA 3L8YA 1N2JA 2GN2A 3TPCA 3NBQA 3A0UA 2G8LA 4CM8B 1TU3A 2PUEA 3AL0C 4WX2B 3AEKB 1I3KA 5HM8A 2BFPA 1WEHA 2YWBA 2O2GA 4PM4A 3C24A 4OB6A 1YVUA 5TQVA 4GLOA 4PZLA 4EJ6A 1OLUA 1DS6A 3RAEC 1KERA 3CZQA 3CZRA 3D5TA 1UXHA 4YP6A 1VLVA 1VL1A 3ZKAA 4MDEA 4PO1A 5EWMA 4AMUA 2FP3A 4OXKA 2XDYA 3ANMA 4JP8A 1N2CA 3WJAA 5LZ8A 3ANTA 2P9LG 2P58C 3W2EA 3LQRA 3D9JA 1Z4LA 4FULA 3KS2A 3CG4A 1PJCA 4IFTA 5DK6A 5KJEA 1X92A 3C4VA 1HF8A 4D43A 3GPLA 3TQOA 4OQDA 1G3MA 1W4ZA 4R41A 1ZFNA 2W7TA 1P2FA 1M2OB 3L7AA 4B73A 2RDMA 1G6Q1 4HQDA 4TX1A 1JCSA 1WPXA 5CGQB 1NASA 1L3IA 1PAUA 5GY7A 2AMFA 1JLRA 2ANBA 3I9LA 3BK1A 4KHPB 2P9UG 2I9KA 3HC7A 1AT1A 3MF4A 3ET5A 1TTHA 3V7FA 1Q7RA 2NUTA 2JFBA 1SD1A 1NUUA 1V4BA 1VGRA 1R0BA 5FOXA 4J4TA 1MBZA 1B1AA 1ACLA 4YUWA 1RWNA 4LQDA 5A4AA 2VS1A 3KKOA 3FFBA 1PFWA 2D7DA 2EIHA 3MMNA 3RC7A 2G9ZA 2VXCA 1WV0A 3T4XA 5BVHB 5JAHA 3HKDA 3DWGA 2PRIA 3BEDA 4D9JA 1E64A 2ZB4A 3L9XA 3ULQA 2EJTA 5ALWA 3H6GA 1JMYA 2PXXA 3PNOA 4XIFA 2EP7A 3INYA 4LDPA 3R0VA 3RIYA 4PONA 3OF2A 5IJAA 1PNVA 3B3GA 3A31A 2IFTA 2D2IA 1OLXA 2ATEA 2LP4Y 1B6TA 2OO7A 4EGFA 3CVUA 2Q2NA 5ICFA 4RENA 4QDXA 1FS6A 3RQSA 4FJ0A 3A2LA 2AN1A 1BDHA 3ZHQA 3C6MA 3WLTA 1FFXA 2NYVA 1UXIA 1MJ0A 1UZNA 1XIVA 1QQTA 5DIFA 4PANA 3DEYX 1SC4A 3FGOA 3Q4AB 2IPMA 2E0IA 3FZNA 4P53A 1T25A 4WERA 2J09A 5EJ6A 2ISCA 3ISTA 2PTHA 3W04A 1SXJB 3DFUA 4QBIA 4CGZA 1XMJA 4U63A 1YQTA 5GONF 4EFDA 2VJOA 1RI3A 4IIBA 2DQSA 2N1BA 8ABPA 4G0XA 4X20B 4C6TB 4B6OA 2IS2A 1XVVA 2EGUA 5FBWB 1XAHA 2A2ZA 2XMDA 3F74A 4Q1BA 1XGKA 4Y2UA 5DF1A 5C9ZA 2WEKA 2ZJ8A 2XKKA 1KYWA 4AS3A 4BWFB 1QOPB 1X7ZB 4KLZA 1QGAA 4R69A 4DS3A 2QAIA 3PQ5A 2V6JA 3S1AA 3D8SA 5MGBA 2Z2IA 2HDOA 4DADA 4JEUA 4YV2A 4J6IA 2HU5A 4NBTA 2IV3A 1KAEA 4R7ZA 3G8BA 2YOGA 5MF6A 2JPDA 2IPNA 3KYCA 5AVZA 5C18A 3AERA 2Z8YM 3NKLA 3DV9A 4HWKA 4AIFA 2JGKA 3W1VA 3ESBA 1XGWA 3DSUA 4ANFA 1ZJ5A 2PMDA 3RJTA 1Z13A 5JTUA 4DIMA 4K9NA 2IFUA 1NA0A 4QRHA 2SHKA 5IT5A 1BYUA 2AW5A 2VCYA 3CUVA 3SAJA 4D45A 2GRJA 2FZ5A 2V0CA 2C8VA 4ZFHA 1P72A 3GNSA 4G1TA 2D4AA 1JA9A 2ZGVA 4XOIA 2EWMA 3MWGA 4X5OA 1E7VA 5T6BA 4G23A 5BN5A 2FR8C 4UI9J 1OFHA 3LBAA 4KREA 3L7IA 3PL5A 2ILRA 2H5LA 3M4YA 1PJLA 3BYZA 1LWNA 3WWDA 1CDZA 2NT3A 4JVLA 3U31A 3IBEA 1C3JA 3R40A 3HZZA 3O26A 2I99A 4OMFG 5A62A 1BVUA 1YACA 3DCJA 5K2OA 5BUSA 5I7SA 4Q7MB 4IO1A 3UOGA 4JELA 1EA5A 2C9BA 4O2RA 1ZESA 1IUKA 4N6GA 3WL6A 4N65A 1A4RA 3GMDA 4YV7A 1J07A 2FPOA 3OM1A 4D82A 1CR0A 4M1YA 3W5VA 4OSOA 1QOQB 2V97A 4GCOA 5HKLA 3U09A 5AKJA 3L01A 1VJ5A 1CT9A 2VK8A 2VF8A 2DY0A 3C3KA 1QTNA 4MINA 1EUYA 5IDYA 2VQEB 3A2NA 1NPDA 1F14A 4NJEA 4XE5A 1TA0A 1PQ4A 2R7AA 4ROSA 3JRNA 3I6MA 4EELA 1R00A 2V8SE 2XVMA 3IQHX 3VH2A 4HGQA 3VPSA 