3GGMA

Crystal structure of bt9727_2919 from bacillus thuringiensis subsp. northeast structural genomics target bur228b
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
75
structure length
75
Chain Sequence
MNVPDMILYNGKITTLDPSQPEVSAIAITDGLITAVGGDELLNSATEKTKKIDLKRKRAIPGLNDSHIHVIRGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein BT9727_2919
publication title Crystal Structure of BT9727_2919 from Bacillus thuringiensis subsp. Northeast Structural Genomics Target BuR228B
rcsb
source organism Bacillus thuringiensis serovar konkukian
molecule tags Structural genomics, unknown function
total genus 9
structure length 75
sequence length 75
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 3ggmA00
4V1YA 1RJRA 1V51A 1YNYA 3LS9A 3QGKC 5G4HC 1NFGA 4C65A 2AQOA 2QS8A 3SFWA 2UBPC 2VM8A 2BB0A 3QGAC 1FWGC 1EJWC 1FWJC 4B3ZA 3GIPA 4WHBA 1K70A 4EPDC 3HPAA 2PLMA 3T81A 4Z42C 4C5YA 1K1DA 2QT3A 3EGJA 3E74A 3G77A 1YBQA 1EJUC 1KCXA 1EJTC 4EPBC 4KIRA 1GKQA 1A5MC 2I9UA 1O12A 4GOAA 4G7EA 4H9MA 2FTYA 1FWCC 4CEUC 4C5ZA 1J6PA 2GWNA 3N2CA 4L9XA 1FWBC 1IE7C 1ONWA 4R88A 4CNUA 3UBPC 4F0LA 2GOKA 1FWFC 3FEQA 5FSEC 3NQBA 3MTWA 1FWHC 3RN6A 1FWIC 4UB9A 4CNTA 1RK5A 2GSEA 2P53A 3MKVA 4WGXA 5FSDC 2OGJA 4EP8C 2VUNA 1FWDC 3GGMA 4F0SA 2VHLA 3DUGA 1PO9A 4DYKA 5AKQA 3D6NA 1S3TC 4RDWA 5HMEA 3MDUA 3E0LA 4AQLA 2P9BA 4RDVA 1EJRC 1A5OC 1A5LC 2IMRA 2OODA 4RZBA 1P1MA 1YMYA 1EJXC 1KRCC 1FWAC 3ICJA 1A5NC 4DZHA 2AQVA 1EJSC 1RA5A 4CEXC 3GRIA 4CNSA 4G7EB 1R9ZA 1E9ZB 4CQDA 4LH8A 1POJA 4GBDA 3MPGA 1K6WA 1R9YA 3LNPA 2Q09A 5HMDA 1KRBC 1EJVC 1FWEC 4AC7C 1E9YB 4R7WA 4CQBA 3GIQA 3T8LA 2G3FA 4F0RA 1ONXA 5HMFA 5LXXA 2PAJA 3LSBA 3LSCA 1GKPA 4BKNA 1YRRA 4GY7A 2OOFA 2Z00A 1POKA 1EF2A 4C60A 1RJPA 1XRTA 1UBPC 3IGHX 1GKRA 1KRAC 5A6TC 4EPEC 2KAUC 1A5KC 3OOQA 1RK6A 1YBQB 3O7UA 1V4YA 2ICSA 1XRFA 3IV8A 4YIWA 1RJQA 1M7JA 2P50A 2UZ9A 3HM7A 4M51A 4V1XA 1RAKA 2PUZA 4KQNA 4R85A 4BJHA 1RA0A 2FVKA 3R0DA 3V7PA 3LA4A 3BE7A 1R9XA 4CQCA 4UBPC 2FVMA 3MDWA
