4GZ5A

Crystal structure of human o-glcnac transferase with udp-glcnac
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
716
structure length
700
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 265
structure length 700
sequence length 716
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz5A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gz5A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gz5A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gz5A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gz5A03
2IV7A 4NEQA 2IW1A 2BGUA 3CUVA 4EJ2A 1GGNA 4YNDA 1ELWA 3KS2A 3SYRA 1NOKA 2IEIA 1NZNA 2KS6A 4GZ5A 4G26A 1C3JA 3OT5A 4EKEA 3O3CA 1LWNA 2WTXA 3CVNA 3RSCA 4CTNA 1F6DA 1L5QA 2PL2A 4G24A 1E96B 2C1XA 2P6PA 3OTIA 2QLNA 2HO1A 5A7DB 4GZ3A 4BWRA 3KD7A 3S7JA 1IYGA 3DDSA 2ECPA 4N3CA 3VTYA 2X6RA 3NC4A 5TMBA 3Q47B 3MV2B 4YI5A 3E3OA 3QKWA 2QLMA 3LPZA 4LDPA 1KTIA 3RJVA 3U3WA 3CUTA 2XGOA 2G9VA 3L7DA 4LEIA 5KJNA 3AS4A 2F9FA 2GT1A 3MS7A 3RO2A 4YI3A 3VDNB 2IV3A 2FF4A 2FO7A 3T3GA 9GPBA 3VDMA 5TMEA 4A1SA 2DBAA 4WADA 3QWWA 4BT9A 1HZ4A 1Z62A 4G2VA 4U0SA 4CTOA 3CV0A 4UQXA 1GPBA 2VGYA 4LEUA 3OXGA 4F3VA 4J8EA 1NZFA 2L6JA 3QDNA 4UI9K 4N3BA 3TSAA 2C1ZA 3K9IA 2IFUA 2XEVA 5JJ6A 4REMA 2AVPA 4I1AA 3GZ1A 5ARGA 4JHRA 4HORA 4ME2A 1NA3A 3HYMB 4G25A 1RRVA 2R4TA 1P29A 1NOJA 5D0OD 4U0ZA 2QN1A 2H1HA 5IKOA 5FT9A 1NA0A 3MBOA 2ZB2A 4NRHB 2QRMA 2AZDA 1EXVA 2PRJA 1WV0A 1W3BA 2SKEA 3GZ2A 1EM6A 2YHCA 4NESA 3CEMA 3L79A 2V5FA 3LKUA 3QWVA 4GPKA 1PSWA 2Q6VA 3OKPA 4WNDA 4HOUA 1P4GA 2UY1B 4FZRA 1HXIA 1K08A 4MICA 5JTTA 2F3PA 1L5WA 2G9UA 3CUUA 3T3DA 2AMVA 1BX3A 1GPYA 1XL1A 4KXKB 5FZSA 4BFCA 3URZA 4GZ6A 3ZCTA 4GYYA 5DIZA 4CDRA 3OTGA 3MRTA 2PZIA 4X7MA 3QWPA 2C9ZA 3GPBA 1B4DA 2E2EA 2QRGA 2PQ6A 2XA1A 3RT1A 1E1YA 3TGOA 4GA2A 3FWVA 3TOVA 2F3SA 2O6LA 4RIIA 2C2LA 3MKRA 2R68A 1UQTA 2XMPA 1Y8ZA 4Y6WA 4Y6CA 2J9QA 3ZGQA 4KYOB 5EX0A 2F3UA 3CV3A 5D01A 3T3HA 1Y6GA 2SKDA 3ZN3A 3MQFA 3EBOA 2QRHA 1V4VA 2FBNA 1PNVA 2G9QA 1L5VA 5G05J 2ASVA 5CCLA 2QN8A 5ENZA 3TG5A 2QRPA 3BEOA 2BGTA 2QN9A 3UUXA 3NCHA 4MHSA 3FP3A 4IN3B 1SXQA 4GA0A 3D0QA 4MRAA 1WW3A 3OXFA 3MSCA 5M72A 2JZCA 2KATA 3WADA 3NP7A 4RBNA 3RHZA 2C4MA 3PE4A 3T3EA 1PN3A 3TG4A 1IXYA 2KCKA 3MA5A 5KJKA 1L6IA 2H1FA 3GW4A 2GPAA 2QLLA 3CK8A 4XI0A 4HOSA 1P2DA 3ZCPA 3Q4AB 2PYIA 4X7RA 4YVQC 3RKVA 4UI9C 3L7CA 4N2SA 3S7DA 3OKAA 3E4BA 3S2UA 3ASGA 2VGXB 4RELA 2FETA 4HWGA 1YGPA 3HBNA 5LCWC 1ELRA 3DD1A 4W9RA 4EL5A 2JLBA 2HYZA 5CCMA 3CEHA 2VSNA 3H4TA 1L7XA 4EKYA 4RIHA 4I9EA 1FC0A 2UWJG 1JIXA 1FU4A 3O48A 5IKPA 3C4VA 5JJ7A 1C50A 4PQGA 4RG9A 1IHGA 4APOA 4KQ2A 2FEZA 2AV6A 3EDTB 2FF5A 3MRXA 2QN3A 2X6QA 4O6FA 1XV5A 4HOTA 2PQRA 4FKZA 5FTPA 1QM5A 2GPBA 3IEGA 4I17A 4JA9A 1WM5A 3NP9A 2R5SA 4BTAA 3BEEA 4AY6A 3OY2A 5BNWA 2FI7A 1QZ2A 2WQHA 2PRIA 4F9FA 3H4IA 8GPBA 3S7FA 1QQEA 1QKJA 4CGWA 2R60A 3LYAA 2QRQA 2VYIA 2GW1A 4JL0A 3QOUA 3HBFA 4G23A 1JEJA 3L7AA 2G9RA 3LY9A 4RIFA 1PYGA 4HOQA 1Z8DA 5G04C 3G2LA 3RO3A 1AXRA 2OOEA 3NAZA 4WACA 4WHMA 2LSVA 3T5TA 3NB0A 4N2QA 2WPVA 2UY1A 1KT1A 1J39A 2X0DA 2Q7FA 1L5RA 2IYFA 1O6CA 3Q3IA 2AW3A 2KC7A 3AMVA 3E3NA 3QHPA 2VSYA 1XC7A 1NOIA 4XIFA 4NC9A 3MT8A 1M5RA 2QN2A 3CEJA 3G2NA 2XCCA 3G2JA 2IYAA 2BUGA 3N71A 2QZSA 1NLMA 3ZCVA 1GZ5A 3BDAA 1F0KA 2ACWA 4N3AA 4N5CA 3UPVA 3MT7A 5JTUA 4MI6A 2GPNA 4H7YA 4RG6A 7GPBA 4BT8A 3R9AB 5DXFA 2ONDA 4F97A 3ZHEA 3GYZA 2YQ8A 2NC9A 5AYWD 1JG7A 2P58C 1P2BA 3ZPJA 5D00A 3OXLA 3FROA 3T7DA 3CVPA 3MT9A 2PYDA 2HY7A 1VGVA 2R66A 3IA7A 1L5SA 3L7BA 3LY7A 5DBKA 3DZCA 1ZBPA 1GFZA 4KBQA 2I6HA 1C8KA 3NF1A 5BT1A 3S27A 2VCHA 3Q3EA 4RIEA 3CK9A 4M60A 3VTXA 3ZCSA 2Y4TA 1WV1A 1RZUA 3CKBA 5FZRA 3MRVA 2XPIA 2GEKA 1XL0A 3CEQA 1FU7A 3G2KA 1C8LA 3BD6A 4GYOA 2VCEA 4AMGA 4EQFA 3E3LA 3OKCA 4AN4A 4AIFA 4CTMA 4AMBA 4U04A 1YA6A 1P4JA 5HI7A 1IIRA 5I45A 2R4UA 4MI3A 3CVLA 1NVKA 3VUFA 4MI9A 2FFRA 4G2TA 3BD7A 2HR2A 4YVOA 1ZU2A 1NZDA 4U07A 1XKXA 5LQDA 2VQ2A 2SKCA 2MHKA 4NQ0A 2X0EA 3MTDA 3EBPA 1PC2A 4JA7A 3KAEA 3MTBA 4W6QA 3ZCQA 1H5UA 2XCBA 5DLDA 4KQ1A 2Y4UA 1GG8A 1P4HA 2GJ4A 1JIUA 3OTHA 4M83A 3G2HA 3RIBA 4I2WA 5FZQA 2QN7A 4N9WA 3UQ3A 3VUEA 2VG8A 4KQMA 4GCNA 3ZCRA 2XA9A 3C48A 4GYWA 3WXXA 3RSZA 3CX4A 4GCOA 3S0JA 4L22A 1GPAA 4M7PA 3BD8A 2YJNA 3BCUA 1LWOA 3ASFA 3T3IA 3ASDA 4MHOA 2XGSA 4X6LA 1ABBA 3S29A 3FFLA 1TJCA 1Z6PA 3LY8A 3MEKA 2KCVA 3MS2A 3ZHEB 3Q5MA 4J8DA 3UYKA 4BQFA 3WAGA 1HLFA 2GEJA 4BTBA 2C0LA 2XGMA 2QFCA 4WNFA 5LCWJ 2XCUA 4BQIA 3TAXA 3DDWA 3SYMA 1RZVA 5GPBA 1FCHA 1FA9A 3IAAA 2GM9A 4BQEA 3U4TA 2XA2A 4J8FA 3BCSA 1Z6QA 3ESKA 5CHEE 2VGXA 4N39A 1XOIA 4F96A 4RENA 4UQZA 3GUHA 1AHPA 4UQYA 3MTAA 2OFFA 4GPBA 4AM9A 4GA1A 1JG6A 2BFWA 1P5QA 1KT0A 4WNGA 2KCLA 3S7BA 2IEGA 5HQ8A 2XCIA 5FJYA 4Z5XA 2F3QA 3PDNA 5DU2A 3MS4A 4XI9A 5EX3A 5JJTA 5C1DA 3CUYA 4I9CA 3UYLA 1FTWA 2PQNA 3OY7A 1WUYA 2ACVA 4H7XA 5G05C 2JJMA 5EKQD 2BISA 1FS4A 3AS5A 3L01A 4HLNA 4YUAA 1WAO1 3S28A 3CK7A 1A8IA 4UI9J 3Q49B 4WNEA 3C4QA 5BW8C 5ARFA 4X7PA 3CKCA 1FTQA 1FU8A 3BCRA 3CVQA 4U0UA 4B94A 3PE3A 1B89A 3SZ7A 1WUTA 3D1JA 3HBJA 4I2ZA 3ZFWA 5KJMA 1JIVA 5TMDA 5KJLA 3NPAA 1WW2A 3CUWA 5G04J 2ATIA 3HBMA 1KLXA 1Y8MA 3Q3HA 4G1TA 3RU0A 3SF4A 1FTYA 3Q15A 1UZUA 3ASHA 2IF4A 2IUYA 4J0UA 3WC4A 1A17A 4CGVA 1SXPA 5D0QD 1Y6FA 3G2IA 3JYSA 1XNFA 2LSUA 2QNBA 4AY5A 5TVGA 3ZCUA 1E4OA 2X0FA 5A6CA 1P2GA 1OUVA 6GPBA 4EL0A 1HH8A 4WUYA 2C0MA 2LNIA 3MV3B 4ABNA 3AS8A 5HXAA 3LCAA 3COPA 4RIGA 4QLBA 1UQUA 3D0RA 1K06A 3ULQA 1YA0A 3QKYA