4C0AC 1TF2A 4R2LA 2VC2B 3R24A 2QM0A 4RE5A 3HM9A 1YRAA 1TM7E 1MAVA 3L7LA 1VI2A 1MRNA 2FWBA 5EJIA 3AI2A 2G1KA 3S8YA 4IDBA 1H8HA 2FMIA 3QSGA 1XQWA 1NA5A 2WYVA 1K2WA 4DDKA 3FW1A 3WJ1A 4I9HA 2BGUA 1N7JA 3QAQA 2WJHA 1D2CA 3JQDA 5L53A 3ROGA 2QN9A 4C20A 2F55A 4E5PA 3OCCA 3KTAA 4DGSA 2ZCVA 1H6OA 1IEXA 2QT1A 1R9MA 5ALDA 3ZCXA 1SUPA 3AHEA 5E6UA 4DX6D 4WT7A 1RJ9A 3GRUA 3MN1A 2BGIA 1TKRA 5JYEA 3QVOA 5JC1A 4O0MA 2OAP1 1PR9A 3USCS 5CLHA 3WYGA 3L4BA 3MGBA 4HL6A 5JCPA 3SZ7A 3O82A 3PXUA 3TDMA 1QORA 1914A 4ATGA 5I51A 4Z86A 2FWAA 4CQMD 1RM5A 4MPRA 3HGTA 1UQUA 1YHNA 4C6HA 4Z4EA 1WEKA 5K5EA 1E7UA 2DTDA 4JLKA 4TUYB 2PSJA 1SXJE 4QEDA 1RXEA 4KN5A 4Q47A 1MV8A 3I45A 2NUBA 1X7WA 1KAGA 4IOMA 4DBVO 5T5QA 4HOYA 4JLSA 3R9XB 2G80A 4PZAA 1QHNA 2D1QA 2O23A 3L8ZA 3TLYA 3GFTA 3ZGNA 3WSTA 4YRLA 4A55A 2QT0A 4QBHA 3E8XA 2PGAA 3RK1A 5KOHA 4K9PA 1G18A 4YUAA 1B41A 4WWOA 3C8ZA 4PPFA 2WVAA 1Z73A 3QMWA 2WJZB 3TVYA 3I2FA 3INGA 2OSBA 4RC9A 1DU4A 1BQEA 5AKLA 2JKZA 3EMKA 2WB4A 5A71A 4BSXA 3IMEA 4R05A 3G2UA 2Y6UA 4R9NA 1KO7A 3O8OA 1YDHA 5ALMA 4A3VA 2AOTB 5F3RA 4Y2QA 4RWZA 2EC5A 2IHNA 1OXKB 3O91A 1TVCA 3KYDA 4AMYA 3IOEA 1G4HA 2IEYA 3NGXA 5DBEX 3B89A 4X8QA 4QNRA 4QFCA 3ZHCA 2J3LA 1ONPA 1V1MA 3N8HA 4HNAD 3CXUA 3A6FA 2FEZA 4XI9A 3R3WA 4MWOA 4I50F 1BNCA 2A1TS 3GT7A 2JEKA 3I4GA 4FJ1A 4J1SA 1W48A 2AVPA 5IARA 3V2GA 1HDRA 2BGRA 3DBVO 1ZHFA 4EJSB 1MNQA 2JAHA 5KOJA 4GPD1 2CSXA 4RTOA 1VLLA 3MJTA 5K45A 2NOAA 1WMAA 5DN6D 5CIWA 3QNUA 3W77A 3G2NA 4G97A 1R6UA 3KR0A 3CMMA 1UOQA 1RHJA 4OBEA 3GLKA 4RZXA 1N5IA 3PX3A 3D4LA 1CHNA 5BSHA 3UJDA 5EP4A 2ECQA 4OJTA 3TG8A 2EG5A 4WNYA 1WMDA 4RG9A 3AHGA 4OKNA 3X2FA 4YK7A 3KCQA 4EO7A 2GX6A 1PTKA 1GUDA 4EK9A 3MKQA 3RD5A 5FR1A 3QF4B 4B4OA 1QRSA 4URUR 3A1DA 2Q5EA 3GEGA 4IF4A 3ZV6A 1OKKD 4ARZA 2BY4A 4UDOA 3CKBA 1IUPA 2VZ8A 3CE9A 1GSOA 4BYGA 2Y1DA 3BIOA 4C7MA 2A3RA 2FSVA 4WKGA 3R0QA 4QU9A 2KQUA 1T5OA 4MQFB 3KWJA 1FZTA 4L3OA 4LBYA 4ZCRA 2QMUA 2C7BA 2ZIUB 4V0KA 4LSZA 1JHUA 1B2RA 3WGMA 4E5UA 3GVHA 5ILOA 1A7UA 1NAIA 3LGAA 3RTGA 2JHPA 2ZBGA 3T34A 4NULA 1MO2A 4CCAA 1F2UB 2KJZA 4J2OA 3DLBA 4D98A 4KBYA 3GDHA 4LCBA 3QVGA 3HCOA 4HP8A 3EIHA 4K3UA 3SNKA 1V4NA 1JQAA 3C3QA 1DKPA 1B6RA 1ULBA 5CDHA 2R6FA 2F1RA 4KR0A 1CNEA 2ONCA 1ENPA 3QELB 3V8EA 2PNNA 4LERA 4NZNA 1FRFS 3AF5A 1A2BA 3C1UA 3SHVA 1ORVA 3W78A 2C97A 2JJ2A 1IJKA 5IH3A 1W36C 5ENRD 4L51A 3PHGA 4ZYUA 5CURA 4MKFA 1EF1C 4N5LA 2JBHA 3I9JA 4AQDA 1JE1A 3DNPA 3SR3A 1O9HA 3LC1O 3PUKA 3GP3A 5GGYA 4RY2A 2P4QA 3MTAA 4LY0A 5HTOA 4A26A 3HCBA 1Z4OA 1NQUA 3H16A 2PKXA 5FO1A 1BMTA 3QC1A 4JVSA 4RX1A 1H6BA 2GAAA 4B5KA 1X81A 2NU8B 3QLTA 1XCJA 2WTEA 2WUDA 1NJGA 2W0SA 3G6WA 3HB0A 4B34A 4TN5A 4NZ9A 