chains in the Genus database with same CATH superfamily
3V6HA 4V1YA 1RJRA 5DG7A 1V51A 5G4HC 3KHHA 3PR5B 2AQOA 3SFWA 2UVVA 3QGAC 2RDJA 1FWGC 1K70A 4IR1A 3T81A 1K1DA 2QT3A 3EGJA 2J6UA 3E74A 3G77A 3PW7A 2J6SA 3RAQA 2UVUA 3KHGA 3BQ2A 4RZRA 2J6TA 4L9XA 3MR6A 4R88A 4CNUA 3PW4A 4RU9A 3FEQA 4QWCA 2XGPA 4JV2A 1FWIC 2AGOA 2GSEA 4J9PA 4EP8C 3GGMA 4ECSA 2BR0A 4YR2A 3DUGA 1PO9A 4DYKA 5KFPA 5EDWA 3M9NB 5DLFA 3GV7B 3MDUA 4O3QA 3E0LA 3G6VA 5L1IA 5KFOA 2OODA 5KFQA 4ECUA 2OH2A 1YMYA 4TQRA 5F9LA 2VA3A 5DG9A 3RB3A 4F4WA 4CQDA 3PW0A 4LH8A 2BQ3A 3MPGA 1KRBC 5KFDA 4QW8A 4ECVA 4YR0A 4ED2A 4F0RA 4GC6A 5KFKA 1ONXA 5HMFA 4QWEA 3LSBA 1GKPA 5KT4A 5KFNA 2OOFA 1EF2A 4EPEC 1XRTA 1KRAC 2KAUC 1A5KC 1S97A 3O7UA 4RNOA 4EBCA 1ZETA 1XRFA 3GIJA 1RYSA 1RJQA 2UVWA 4M51A 1K1SA 3RB6A 3GIKA 5DGBA 3R0DA 2RDIA 1R9XA 5KFTA 4J9SA 4DL4A 3MDWA 5L1JA 3G6YA 1YNYA 3LS9A 2WTFA 2FLNA 3FDSA 4J9RA 2QS8A 2BB0A 3H40A 2FLLA 1EJWC 3NGDA 3H4DA 2ASDA 3GIPA 4EPDC 4Z42C 3BJYA 4QWAA 3PR4A 3Q8SB 2R8KA 2ASLA 1EJTC 4KIRA 2R8IA 1A5MC 4GOAA 2FTYA 3MFIA 3GIIA 4ECTA 1T94A 4CEUC 4C5ZA 5KG7A 2W9CA 1J6PA 1S9FA 1JXLA 4Q8EA 2R8JA 5KFFA 1FWHC 2VA2A 4DL7A 4EEYA 3KHLA 4CNTA 3BQ1A 3T5JA 5L9XA 5DQHA 3H4BA 3MKVA 5KFSA 4QWBA 3M9OB 5FSDC 3TQ1A 4EBEA 1FWDC 5KFHA 4EYIB 4F0SA 2ASJA 2VHLA 5EWFA 4EYHB 3Q8QB 5KFUA 4ECXA 3D6NA 3OHBA 3RB4A 2IA6A 5DQGA 2AQ4A 5DLGA 4O3PA 4AQLA 1K1QA 1A5LC 4J9LA 2DPJA 1P1MA 1N48A 1JIHA 1FWAC 4DZHA 2AQVA 5KG5A 1EJSC 4ED0A 4G7EB 1R9ZA 1E9ZB 5T14A 1K6WA 1R9YA 4U6PA 2V9WA 4DL6A 4JUZA 4AC7C 4R7WA 4CQBA 2AU0A 5KFYA 5KFLA 2PAJA 3LSCA 5KFCA 4R8UA 1N56A 4IRDA 4C60A 1RJPA 5KFEA 4Q44A 5KFXA 2ICSA 5KFAA 3IV8A 4YIWA 1M7JA 2P50A 5KT3A 4V1XA 4QW9A 1RAKA 2PUZA 2W9CB 5KG6A 3V6KA 1RA0A 2FVKA 3PW5A 1S0OA 5JUMA 4DL2A 2C22A 4J9KA 2UBPC 2V4QA 4B3ZA 2JEGA 3QZ7A 5KFIA 1KCXA 3V6JA 2XCAA 2W8LA 4ED3A 1GKQA 5KT7A 4G3IA 4G7EA 4H9MA 4J9NA 1FWCC 4DL3A 2ALZA 