chains in the Genus database with same CATH superfamily
4K5BA 1JHAA 1PR2A 2GN2A 3LBAA 3LBFA 3RC1A 3RVBA 1DQSA 2GRQB 1MG5A 2V5AA 3GFFA 1CUWA 1DXHA 3IKMB 3KE9A 3KZOA 5LNK1 3QOFA 1JFVA 4XKCA 3QLJA 4FYHA 3DP9A 5KDLA 2G70A 4D0RA 4JT4A 5FR1A 1ODFA 2BUBA 4MRPA 5BQ5A 3LBIA 3N59A 5JNSA 1MEOA 1FJGB 2HLDA 1JFFB 4IOMA 4LXTA 4FPXA 3DXKG 1TUGA 1L5QA 1VE9A 5B6PA 2QJFA 3NJ8A 4WZAE 2IY7A 5K0FA 2JHPA 2K2WA 4ZT7A 3TB6A 1GTL1 4YRIA 3FM9A 4I1YA 2QRLA 5HQTA 5FIOA 2HO1A 1UBCA 3M3PA 3BJZA 4Y2VA 2QUAA 1H2VC 5IBQA 2NU8B 5JMOA 2FFBA 5KJFA 3OPYB 1GZSA 2FFJA 2PQ0A 4QGGA 2B4TO 1P75A 4EG0A 1EK5A 4YQZA 1KERA 1B26A 1NBEA 2J41A 2Q1SA 2QLMA 2GB4A 2WC1A 2PO7A 3OPNA 1H4TA 4LDPA 4A36A 4FQ8A 2C00A 2DUJA 3X1ZA 3AK4A 1OYWA 2VP2A 1AO0A 1VE3A 4RGQA 2NTEA 3U44A 3O9MA 3AY3A 3KV1A 3U3DA 4U9HS 2NXCA 3VAZA 3GFSA 3OTNA 2GAJA 1JTFA 1HKHA 1H1TA 1KFCB 1Z6YA 3IT1A 2O3RA 1ZIYA 3EGVA 3PVZA 4JBLA 2F3RA 1RJFA 1G59A 4QGBA 2A6PA 2AXEA 1NC3A 3HWRA 1X81A 4UM5A 2Y0DA 4PO1A 4M0EA 4YDQA 3ZUPA 4KE7A 1E18A 2ZM5A 2RGRA 2WEKA 5BRJA 4JYCA 4MIKA 1SUWA 1W36D 1VDZA 4XW2A 2X0IA 5CH5A 3DUWA 3A04A 4CMIB 2AYXA 2FE4A 3O92A 1W88B 3ZQUA 5CA1A 4S05A 4TLMB 5EOVA 1JEYA 4N3GA 3V2XA 1Z25A 1MABA 2PJUA 3P9NA 3EMKA 4R2WA 3DE2X 5FBKA 2REQA 3IR6A 4GTTA 3PHLA 5IN4A 3HM2A 3EPHA 2XUQA 1F48A 4E3WA 1XZLA 3C3CA 4F1PA 3NCHA 3IAAA 3P9YA 4RAOA 1G6OA 2ZFUA 5CM2Z 4QU5A 4AT1A 1QLJA 1F4PA 3MYYA 1MOZA 1EZ4A 1NP6A 1N2EA 4LPKA 4D3DA 3FYUC 1BAPA 4JLPA 4UU0A 5C2JB 4RHCA 3CF6R 3IJPA 3U7IA 1ZNZA 3GEBA 4OI0A 1YCSB 4YT4A 4HLLA 1JIQA 1OXVA 2OOSA 3ZHBA 4CUZA 1E7RA 1NI3A 1UH5A 3U9LA 4G84A 5K20A 5EA2A 1BE0A 2VYQA 2CXQA 3PGA1 2BELA 2NO7A 4A0FA 1JAZA 4H4DA 4QQKA 4RD3A 1F8UA 4D9CA 4UW9A 2FEWB 2FGKA 3GDFA 1U63A 1JHXA 2QGZA 4E1VA 1GPYA 3O84A 4TV3A 2BKVA 4GBED 5AI5A 3UWDA 1KH3A 2XNKA 3CNBA 3ESXA 4V2IA 1XWIA 3ZGNA 4A6EA 5JBNA 2XKKA 2BI8A 3PPYA 2PDAA 1B4DA 3QBTA 4GLFA 1WSDA 1AF7A 2HD4A 4PFSA 5JPIA 2VJNA 2QRGA 1S4MA 3PUJA 2ZRHA 1E20A 2D4HA 2JGAA 4KP7A 1ZVQA 2W58A 1EF1C 5A4KA 2CLDX 2VDOB 1YOVB 4JMPA 3TGOA 4KPUB 2ZUWA 3UJ8A 4EG8A 1E60A 3DLIA 5JXGA 1E6CA 3WTBA 4CV1A 1FXSA 1LRJA 1T4BA 5LUBA 3T54A 2B30A 4BIMA 2JFFA 1WF6A 4CHGA 1TA9A 2F3UA 4S1VA 4Y6LA 4CJXA 5D01A 4NYJQ 1QV7A 2AWOA 3HGTA 4FCWA 2OA0A 3H2JA 2UXBB 3T8YA 2C0PA 1JZTA 2PVSA 2LR0A 1B00A 2JBHA 3PIDA 3PQFA 5H4GA 1SUIA 1YUNA 4H7JA 5D5QA 1YR8A 1ZIXA 4QUJA 1A1VA 3D02A 4G1EB 4PZDA 4JV5B 4QTZA 3LAWA 2RAFA 2C96A 2ZGGA 5B1AE 4DX2A 2BGTA 1ZMTA 4WCVA 1UPAA 1XDBA 3IX7A 4NENA 4XYLA 3UT6A 4WBNB 1TI7A 5K8UA 5KO2A 1G9XA 5CD1A 2ZZNA 1BE6A 3MHPA 1WW3A 1Z36A 4LZJA 4OLBA 1PUXA 3MSCA 1F2UB 2RIRA 4KGDA 1DIRA 3MTEA 4H7DA 4V0QA 1RC1A 2L2QA 1JDBC 2QB5A 4F6RA 3TG4A 2EHDA 1V6AA 3TD6A 3LPAA 3I28A 4FVTA 3WNDA 4QM7A 3FWYA 4DJDC 4X64B 1G291 5JANA 3TNLA 3P4UA 5EKSA 3EYWA 3I04M 4ZCMA 3TQHA 1BSVA 1P7ZA 1PS8A 1KGDA 2JK0A 3Q3VA 3UAVA 3ZDRA 4EB8A 2XAAA 1DB3A 1YB5A 1LJUA 3QITA 4WOBA 1NFIE 2BKGA 2DWZA 2ZGDA 2ZIRA 2CBXA 2J33A 5ERGB 1MFPA 3GC6A 4JBXA 4BVFA 3R5XA 5HX7A 3W9BA 2APJA 3R3UA 3N86A 1T6ZA 4MAFA 1NBMA 1E9DA 2AEEA 2AKAB 4ALMA 4KQXA 2A5JA 4TXPA 1IUOA 3VNSA 4GTPA 5DSZA 5L45A 5K3FB 1W1UA 4M2LA 5BSFA 4HAWA 3OSUA 1BMQA 4RY8A 4F5YA 3BWEA 3D4PA 1QHHB 1P74A 1Q11A 3KHTA 4RPKA 4EKYA 2IXBA 5TQJA 1MRSA 2ZAMA 2I1LA 3WKEA 2YWFA 3KQVA 1G8JA 1R0BA 5CHYA 1M2HA 1ONNA 5ILQA 2NO9A 1KS2A 3PFKA 4P84A 4Z0HO 3FEXA 5CLFA 1ZRMA 1A04A 3CVJA 3HE3A 5IKPA 1DAHA 3UXYA 3OLYA 5EJ9A 2Q7XA 3G2VA 4JLKA 5IDQA 3B70A 3OIVA 1U0EA 1NLYA 3BWDD 4BKMA 4RTRA 2JFXA 3CPSA 2WU8A 5CRIA 2VT3A 1E2DA 5IVDA 2VSXE 2WMDA 4BECA 4EWLA 4YP1A 3GFVA 4OYYA 4TXNA 4EJSB 4H0CA 1QIEA 3FULA 3TW8A 3GA7A 3ZV3A 4EYOA 5CFPA 2JBAB 4EI7A 2XX3A 4LYEA 4EA7A 1X8JA 4DBZA 4BGUA 4GKBA 1CJMA 1WM5A 4ZC8A 1JPNA 3SBTB 5CAEA 1NV9A 3NOGD 1E8OB 2E5FA 2NACA 1ZW6A 4YMIA 1U2TA 2PRIA 4KFTA 3NUGA 1NVXQ 1U4SA 2ZIVB 1G0OA 4CGWA 2FPIB 1R0ZA 1HXHA 2WHRA 2X3YA 2RAPA 2FPGA 4N40A 1PNTA 10MHA 2VDLB 1ZQ9A 1N2HA 2P2GA 3JUIA 3KXKA 4YLGA 4ZYXA 3LGAA 2FFAA 3W9FA 2I2WA 5CCBA 3Q6MA 1Q3TA 2ZYRA 3PRZA 1ZIPA 3B5JA 1E8DA 1T0IA 1MPXA 2DUMA 3A9RA 2G04A 3DEKA 3EQ9A 3HMQA 3KS9A 4FBMA 4BNKA 2ISQA 2B1QA 1RADA 2BR4A 1J39A 3DVSX 4XJXA 3NM4A 4CKXA 1QBKC 4YMTA 2XQFA 1E9AA 2DFDA 3G9XA 2R1TB 2AW3A 3CIOA 3JWIA 1ZI9A 3NB2A 2LPMA 3O2SB 2AR7A 4Q01A 4YCAA 5GV8A 1CDEA 3RU2A 4CG1A 3TLYA 3DLHA 2DLNA 3ONWA 4OGGA 1J8VA 3ER9A 1ORIA 4URVR 1USUA 1J2TA 2JRLA 2W2VA 3ONFA 3PVSA 5CUQA 5BMVF 3HB5X 5CVTA 1GZ5A 4KBGA 5IHPA 2AG5A 4FFOA 4A8PA 1TLTA 4RF3A 1ZXBA 2CN1A 2JD2A 3QFCA 1QE5A 2C84A 3ENEA 4ZJUA 5HE9A 3URMA 5LMNB 2GPNA 4PZYA 3V2GA 1QMGA 4LWQA 3Q72A 3WYCA 5MDHA 1D9XA 1HDOA 3DFMA 3OAAA 1UP7A 4PLZA 3OZCA 3PL5A 3GYZA 5EQFA 1RMYA 4C6HA 4EGAA 4CEJB 1QGOA 1GEEA 4WSOA 2WG1A 1S2NA 2HJSA 2O5RA 2OBBA 1JZSA 2X5GA 3ENNA 1Q3KA 