The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
27
|
sequence length |
122
|
structure length |
122
|
Chain Sequence |
MTHPDFTILYVDNPPASTQFYKALLGVDPVESSPTFSLFVLANGMKLGLWSRHTVEPKASVTGGGGELAFRVENDAQVDETFAGWKASGVAMLQQPAKMEFGYTFTAADPDSHRLRVYAFAG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Solution structure of protein ATC0852 from Agrobacterium tumefaciens
rcsb |
| molecule keywords |
ATC0852
|
| molecule tags |
Unknown function
|
| source organism |
Agrobacterium tumefaciens
|
| total genus |
27
|
| structure length |
122
|
| sequence length |
122
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2009-06-12 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00903 | Glyoxalase | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Signal recognition particle alu RNA binding heterodimer, srp9/1 | Signal recognition particle alu RNA binding heterodimer, srp9/1 | ||
| Alpha Beta | 2-Layer Sandwich | Signal recognition particle alu RNA binding heterodimer, srp9/1 | Signal recognition particle alu RNA binding heterodimer, srp9/1 |
#chains in the Genus database with same CATH superfamily 1U7I A; 3ITW A; 3SK1 A; 2KJZ A; 3OMS A; 3BT3 A; 3VCX A; #chains in the Genus database with same CATH topology 1U7I A; 3GYX B; 4N3B A; 1UJR A; 3OMS A; 4CDR A; 2FJA B; 4N3A A; 1E8O B; 3PE4 A; 4GZ3 A; 3VCX A; 4AKX B; 5AOX B; 4AY6 A; 2FJB B; 4UYK B; 3TAX A; 2RSF A; 2FFG A; 4GYY A; 3V3L A; 2X5T A; 2X5H A; 2A90 A; 2K4N A; 3TU3 B; 5BNW A; 4UYJ B; 2FJE B; 4GYW A; 2DK6 A; 1JNZ B; 1QMO E; 4N39 A; 2X5G A; 3PE3 A; 2W9J A; 2FJD B; 4XIF A; 4N3C A; 5AOX A; 3ITW A; 1JNR B; 3SK1 A; 4AY5 A; 2KJZ A; 4GZ5 A; 4XI9 A; 5C1D A; 1E8O A; 4UYK A; 1914 A; 3BT3 A; 4GZ6 A; 1X4R A; 4UYJ A; #chains in the Genus database with same CATH homology 1U7I A; 3GYX B; 4N3B A; 1UJR A; 3OMS A; 4CDR A; 2FJA B; 4N3A A; 1E8O B; 3PE4 A; 4GZ3 A; 3VCX A; 4AKX B; 5AOX B; 4AY6 A; 2FJB B; 4UYK B; 3TAX A; 2RSF A; 2FFG A; 4GYY A; 3V3L A; 2X5T A; 2X5H A; 2A90 A; 2K4N A; 3TU3 B; 5BNW A; 4UYJ B; 2FJE B; 4GYW A; 2DK6 A; 1JNZ B; 1QMO E; 4N39 A; 2X5G A; 3PE3 A; 2W9J A; 2FJD B; 4XIF A; 4N3C A; 5AOX A; 3ITW A; 1JNR B; 3SK1 A; 4AY5 A; 2KJZ A; 4GZ5 A; 4XI9 A; 5C1D A; 1E8O A; 4UYK A; 1914 A; 3BT3 A; 4GZ6 A; 1X4R A; 4UYJ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...