3N2CA 1FWBC 1IE7C 2GOKA 4FS2A 3GILA 4DL5A 3RN6A 1JX4A 3GQCA 4EBDA 4UB9A 1RK5A 2P53A 3OSPA 5KG1A 3MFHA 4R8UB 2FLPA 3GIMA 3RBEA 3PZPA 1IM4A 4RNMA 2IMWP 4Q43A 4NLGA 2P9BA 1EJRC 2IMRA 4RZBA 3MR3A 1EJXC 3ICJA 1A5NC 4YQWA 1RA5A 4CNSA 4O3OA 4ED6A 1POJA 2C2RA 3OSNA 5KFMA 5KG3A 1EJVC 5KFGA 3GV5B 5KFZA 5LXXA 2C28A 2V4RA 4BKNA 1YRRA 4GY7A 2C2DA 2Z00A 1POKA 4RUCA 1UBPC 3IGHX 1GKRA 5A6TC 2AGPA 2R8GA 4YP3A 4GC7A 4FBUA 5KFWA 3EPIA 3PW2A 4Q8FA 2UZ9A 3HM7A 3OHAA 5KT2A 5KG2A 4DEZA 4KQNA 4R85A 3MR2A 2W9BA 3T5KA 3LA4A 5L1KA 4ECQA 4ED7A 4IRCA 4O3SA 4ECWA 5DG8A 5KG4A 3QGKC 4C65A 1NFGA 2W7OA 2XCPA 3M9MB 2VM8A 4O3NA 1FWJC 4WHBA 3HPAA 2PLMA 4F50A 3T5LA 4C5YA 2W8KA 3EPGA 1YBQA 1EJUC 1S0NA 5DGAA 1S0MA 4EPBC 4F4XA 2I9UA 1O12A 2JEJA 4U7CA 2W9AA 5C5JA 5KT6A 4FS1A 3T5HA 2UVRA 2XGQA 4ECZA 3GV8B 2DPIA 2GWNA 5KFJA 3PVXA 5KG0A 1ONWA 3UBPC 4F0LA 4ED1A 1FWFC 2R8HA 3IN5A 4RUAA 5FSEC 3NQBA 3MTWA 5EWGA 3SI8A 2ATLA 2XC9A 5L1LA 5KFRA 4FBTA 4ECYA 4WGXA 3Q8PB 2OGJA 2VUNA 4F4YA 4O3RA 3KHRA 2AGQA 5AKQA 4HYKA 5DQIA 1S3TC 4RDWA 5HMEA 3RBDA 4RDVA 5KFVA 2JEIA 1A5OC 1KRCC 4JV1A 1T3NA 4CEXC 3GRIA 2W9BB 4RNNA 4IRKA 4GBDA 1S10A 4YR3A 3LNPA 4TQSA 2Q09A 5HMDA 2JEFA 2IBKA 3BQ0A 1FWEC 1E9YB 4ECRA 3GIQA 3T8LA 2G3FA 5KT5A 2C2EA 2BQRA 3RB0A 5F9NA 3Q8RB 2W7PA 4J9QA 3OOQA 1RK6A 1YBQB 1V4YA 3RAXA 4ED8A 4F4ZA 4JV0A 2BQUA 4Q45A 3QZ8A 4J9OA 4IR9A 5KFBA 5EWEA 4BJHA 3MR5A 3G6XA 4J9MA 3V7PA 4QWDA 1RYRA 3BE7A 4CQCA 4UBPC 2FVMA
chains in the Genus database with same CATH topology
4V1YA 1RJRA 1V51A 1YNYA 3LS9A 3QGKC 5G4HC 1NFGA 4C65A 2AQOA 2QS8A 3SFWA 2UBPC 2VM8A 2BB0A 3QGAC 1FWGC 1EJWC 1FWJC 4B3ZA 3GIPA 4WHBA 1K70A 4EPDC 3HPAA 2PLMA 3T81A 4Z42C 4C5YA 1K1DA 2QT3A 3EGJA 3E74A 3G77A 1YBQA 1EJUC 1KCXA 1EJTC 4EPBC 4KIRA 1GKQA 1A5MC 2I9UA 1O12A 4GOAA 4G7EA 4H9MA 2FTYA 1FWCC 4CEUC 4C5ZA 1J6PA 2GWNA 3N2CA 4L9XA 1FWBC 1IE7C 1ONWA 4R88A 4CNUA 3UBPC 4F0LA 2GOKA 1FWFC 3FEQA 5FSEC 3NQBA 3MTWA 1FWHC 3RN6A 