4X84A 3FUWA 4AMYA 2VEDA 3LWBA 4OJNA 3SFXA 1BU8A 1I7LA 2WUWE 2QP4A 2F1IA 1PD0A 2H1WA 3DBIA 5LXTF 4UHKA 1J24A 4BB9A 2ODWA 3IA7A 1NHGA 3P2EA 4MYRA 3ETDA 1ZH2A 4J90A 4FCTA 4PHFA 3TW8B 1M2JA 1ZB1A 1C9EA 3UT4A 2C9CA 1PQPA 3FJOA 3GRZA 3L6BA 4HWOA 4I4CA 4DX7D 4JOBA 4ND5A 3SF0A 4DUPA 1KBQA 1Y3DE 2PL5A 4Y2PA 1YV9A 3DNFA 1U1CA 3GGPA 1EK6A 1X1DA 5GJVC 2PXHA 4MCIA 1NLFA 1E2HA 3IAS1 1FFBA 1GZVA 2JGIA 2VDMB 2WHEA 3EGWA 4KWTA 4URYR 2Q9UA 4U9IS 2UZ3A 1TPZA 1FL9A 3WDMA 3VR6A 3IUYA 1XIVA 2BFAA 4U4AA 2FWJA 1O97D 3ZGYA 3ZGVA 4BWYA 2WTBA 3HB1A 3LK7A 4KFCA 2IZ5A 4X8LA 4AJKA 3R7FA 2XDQA 3UV3A 4UOZA 2O1SA 4W63A 5LP6A 1SQMA 2CNOA 4NBSA 4I1RA 4E11A 3FYTA 3BUAA 3CVLA 5H9VA 3DDNA 1K4YA 1TMGE 3BQNB 3FB1A 2FFRA 2JFWA 4Q4DA 2VQ6A 1CRLA 1PWEA 4CBVA 4QASA 3OEEA 3UM0A 2SECE 3TF5A 1KEVA 2DPYA 4FJ0A 4UE2A 3B6IA 1TM5E 5K3CA 2VHYA 2C3YA 5I9SA 4ALIA 4B0ZA 1MQSA 1V96A 4LFBB 1HFWA 4H7HA 2ZTMA 1YCFA 1P60A 4ALLA 3PGLA 1ESNA 3PA6A 3VLFA 1V5EA 3N28A 3QMVA 1T6NA 5EHNA 4FJZA 1YGYA 2J9YB 1KXJA 3U1BA 4EG4A 4OHCA 4E09A 1U8EA 2R9VA 3E7WA 4R9NA 1HO8A 4KQ1A 5TQ2B 3ESLA 5K0BA 3JZAA 3L0CA 1OZHA 1RM5A 1VMKA 3ETEA 3JR3A 1P2UA 3QE4A 4RY0A 1XTUA 4ZVUA 1FDIA 3ZI7A 1BDBA 1NQ5A 5JWOA 2QE7A 2HREA 4KC0A 3VNQA 4EQZA 2GDJA 1CU1A 1WHTB 1B3RA 5HKAA 4AMUA 5A9TA 3IUEA 4ATZD 1X87A 3CNHA 1V26A 3OE7D 4IO1A 4PFJA 4V0MA 1MV5A 1NYLA 1ISIA 4JVSB 2RGEA 3E0QA 1P1CA 1JWGA 3TI9A 2NZ2A 3FDZB 1ZMOA 1RTKA 4TRMA 1A8QA 5K8VA 3EDCA 1LWOA 3NRBA 1GY8A 3IR7A 4C7XA 4ZAWA 3RNLA 3C1TA 3KWFA 1O95C 3B82A 2X9NA 4KVGA 5D3MA 1RXIA 3ZKJA 4WOCA 2NWQA 3H1PA 3HDHA 1NGSA 3INYA 3LHSA 1K5PA 2FKNA 3TW6A 1XDUA 1TMKA 1ZH8A 4BQFA 4D41A 3QELB 5CTAA 4H35A 3VYRB 2QL5A 1E7WA 4I2NA 3WDLA 4DA0A 3TK1A 2F4VB 5E6UB 3HA2A 1VOTA 1ESCA 4JEIA 3BAFA 3TWVA 5LCWJ 3GIWA 3VVCA 4A16A 4BYGA 4D82A 1AMUA 2E4AA 1PVVA 1CS0A 3CZPA 5LMUB 1PK9A 2VYND 5ENPD 1TO6A 3S2GA 5CHEE 3L1VA 2YHEA 3SWWA 4H4CA 2GGSA 3CE6A 5DLPA 5JECA 3KYCB 2G1AA 4M0UA 1RWVA 1QYRA 1JALA 2G4VA 4OI1A 1EZZA 2ABWA 3IVGA 3MMSA 5AI8A 3FF4A 1UBMS 1EI9A 2F90A 3I5AA 4XGRA 4A1OA 4AYXA 3K6SA 3SU8A 1SKUA 1YZNA 5ECYA 4RVFA 4EVIA 4Y1EA 2NPFA 4R0NA 5G55A 2FMKA 4WA7A 1YU6A 2AE2A 2AUMA 2KBFA 1KSFX 1J99A 1DAMA 2Y0BA 1YJBA 3GLSA 3RAGA 3H2BA 3QZUA 1PKEA 2XAUA 1ZUHA 4HR7A 4YRDA 2R7KA 3OD1A 1ADYA 3IKJA 1ISSA 3PJRA 2O8EA 4CG3A 1FS4A 4CGZA 2OBLA 3G0HA 4B2LA 2DHRA 5CURA 2NO0A 1Q7RA 5CJ2A 3OZGA 4KXFB 4BGIA 3UB3A 4HB0A 4PTLA 4X6UA 3E7XA 2ODEA 2RHDA 3C4QA 2HL6A 4FGUA 3ONNA 3BBPA 4YFVA 2AOUA 4KIWA 3M1LA 1WZCA 2RGCA 1F51E 1O58A 2A67A 4KWEA 1C3LA 5ES3A 2VDPB 1I0IA 1UR5A 4GWLA 3LHFA 1JXMA 1Z39A 5HG0A 1FFXA 2P2ZA 2VT7A 3E58A 4KYIB 3ZHTA 2NU9B 2YRXA 3L8ZA 4AWXA 1X7ZB 2VJBA 1NW9B 3R77A 4JVLA 2FSHA 3NAWA 4R7LA 1QGUB 3HL4A 3LCRA 4NS1A 5TEVA 4BE9A 4CGVA 1V5GA 1I30A 1ZL2A 2WU3A 3D6AA 3I2JA 3NHMA 3RSLA 3JVVA 4P4SB 1VFNA 4YA6A 5LFAA 1LV8A 1PV2A 1G64A 3LC1O 3ED1A 1T36A 1NUSA 1PEDA 2HRDA 3TQRA 3L8HA 3WYBA 1VB5A 3C8HA 2QNRA 2WYOA 3NEAA 2UV8A 2F8YA 1SJ9A 1WABA 3EQ2A 1F7VA 1XD8A 3O91A 3U37A 4EL0A 2ZR8A 2J8ZA 4R3UC 2A1TR 5BSVA 4I6EA 1YI1A 1MC4A 5C8YF 2XDYA 3EXFB 5CHEA 3FU3A 5DCLA 3TTXA 4QTYA 4N6OA 3A4MA 4BATA 3WIEA 3FU0A 2WJ4A 4FZJA 1X3LA 3I4FA 1K06A 1QG6A 4CT5A 3REQB 2E4WA 1RAAA 3M6FA 1EFCA 4RFLA 5IXYA 4ETNA 2ZBFA 3FTVA 3QFHA 2Q3DA 5HBRA 4GLOA 2C5HA 1E2GA 2I22A 3CZ4A 1SG9A 3K73O 4TX1A 3VJKA 5I48A 2X58A 3RS8A 5A06A 1UWCA 3DKVA 4TMFA 1QH8B 3PLRA 3HYSA 4G26A 2I1VB 3V1TC 1SHLA 3M5PA 3T5MA 3I5XA 2X42A 2YUIA 2VDWB 1CF2O 2GO1A 3N0TA 3AFOA 2QXTA 3O3CA 3HRIA 4MUJA 1ODLA 3RTAA 3T06B 3KL2A 2YQ4A 3W2IA 3OH8A 4YRAA 2QTFA 2C1XA 3R41A 1BGWA 2CHQA 5A3JA 5IZCC 1EGHA 3BERA 4ALKA 3I5YA 2PS1A 1HU3A 4F46A 1CF4A 4LQCA 3MD9A 2GBFA 1MG0A 1PI3A 4BNIA 3KKOA 3ANSA 5DTEA 3WQHA 2FB9A 3A3KA 1UXJA 3LUPA 3QVTA 3AG4E 1T6YA 1X7YA 2ADFA 3SZLA 4KX3A 3WNBA 3WLJA 5GGXA 5B7GA 1A5ZA 4MQEA 1HTWA 3GI1A 2XVAA 5BSGA 3QELA 4CM1A 3LBHA 4NYMR 3R0VA 3QQ5A 1KAHA 1C3VA 2QVYX 2QQFA 2QX7A 4NMXB 3VV3A 1JDTA 3VMFA 1W36C 4EHNA 3G2SA 2FUG6 5H5JA 2VKQA 2RKWA 4J16A 4WUTA 3ZE0B 1QTNA 2AG1A 1XELA 4PXAA 4Q3KA 5EHGA 3N07A 1J0EA 2BLLA 3TE6A 1JDVA 3I37X 3VU9A 1UEJA 1Z62A 4PV7A 4UBIA 3AXSA 1HZZC 3RIYA 2ZATA 1P33A 3K30A 1JQDA 3JQAB 3QA9A 4P7KA 1FDOA 2JEYA 1NPTO 3WLAA 1RI5A 3PENA 1DO2A 1HH4A 5K0LA 4EI9A 5JFGA 1HE3A 3FVVA 2PVCA 4ME6A 1IWPB 1DKLA 1SC4A 1UWVA 3SE7A 4ZZ3A 1SZPA 4XDYA 5IC4A 1USVA 3HUFA 2IO2C 5F76A 1FNNA 2WFZA 4MV4A 4N7RA 4UYJB 4M8KA 1MABB 1P39A 2Q5IA 2YJZA 2Z3ZA 3G2MA 3G89A 3HG7A 2ZE6A 4FDTA 4UWGA 4MWDA 3N0XA 4WUVA 3K9GA 4CNQA 2UUCB 1VKHA 3DWEX 1O9BA 5ARBA 2IH5A 3FUIA 1WDMA 4GOMD 2AL7A 5EJFA 4CNBA 3ZWNA 1VCMA 3JRXA 2FQXA 3EB9A 1FUIA 4JS0A 1NOJA 4L78A 3MINB 5DZSA 5EMJA 2GRLA 1E64A 1SZJG 1CUZA 1L5MA 2H9IA 4U6QA 4EG6A 1XXHE 5LLDA 4I5IA 2OHVA 3UM2A 2PRJA 3LUAA 4D3SA 4EHAA 5H68A 3U6KA 2FRXA 2Z09A 3G13A 1OREA 1M0WA 2MYOA 2J0UB 4NL4H 1KEZA 5E6SA 2F6RA 1Q91A 2GBLA 2V5FA 2XZTA 3H1GA 5C1PA 4TKVB 4RTOA 4XB1A 3AI1A 1P4GA 1G21E 4FIDA 1IG3A 2I4OA 3INTA 3TWOA 1DZIA 4PQEA 3ZXUB 1U04A 3KD3A 4MR9B 4A8JB 3QYJA 1Q21A 3CUUA 3ZHVA 5CERB 3T52A 2Y0CA 1SXJC 3WBFA 1I5EA 1PSDA 1QHEA 1OAAA 3KB1A 4NE9A 