3GGMA

Crystal structure of bt9727_2919 from bacillus thuringiensis subsp. northeast structural genomics target bur228b
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
75
structure length
75
Chain Sequence
MNVPDMILYNGKITTLDPSQPEVSAIAITDGLITAVGGDELLNSATEKTKKIDLKRKRAIPGLNDSHIHVIRGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of BT9727_2919 from Bacillus thuringiensis subsp. Northeast Structural Genomics Target BuR228B
rcsb
source organism Bacillus thuringiensis serovar konkukian
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein BT9727_2919
total genus 9
structure length 75
sequence length 75
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 3ggmA00
3G77A 1YRRA 3T8LA 3NQBA 4Z42C 1YBQA 4EPDC 4BKNA 2OOFA 2PAJA 4G7EB 3E74A 4RDWA 4F0SA 1V4YA 1ONXA 2Q09A 1O12A 1EJSC 2BB0A 4R85A 4GOAA 1E9YB 5FSEC 1FWFC 1UBPC 1P1MA 4KIRA 1RK6A 4EPBC 1RJRA 3MDUA 2G3FA 1K1DA 5G4HC 1A5KC 3LSBA 3HM7A 4L9XA 1RK5A 4R7WA 2VHLA 4C5ZA 4M51A 1R9XA 1FWBC 1FWIC 1YMYA 2KAUC 1PO9A 3O7UA 4LH8A 4CNTA 2Z00A 1R9ZA 2AQVA 4V1XA 3QGAC 1A5NC 1FWDC 4EPEC 2GSEA 4DZHA 1RJPA 3MPGA 2I9UA 3OOQA 4C60A 1EJVC 1GKPA 3IGHX 3RN6A 4C65A 2AQOA 4R88A 3D6NA 1XRTA 3LA4A 4F0RA 1RA5A 1FWGC 2P9BA 1RAKA 2GOKA 1A5LC 1FWCC 2PUZA 4BJHA 2PLMA 1FWHC 1POJA 2OODA 3GIQA 4G7EA 1KRCC 4WHBA 4RDVA 1J6PA 3LS9A 4UB9A 1YNYA 4GY7A 3T81A 1KRAC 2GWNA 3N2CA 1FWJC 5A6TC 3SFWA 1EJXC 3IV8A 3V7PA 3GRIA 2QS8A 3MDWA 3R0DA 4C5YA 1E9ZB 1POKA 1EJTC 1EJRC 5HMFA 5HMEA 4AQLA 3MKVA 1V51A 1S3TC 5HMDA 1NFGA 4CQBA 2VUNA 1K70A 1EF2A 1YBQB 1KCXA 4V1YA 2OGJA 4YIWA 4CNUA 4F0LA 3GGMA 1M7JA 1A5MC 4RZBA 4EP8C 3MTWA 5FSDC 1GKRA 3FEQA 3LSCA 3EGJA 4GBDA 1GKQA 2P53A 2UZ9A 5LXXA 4H9MA 2ICSA 1FWEC 2IMRA 2VM8A 1R9YA 2P50A 4KQNA 2FVKA 4DYKA 1A5OC 1EJWC 3ICJA 1ONWA 2FVMA 1K6WA 3BE7A 1RJQA 3QGKC 3UBPC 4CQCA 1RA0A 1XRFA 2FTYA 1EJUC 2QT3A 3DUGA 4B3ZA 4CNSA 2UBPC 3GIPA 3E0LA 4AC7C 4CEUC 4CQDA 4UBPC 4WGXA 3HPAA 1IE7C 1FWAC 3LNPA 4CEXC 1KRBC 5AKQA
chains in the Genus database with same CATH superfamily