1OXMA 2PD6A 5TQJA 1V26A 1ML4A 3JS5A 4UYKB 3G9TA 3PUYA 2DC1A 2HCFA 4IOJA 4E13A 4YAJA 3A0RB 2L9BA 4DRXA 1CBUA 5HE9A 4X1YB 3ZGVA 4GZDA 1QP7A 4DNFA 3GO4A 1QU3A 4U7FA 2H5EA 3E23A 5FFNA 2PUAA 4G0ZA 4PW0A 2YYYA 2J4DA 5D86A 5J2TF 1BD8A 2OD7A 5JMND 4WHMA 3IP5A 3CU5A 2WFLB 1SVMA 4CM7A 1SY7A 2GEDA 2ZI4A 3EASA 3V8RA 2WXNA 4MKTA 3C3OA 3GN2A 1XHFA 2VYCA 1OCRE 1DMSA 1MO6A 1GOTA 3GVXA 1XMIA 4G1BA 3RYHA 3TG5A 1CJVC 4J8FA 1ZJYA 4XWYA 4F96A 1E3JA 4RM2A 3WNDA 2CFSA 3DHYA 4QD3A 4GMRA 3SO8A 3QU7A 5IVKA 1T9AA 3R0JA 1XZHA 3VAAA 2EQBA 2FW0A 1C9JA 1NVAA 4A3SA 4WNDA 4REQA 3S7BA 3ZQ4A 1L4EA 2NT4A 4HD8A 2C9DA 5J2UA 1ZLYA 1W73A 4B17A 1OAOA 2G7MC 5CDTA 1V5EA 3VU9A 4RMIA 3BMOB 3PEEA 4FFSA 3FTYA 5IPFA 1XCPA 1CRQA 2GR9A 1K8QA 1XZLA 5CNIA 5DHUA 3TAHA 3V3TA 1W44A 2H8KA 5CA0B 3N07A 4OD0A 1TD1A 3P0HA 2R1ZA 1VE6A 3EIFA 1K3ZD 2HSEA 2Q3EA 4PG6A 4DLYA 1NVXQ 5JRZA 2R03A 3H3FA 2XYVA 2HADA 1OBOA 3QVUA 3UMYA 2OD2A 2LIVA 4H1UA 2BFNA 3BZWA 1JDZA 2IW1A 4HEQA 4E5KA 5ALEA 5BMVB 1TZJA 1D2EA 3IP1A 4UDXX 3LCMA 3URZA 5TJ9A 4BVAA 1AG9A 1D1QA 3IQEA 1SUWA 5F1YA 4MJ7A 4PSAA 2H6EA 4B4VA 1TVEA 2OV8A 1B7GO 1YR1A 3KXKA 1F2TB 1DC7A 5IK2A 3ZI7A 1YH3A 1H85A 1KZ4A 1MJ5A 4YA6A 3K05A 2WJYA 4HGPA 2G67A 4URXR 1GTJ1 3K1JA 1GPH1 4FDTA 4OYLA 4XJXA 4FK8A 4ZZ1A 4QQRA 4TWAA 3SM3A 1ESCA 5D3ZA 2NZ2A 1ZU2A 1OGYA 1Y7HA 4U0ZA 1WUYA 5JSKA 4BJ6A 5K0LA 4YAGA 4GD3Q 3I0NA 2X42A 5ULLA 4H3VA 3ZHOA 1IXYA 3VGJA 1G21E 5IT0A 3LJ3A 2IXGA 1Y9AA 3OQ1A 3G9ZA 3EPRA 3WI7A 1CEEA 4CV3A 3SKXA 1NUPA 3GYGA 2ZCJA 1T2DA 3AMVA 3G5AA 4BMNA 2VZ0A 4OIFA 1LBTA 4CG2A 5E7QA 1II0A 2AL7A 2X23A 3LZCA 1K7FB 4WNAB 5BT1A 3I9FA 3AOEA 3T5GA 1QRDA 2XAAA 3VKUA 3Q3IA 3RRZA 3T7DA 3G5TA 3LOQA 5FLKA 1E61A 1SIBE 4HS2A 2BFBA 2A5JA 2E55A 4LZJA 3CFYA 3L7MA 4EHIA 3QBVA 2P9JA 3FDZB 3W4JA 4HY3A 3B8HA 5HTKA 1CUCA 5MN6A 1BD3A 2BZ0A 3PGJA 4IGAA 5FD8A 2CMFA 4JLBA 2PIAA 2UWJG 4YONB 4BIIA 3BG1B 4OFZA 2CLMB 3H1GA 3R41A 2RD2A 2VDOB 4PYMA 2VR1A 1AXRA 5FWAA 4ER0A 1JR2A 2OXFA 1NQTA 4LYEA 1C8VB 3E32A 3IKMB 3HJTA 1X1AA 2TMKA 4HR7A 5FNVF 1M7GA 1HWYA 4F4IA 1SEPA 1G5PA 5AKXA 1YCFA 3T4EA 4DFDA 2RBGA 5MFPA 4HX9A 3CHOA 2VIIA 3F4LA 3W9SA 3WLKX 1SVKA 2BCGY 4J6EA 2OILA 1M2FA 1V8DA 4KR7A 2WUVA 1PF7E 3G2OA 4UOQA 4JLMA 3OZBA 4TQUS 1E6WA 1E6MA 4C4RA 5L40A 2QZAA 5JYCA 3F6BX 1AGRA 1E2KA 3L8DA 1QSGA 2FUG6 5JJ6A 6AT1A 5LX8A 4YV1A 3DOOA 4L9SA 4L08A 3ZIAD 3KX2A 2P77A 3BBLA 1SW6A 1TMGE 3M6IA 1Y3DE 3AKCA 4KE6A 1A9OA 2XLBA 2GZSA 1CUXA 4OAUC 1CERA 1YJXA 3ZXUB 1CZKA 5JDCA 2IU1A 2R751 3G1UA 4QYMA 4BO8A 1MVOA 3HDXA 1VIAA 5MN4A 1BJTA 3OQJA 3IL2A 1ORHA 4AMVA 1NPTO 4HWOA 3T9DA 1Y5NA 3STVA 2M1XA 2EATA 2QV0A 1YKGA 2YNQA 2EFYA 2XGOA 3OECA 4EGCB 1KOJA 5LP0A 2PX6A 