2IPNA 4CDRA 3OT1A 3CVUA 2HUPA 4GP9A 3P1UA 5KJCA 1ZUNB 2Q0HA 5TB5A 3UIPC 2FU5C 4X7MA 4NNPA 2JEZA 3M3DA 1U7UA 1ODTC 2Z3WA 5AXCA 4QDKA 1IKND 1ZEJA 4Y6PA 2UUAB 2P78A 1YIOA 4IW3B 1PWZA 2MTBA 5C1BA 2F2TA 4Y2GA 3G6KA 1D1PA 1ZW1A 2QGFA 4YRQA 4CV0A 4E31A 3R9MA 4X0EA 1JX6A 3K7EA 4N5NA 2EVWX 3NCTA 1RYFA 1S9DA 5HQ3B 1OI4A 2L17A 5CVUA 4BWGA 1NJ1A 2QX4A 3D7MA 1Y6GA 1HM5A 2DWOA 4ZYLA 1F06A 3GJ7A 3HXTA 3CVXA 4JVMA 3QU5A 4JBWA 2BGGA 5G05J 3WGVA 3TRHA 4KZCA 1W2HA 3LT1A 3VNAA 3YASA 2N3ZA 1C0KA 1I1OA 3HUEA 3Q8WA 4EDHA 2HNKA 2DKFA 2MSDB 5BSTA 4EMSA 1RCTE 1U0BB 4KXVA 1F8XA 1DFGA 1E99A 1M72A 3DFUA 4JX9A 5K3DA 3GGCA 3ESCA 4ND2A 1AGNA 1ANKA 1FFDA 3CZQA 1E92A 1JPJA 1DEHA 3PUHA 1BA2A 2C8KA 1GSIA 1WUIS 4YCDA 5CXSA 2AOTA 1O94C 4D44A 3SY2A 5EMLA 3RYCB 2FJDB 3CKYA 3CMCO 4IEFB 2GRUA 1I24A 4OVUA 4ANXA 3IBFA 4OOEA 4EOGA 3ERCA 1QB8A 2D1YA 2B7CA 3AILA 2PKXA 1LVUA 1YMVA 2BWJA 2Q0SA 4GSLA 4X41A 5HIIA 3ECAA 3WKCA 2CT8A 3N58A 3O3MB 3ICPA 4WXYB 4B4KA 3TEFA 5GZ6A 4BO3A 5CXQA 4D8WA 3CK8A 3P9SA 2Q3HA 3K9WA 3GJ8A 4FINA 1SQ0A 2QYTA 2XQIA 1M6VA 4IV0A 4K9QA 4D4JA 3CLRD 4L8VA 4ZYZA 4YVQC 2IKSA 1CP2A 2RI1A 4ABYA 4D3YA 4YWJA 3WXBA 4WMLA 5B64A 1QAOA 3Q4GA 4Q0MA 5D7BA 3WJ7A 1CLEA 3EW7A 3AVPA 4LFCB 3TX2A 2J5KA 1A4XA 1I9GA 2I1KA 1OTYA 4HT3B 1DKPA 3UJCA 2XGGA 3ULYA 1IJFA 4EQ6A 3I9JA 4DG8A 4MRSA 2Z30A 5BR4A 1A9ZA 1K2VN 2OLKA 2VZ9A 3UJDA 3JVEA 2VSNA 1U3UA 2C4KA 2G3YA 5KHLB 1WB5A 2O2SA 1K7XB 3C70A 1ZD4A 1H0AA 1A8PA 3NHAA 4WFIA 1IXZA 5DHPA 3ZNQA 5CECB 4NSNA 4DIKA 3U7GA 1FU4A 1EX9A 2GD2A 3GNQA 1YJQA 3G49A 3W06A 4FMDB 4D7AA 3CH7A 3CCCA 2VJOA 4DLVA 3PPWA 1C50A 3LXXA 3ELUA 3LXRA 5E7IA 2WYIA 4KGXA 5JS2A 4APOA 1L7PA 4KQ2A 4PCLA 3UJ7A 4BBJA 2JI7A 5M04A 1T1IA 1NKSA 3KD2A 1H6BA 3CXRA 4F72A 5DX1A 5KSPA 4LI3X 4O6FA 4ZK2A 2ZVPX 4YN3A 1A8SA 3PV0A 4FLMA 2Q3EA 2RH9B 1RHUA 4RKQA 2RE8A 2H1OA 4N48A 4CMIA 5CA1B 3JQ6A 2AZTA 1MRNA 5LXTA 3BFJA 3GNSA 3RSEG 2C2XA 4YDHB 2EWWA 3DM5A 1N4DA 4FD2A 3SS9X 4EPTA 1QZ2A 4A8JC 1XU4A 2WMOA 3JSAA 4KG7A 1UK7A 3GA0A 2HRRA 3MJTA 4C01A 4CR8A 2OFOA 3E8XA 4RQAA 3DHYA 1OZAA 1VIAA 4E4TA 1IE3A 4G23A 1OZ0A 2Y6UA 4D4MA 4I55F 2GRAA 2C07A 3BE5A 5L53A 4MUIA 3A36A 4OF4A 4DTCA 1QV6A 4AS3A 4OXRA 3TMAA 2FSPA 3W4KA 3WRYA 4OVVA 3UJNA 1YTUA 4D99A 2BKAA 2WHQA 3HV0A 1ACJA 1EQ2A 3FZGA 3T95A 2PLFA 2BIFA 3WVNA 4R9RA 4ERXA 1DO0A 4G4JA 3MCTA 4B82A 2CF5A 4MVJG 4MQMA 1T8UA 3TL5A 3E3NA 4I9UA 5T5QA 3SC2A 3AKZA 4Z4HA 5HJ2A 4G85A 4IJMA 1HYGA 4B7CA 1C9YA 4BVBA 1Y4UA 3PGJA 5IX8A 2R03A 3IQXA 1OWPA 4G5GA 3N7TA 1IY8A 4ZVMA 1J9GA 3T99A 1FUEA 5A7HA 3KJZA 3TIIA 4YT8A 1Q12A 1OB5A 4F53A 1AZSC 2IBMA 4KO4S 1DRJA 3F3KA 1CUGA 1GL6A 5ETJA 2E0IA 3W8EA 2PVPA 4TV8A 2XEHA 5CRUA 3GU3A 5FL7D 3EHQA 4CCSA 2XDAA 3DEAA 4AKTA 1TTTA 1UBUS 1ZHHA 3WYGA 2QBYB 1OFUA 2B8EA 2GVNA 3OIGA 4LI0A 3ZE2B 1JR4A 1H93A 2C78A 4K9LA 4RORA 4MS3B 3TIFA 1DPGA 3EHMA 2CNWA 4DUGD 1VLZA 4ZAZA 3V30A 4Q69A 1PS0A 1ZSVA 2WQZA 3HKBB 5LP1A 4ANUA 5E1DA 1L4MA 1VZ3A 4AAYA 4EO9A 1MDBA 4EFDA 2J7PA 3RIGA 1ZGCA 1PGPA 2GR9A 4AP5A 1K1BA 1KSJA 1UINA 2BMWA 2Y68A 5B3AA 3VR2D 4UTVA 4RTPA 1I9CA 3NT2A 3F5MA 3RRMA 1MB0A 2QXUA 5AOBA 5KNCA 5AKHA 1BGVA 3H86A 2ZVDA 1T3ZA 4MPDA 4WFQA 2ZUUA 4JQYA 1NJ8A 4MQ4A 4F3RA 5JZMA 4HLCA 3P0JA 1V3UA 1OLUA 3ND8A 4M1YA 2ZLBA 4MGIR 1G18A 4PLWA 4PVCA 1FOEB 3TZQA 4B3JA 1BRMA 2VPYA 5FBHA 2I8CA 3P94A 1AX9A 4QPNA 4NTZA 4PGHA 4NVRA 4HP8A 3MCZA 1AKUA 1IB6A 1SC6A 2XQJA 3I04A 4DI3A 1PR0A 4IDOA 2IHYA 2J6IA 3IEVA 1A9SA 4E6PA 1P4RA 2FKAA 2QVLA 3SEZA 1FPMA 5FWXB 4F6CA 4AKIA 1E77A 3BMXA 1CUSA 4MAAA 4O29A 4TV9B 3AP1A 1Z8NA 1U3CA 1YR6A 4G2TA 2K4MA 5ITZF 4C3ZA 4DMFA 2ZUVA 3D9HA 3QKRA 4O33A 1J4AA 1C9NA 1Z6ZA 3ONLA 1PJ2A 3HWX1 2K5UA 4Q6WA 3JYOA 1NZDA 5EJ8A 3DW3X 5BXYA 4DMUB 4WWNA 1O8CA 4JWTA 4D80A 1T91A 3S8EA 1JIKA 5A0TA 1PC2A 1XDDA 4IG4A 4FOPA 3T9BA 1J2UA 3X1XA 1RZRD 1AUPA 1E61A 4LY3A 1YC2A 3DDHA 1CY4A 2RSFA 2R8RA 2HWUA 4M7OA 4PSUA 3SZRA 4EEKA 4LSMA 821PA 3H75A 2OO5A 3A8TA 3HDGA 4KR0A 3MYVA 4B2IA 1G8MA 2D3TA 1E1QD 2FPKA 4QPCA 3VR3A 3R5KA 1T3SA 1JXQA 3H7AA 5JNLA 3FVQA 5ALGA 3VVLA 3NDBB 2J9FA 1RIFA 5EWJB 1P9RA 2IY9A 3PPXA 2NTNA 2L0XA 1GTVA 1ZGAA 3OO0A 4LISA 5AW2A 4YRJA 1VXOA 4RPLA 1UKZA 3P96A 4IMPA 1Z0KA 1PV1A 4ZAXA 2JAUA 2XA9A 4DIDA 4YRBA 2FJAB 1E7MA 2AZ4A 3RUIA 2ZUDA 3CX4A 3ZDQA 2NZJA 1ULHA 2UYHA 4KITB 4QTTB 1JU3A 1M6HA 4ANWA 1A9TA 1O6GA 1E3QA 1JA9A 2ECKA 2H2WA 2JBAA 2V0CA 1K1EA 1OFGA 1FDTA 1ICEA 3K15A 1VHQA 3AR5A 4X92A 3ADBA 3CSUA 1XPRA 1O4VA 3R7BA 5ED0A 2V6BA 1GR0A 3PVCA 2VP9A 3KYDA 1WXXA 4DC9A 1QCCA 3DFZA 3FFLA 1L1RA 1DCKA 3B6KA 3N7UA 3CN7A 3R3YA 4IGEA 4QYIB 3ROGA 3VPHA 1T2NA 5K2OA 2UXDB 4KDCA 3IV0A 4KRFA 1HLFA 4QO8A 3MTIA 3PFCA 5KNCH 2Q4BA 3GRAA 4I9FA 1C0IA 3R5HA 5HKKD 1I80A 3DLAA 4DR6B 1Y4DE 2KHZA 2ONYA 2OXRA 1XDZA 3BXHA 1T13A 2JAHA 4FLFA 3DE6X 1XEXB 4QG3A 1W4LA 3W8NA 4ER7A 4I7EA 2P3LA 4WXHA 5D51S 3HSKA 2ZJZA 4OB7A 4YPVA 2OVBA 3DEJA 2QZ9A 1JBQA 4FWBA 5FYQA 2LCIA 4AM9A 1UP4A 2FP4B 2R6DA 3HCBA 1XZKA 3E1SA 3ZW3A 3HVUA 2O7QA 3KDAA 3MSXA 4WLEA 4QM6A 1T1GA 4A7PA 4RACA 1SHJA 2RGNA 2I55A 4TRRA 1DKOA 1Y6QA 3PXXA 3L9XA 4C48B 3L04A 2ZIWB 4TSKA 1JI3A 3ZZUA 