1FWIC 4UB9A 4CNTA 1RK5A 2GSEA 2P53A 3MKVA 4WGXA 5FSDC 2OGJA 4EP8C 2VUNA 1FWDC 3GGMA 4F0SA 2VHLA 3DUGA 1PO9A 4DYKA 5AKQA 3D6NA 1S3TC 4RDWA 5HMEA 3MDUA 3E0LA 4AQLA 2P9BA 4RDVA 1EJRC 1A5OC 1A5LC 2IMRA 2OODA 4RZBA 1P1MA 1YMYA 1EJXC 1KRCC 1FWAC 3ICJA 1A5NC 4DZHA 2AQVA 1EJSC 1RA5A 4CEXC 3GRIA 4CNSA 4G7EB 1R9ZA 1E9ZB 4CQDA 4LH8A 1POJA 4GBDA 3MPGA 1K6WA 1R9YA 3LNPA 2Q09A 5HMDA 1KRBC 1EJVC 1FWEC 4AC7C 1E9YB 4R7WA 4CQBA 3GIQA 3T8LA 2G3FA 4F0RA 1ONXA 5HMFA 5LXXA 2PAJA 3LSBA 3LSCA 1GKPA 4BKNA 1YRRA 4GY7A 2OOFA 2Z00A 1POKA 1EF2A 4C60A 1RJPA 1XRTA 1UBPC 3IGHX 1GKRA 1KRAC 5A6TC 4EPEC 2KAUC 1A5KC 3OOQA 1RK6A 1YBQB 3O7UA 1V4YA 2ICSA 1XRFA 3IV8A 4YIWA 1RJQA 1M7JA 2P50A 2UZ9A 3HM7A 4M51A 4V1XA 1RAKA 2PUZA 4KQNA 4R85A 4BJHA 1RA0A 2FVKA 3R0DA 3V7PA 3LA4A 3BE7A 1R9XA 4CQCA 4UBPC 2FVMA 3MDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V1Y A;  1RJR A;  1V51 A;  1YNY A;  3LS9 A;  3QGK C;  5G4H C;  1NFG A;  4C65 A;  2AQO A;  2QS8 A;  3SFW A;  2UBP C;  2VM8 A;  2BB0 A;  3QGA C;  1FWG C;  1EJW C;  1FWJ C;  4B3Z A;  3GIP A;  4WHB A;  1K70 A;  4EPD C;  3HPA A;  2PLM A;  3T81 A;  4Z42 C;  4C5Y A;  1K1D A;  2QT3 A;  3EGJ A;  3E74 A;  3G77 A;  1YBQ A;  1EJU C;  1KCX A;  1EJT C;  4EPB C;  4KIR A;  1GKQ A;  1A5M C;  2I9U A;  1O12 A;  4GOA A;  4G7E A;  4H9M A;  2FTY A;  1FWC C;  4CEU C;  4C5Z A;  1J6P A;  2GWN A;  3N2C A;  4L9X A;  1FWB C;  1IE7 C;  1ONW A;  4R88 A;  4CNU A;  3UBP C;  4F0L A;  2GOK A;  1FWF C;  3FEQ A;  5FSE C;  3NQB A;  3MTW A;  1FWH C;  3RN6 A;  1FWI C;  4UB9 A;  4CNT A;  1RK5 A;  2GSE A;  2P53 A;  3MKV A;  4WGX A;  5FSD C;  2OGJ A;  4EP8 C;  2VUN A;  1FWD C;  3GGM A;  4F0S A;  2VHL A;  3DUG A;  1PO9 A;  4DYK A;  5AKQ A;  3D6N A;  1S3T C;  4RDW A;  5HME A;  3MDU A;  3E0L A;  4AQL A;  2P9B A;  4RDV A;  1EJR C;  1A5O C;  1A5L C;  2IMR A;  2OOD A;  4RZB A;  1P1M A;  1YMY A;  1EJX C;  1KRC C;  1FWA C;  3ICJ A;  1A5N C;  4DZH A;  2AQV