4KQFA 4PLWA 4ZCLA 1G8SA 4BKQA 1YIOA 4JFAA 3U4AA 3WLLA 5KWEA 5JBQA 2R6JA 2Z3VA 5CD1A 1JIUA 1QH8A 4I6EA 5F23A 1TYEB 3UV7A 2QBYB 5L8VA 1ECPA 1A5SB 4FFBB 5KYUB 3FHEA 4ZJPA 1VL6A 2NUAA 1IN6A 2G04A 1QJ4A 3FTFA 2PGXA 4M1TA 2A8YA 3D54D 4MUXA 1WZNA 3DLTA 1WPQA 2OZPA 3WKDA 1E1MA 2WQHA 4G4IA 3PQ7A 1IXVA 3ZIDA 4MWBA 5FYDA 3CLHA 1FDTA 2IUSA 3MINB 2IEAA 2IGTA 5EHXA 2AYXA 1LS6A 5LQJA 3BGVA 3RVNA 3U19A 2A9RA 1XZJA 3UJBA 2W0MA 3SQOA 1P77A 4RKFA 2WM9A 4ZWNA 3QVMA 3AJRA 1W7AA 4KO2S 4WD3A 2VXBA 1N6PA 3GFOA 4D8WA 3CVVA 4YDQA 1ONOA 5CP8A 1JJVA 1YCHA 1RLMA 2QP3A 5IN5A 3D0OA 4BJ1A 1Y8CA 3ABSB 2ZAYA 4UBIA 4XXHA 1F4PA 1HLGA 1EQUA 3OIFA 1AA9A 2JIBA 2P9CA 2ZT5A 2B0JA 3KKZA 1W581 1KDTA 3BM5A 3A9UA 3FOCA 3IBTA 2FQYA 1ISSA 2V1UA 2YJNA 3I92A 4RPJA 4LDQA 1AKVA 1IHUA 1OR8A 5HCUA 4Y6QA 4OI1A 7REQA 4UKDA 4W99A 2QVLA 3GEDA 2VLBA 3LT0A 4MMYB 4RESA 4NNOA 2G36A 4D26A 5KMGB 3FNQA 4W1QA 2CYAA 1XPJA 4YVQC 1UAAA 3TEMA 2HQ1A 5T8KC 5BN4B 4FR2A 4MCIA 4RMHA 3O8NA 2V7PA 3I05A 5B36A 3PIRA 2NGRA 4ABTA 1UMBB 1QS0B 2ZTUA 2LZ0A 2ZXFA 4CCYB 4LS3A 1K8KG 1ZH8A 3DKVA 1QF7A 1A82A 4HMQA 4WCFB 2Q29A 2A7XA 3P26A 3QW2A 4KYTA 4R54A 2YVKA 1FFGA 2O2YA 3TI7A 2V96A 3HWWA 1XI2A 4KK4A 2FJDB 3IA7A 3DE6X 5LD2B 2G72A 5D1HA 3WKCA 3NIBA 4B35A 2P30A 4GBJA 4B93B 4K9OA 1CRZA 1IJBA 2V7XA 1SCJA 4W8GA 4HOSA 4AKTA 1CUBA 3MTBA 1IQPA 1Z4PX 4NZPA 4BFCA 5JZMA 1YZKA 1SVXA 5K3EA 2D0IA 3QVKA 4GXTA 1SCUA 2B1QA 4D81A 1JBQA 1N0QA 4L7TA 1SZJG 4FFRA 3GI1A 3UJHA 1GZDA 4BZWA 4HOTA 2QTGA 3NETA 1LGYA 4KLRA 1LJLA 3K8YA 3TLKA 4X00A 3AF6A 2OBBA 1ZO8A 3E3OA 4MVXA 1KAHA 3VR5A 3EEQA 4XUDA 1U9JA 1G8PA 5D0OD 1DKOA 1AGXA 2LXNA 1RMQA 2CFOA 3BH0A 3TNJA 5LUBA 5ERYA 4A0GA 3LS2A 1DTWB 4CMBA 2EIME 1Z35A 2QLMA 1XTSA 1D6NA 4H77A 5JECA 3AVTA 2I2WA 1SQFA 1IH8A 5IDQA 2VEOA 3W4KA 2EZTA 4XUEA 1FU8A 3WB9A 3CNQS 3V7UA 2ZIRA 1YQXA 2V6BA 1L4GA 3VX4A 4MHOA 1IQ0A 2QW8A 1XRLA 4G07A 1XJWA 2YVAA 4UWHA 1EFDN 4R5MA 3OF3A 4HUTA 2AN9A 4P4LA 3P5BA 3SJ7A 4ZXFA 1NLFA 1NN3A 3TKYA 2HREA 3KLOA 2IYRA 3AFOA 4MTCA 3AP3A 1PJ2A 2B7BA 3TTXA 3SFXA 3GAFA 5DW3A 3U4HA 4JK3A 4WNCA 2M2IA 4R9SA 1BMFA 5EI5A 2IHKA 1SZAA 1CW2B 3X2EA 3VAZA 3V1MA 4RD1A 4OBXA 4LGVA 3HJGA 2G8NA 2J3IA 4NZYA 1G3RA 3ULEG 3VGPA 1WSBA 5CAEA 3FJOA 2IF2A 1Z5OA 5JQWA 3ABQB 3G9QA 5FOUA 2UYYA 2ZI9A 3S6JA 4JP1A 1H3NA 4IRMA 1VYVA 2EBWA 1F0PA 4LRZA 1QKIA 1BOOA 4XE0A 4XSGA 4XWGA 3TJPA 5J5CA 2VDQB 4EB6B 1AH2A 1U28C 4R7LA 3R7FA 4OQEA 4OP3A 2QDKA 3EG5A 3K09A 2GXUA 3OCWA 2R79A 2H2AA 1KZPA 3B6KA 2F7SA 1CEYA 3TFQA 1D3AA 5HF5A 1RLIA 2DBVO 4JFRA 3B13A 2XE4A 2OCBA 4Z0HO 1Q16A 4J7WA 3EBPA 4Q1EA 4W7IA 1PS8A 2Y4UA 4CQLA 1WE2A 2IEZA 2Y69E 1VJ0A 3E5MA 1BGXT 1RYMA 1I4WA 3KSQA 4K6HA 