1LK0A 5JSZA 1GFIA 4GDMA 2XVXA 4UHBA 2ORYA 2WFLA 3F3SA 4GYKA 4AO7A 1QP8A 4GTQA 1PF7E 3GLKA 3AM3A 5TC4A 1WUYA 3NOXA 3TTTA 1Z33A 1SXIA 2AJBA 4PYMA 3HDVA 2BY4A 3ZJVA 3R3WA 1S70B 2FI1A 2VNJA 2C8VA 3R6LA 1IVYA 1M1XB 1U2RA 1W4RA 3BMCB 3H9UA 4RA6B 4ARSA 1XZMA 3WJ2A 4YRZA 1YAJA 2C2MA 4BLVA 1FVFA 2OCCE 3BGVA 1OKKA 4OKSA 4RK4A 2P90A 2QU8A 4ZYUA 1F38A 1WSAA 2PWAA 3DB1A 5E0OA 2MSLA 5E1BA 5CITA 4DDVA 5KHOC 1RJWA 2NMVA 2NTVA 3FYDA 1YMPA 1RPAA 1QBQA 5COAA 5BMVB 5JI3E 3TVTA 4R81A 4ZI7A 4B89A 3GAZA 3G59A 1OIWA 1C4KA 2X8LA 3BJMA 2PX5A 5KJLA 1RR6A 1EQAA 1PHPA 3O0DA 3MWYW 1KAQA 3K0CC 1QYDA 3BHMA 1K92A 3DKKA 3FSGA 5CJJA 2AZXA 2CDBA 2VNSA 2B78A 3UM3A 5ENRD 1IAVA 2H9YA 1Z5UA 3C5HA 3GMDA 1R0XA 2ZSIA 1AUXA 1A17A 2Q3FA 3IURA 1H23A 4NU8X 1SXPA 5DBEX 4XQCA 3WS7A 1ZP6A 2ZBPA 1RYYA 4B71A 2HSDA 2PX4A 2AD5A 3FSEA 5E2BA 5M2QA 4HXGA 3E15A 3O4HA 4BC1A 2PGIA 3WBKA 1Q0PA 1UIRA 3O90A 2PKCA 2RJOA 4N3NA 5E9AA 1TJPB 1TJFA 1ZFNA 3CGWA 3KYBA 3PEYA 1WLYA 3FTUA 4OSEA 1J8FA 4NAUA 3IPCA 4HWTA 2QXYA 4GGPA 1W581 3A05A 2EF1A 1NBOA 1FMFA 1V25A 3PB3A 4K9DA 3JRNA 2X7HA 2XWBF 2ZAIA 4IS2A 1A95A 1GTG1 4F86A 4KQJA 3QKYA 2VL7A 3QJYA 3UG6A 4BIIA 2DVMA 3LCUA 3ZY2A 2HYDA 4EG7A 3JY6A 1HYEA 1O3YA 2W2KB 1R4MB 3FUFA 4NFHA 1A5EA 2G72A 1SBNE 1H22A 2HIGA 2OV8A 3TINA 2FVXA 4RDCA 4AUEA 5A04A 5BN1A 2PSJA 2WAAA 2A90A 5LD2B 1V3QE 2DQYA 1G6KA 4UEOA 1Z0FA 5I7UA 4W5RA 4BO5A 1LD3A 1YDGA 1FUYB 4K6CA 3WGJA 3J5PA 2NP6A 1F6DA 3OZFA 4ILGA 3CNOA 3NAMA 4DIUA 2B5OA 1MQ8B 5C7OO 5MGBA 4WLVA 5B2FA 3IJ5A 1OD6A 5CH3A 3GUVA 3QEMB 4ID3A 3SHWA 1JQEA 3UMGA 3HHEA 3R5JA 3JQ9C 3UIOC 3HXQA 4MKRA 3GFOA 5EMHA 4EJMA 4DSNA 5JJIA 1QC5A 2CXUA 3MN1A 4DB4A 2V6JA 1XBTA 3FGOA 4S1PA 4ZGBA 3C74A 3IIIA 1UKVY 2DUUA 1GSOA 1DEOA 2NT3A 2CLHB 1HQYE 2NVOA 2XUPA 2CYAA 2YQ5A 4MLPA 3ULEG 3O8DA 1TIBA 1LDEA 4JB2A 3T4XA 1QFXA 3D3QA 4YI3A 4R9UC 2G4LA 3P4XA 4PC3A 3RHSA 3T3GA 3ZNGA 2D3WA 4FP7A 2HIAA 2A3RA 3LI2A 4J3JA 4OHZA 4QWWA 4WADA 2E82A 3QWWA 2PYZA 2P9LG 1GV1A 2P7IA 4D0SA 1CDOA 3DT6A 1KWGA 4IIHA 1X1QA 2ZYUX 4IDCA 5LYJB 1IJBA 1Z2EA 3OEYA 1V95A 1MX1A 3BRWA 4UQXA 1I7NA 3CJTA 3OEWA 4QE3A 2TS1A 2VP3A 5LM3A 4H6VA 4M8NE 4RD6A 3A3OA 4C0SA 1W5EA 3AGQA 4EY5A 3R9XB 1V8ZA 4JFAA 5FTLA 3ASUA 1J9EA 4AJJA 4RA9A 3K8QA 4R1UA 1MIOB 4TZTA 3TG8A 1M1YA 4RCVA 1GZUA 2OCKA 3B38A 4LJ9A 4AXXA 2GZ1A 5DRYA 2DWPA 4YASA 1KYYA 4OXIA 2SCUB 2JD1A 3G1TA 3ICVA 5AOCA 3RH0A 4GKJB 4H60A 1MVOA 2K4NA 1RIIA 2JGDB 3AF3A 3FKSD 3LE8A 1I8TA 5E0KB 2WVGA 2YNQA 2BKKB 1J8YF 1LXCA 1US8B 2G5CA 4Z4FA 1VIYA 1NA3A 3TZ6A 3EMVA 1KRHA 1DKUA 1K6EA 1WB4A 3EULA 2EV9A 2W8BA 4NH0A 5IT5A 4IDEA 2DF8A 3NUZA 3WGLA 3O8QA 1TO1E 4D9HA 1RQLA 1JIIA 2AI3A 2Q8NA 5E6SB 3QLUC 4GFDA 4B5LA 1RLUA 3KQPA 5ICGA 4A3SA 5CIYA 1WTCA 5LIRA 4UEKA 3BZUA 1BEEA 5KX5B 4Z9YA 2YJTD 4KRYA 4ATNA 3DGFC 4PX3A 2IYPA 2C8JA 3LCMA 2GYWA 4G4IA 1XTBA 4KTVE 3J80A 2PIDA 1FB5A 4FZRA 3U4CA 3DONA 1K08A 1MEEA 3LX4A 2CMDA 3QXCA 4MR9A 3RI3A 1E4VA 3TS1A 1E66A 1EP3B 2ZGVA 4PZ9A 1R5BA 3AW9A 2G9UA 4E0BA 2YV5A 6ADHA 3BSSA 4ZCLA 2B4RO 1YHYA 3AJ9A 3UZUA 3ZCTA 4KO2S 5TSDA 3ETNA 5CDHA 3FUNA 1FNMA 2B36A 2HPVA 2YWHA 3VR5D 1QC5B 1GOTA 1ZXXA 2OXCA 1TCAA 3ZDXB 3N6RA 1FFWA 2PQ6A 3ZW8A 2OBNA 4ZHSA 5JCZA 4YCJA 5HTOA 3RRMB 1IZYA 3BMQB 3D6JA 3MMPA 4OBBA 5FJIA 5AESA 5LDHA 1NXSA 1DJOA 1B14A 2C98A 5INTA 1GDTA 1TAHA 1HLPA 3GOHA 3KLMX 2X9GA 4R54A 2PZLA 3KALA 3WB1A 1O1YA 2EJCA 2ZI3A 3EIOA 4U7TB 3W2TA 4M8LA 2EFEB 1G5FA 1W75A 1KDZA 1YAHA 4IXWA 4KYOB 1NBIA 1U65A 1XD2A 3B6ZA 4TKZA 3UTMA 1Q1EA 4H1UA 4MWZA 3WGOA 4S35A 3QK7A 5JLJA 3CLUD 4KR9A 2OV1A 3SOPA 5HM6A 2ATXA 1QJ4A 1PY1A 1TN7A 2IZ7A 3ZH2A 3M83A 1PNVA 2BKEA 4LN1A 5DK6A 5C80A 2H8KA 3ZXYA 1CVIA 3TJMA 1Q0HA 1EVQA 5THXA 4Q03A 2H0RA 3DBRB 2O2DA 3GN2A 3VDQA 2W2LD 1V37A 5JJCA 1D04A 3BSWA 4CPDA 4O4IB 5K1ZA 3NDIA 4REOA 2DHCA 2QN9A 4LG6A 1ZAKA 3DDCA 2XE8A 3AB7A 3E9ZA 2RG8A 3RTCA 1DEXA 2F64A 3UAWA 3U2QA 4JI7B 2WVAA 2YZ7A 4O4HF 4ZOAA 2PEYA 5FUVA 1FPQA 1RU3A 4CM7A 3DEYX 1YUBA 2CNDA 2GZSA 3I9NA 1C2TA 4QYXA 4MGEA 2NZWA 5IBRA 4HSEA 3I2IA 4DJEC 1BJTA 2FPRA 4XGIA 1B73A 3T3EA 4MBGA 1GCGA 3CWQA 2AH5A 2FK7A 4JJIA 4YDYA 5EP4A 3NHPA 5JVDB 5CIQA 1OI2A 4MRUA 2QQGA 1DQYA 2DM6A 1IONA 3H5OA 2VDVE 4MLDA 4KO1S 1BFKA 3HXFA 3CQ9A 4EW1A 4K0KB 2X8JA 3H83A 3OM8A 5D86A 5CPBA 5JUWA 1TZCA 3S8MA 3ZEIA 4X44A 3T9FA 3KEFA 1W34A 2AN3A 1UL1X 1QYMA 3MWFA 3ZY6A 4FHCA 2A0KA 3DBHB 3G2OA 1R8SA 2VGXB 5DM0A 3TFWA 4AP2A 1TUEA 1TK3A 4C3UA 1DELA 1TM3E 1Z5ZA 3CINA 3HBNA 5IM4A 5JDCA 2O1EA 3KJEA 3DD1A 1THZA 3ORQA 5L3QA 3KBBA 1MOQA 4QRDA 4WGGA 1SG0A 2DU8A 1U9YA 1R5JA 4JB3A 3RIMA 4U7GA 3TQIA 3V1MA 5K03A 2AG8A 4YUVA 1YVRA 5M29A 3O48A 1EUQA 5A5DA 3IAUA 4POAA 4ZK6A 4C0QC 4DM4A 4MWEA 4K2HA 2LRHA 1B74A 1J5PA 1F8YA 1CUFA 2VDNB 3EG5A 4OHFA 4Z9AA 5AOAA 4C03A 4FADA 1ZGBA 1AO3A 4MS4A 2P6MA 1DC6A 2GN4A 4M1ZA 3STUA 3VOAA 3ZYCA 4FLBA 2BKLA 2VYVA 3C0KA 3AYXB 2IOFK 5A4IS 1G7CA 1SQ5A 5ARCA 4V0KA 1B0PA 1FXWA 1FQKA 1Z5WA 2RH5A 1UT8A 3V3LA 1P4SA 2GCPA 2RD0A 3OM1A 1II8A 1KTVA 2CXPA 3O1JC 4RH1A 5K0CA 4L3VA 5JIBA 2GPWA 5TIIA 2AMJA 1JQAA 2WKRA 3V8MA 1RW2A 4RM3A 4G56A 4FGZA 3SNKA 1DWQA 3NXKA 1V6CA 