A;  1EJS C;  1RA5 A;  4CEX C;  3GRI A;  4CNS A;  4G7E B;  1R9Z A;  1E9Z B;  4CQD A;  4LH8 A;  1POJ A;  4GBD A;  3MPG A;  1K6W A;  1R9Y A;  3LNP A;  2Q09 A;  5HMD A;  1KRB C;  1EJV C;  1FWE C;  4AC7 C;  1E9Y B;  4R7W A;  4CQB A;  3GIQ A;  3T8L A;  2G3F A;  4F0R A;  1ONX A;  5HMF A;  5LXX A;  2PAJ A;  3LSB A;  3LSC A;  1GKP A;  4BKN A;  1YRR A;  4GY7 A;  2OOF A;  2Z00 A;  1POK A;  1EF2 A;  4C60 A;  1RJP A;  1XRT A;  1UBP C;  3IGH X;  1GKR A;  1KRA C;  5A6T C;  4EPE C;  2KAU C;  1A5K C;  3OOQ A;  1RK6 A;  1YBQ B;  3O7U A;  1V4Y A;  2ICS A;  1XRF A;  3IV8 A;  4YIW A;  1RJQ A;  1M7J A;  2P50 A;  2UZ9 A;  3HM7 A;  4M51 A;  4V1X A;  1RAK A;  2PUZ A;  4KQN A;  4R85 A;  4BJH A;  1RA0 A;  2FVK A;  3R0D A;  3V7P A;  3LA4 A;  3BE7 A;  1R9X A;  4CQC A;  4UBP C;  2FVM A;  3MDW A; 
#chains in the Genus database with same CATH topology
 3V6H A;  4V1Y A;  1RJR A;  5DG7 A;  1V51 A;  5G4H C;  3KHH A;  3PR5 B;  2AQO A;  3SFW A;  2UVV A;  3QGA C;  2RDJ A;  1FWG C;  1K70 A;  4IR1 A;  3T81 A;  1K1D A;  2QT3 A;  3EGJ A;  2J6U A;  3E74 A;  3G77 A;  3PW7 A;  2J6S A;  3RAQ A;  2UVU A;  3KHG A;  3BQ2 A;  4RZR A;  2J6T A;  4L9X A;  3MR6 A;  4R88 A;  4CNU A;  3PW4 A;  4RU9 A;  3FEQ A;  4QWC A;  2XGP A;  4JV2 A;  1FWI C;  2AGO A;  2GSE A;  4J9P A;  4EP8 C;  3GGM A;  4ECS A;  2BR0 A;  4YR2 A;  3DUG A;  1PO9 A;  4DYK A;  5KFP A;  5EDW A;  3M9N B;  5DLF A;  3GV7 B;  3MDU A;  4O3Q A;  3E0L A;  3G6V A;  5L1I A;  5KFO A;  2OOD A;  5KFQ A;  4ECU A;  2OH2 A;  1YMY A;  4TQR A;  5F9L A;  2VA3 A;  5DG9 A;  3RB3 A;  4F4W A;  4CQD A;  3PW0 A;  4LH8 A;  2BQ3 A;  3MPG A;  1KRB C;  5KFD A;  4QW8 A;  4ECV A;  4YR0 A;  4ED2 A;  4F0R A;  4GC6 A;  5KFK A;  1ONX A;  5HMF A;  4QWE A;  3LSB A;  1GKP A;  5KT4 A;  5KFN A;  2OOF A;  1EF2 A;  4EPE C;  1XRT A;  1KRA C;  2KAU C;  1A5K C;  1S97 A;  3O7U A;  4RNO A;  4EBC A;  1ZET A;  1XRF A;  3GIJ A;  1RYS A;  1RJQ A;  2UVW A;  4M51 