1QCZA 3PF9A 2ZJ1A 4K3VA 3WYFA 3Q15A 4RVCA 2J46A 1EMDA 4BMOB 4UMDA 1OZAA 1AVTA 4IJKA 1W0KA 5HIAA 2I55A 4F3RA 1DWPA 6REQA 2XUZA 3VR5H 1ZISA 3NALA 4UEJA 1Q7BA 4O5AA 1QANA 4J3JA 4MRUA 1TN8A 2J9XB 1GPLA 1PDWA 4Q21A 4NXMB 4YIHA 4DRYA 2XYGA 1KFBB 5C37A 4M99A 2FHPA 3U3KA 4LZZA 4YJDA 3URKA 4XDHA 2WTNA 3SG0A 5DOVA 4HAIA 4OKSA 3NC1C 1USWA 1AK1A 5IEJA 1OA1A 1OFVA 1IVSA 3QTLA 2RGRA 4W1SA 3VR6H 4E70A 2QPLA 1MO4A 1IN1A 2MSKA 3SQLA 3O03A 4JL6A 2V54A 5P21A 4OX9Y 2R1VB 2G71A 3H1EA 4KZ0A 3JXJA 1FPPA 2MJLA 3HL4A 2DU8A 1LF5A 1FA9A 3VKVA 3KHTA 4CT4B 1P7YA 3V3KA 3FUIA 1A7KA 3PENA 1XZKA 4FHZA 3TO5A 2QVZX 2AD1A 3DMTC 1BVRA 2MSCB 3WAKA 1ZD2P 1QHHB 1D2HA 2EDCA 5JT1A 4E14A 4PNEA 1AQYA 4TTQA 3IAS1 3OAWA 4YRAA 3ABRB 3QJYA 4EVSA 4E09A 3QU9A 1QQAA 3ZPXA 4WFIA 4OV6B 1DTSA 1Q7TA 4G5RA 1X94A 3UWMA 1VBFA 4O4HA 2N47A 2DKNA 3VPXA 1RR6A 2WVIA 1Z0DA 4YJ2A 2P11A 2GGSA 2WD8A 3TW8B 1N95A 4FJYA 3MEKA 1J2RA 2NUPB 1JKFA 4W6ZA 4GG1A 1DDOA 3FH5A 2OZKA 1ND5A 3KYBA 3DMHA 2CNLA 5AQAA 1B4DA 3O3MB 3BFXA 1L7XA 3M82A 5EP2A 4XLTA 3HJCA 4X44A 4UJ5A 1V1RA 2XNHA 3HJNA 3P7MA 4Z54A 1ORDA 3K9NA 4IGEA 1E9VA 4NC9A 3NIWA 2E6KA 5TS3A 3KQOA 4C4XA 4ZC1A 3R2JA 2B8EA 2WKQA 4G1UC 1WDKA 3LMKA 1VC2A 1U5AA 1V95A 4M54A 3GT3A 1SZCA 2Z9CA 3QTTA 3VR2D 4YJKA 1A2OA 1GGMA 2FO1E 3NIFB 3KJQA 4AIIA 2OWDA 3O0TA 4MPPA 3GHYA 2UUBB 3UAYA 3FNIA 4D9EA 4B1FA 3FR7A 4B0ZA 1XYGA 4LJ8A 1X80A 1TJCA 1PR0A 3T9EA 2X5KO 1KI6A 5KS2A 1UADA 1UBOS 2WG1A 1Z2PX 5GGXA 2PCLA 2FEPA 4I17A 2EFHB 2R6HA 1E7YA 1RQLA 3A4YA 5IXJA 3EAGA 5BORA 2OT3B 3IVXA 3LRXA 1EFRA 1JG6A 3JQGA 2NIPA 2ZB8A 2G28A 3PI6A 2NVUB 1P73A 2CLCX 2BE7A 4YACA 4BO1A 3EXG1 1N5MA 5CVEA 1I94B 1JAHA 1PW5A 1GARA 2G70A 1MJGM 1WZIA 2V6MA 4UBKA 1YQUA 1QMOE 1AUQA 3RJ5A 4JJKA 2X3MA 1H2TC 3S5JA 2V1XA 2Y68A 3A3KA 5M72A 1GTMA 1OB5A 5DHQA 3RVRA 3CZPA 3KSLA 3W0LB 3TU3B 4EA7A 4Y1RB 1QRRA 3KD3A 2W11A 2VPYA 4CEJB 2WHEA 5I9TA 4DX2A 1NBAA 2VWGA 4DLPA 5KHAA 1JDBB 2KBXA 3E9EA 3BHNA 1GKKA 5DT2A 3TNYA 3BORA 4JJIA 1EDBA 3JVEA 1PUJA 1WXDA 4EDHA 2LE0A 3JD3A 2RC6A 3THYA 3L8HA 1E32A 5AQ7A 5HZGA 2Y76A 4GA0A 4WY8A 4CZ2A 4EHHA 3ZD6A 3GUHA 2PV0A 3NDJA 4IGIA 1WA5A 4F2WA 4YJHB 1GFIA 5DE3A 3ASHA 1JMKC 5CX1A 1K89A 4G3XA 1GEEA 3BULA 1V2GA 2CDBA 4CHGA 1WZ2A 5ALPA 1KVRA 3LA8A 2J45A 1YQQA 3R4VA 1MABB 2WOJA 4IDGA 3OT1B 1J1UA 4URVR 1P7CA 4EY4A 1ZQ1A 3H99A 3NBYC 3O93A 2PEYA 1JFSA 1M1UA 4BP1A 3KOUA 5K0FA 4LBWA 2O1XA 2C59A 5IVPA 1AJEA 4AZ3B 1EM8A 1FW8A 2YRXA 3ZGZA 1RLUA 1P9WA 4G65A 4L8WB 3WGQA 1DC5A 3I01A 1QM5A 5H0IA 1MG0A 3UTCA 3LA6A 3I62A 5LQAA 3PNLA 4PZ0A 5FL3A 2VUSA 3W3AD 3NTUA 3CX3A 4ZU1X 1Z7WA 2OGUA 5AXDA 3T8KA 4C7KA 2VF5X 4HORA 2X7HA 3E61A 4K40A 4P4UA 4MVCA 2A5FA 4UWGA 