4TTAA 5T57A 2WQHA 3TLKA 5C5CA 5FPPA 3SM3A 8GPBA 1QQEA 3U7QA 4DMHA 4O4LB 2R60A 2QRQA 1Q0ZA 3HCEA 4Z68A 4AX4A 4D0NA 1O5MA 4P0PB 1JEJA 4C4YA 3BQ9A 1K6IA 3EGXA 5BN3A 4XM0A 4RIFA 2X2EA 3N74A 2IBTA 2V7TA 4NZ9A 1FRFS 3EOBI 5BYAA 2PUEA 1M2FA 4CMHA 1KZ6A 2W00A 4AXBA 2R7MA 4RE6A 3H0CA 1MP0A 2CD7A 4Y2TA 3V9AA 1I4LD 3DO6A 4A0QA 2ZT7A 5CNIA 1Y81A 3KEMA 1N4QA 1FP6A 4U7JA 1XVTA 2FSVC 1BO6A 4QFCA 4U5XA 2WM2A 1GW6A 1N6HA 2GNOA 4GLLA 5EKTA 1JL3A 4TM8A 3TQQA 4EKDA 4UFOA 1LS1A 2E55A 4YLEA 1J0AA 3OPYA 1CETA 1WY5A 2PPVA 5CR9A 3TLGA 5DM60 4BO4A 4DHWA 3BFPA 4D5EA 2BGLA 1EHYA 4XASA 3Q7IA 4CUJA 3HLTA 5AK4A 1CYEA 1ZSYA 5EUQB 1U2PA 5A9SA 1WDKA 3E84A 1T4CB 1F0KA 1R16A 5EZ5A 4N5CA 1FXUA 1N7IA 3V7FA 3PX7A 1VKOA 1G8KA 2QQEA 3P5BA 3APDA 4MI6A 1XFAA 5IAEA 3SS8A 5DDIP 3HVEB 3JQFC 2J0UA 4HB5A 2XEXA 3TPFA 3PIRA 1G66A 3GGSA 1U9IA 4HBGA 2XT9A 1Y3IA 4BFLA 2LIVA 1E9FA 1JG4A 1KOJA 2JNWA 1VQ1A 2YQ8A 5C3UA 4WT7A 2UVDA 4DIBA 5BSKA 1RKBA 3A10A 1EPUA 2JCYA 5FA8A 3FROA 2PFKA 1QVZA 4J2OA 3DQZA 3IODA 2O5EA 3AHFA 3LHDA 3H9CA 4CKEB 1HC7A 5KVSA 4J9UE 2GK3A 4L9WA 3KFLA 2IDZA 3T5DA 4BMSA 2IHKA 4RK0A 1G98A 3I2FA 3CGGA 3OEHA 3NF1A 3T9AA 3H8JA 2XWSA 3HGQA 1M9NA 3MTJA 1FEZA 5AJXA 1BROA 2QVBA 1M76A 1TKBA 3AUYA 2EIJE 1P6QA 4RV4A 4BRZA 3G2TA 2QP3A 3AI7A 2HCFA 4FS3A 4LJYA 5CFMA 5JVDA 2PD3A 4V03A 1NKTA 3PQ5A 4LHZA 1KRWA 2VZ0A 4HDRA 3ETLA 4OCZA 1T1EA 3QLVC 1GPKA 1DFIA 3RG8A 1AKWA 1TM2A 1AKQA 4FYVA 2I1JA 4KQKA 4OFBA 4JHKA 1NUUA 3LUBA 1NN3A 3UJ3X 2ANCA 1HG2A 2YHIA 4P54A 3ITNA 3FH7A 3OLXA 4GYJA 4BO9A 2BFCA 4MDEA 3CKLA 4Q3EA 3N7AA 3PRKE 3BPSA 1O77A 3A6GA 3P0RA 1TT5B 3DBHA 5EEGA 2FH5B 4FFLA 3HRHA 2I2AA 1W59A 2V3CC 4RZ3A 3CZRA 2F43B 1T2AA 4HWKA 1BWSA 1W88A 3D6VA 3RSGA 4G9BA 4D46A 3L7OA 4XPIA 4B80A 2EIHA 4AK9A 1OLXB 3P9XA 2AN1A 4GEKA 4NZMA 3KWLA 4PR3A 4RTQA 1IIBA 3K35A 4D42A 2J3EA 3HR8A 3SQNA 1BDHA 1TO2E 2BTQB 3TWSA 3A1EA 1JA1A 4EVSA 3DV9A 3FNIA 1FBTA 4OGFA 1T2CA 4JLNA 2P1ZA 2I4MA 4FEAA 2AMFA 1WJGA 1XZHA 1T1JA 1ZD1A 4B09A 4IIXA 1QGDA 3K0HA 4PDXA 1E3DA 4M1QA 3UAZA 1CUDA 3VR5A 4WESB 3UATA 3P7MA 5LQAA 2PUBA 5AW4A 3WQBA 4GRIA 2ZYGA 3ZU6A 2AR0A 4AY2A 1EJ6A 2GRRB 5H9WA 2J30A 3DPIA 3RIBA 4AXHA 3JQAD 4H77A 1NMEA 2QN7A 4GZMA 3UQ3A 3LSTA 4E22A 1CQIB 1F1BA 4Y3UA 5EGSA 1EEHA 1P17A 5EL0A 4RWZA 1SU7A 5JO9A 3ELBA 1NMQA 4IDPA 1VG8A 2TMGA 4FYIA 3LRXA 4UE3S 3WLQA 3AR9A 3VYSB 4P98A 1X7WA 4M7PA 4X24A 3HKBA 1KKMA 5TGDA 5HGXA 3MPUA 1XLUA 3RTEA 1DRVA 1ID1A 2C2KA 2JJ1A 4FBGA 1Q57A 4JIGA 3JUEA 3OETA 4AMZA 2PT6A 1ABFA 4CODB 2XGSA 2YWBA 5JFOA 4BKUA 2ZJ7A 3ESRA 4YCCA 1SBTA 3AIIA 2C03A 3EIEA 3I6BA 1YZFA 3ZQKA 2AXNA 2H6EA 3VHRA 2UYQA 5EUCA 3ISMC 4Y67A 1SCBA 1ADGA 1DX4A 4J16C 5FPYA 3COYA 1NIPA 4NBNA 4F7AA 4J75A 4RABA 4JELA 2FPPA 2C4NA 4RNDB 4QATA 4B3CA 4W5WA 1FW8A 1PHRA 1WXQA 1M2NA 4N54A 3DTYA 3S7TA 2IUSA 2WZCA 3PDJA 1U28A 1SXJB 1HG1A 4KOAA 2ZSAA 3U16A 3AU5A 1MTZA 1FP4B 3GT4A 2HQBA 3UK6A 1SKBA 2EINE 4G8KA 2CDCA 4XEHA 1CY1A 4O1HA 1D6NA 1PP4A 4QYSA 4IDGA 1H0RA 2RJNA 4LHWA 2B0JA 4AJIA 5HPYB 3EXHA 3TTSA 2XUZA 3AIKA 2B7LA 4LNGA 1P5QA 3S7BA 2KCLA 3CXUA 4PG8A 2BTQA 2ECFA 2ID4A 2JFVA 4JEMA 2BCJQ 4RE5A 4AJ1A 2H92A 1GUAA 3L8FA 3AP3A 3F7NA 4A63B 1NDUA 3EQ7A 1XEWX 3A3PA 4I8DA 4P22A 1T8WA 2IO3C 3AJAA 1LQUA 3OF5A 5JJTA 4C6TB 4MINA 2WQ7A 1UAAA 1ZIOA 3GPIA 2Y1LA 3NANA 4K6KA 5EG5A 3I6YA 3B78A 4KN5A 2IZ0A 2QRVA 2OCPA 3IPAA 4FD3A 3RFUA 3W34A 2P9FA 4Y2UA 3UIEA 5EKQD 3UKJA 2P69A 4YJHA 3OZWA 2F48A 2P3SA 3G79A 3UJPA 1O54A 4MQFA 5DTMA 4ERNA 5IWCA 3OC0A 4CV3A 4D10C 3VLEA 2F1OA 5ARFA 2O0HA 3SC2B 3CVQA 4KDFA 2CNKA 5K9ZA 2ZR7A 5BNIA 5DKFA 2CVOA 3P52A 1YDFA 2O2GA 1YR7A 2WPDD 1FVOA 1HOTA 1EGQA 2ZJ1A 2NPIA 5EFOA 4DCJA 4DSUA 5KOJB 3GDHA 3FOFC 2GXAA 4ZOEA 1FJHA 1EP9A 1JHZA 4EUFA 1PZNA 1TFRA 1R4ZA 1EIZA 1J06A 1EUDB 1JWBB 4LVOA 3VH1A 3DHWC 3K53A 1WQ3A 5L3ZA 5L8VA 1YULA 3UPUA 2ZCVA 2IF4A 1BOOA 1UPUA 1DQPA 3O8NA 5JG7A 3RUAA 4CIAA 2CHZA 3ZOZA 4TS9A 2D06A 3IPXA 1UMDB 1QWOA 5EYPF 3G2IA 4WZAA 4LFAB 1DLJA 1SUDA 2ZYWX 3RJZA 4DA7A 4XVRA 3SSAA 4RSMA 3RARA 2UVPB 4DA8A 4ZTUB 4PGGA 5T67A 1VSUA 2FZLA 1CRQA 2X1LA 4NV0A 5CM9C 4AM8A 1DTSA 5AUOB 1UZAA 4TL9A 4QDZA 4ILEA 2YY6A 3AI3A 3G5LA 1VJGA 4H7PA 1U3GA 2P6OA 3Q7EA 1VCIA 1ZZGA 2JCGA 2W2PA 2VPZA 3FPLA 4TLLB 4CQLA 4RJTA 4W5NA 1U2QA 1UOQA 4A73A 5JNRA 2OEVA 2QUZA 3QKTA 5EGNA 3R6DA 4TYNA 5K3SA 3HTXA 5BOVA 5JAQA 3IQDB 1Q83A 4E14A 3E22B 5FA5A 2W70A 3K94A 3B1ZA 5DN9A 4FGJA 2KM1A 4L5IA 1FRVA 1TC2A 4R1QA 1JHMA 4ZO7A 4AIIA 5HIAA 4KIGA 4DDHA 3D2BA 1E9EA 1JJIA 1CTQA 5DLEA 2JZNA 2EJVA 1QR2A 2E18A 3PLNA 1KZ1A 2QWXA 3IAM6 1AZTA 1TZMA 1MAHA 1LWNA 2WTXA 1LPAB 3JR7A 4PSDA 2P68A 4EHMA 4TTQA 4CTNA 4CKCB 2ZSUA 3R3VA 4RW0A 5CMLA 5HF5A 4O0MA 5I4IA 4M3OA 4PIMA 5IJ9A 3V48A 3DWIA 3V1LA 4AULA 1U4NA 3SX4A 3CF4A 4PLVA 4V0SA 4AN0A 3FPKA 2V4HC 2PV7A 1PJCA 1EVLA 1SZDA 1Z08A 2VJYA 2XLCA 3IJEB 5FIUA 4RVBA 3CR3C 3ISTA 3U26A 3GR6A 1FJ2A 1N2GA 2EX1A 1M6NA 1O7JA 1VPVA 1W8IA 1KI6B 2BEWA 1YVUA 2ZIGA 5FTJA 4A6DA 1IUPA 1QF7A 4OV6B 1H9CA 3FAKA 3NBMA 1KFKB 4NU5A 5LBUA 2NXEA 4Q66C 2CZGA 5HMMA 3TAUA 3PIIA 2J5XA 2Q2OA 3WI7A 1A7KA 3DE5X 3L82B 5CLLA 1A7UA 1WBDA 