A;  1K1S A;  3RB6 A;  3GIK A;  5DGB A;  3R0D A;  2RDI A;  1R9X A;  5KFT A;  4J9S A;  4DL4 A;  3MDW A;  5L1J A;  3G6Y A;  1YNY A;  3LS9 A;  2WTF A;  2FLN A;  3FDS A;  4J9R A;  2QS8 A;  2BB0 A;  3H40 A;  2FLL A;  1EJW C;  3NGD A;  3H4D A;  2ASD A;  3GIP A;  4EPD C;  4Z42 C;  3BJY A;  4QWA A;  3PR4 A;  3Q8S B;  2R8K A;  2ASL A;  1EJT C;  4KIR A;  2R8I A;  1A5M C;  4GOA A;  2FTY A;  3MFI A;  3GII A;  4ECT A;  1T94 A;  4CEU C;  4C5Z A;  5KG7 A;  2W9C A;  1J6P A;  1S9F A;  1JXL A;  4Q8E A;  2R8J A;  5KFF A;  1FWH C;  2VA2 A;  4DL7 A;  4EEY A;  3KHL A;  4CNT A;  3BQ1 A;  3T5J A;  5L9X A;  5DQH A;  3H4B A;  3MKV A;  5KFS A;  4QWB A;  3M9O B;  5FSD C;  3TQ1 A;  4EBE A;  1FWD C;  5KFH A;  4EYI B;  4F0S A;  2ASJ A;  2VHL A;  5EWF A;  4EYH B;  3Q8Q B;  5KFU A;  4ECX A;  3D6N A;  3OHB A;  3RB4 A;  2IA6 A;  5DQG A;  2AQ4 A;  5DLG A;  4O3P A;  4AQL A;  1K1Q A;  1A5L C;  4J9L A;  2DPJ A;  1P1M A;  1N48 A;  1JIH A;  1FWA C;  4DZH A;  2AQV A;  5KG5 A;  1EJS C;  4ED0 A;  4G7E B;  1R9Z A;  1E9Z B;  5T14 A;  1K6W A;  1R9Y A;  4U6P A;  2V9W A;  4DL6 A;  4JUZ A;  4AC7 C;  4R7W A;  4CQB A;  2AU0 A;  5KFY A;  5KFL A;  2PAJ A;  3LSC A;  5KFC A;  4R8U A;  1N56 A;  4IRD A;  4C60 A;  1RJP A;  5KFE A;  4Q44 A;  5KFX A;  2ICS A;  5KFA A;  3IV8 A;  4YIW A;  1M7J A;  2P50 A;  5KT3 A;  4V1X A;  4QW9 A;  1RAK A;  2PUZ A;  2W9C B;  5KG6 A;  3V6K A;  1RA0 A;  2FVK A;  3PW5 A;  1S0O A;  5JUM A;  4DL2 A;  2C22 A;  4J9K A;  2UBP C;  2V4Q A;  4B3Z A;  2JEG A;  3QZ7 A;  5KFI A;  1KCX A;  3V6J A;  2XCA A;  2W8L A;  4ED3 A;  1GKQ A;  5KT7 A;  4G3I A;  4G7E A;  4H9M A;  4J9N A;  1FWC C;  4DL3 A;  2ALZ A;  3N2C A;  1FWB C;  1IE7 C;  2GOK A;  4FS2 A;  3GIL A;  4DL5 A;  3RN6 A;  1JX4 A;  3GQC A;  4EBD A;  4UB9 A;  1RK5 A;  2P53 A;  3OSP A;  5KG1 A;  3MFH A;  4R8U B;  2FLP A;  3GIM A;  3RBE A;  3PZP A;  1IM4 A;  4RNM A;  2IMW P;  4Q43 A;  4NLG A;  2P9B A;  1EJR C;  2IMR