1H6DA 1Z07A 3HUEA 4E46A 3C14C 3H7AA 4JB8P 5A5EA 4OPMA 2RHRA 3CVNA 4KH0A 1VHDA 2DBZA 2QTRA 3MAAC 1G2OA 5ADUS 1PBNA 4ZT3A 3MUFA 3QFHA 1EXDA 2C83A 2B21A 1A5AB 2D1RA 3S2EA 3MV3B 1YOVB 4KX5A 2WJVA 5AYVA 2YW9A 3UBMA 2R68A 2Y4TA 4TTSA 4Y2VA 2ZSIA 1GGHA 5CB4B 3FDHA 5FTPA 1K68A 1X5BA 2IY0C 4QYTA 1ADCA 3IKJA 2AN3A 1L4FA 2QZJA 2V7UA 4R1LA 1NC3A 3MWDA 4UQPA 5C4IA 3D02A 1KEWA 3TMYA 3Q3GE 1JR3E 1Z0UA 3MCUA 2PZBA 2V0GA 4HN4B 2QN1A 2V03A 3WRXC 1DTEA 3FTSA 3WWZA 5FL7D 4PG8A 5BPPA 1P5ZB 4II2A 4QFMA 1FNDA 4C6SA 1OY3D 5BT8A 4TTRA 1EWYA 3WV5A 1X3LA 2O8DB 4Y6WA 1LW7A 2ZWMA 2I2XB 3HRIA 4AMBA 3W3ZB 1TK3A 3ETHA 4CRWB 3LUBA 4FP7A 1ZEMA 2XVYA 3DL4A 2IY7A 1M34B 1R6XA 2ZJBA 1CLUA 3EXIA 4FFPA 1X7YA 3AXTA 1KJZA 1DUSA 2W2LA 3GFFA 2NXJA 3A6PC 4L8FA 3FFWA 2H48A 1R18A 2J6IA 1ULHA 3AHDA 5G53C 3OQIB 1KFCB 3RVJA 2GBGA 3I58A 3H86A 3DDZX 3QV2A 3JQFC 3ZZMA 1M0SA 2YX1A 3CN9A 1EPUA 1U7UA 1WVIA 4JW1A 2HD4A 4DBLE 3JW8A 1V55E 2RI0A 2QI9C 2YZKA 5LXTB 2DT5A 3VC2A 2GM9A 1RZ3A 4RMJA 4DXDA 4CODB 1WXIA 4OQMA 3B82A 1JBKA 3M70A 5C8DA 5HZMA 4FE7A 5ENQD 3ZD8A 5DYYA 4I4TB 4U3JB 1Y9EA 3MJ4A 2KLHA 1G8MA 2I62A 5F1PA 4X0EA 2RI1A 2NU9B 5LZ9A 3HIZA 2IUEA 3NR2A 1E0KA 4PLHA 3V30A 4OLAA 3F3SA 4HVLA 1CY8A 3DFFA 5CFLA 3FKSA 1DJPA 3TBFA 1XP5A 3BKWA 1TZBA 2AZXA 1KA9H 2JIMA 3LU1A 5EOVA 3FTPA 4JSTA 3TCNA 4N4AA 1HS6A 1D4AA 1QOZA 4X93A 4IG4A 2PUGA 3MJDA 4JODA 2BM8A 2Q27A 2TMGA 4L3VA 1QHGA 3ES9A 2GEUA 3AR7A 3O5AA 4PYNA 1HNZB 3FAZA 3BREA 3DAPA 3P1JA 2VF4X 2J7KA 3FJYA 2AXPA 3UWPA 5IJ0B 2C1ZA 1N6LA 3TRKA 2JFVA 4AI6A 4ZHQB 3L0ZA 3QFTA 4G1FA 1RPAA 4OCZA 2GF9A 3IKOB 2FZWA 2Q0XA 5GP1A 2VUUA 3UWSA 5LM3A 3FYUA 3Q79A 2CFZA 1BXGB 5F98A 3M2PA 3WLJA 1SQGA 2EZ8A 3IEVA 1L7DA 3O9ZA 4NR0A 3W34A 4LXXA 1QVZA 3DBRA 4LRQA 3NHYA 2GSWA 5JMWA 3KVYA 1PYGA 1ZCBA 4TLAA 4ZPJA 2P7HA 1ZU5A 3CHQA 2B3DA 1G64A 4Q9LA 3JYPA 4G0YA 4TROA 3FCAA 5ELXA 4QATA 4EKIA 5K3BA 2AVDA 4LHSA 5JLAA 2GZ1A 2V6FA 1U0EA 4GYJA 3HFJA 3ZJYA 4YJFB 4F2DA 2IOHA 2C9MA 4DWOA 2PZEA 1JKJA 3CF6R 4BXOA 2OOKA 5LMCA 2C7RA 3I4LA 1K98A 4ZVSA 1SCBA 1K6JA 2PIDA 3FZQA 3ZWVA 5HZKA 5LZ5A 4C04A 3IXEA 4DMMA 3QEJA 2XZTA 3RUFA 5EJAA 5JFGA 1HEUA 4FGSA 3WRYA 2JI4A 1D4ZA 1S8FA 4DM7A 1TTTA 5I7EA 3ENVA 3A9RA 4KQJA 3O1LA 1EU1A 3STXA 4MJ3A 2WPDD 4QDOA 5CHEE 4B80A 2ILTA 2BMDA 1JDNA 1UJCA 3REQB 2G76A 5I7HA 3RVLA 3TWXA 4HFJA 4WCVA 1HLPA 3OWOA 5ALUA 4EOGA 5KYXB 3I32A 4PCUA 4U6NA 3GEMA 5J2UF 4XVCA 2GZAA 3FETA 4KDEA 4AG6A 3HWRA 3FTXA 2JIZD 3Q3VA 3ZE1B 5ED4A 1Y8AA 4BN0A 3UN1A 3KEAA 3NIDB 1GW6A 4F4CA 3W79A 1CP3A 4MI1A 4ND2A 4PQEA 3KJXA 3OUTA 2Z2YA 4GYOA 2DZDA 1KMCA 3LLMA 5T67A 3REGA 2H2FA 3CLKA 3DV0B 4E5DA 3S1LA 4LOJA 3MX3A 1M34E 2EHDA 2FPRA 4HDKB 