3DO8A 3T5VA 2VAMA 4GL2A 3NX4A 2DTDA 1SMKA 1OAOA 4E1BA 1HFAA 5KAMA 3ONEA 1XSEA 5EXTA 4YRPA 2ZQ5A 1H4QA 4MROA 1Y1QA 4QUEA 3SLRA 3CV0A 1QIHA 1RLIA 1U2EA 4UE6A 4BP9A 3W6ZA 5DGCA 4XIJA 2AVNA 1UDWA 2VQDA 3R4CA 4FZ5A 5TGZA 2L6JA 2QTZA 2VSFA 4URKA 2XNDD 4RVCA 2DH6A 1F8FA 1M5UA 2ZI7A 4TTSA 1NPDA 2O2EA 3KAJA 4IIBA 3K9IA 5KWEA 2ZBDA 4P92A 3I4CA 3QKUA 4YC7A 1POWA 4LY9A 5EP2A 3RYFA 2Z8YM 1YRYE 1DBPA 2XS1A 2WKPA 3A11A 4JOCA 3WL4A 5AIBA 4GI2A 4JI6B 2GEVA 3QBDA 4DNPA 2EIKE 5CRVA 4LOAA 3ELWA 1DC2A 1NVVQ 2QN1A 2YQZA 5A6SB 1WHSB 1DAIA 4U0ZA 5AT1A 2BN4A 1E3WA 1ZU5A 2X14A 3LOPA 1GTSA 5FT9A 4PCUA 3NOCD 2VH5R 2UAGA 4PLFA 1JEAA 3DXXA 2GNAA 5C7YA 4BGVA 2SKEA 3K2QA 5EYPB 2AFHA 4QZVA 4NPCA 5ITWA 2AJ8A 4RUKA 5IZ4A 3BG5A 2FQQA 3ICEA 3A4YA 3SAJA 3KSLA 2E2WA 3U6BA 2HLHA 1Q0SA 3ILYA 1U4OA 2AN4A 5KJEA 2H54A 1P3DA 2QM7A 3MGGA 1PWHA 2ODTX 1J90A 4DNOA 4JZYA 2E3JA 4R69A 2WOOA 2ZUEA 3BWBA 3VUFA 1P5ZB 1U1EA 2GUGA 1UT6A 1Z75A 2YWJA 1GXSB 2O3QA 3TE7A 4BN0A 4D57A 3Q3GE 1XJCA 3D4OA 3MCXA 3DKPA 4IH4A 2PZIA 1MF7A 1P0MA 4GUDA 2XCRB 4J6FA 4MRMA 4PGAA 1OIVA 3E30A 3FPBA 1I4TD 2KLHA 2JIDA 4AD8A 4DIFA 5ABPA 3MOGA 3PXCX 1PBTA 2XTNA 2NYAA 1LI4A 2FWMX 2WJWA 2FFQA 5EHIA 3KR0A 3UPDA 5KNLA 4ND7A 1E3TA 3STXA 3TOVA 2HBYA 2M6LA 1AQ6A 9ABPA 2KYRA 1ZN8A 3RVPA 4UJ5A 5KTRA 5TQ2A 4OEHA 3SBEA 4GKVA 4RJKA 2BMVA 1VPWA 1UOOA 1PEYA 3WO0A 2XKBA 1FSPA 3ZGQA 1TECE 4FSDA 4ZQFA 4WBNF 2QN6A 3VTFA 4CGYA 1U98A 3P32A 4N5QA 3VO9A 1SEPA 4RNCA 1MX6A 1N0RA 2BPOA 1FMJA 1H5NA 1LW7A 4KCGA 4LY6A 1EVKA 4ZEMA 2GWHA 4DG9A 4AS2A 2WV7A 1G20B 2G9QA 1XGWA 2AWIA 2CXOA 1AS2A 2V74B 3H2YA 5EAIA 2O05A 1HZZA 1G8GA 1E98A 1SUPA 3RW9A 1DC5A 1W29A 3Q0IA 5LB2A 1Y89A 2IUFA 4BNXA 3DPDA 3F9CA 2C7OA 1N2BA 4IG9A 4RHFA 4YYEA 2XMQA 3GVCA 4PIPA 5ANRB 2BBTA 3HB9A 1EHCA 3QW2A 1DUSA 3T1OA 4LK2A 1OCCE 5EXXA 2OV6A 1FP1D 2CVFA 2Q1XA 2WYWA 3GT7A 3GV0A 4IPTA 3C3JA 2YH2A 4RKRA 5FTNA 2VPIA 4H1WA 3MHTA 1P8AA 1V7QA 3IRUA 3N8KA 4JLVA 4J2TA 3WYAA 1PK7A 1RMTA 1DINA 2WJYA 3AEUA 2C4MA 3H42B 4UNIA 5EYPA 2I71A 4POOA 3SYKA 2KCKA 3B13A 2VPQA 4QGAA 1CVRA 1OLOA 2B34A 3HPQA 5BQXA 2OZLA 3EUAA 3NT4A 5CU7A 1ZX1A 3QEAZ 5FBVB 1GEGA 4KUEA 4FYXA 1ZK3A 3HKDA 3KAKA 4LDAA 5DNWA 2AF4C 5FLXA 4NQRA 2I1QA 2ZYIA 1O96B 1C81A 2F3TA 4XGQA 5TGTA 5HRYA 1UJRA 1FSSA 2FPMA 1B6RA 1GRNA 2GK7A 2JKZA 3AFMA 3ZW9A 5IAAA 4JI2B 3IDFA 2HOQA 1GXSA 4KKVA 4XD7D 2Z4RA 3O4GA 3OCCA 3K2EA 2VBGA 3FRJA 3SJ7A 1MR3F 2WLSA 5A1JA 3DUFB 4IHAA 1U1FA 2F9LA 2Y0PA 2QQ0A 2X4DA 4TQ9A 3SX2A 4BNWA 2EKDA 2H2HA 4D2IA 4NXNB 1L9KA 1NXPA 1NJ6A 1BVRA 4BEJA 5IBCA 1KMCA 1ZOLA 4I9EA 2HXGA 2YXLA 3PXBA 3SR0A 3U31A 2FSIA 3MF4A 3JPYA 5AKXA 5ALQA 3SMVA 4UTRA 3WBBA 1T1SA 1O1TA 2C97A 4P4SA 2C7GA 1UN9A 5JVDF 3D64A 1SR8A 4UULA 3ZX5A 4YALA 2GEUA 1ZO8A 4UAGA 2P9CA 1A4UA 4B76A 5EIBD 3SJAA 3BXPA 1SEVA 1M1NB 5MN6A 3B7PA 3PR3A 2DT8A 4AP6A 1GLNA 4H7KA 1I6WA 1CT9A 1YDMA 4JMLA 3WWYA 5I51A 2BGNA 2V7PA 2W93A 4EH1A 1BCRB 3W5BA 3EXFA 4G8JA 5C51B 4O08A 4LXXA 4IZHA 1R3UA 2O0JA 3JYPA 1C8BA 2QUHA 3GP3A 3NBAA 2WT8A 4H15A 3B36A 2X2PA 2QGNA 3KYCA 4QNRA 1FPPA 1V54E 5BNWA 4TMTA 2FPLA 2I8LA 1D09A 1RRKA 3DHVA 4XD2A 1IN7A 3QC1A 1DRKA 1JI0A 2HMAA 4EPVA 2X6IA 6YASA 3EIJA 2VOEA 1HFKA 3FYCA 3E4DA 1QNFA 2PK3A 4QXAA 1T0JB 2BF0X 1JXAA 3WWEA 2W8ZA 1QX3A 2W6NA 2QMEA 4I3HA 3THWB 1B16A 2CDNA 2IODA 4KXUA 1N33B 1YS4A 4MV9A 4F7DA 3BL8A 3G8BA 5AM2A 3I01A 3V32A 1L5HB 2BTEA 2ZG6A 4MO2A 2Q7FA 2QTBA 4PNPA 2ZK7A 4YHHB 2WJZB 1ZK2A 4K03A 1LF0A 3BXFA 3Q3IA 2AJLI 1HA3A 3FLMA 4KNVA 4OAOA 4ZEOA 3RJTA 3H13A 3THRA 4AZ3A 2Y1FA 4DBLC 3C5CA 5JYEA 3ZX4A 4NLLA 2CLSA 5FYDA 3T15A 3OZSA 4KE8A 4ZT4A 3UEOA 3WDKA 3PEEA 3KPYA 1GPDG 2I4RA 1ONSA 2P1RA 3DL0A 4MRNA 3EE6A 5LA6F 2Q7DA 5HR5A 5LL6P 4PFKA 4HDSA 4M7WA 3C5VA 4KVFA 3B8HA 1C0PA 3UJ9A 1VRCA 4OL0A 3VVBA 4CLRB 1QU2A 2KM4A 1M2OA 2FVYA 3GEDA 3T7RA 7GPBA 4X93A 4WA8A 1R7RA 5G1PA 3SGLA 4CQNA 2QW1A 3CNEA 3EZ2A 3FMVA 3LT5A 2ZT5A 3U3KA 3IP3A 4AG3A 4PQFA 4FNAA 1PKXA 3T94A 1PT7A 2AW6A 2P9QA 3V2OA 1FYEA 4PU0A 2XYPA 2G17A 2X3FA 4OH7A 3V3TA 1IATA 1PJSA 2JC3A 2CMFA 3F0TA 3IOEA 2Z5FA 4Q9KA 1KKLA 1TD9A 3OQBA 1YE3A 2FEAA 1M54A 4AJEA 1N78A 4J3NA 2WUGA 2IBSA 1L4HA 5DWQA 4EFNA 1LC0A 1GFZA 3E3MA 4F4IA 2OEWA 5AUNB 4A26A 2JLAA 3HNPA 3TKYA 3TPCA 1FNDA 2JHCA 1XA4A 2V3WA 3T8MA 4OJTA 4PRKA 5AOVA 3EOZA 1HRDA 5JAIA 3VTXA 2O23A 3NBYC 2QJRA 3FWPA 4RZXA 3VU3A 5A4MS 1MH9A 2P9PG 1RZUA 4G9EA 4EUHA 1GUYA 3CZ9A 4DT1A 1QJCA 1F4LA 2WJGA 3LVFO 4M0LA 4C2TA 3MT0A 4E46A 2YFQA 3BD6A 1HMYA 4GYOA 5IJXA 2WWTA 2M98A 1L7AA 2ODQA 3CURA 3EUEA 4PY2A 3C7DB 1KQPA 3OCUA 4V0ME 4AN4A 4LGVA 2X3UA 4QODA 3TNYA 1TNUA 3DYIA 3GD7A 5KB3A 5FWYA 1QS0B 2P9TA 1SXJD 1REQB 3UOGA 1NVKA 2H4HA 2CFCA 4BJ6A 5TMPA 1EDZA 4AJOA 2YNMC 3HR7A 4DADA 2W83A 3GHHA 4PQRA 4HLDA 3FX2A 5DI9A 3O4RA 4DCUA 4UTXA 2CLEB 1I7DA 1V5FA 2BH9A 2PM7A 4PC1A 3C39A 3UK1A 3W1VA 3UMVA 3HN6A 5H59A 1VSTA 4XFDA 4NJEB 3R8CA 2R62A 4EPYA 1D5WA 3KAEA 4HH1A 2GBIA 5I9IA 3HCCA 3VZRA 5FTKA 1O95D 4DRXB 5KREA 5AW9A 2O3UA 3DZFA 2MYUA 1JJFA 1E79D 1L4UA 4Y18A 3JX9A 4G5YA 3WGGA 4RSRA 3T35A 3OM9A 2HA6A 3AERB 3QBJA 5F52A 1PUJA 1ULZA 1JG1A 2D13A 2J1LA 2Q5QA 