A;  4RZB A;  3MR3 A;  1EJX C;  3ICJ A;  1A5N C;  4YQW A;  1RA5 A;  4CNS A;  4O3O A;  4ED6 A;  1POJ A;  2C2R A;  3OSN A;  5KFM A;  5KG3 A;  1EJV C;  5KFG A;  3GV5 B;  5KFZ A;  5LXX A;  2C28 A;  2V4R A;  4BKN A;  1YRR A;  4GY7 A;  2C2D A;  2Z00 A;  1POK A;  4RUC A;  1UBP C;  3IGH X;  1GKR A;  5A6T C;  2AGP A;  2R8G A;  4YP3 A;  4GC7 A;  4FBU A;  5KFW A;  3EPI A;  3PW2 A;  4Q8F A;  2UZ9 A;  3HM7 A;  3OHA A;  5KT2 A;  5KG2 A;  4DEZ A;  4KQN A;  4R85 A;  3MR2 A;  2W9B A;  3T5K A;  3LA4 A;  5L1K A;  4ECQ A;  4ED7 A;  4IRC A;  4O3S A;  4ECW A;  5DG8 A;  5KG4 A;  3QGK C;  4C65 A;  1NFG A;  2W7O A;  2XCP A;  3M9M B;  2VM8 A;  4O3N A;  1FWJ C;  4WHB A;  3HPA A;  2PLM A;  4F50 A;  3T5L A;  4C5Y A;  2W8K A;  3EPG A;  1YBQ A;  1EJU C;  1S0N A;  5DGA A;  1S0M A;  4EPB C;  4F4X A;  2I9U A;  1O12 A;  2JEJ A;  4U7C A;  2W9A A;  5C5J A;  5KT6 A;  4FS1 A;  3T5H A;  2UVR A;  2XGQ A;  4ECZ A;  3GV8 B;  2DPI A;  2GWN A;  5KFJ A;  3PVX A;  5KG0 A;  1ONW A;  3UBP C;  4F0L A;  4ED1 A;  1FWF C;  2R8H A;  3IN5 A;  4RUA A;  5FSE C;  3NQB A;  3MTW A;  5EWG A;  3SI8 A;  2ATL A;  2XC9 A;  5L1L A;  5KFR A;  4FBT A;  4ECY A;  4WGX A;  3Q8P B;  2OGJ A;  2VUN A;  4F4Y A;  4O3R A;  3KHR A;  2AGQ A;  5AKQ A;  4HYK A;  5DQI A;  1S3T C;  4RDW A;  5HME A;  3RBD A;  4RDV A;  5KFV A;  2JEI A;  1A5O C;  1KRC C;  4JV1 A;  1T3N A;  4CEX C;  3GRI A;  2W9B B;  4RNN A;  4IRK A;  4GBD A;  1S10 A;  4YR3 A;  3LNP A;  4TQS A;  2Q09 A;  5HMD A;  2JEF A;  2IBK A;  3BQ0 A;  1FWE C;  1E9Y B;  4ECR A;  3GIQ A;  3T8L A;  2G3F A;  5KT5 A;  2C2E A;  2BQR A;  3RB0 A;  5F9N A;  3Q8R B;  2W7P A;  4J9Q A;  3OOQ A;  1RK6 A;  1YBQ B;  1V4Y A;  3RAX A;  4ED8 A;  4F4Z A;  4JV0 A;  2BQU A;  4Q45 A;  3QZ8 A;  4J9O A;  4IR9 A;  5KFB A;  5EWE A;  4BJH A;  3MR5 A;  3G6X A;  4J9M A;  3V7P A;  4QWD A;  1RYR A;  3BE7 A;  4CQC A;  4UBP C;  2FVM A; 
#chains in the Genus database with same CATH homology