3GU3A 1SKYB 3C6BA 4U07A 2NPIA 1DO8A 4RKQA 4PNZA 3O4GA 2JA1A 4C3ZA 3PDCA 4MJLA 4RXTA 3AIKA 1QNFA 4MCAA 1SU7A 1DAMA 4WZBA 1FB5A 5FWNA 5DTEA 2VSOA 2R2GA 1G7CA 2GCNA 1V11B 5G05C 1B1CA 2P79A 2HV8A 3TSZA 1QC5B 3QI7A 3NBMA 3KBOA 1COWD 2AFRA 4RTLA 2FWIA 2QN2A 4M9CA 3UT7A 1SA4A 3LRPA 2AT1A 3HKCA 2FETA 5BN1A 5IJ9B 1N3YA 3BRQA 5FDFA 4R2IA 3OFKA 3BB4A 3K0CA 5KTRA 2VWPA 4JC0A 1H2FA 3VOBA 3TQTA 4PSUA 4N3CA 1GL6A 2MRIA 2IUUA 2PL2A 4GAEA 2Z09A 3TRFA 4LFAB 3JATB 3FVRA 4A1GA 4KIJA 2GB4A 3OXLA 4O1MA 1L0BA 3O9VA 5BSTA 4B3HA 2HU2A 3BGDA 1NW7A 2PXHA 4CL8A 2C2GA 4YAEA 3U5ZB 4FPXA 3QV1A 4EVQA 1UT5A 2C61A 1XA3A 4NE9A 2KE5A 2Q4BA 2A5LA 4NJMA 4LECA 3T99A 2YC4C 4I08A 1OZGA 2AOVA 3DSWA 4NABA 1ZINA 3T3PB 4AM8A 5FIOA 3WBFA 5HS4A 3PFGA 2QD4A 3E22B 5KDOA 1XJQA 1JFTA 1N1EA 2Z8YA 3UT4A 5L7TA 4OSEA 1L4KA 1ZNYA 4BUCA 4DNXA 5GZ6A 3AS4A 2ZWOA 2HDNB 5EPEA 2GWHA 1E94E 4JR1A 3WZLA 5BNTA 2BM0A 2RD0A 3CMCO 3IBFA 5DO9A 3JWPA 4CLOB 3GCDA 3C6YA 4DCTA 4PYOA 4TRRA 2QTCA 5CRVA 3CSSA 1LDYA 3HVRA 1U9CA 2PQNA 1BE6A 2O3QA 2N75A 1FYXA 4RGYA 4GXRA 4J94A 4A9AA 3RSOA 3WFJA 3AJDA 4DMUB 5TQ2B 3EGOA 2G83A 1SOVA 1OD6A 3EXHB 2AOWA 5LCWJ 1T1RA 3N86A 2VH1A 1OE0A 1YB2A 6LDHA 2H9YA 2Z98A 2NTVA 1IBRA 2DHCA 4D8VA 1RYDA 3QX3A 1B0PA 2GERA 2GAIA 1BHQ1 3RSZA 3Q6NA 1Q2UA 1DJLA 2J49A 1LPNA 4EBAG 4CGYA 5HCIA 2VP0A 3LWZA 4U2FA 2ETVA 4DKJA 1LDBA 1O95A 2IWHA 2CW5A 1CF9A 4JXJA 3FPBA 3RADC 4CKCB 5C4MA 3NPAA 1UT6A 3DVRX 2I65A 3F98A 4ZZ0A 1N4QA 5I3CA 4C21A 3FU5A 1L6IA 2MYTA 2IYZA 1QYWA 2HHAA 2HMAA 3SNHA 3RBZA 1SG0A 1Q84A 2FW1A 1FTYA 2V5FA 1XTTA 1FDUA 4OQZA 4S1WA 5DM4A 1QWOA 1N54A 1GVHA 1ZUHA 3ELDA 3GGCA 3SICE 1D5WA 1Z63A 1T4CA 2DX7A 3B1KA 2QGFA 4S3MA 4JLPA 4O4LB 3EA5A 1OBCA 2WILA 2I1WA 3A6GA 3S1SA 4IF6A 1OZ0A 2ZYRA 1SRRA 3CQGB 1N33B 2J9QA 1O1SA 3FD8A 4B87A 4TUMA 1LSJA 4GRDA 2BELA 5BWMA 1SKYE 1IM5A 2NU6B 4ME6A 4C3UA 4D0NA 3UMFA 3I73A 4FB4A 2PTGA 2ZT7A 3PXDA 1XZMA 3CKLA 4P29A 2FW7A 1YRLA 4IDEA 2Y4NA 5F7ZA 3DP7A 3UHJA 3SYKA 2P9BA 1W88B 2JNWA 4WXPA 1XPRA 5BSMA 2XNJA 3DHEA 4RF4A 3ZCRA 2XZDA 1T10A 3M6WA 3BXEA 3SF0A 2WWGA 1F2DA 3TECE 3HWX1 1ZKMA 1RQPA 3T1OA 4PS8A 1DCMA 4MAFA 4QYXA 1MPTA 4TKUB 3OEHA 3D4NA 1U0SY 1QG0A 3HBNA 4RLQA 4PZCA 1U7WA 2Z4RA 5KOIA 3HFRA 3WLIA 4M9SA 4BLUA 5FYQA 4FMCF 4RIGA 3D2LA 4MKHA 2ATXA 4K9SA 2H0RA 2QM7A 4BFVA 3R09A 2O8EB 1CF2O 4OGKA 2QTLA 1NXQA 3SK0A 4R7TA 2Q3BA 3GA0A 3DFZA 1HDXA 5HS6A 5BYJA 5THQA 3AS8A 5BMOA 1OJLA 9LDBA 3O95A 4DV1B 2LBPA 4YUVA 4N6NA 4P5DA 4YCAA 4RF2A 2J3EA 3FUCA 2V3WA 2A94A 3Q10A 4EKGA 3IPLA 1Z88A 4KPYA 1TJ3A 3V5NA 1AKEA 2BWJA 1SU4A 4QGFA 1E1LA 3DR5A 5BWNA 3DMGA 2I4OA 5B1DA 3NATA 5CFOA 3M1YA 1VCNA 1DAGA 4P98A 4LE0A 1S3GA 2W2MA 