2QD1A 1S5PA 2UYGA 4JQSA 4XCVA 2G09A 2ZJ6A 4ZU3A 4CE6A 5IUNC 1NQWA 4M22A 1M34E 2INGX 1TK9A 2NUTB 3IXMA 2PH1A 4Y6QA 3THXA 1L7DA 3D3EA 1ODSA 3C43A 4DBLE 5I7VA 1X1CA 4B3SB 2WDPA 1HE8B 1ABEA 3R7LA 5J63A 3ZWQA 1L7MA 3OT1B 3GN1A 1Q7TA 2B3DA 3KTAB 3NO4A 4NCNA 4W6ZA 1MO2A 4L22A 3WA6A 3GJ0A 5DYGA 4YT2A 2Q50A 3FDJA 4RVHA 7ABPA 5KU1A 1RW4A 4NIKA 3D3WB 3D9OA 1XE3A 3FN4A 4NZYA 4PRYA 5HEKA 3VO8A 1M2WA 3GLGB 1EBFA 1GPH1 4BQNA 1JUDA 4J49A 2JFHA 3ONKA 3EZXA 4MHOA 1OX4B 1T8PA 4JFRA 4DEYA 2VLBA 2V8OA 2RIPA 4HRYA 1AV7A 1P2FA 3EIQA 4TWRA 3DMHA 5GQSA 4GTVA 4L8LA 3WQRA 1IZ9A 4EECA 3Q5MA 1EBUA 2P91A 3HO1A 2PGJA 4FULA 1CCWA 3HJGA 1PAUA 4WV3A 2BHTA 3R23A 3EPKA 2LDXA 4S24A 1ZJ6A 3D4NA 3VNVA 4PLGA 3WGYA 4LRWA 2D1RA 4U8HA 3SYMA 4R1LA 4RS3A 3GG2A 1U5BB 5DH9A 2Q28A 3CNQS 1FA9A 2RC5A 3HC7A 2R59A 3W2HA 2C20A 1NTOA 5FQ6A 1G5PA 1ZYUA 2H5JA 2HZBA 2FSGA 3OD5A 2VGXA 4LXYA 4B47A 4PHHA 4F96A 2IITA 5KKAA 3LDAA 5FPTA 2OFFA 2R5FA 4U2BA 1M8JA 5LKRA 4OQEA 3KR2A 3ND6A 2PKWA 2XIJA 4IINA 3V9PA 4FFBA 1R8JA 4HDMA 1GL3A 2C31A 4H4EA 4AKXB 4LBZA 4YECA 1X5BA 5AM5A 4EUNA 1TM7E 4LCBA 3VC2A 2IKQA 4OREX 3RWMB 3T7JA 4CIXA 2C7VA 3L4BC 4UOEA 3SMQA 4Y6SA 2P6RA 1F2TB 5AI9A 2IFTA 1R74A 4R01A 4TLCA 5EIFA 1OFHA 3K9BA 4QT0A 2OILA 4BAGA 1HNXB 4TKUB 3ADOA 4TTVA 2AX4A 3RVJA 2BD0A 3QYPA 3R7QA 1R27A 2FN7A 5ICMA 1YH3A 2WSMA 5KTMA 4LRSB 2BISA 2YHUA 4RLHA 1PO7A 3DVQX 2YMQA 4S1TA 4ZDWA 3LWZA 3NAQA 3ITEA 3WLLA 5T7BA 1E1KA 1LGYA 2DR0A 2CLLB 3HA7A 2HN9A 2NSLA 4WZ6A 5A5VA 4ZOBA 2QORA 4IGFA 3A0RB 4MV7A 5BV8A 4DV6B 1NBME 5IHXA 3R24A 5BW8C 2DCUA 3NKVA 5CX4A 5FFNA 3OFKA 1Z2OX 3RVKA 4LGMA 1PJRA 2P5TB 4D9EA 2VF8A 2Y6VA 1B89A 2FZVA 4EJ0A 1BN7A 2GWRA 3CLKA 5JALA 4DV4B 3E9YA 2PSEA 3QXXA 3OWHA 4WXPA 4ETMA 3TZEA 4D9BA 4KL8S 3WFIA 1X7DA 3RU0A 3FSGD 3F97A 1U7XA 5A3VA 2QTVA 3Q7RA 4WFKA 3RV4A 5JAZA 1JNYA 1TZBA 1SH7A 2MJLA 1WXGA 1TGVA 1Y98A 1MX4A 3IPLA 3TSZA 4M0FA 3O47A 5JHGB 1G3QA 4L8YA 3CZ5A 3LLUA 5KNDA 4GZLA 4I9NA 3EIUA 4RMGA 4TRJA 3JQ0A 3ILXA 2Q2NA 1NN1A 4LXIA 3KXPA 5FUWA 2P2CP 1P2GA 3AHGA 5SZJA 1Z7GA 4CCAA 1XVAA 2IXAA 3ZUVB 4OU5A 3ON5A 5CVDA 4EYEA 2H85A 1SXJA 3KJQA 1GSHA 3DOUA 4LJRA 1ONPA 1HDCA 2PJRA 1TVMA 1MHQA 1QBGA 2JHGA 4TSFD 2NUAB 5J3JA 3D0RA 5E3JA 3WQSB 3IUQA 3C3OA 3LPLA 1TOAA 2W48A 1LJLA 2GBPA 3Q78A 4CETA 1DLIA 3QP9A 5FULA 1VKRA 3RBAA 4BKRA 1NX6A 1I14A 3EWAA 4INOA 1LBIA 3LUJA 3U61B 4PZPA 3KC2A 3U3JA 3R0ZA 1RYMA 3RUFA 5C8XA 1JNZB 3D7SA 4G01B 2ZREA 3TIGA 1I6KA 4PX5A 4I0WB 5AK6A 4ARUA 5FUQA 3C3AA 1NONA 4Y7DA 4RY2A 5CM8B 1EFDN 3OJFA 1RE1A 4ZTBA 4WN3A 2V58A 2DTXA 4ZEWA 3FWKA 3RRUA 1H6DA 4MKIA 1W96A 3IQZA 1X13A 1EGVB 3L5OA 4YJ2B 1OXXK 3H6HA 3M89A 2DAPA 2QPTA 4FJYA 2XB2A 5BXOA 2N9UA 3TOCA 3VLDA 5ALVA 4G0XA 3BUSA 4A92A 4D43A 4QYTA 4NENB 2HHHB 5IMSA 4D6PA 4OQYA 4GZ3A 4R84A 1OLXA 3J5QB 4N3CA 1EXNA 3WMXA 1OLSA 2GJ9A 2VQ3A 3BKXA 4WZBE 5TMBA 2G1JA 2QAGB 1VP9A 1HDIA 2RKKA 1YS1X 2IQ5A 2W98A 5IARA 4WVFA 5AW1A 1NUAA 3U3WA 1E0SA 2V1XA 2W11A 3B9BA 2L6BA 3L7DA 2QRKA 5ELLA 3KYDB 4OFWA 3ZE8A 2I7XA 2BFCB 5IC5A 4DW8A 2ID8A 4FMDF 2PNJA 1J1UA 4JBIA 1GG2A 2WIAA 1H3EA 4QHYA 4CLHA 2V9PA 5ESXA 2E7ZA 1OCRE 5JQGA 1K3ZD 5G2OA 4U0SA 4NCHA 2X5OA 2BBSA 3FNBA 2OBXA 2OAGA 3E32A 2IZ6A 4IXMA 2VT6A 3Q11A 4NX2A 2RB5A 3OXGA 4O4JF 2DEUA 3X1WA 2VAVA 3KETA 2DZNA 4HDCA 1GCUA 3TLJA 5K99A 4RESA 3C3PA 1I1QB 1SUFA 2IYQA 2IFUA 3DV2A 3IV7A 1W47A 2FSUA 3P19A 1EFUA 4GE0A 5K4HA 3QW4B 2HRQA 5IAGA 4CQLB 5KYUB 4D6XA 1U7WA 2CCJA 2P27A 2XCTB 2R05A 1UJNA 3ACDA 4RC9A 2QD2A 5D3ZA 4JHRA 4FE7A 3KQWA 3SBDA 2R97A 4DXHA 1MC1A 5CLHA 2GHIA 1M75A 3N8NA 1AG9A 4EZIA 2P4UA 3AHIA 4K1XA 2Y66A 4DY4A 4OHUA 4LJ6A 4AYTA 4CM9D 1ZGZA 3C3KA 3MFQA 1S4QA 1EXVA 1Y5RA 1XCPA 3X2QE 1BXRA 3CWZA 1COZA 4Q3BA 1Q1GA 2YHCA 3HRAA 2E4XA 3AV0B 3EIWA 5G2NA 3EY4A 3LKUA 3UTCA 1JBKA 4E5KA 2EKLA 3B48A 1QVVA 2JLQA 5SY4A 4E51A 4LDNA 4PC7A 4A2CA 1RPJA 1N4RA 4U7FA 1Z4QA 3THSA 5D2MC 4XX1A 3JYLA 3EXIA 1M2KA 2G82A 2TRSB 1NLUA 3U39A 5J4KA 3WHIA 3D54D 1KFBB 3SYNA 3HP1A 4OSOA 3DWFA 1YFLA 2EC5A 3R7SA 3SHOA 3TVDA 4F9GA 1XU9A 3FTXA 3HU2A 3MWEB 4BVEA 3ESDA 2AHOA 3L0IB 4L74A 5BWLA 2R0QC 1L5KA 2RARA 4DA9A 3L9WA 2DECA 3HL0A 3LA6A 1N54A 5AK3A 5KYGA 3RASA 3JQ9A 5AJLA 2P9JA 2X41A 5LR6A 4CLDA 1Q2UA 2OBMA 5AKEA 3K70D 1V11B 2A92A 2HU8A 3KZKA 3PXDA 5CAEB 4DPLA 2F3SA 1VYTA 4F4CA 1HYBA 3ZHOA 1PQWA 5U9CA 4EFKA 1PFKA 3W79A 2XRZA 1UQTA 1W25A 4YJ3A 3RVSA 5EJ4A 2ZIFA 2JIOA 1E7QA 4ZQEA 2FDCA 3WRYC 1GVNB 5FQ8A 1HTTA 2DLDA 5EZYB 2NAFA 4TWAA 3CQGB 3Q88A 4WLFA 4KQ6A 4BO2A 5TQ0B 3ZN3A 1A9PA 5G41A 4ATGA 3ZW7A 5DYIA 2CLMB 2G9NA 4H0FA 1UPCA 4WK0B 4ZPXA 4MX8A 1VRVA 1V0JA 3ER8A 3I9MA 1MQ9A 3KYIB 3U4DA 1HS6A 1XAIA 3N1UA 2L9BA 3KUKA 4B46A 3PNTB 4Y2YA 2PUCA 1N6OA 1CUVA 1M6EX 1LPBB 1SKAA 2WG0A 1IBRA 2RDMA 1K98A 3SQOA 1RQ2A 1BX1A 3UGQA 2ZXFA 4Y8VA 1PDVA 1PDWA 4P35A 2G8NA 3GDWA 4LHYA 1NI1A 3LZCA 2O2HA 4XUEA 3E81A 3EVTA 2OAQ1 3TRKA 5F1KA 4WKNA 4Z4EA 2OC9A 4P08A 3UFXB 2VQEB 1RBYA 3FFWA 4YJHB 3RTGA 3JTMA 3F6QA 2WNSA 4IDNA 5KINB 2PKEA 3NBFA 1DRUA 1BC5A 1W5TA 1S1MA 1UBSB 3IOBA 3L17A 4JKIA 5CNMA 2Y1GA 4EG1A 3PE4A 3M6LA 3BG0B 4RZ2A 2FA9A 4H16A 4QYWA