 4V1Y A;  1RJR A;  1V51 A;  1YNY A;  3LS9 A;  3QGK C;  5G4H C;  1NFG A;  4C65 A;  2AQO A;  2QS8 A;  3SFW A;  2UBP C;  2VM8 A;  2BB0 A;  3QGA C;  1FWG C;  1EJW C;  1FWJ C;  4B3Z A;  3GIP A;  4WHB A;  1K70 A;  4EPD C;  3HPA A;  2PLM A;  3T81 A;  4Z42 C;  4C5Y A;  1K1D A;  2QT3 A;  3EGJ A;  3E74 A;  3G77 A;  1YBQ A;  1EJU C;  1KCX A;  1EJT C;  4EPB C;  4KIR A;  1GKQ A;  1A5M C;  2I9U A;  1O12 A;  4GOA A;  4G7E A;  4H9M A;  2FTY A;  1FWC C;  4CEU C;  4C5Z A;  1J6P A;  2GWN A;  3N2C A;  4L9X A;  1FWB C;  1IE7 C;  1ONW A;  4R88 A;  4CNU A;  3UBP C;  4F0L A;  2GOK A;  1FWF C;  3FEQ A;  5FSE C;  3NQB A;  3MTW A;  1FWH C;  3RN6 A;  1FWI C;  4UB9 A;  4CNT A;  1RK5 A;  2GSE A;  2P53 A;  3MKV A;  4WGX A;  5FSD C;  2OGJ A;  4EP8 C;  2VUN A;  1FWD C;  3GGM A;  4F0S A;  2VHL A;  3DUG A;  1PO9 A;  4DYK A;  5AKQ A;  3D6N A;  1S3T C;  4RDW A;  5HME A;  3MDU A;  3E0L A;  4AQL A;  2P9B A;  4RDV A;  1EJR C;  1A5O C;  1A5L C;  2IMR A;  2OOD A;  4RZB A;  1P1M A;  1YMY A;  1EJX C;  1KRC C;  1FWA C;  3ICJ A;  1A5N C;  4DZH A;  2AQV A;  1EJS C;  1RA5 A;  4CEX C;  3GRI A;  4CNS A;  4G7E B;  1R9Z A;  1E9Z B;  4CQD A;  4LH8 A;  1POJ A;  4GBD A;  3MPG A;  1K6W A;  1R9Y A;  3LNP A;  2Q09 A;  5HMD A;  1KRB C;  1EJV C;  1FWE C;  4AC7 C;  1E9Y B;  4R7W A;  4CQB A;  3GIQ A;  3T8L A;  2G3F A;  4F0R A;  1ONX A;  5HMF A;  5LXX A;  2PAJ A;  3LSB A;  3LSC A;  1GKP A;  4BKN A;  1YRR A;  4GY7 A;  2OOF A;  2Z00 A;  1POK A;  1EF2 A;  4C60 A;  1RJP A;  1XRT A;  1UBP C;  3IGH X;  1GKR A;  1KRA C;  5A6T C;  4EPE C;  2KAU C;  1A5K C;  3OOQ A;  1RK6 A;  1YBQ B;  3O7U A;  1V4Y A;  2ICS A;  1XRF A;  3IV8 A;  4YIW A;  1RJQ A;  1M7J A;  2P50 A;  2UZ9 A;  3HM7 A;  4M51 A;  4V1X A;  1RAK A;  2PUZ A;  4KQN A;  4R85 A;  4BJH A;  1RA0 A;  2FVK A;  3R0D A;  3V7P A;  3LA4 A;  3BE7 A;  1R9X A;  4CQC A;  4UBP C;  2FVM A;  3MDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...