2ID8A 1X1SA 2COKA 2IO3C 4A6XA 2OO3A 3T8MA 3AVXA 3O47A 2O8CA 2CJWB 2I03A 3DE7X 5CMYA 4RETA 3G0GA 3RS0A 3SLGA 1RWWA 2W48A 1GT91 4OL9A 2NPFA 2PBLA 2CLFB 3L07A 2HE0A 3TNDA 4S1VA 1H2HA 4LJ9A 1WMBA 1KARA 4J91A 2ERCA 3QMPA 5KJMA 2BEVA 2DIWA 1CUJA 5IM4A 4KO8A 3WIBA 1EGMB 1O9BA 2NG1A 1NZDA 4F1WA 2X8JB 4X7BA 1F0KA 2Y67A 3RYIB 2AF3C 1XRRA 4NVRA 1XEWY 2BMEA 1DRJA 2JVKA 3BCRA 1DDGA 3G7SA 4CM9A 3K1YA 4OKIA 5AI0A 3BXPA 1M6NA 1SQ0A 4HNHA 1E6UA 5D6NA 1GCAA 1ZWLA 5D3MB 3NO4A 3VDNB 1L1FA 3UUXA 3FAKA 1PGOA 5ALSA 4TZ6A 1YR6A 4B81A 1RWKA 1EFCA 4IHJA 2XAUA 3IIJA 2IUTA 3P2EA 4UZSA 5IDVA 2OBYA 3IO3A 3R7AA 4GM1A 1FSSA 1RQ7A 5ENPD 2AJCA 1I2DA 1ZJZA 4Q4AB 3EG9A 3UKDA 3DBSA 2PUVA 2VJDA 3HB1A 4CGWA 4XQCA 3VR3D 2LNIA 2HLNA 4Q7EA 1RU3A 1MV5A 1Y3IA 5BOSB 3JVDA 1VPTA 2LO6A 2XY4A 5LU8A 1EWRA 1IPHA 4RNDB 2BTOA 1DLIA 3OPQA 3GJSA 1PZGA 3LVFO 2JJMA 4JV5B 4CBVA 3WL5A 4U7PB 1SC3A 3U9LA 3TSOA 1VJ1A 5EPUA 1P81A 1VJGA 4F6RA 2JCBA 4PLYA 1MYOA 3LG2A 4EAQA 4NQRA 1C1XA 3D6TB 1Z25A 3IVRA 5CH5A 2WXFA 4UUMA 2LRHA 3FDIA 4PYKA 5T4EA 2P9SG 4ZOEA 3SSNA 5A5FA 2YYAA 4K5AB 1U5BA 3VX3A 2ETCA 1XFDA 2JGDB 3CE6A 1EUCB 1BKDR 2W6JD 3FUFA 4UUAA 1LDEA 3NEAA 3A14A 3MSCA 1Y7LA 4UOEA 1FP7A 4G81A 3KTOA 3ZV4A 4OLJA 4AK9A 2RIPA 3U4IA 2IVFA 2HAEA 1JTEA 1UM9A 1UKYA 2QMEA 3SQVA 3W5UA 3E3AA 1SA0B 2NU7A 5JWRA 4TL7A 5KB3A 5ED0A 3QSYA 1S3SA 2OBNA 4HB3A 2IDJA 3HCPA 2Y1LE 5BWOA 5KTOA 2D3WA 1BH2A 2IQIA 2OG2A 2CE2X 1CZLA 4D46A 3FIJA 4YDRA 3ASFA 3C0KA 1CRPA 4NCJA 5FA6A 1CX9B 4J1QA 5DV9A 3D4BA 3UGTA 3Q8MA 3MRVA 5E9QA 2JGIA 5IUJC 5A04A 2ZSEA 1UJKA 2BZ1A 1O96B 4KDCA 3X43A 4EZIA 5KJKA 5H5JA 4B74A 5JS7A 4RNCA 1LV8A 4JL0A 2YXLA 1GSIA 2F8TA 2RMKA 5F5NA 2JRLA 2IQ5A 2W2TA 4PRYA 4J90A 5A7DB 4JOCA 5AUOB 4URKA 2VPQA 4KR3A 1YQWA 2WZCA 4F6LA 3V8NA 1RM0A 2WA2A 1R4MA 4YP9A 4MYCA 3DPDA 2RB4A 5DJ5A 4Z9YA 4B7CA 4YJ2F 5KC9A 3AY7A 1S64A 1E79D 2X3UA 4XX0B 1B0AA 4BNGA 4U7JA 1A9XB 2NSYA 2JFPA 2HF9A 2B37A 3UUGA 2P9QA 4UHJA 4ZICA 1AKNA 3WG7E 1ELKA 3PVCA 3TD6A 2FB9A 4LNUD 2AE2A 3PS9A 3JQCA 5KJLA 2PYDA 2Q1TA 2KW5A 4XKCA 1MKYA 3IQDB 3QLJA 5G4KA 5CNKA 2OR3A 5LQKA 5JNUA 4NYMR 1HZ4A 1MU0A 4DNPA 4ACBA 2H6FA 3RG8A 4JJFA 5H16A 2PAFA 4LOIA 2UZIR 3QKTA 4L8LA 2RH5A 2C7VA 1Q92A 1B42A 3Q5EA 4LJLA 5F1KA 4NPAA 3DSSA 1OFGA 3N0XA 3CUSA 4DQKA 1NOIA 1RWBA 1HX7A 1XEXA 4FNOA 1KT0A 4AO6A 1GTZA 5EZ6B 2QLTA 1XALA 2B2CA 4ABYA 3JWJA 4L5CA 4JB0A 1U7OA 1YVRA 3WS7A 1UKCA 1PJZA 2V4MA 2RAVA 1KP2A 3ZY3A 4BNJA 3GYXB 5DM0A 3H5WA 4WGFA 4DPLA 3KJIA 4HN2A 2JRCA 3EYAA 1RIFA 1HLFA 2O07A 1B2LA 1GHTA 2IIVA 1THZA 1KXJA 3BF8A 1JR6A 3EZFA 2FSPA 4DCUA 2WWVD 3GGPA 4HUQA 2L69A 4HEA1 1FBNA 1WAMA 4PFKA 4ZCQA 4EJMA 5ICGA 1EHYA 3EQ7A 3U3ZA 2B1JA