1YRRA 3OSPA 1S0NA 4QW8A 4Z42C 4R8UA 2OOFA 4Q44A 5F9LA 4ECWA 4G7EB 5KFVA 1K1SA 2Q09A 4IRCA 3Q8PB 4HYKA 1UBPC 4QWCA 3MR3A 4ECZA 4EPBC 2ALZA 2R8IA 3GILA 1K1DA 4O3OA 1A5KC 5KFRA 5KT6A 2R8HA 5KFOA 4R7WA 3EPIA 1FWBC 1PO9A 4CNTA 2Z00A 5L1IA 4V1XA 4Q8EA 3M9NB 3QGAC 2BR0A 1A5NC 4J9PA 3PW2A 3MPGA 3PR5B 3PW7A 3RN6A 4F4ZA 3EPGA 3LA4A 4F0RA 2P9BA 5KFBA 3QZ8A 1A5LC 1FWCC 4FS1A 4BJHA 4EBEA 1FWHC 2XCAA 5DQIA 3RB4A 2XC9A 2W9CA 4RDVA 1J6PA 5KFXA 4GY7A 1KRAC 3Q8RB 4J9MA 3N2CA 4FBUA 3G6YA 1FWJC 2W7PA 3V6KA 2JEIA 3SFWA 1S0MA 3V7PA 2QS8A 4C5YA 1E9ZB 3OHAA 4ECVA 3MKVA 4JUZA 1NFGA 2VUNA 1YBQB 1EF2A 5KFLA 4R8UB 5KFGA 2V4QA 2OGJA 4CNUA 4G3IA 3PR4A 5FSDC 1GKRA 4YQWA 4RUAA 3M9OB 2VM8A 4KQNA 2P50A 2FVKA 1S9FA 4ED3A 1EJWC 5EWFA 3GV7B 4F4XA 2FVMA 3BE7A 5KFDA 4CNSA 2V4RA 5DQGA 3RBEA 3H4BA 5KFZA 5KG7A 5EWGA 3HPAA 4J9QA 3RAQA 3Q8QB 4DL2A 5KFYA 3LNPA 1KRBC 1RYSA 2R8JA 3QZ7A 3NQBA 5KG2A 4YR2A 5C5JA 4ECYA 3Q8SB 2PAJA 3E74A 4Q8FA 4F0SA 1O12A 4TQSA 2FLLA 3T5JA 4GOAA 2UVRA 5FSEC 1FWFC 1P1MA 4KIRA 1RK6A 3MDUA 5JUMA 5G4HC 2WTFA 4RNNA 4L9XA 1R9XA 3PZPA 2AQVA 3MR5A 1FWDC 4QWBA 4DZHA 2W7OA 1RJPA 2I9UA 1EJVC 4C65A 1JXLA 3PVXA 1JX4A 4IR1A 2PUZA 2PLMA 2OODA 4GC6A 4ECUA 4FS2A 4EBCA 3LS9A 4UB9A 4Q45A 5KG3A 5L9XA 3RB6A 2ASLA 3PW5A 4YP3A 2W8LA 3T5HA 4GC7A 1EJXC 5KG6A 5KT5A 5KG0A 3MDWA 3R0DA 5DLFA 1POKA 1EJRC 4F50A 3RAXA 3OHBA 5KFHA 5HMDA 4CQBA 2BQRA 4QWEA 2XCPA 3H4DA 5KT4A 2VA3A 1M7JA 4EP8C 2AGPA 5KT7A 3KHHA 3EGJA 4GBDA 1GKQA 2UZ9A 2JEGA 4H9MA 2IMRA 3TQ1A 4EYIB 1R9YA 2W9AA 1ONWA 5KFAA 1RJQA 5KFKA 2ATLA 2VA2A 2AU0A 1RA0A 1S10A 4O3SA 5KFPA 2UBPC 4AC7C 3GIIA 3KHRA 4UBPC 4ED2A 3GIJA 4ED6A 1FWAC 4CEXC 3BQ2A 3IN5A 3NGDA 5AKQA 3G6XA 4IRKA 3BQ1A 3G77A 4RUCA 2W9BA 2ASJA 4DL3A 4RDWA 1V4YA 1ONXA 4TQRA 3GIMA 1S97A 3BQ0A 4O3RA 2BB0A 4R85A 4DL7A 3FDSA 5DG9A 5L1LA 3GIKA 4J9RA 3MFIA 1RJRA 2DPJA 5KFCA 2G3FA 3GQCA 2C28A 3LSBA 1RK5A 2VHLA 4C5ZA 5DGBA 1FWIC 1YMYA 4IR9A 4RNMA 2RDIA 1R9ZA 5KFMA 1RYRA 4YR0A 4EPEC 2GSEA 1ZETA 3OOQA 4C60A 2JEFA 2XGPA 3IGHX 4ED1A 1K1QA 2AQOA 4R88A 3D6NA 4NLGA 1XRTA 2J6UA 4JV1A 3T5KA 4ED7A 2AGQA 1FWGC 4DL6A 4ECQA 2OH2A 2GOKA 5KT2A 3V6HA 2C2EA 1POJA 3KHLA 3GIQA 4EBDA 4G7EA 4ECSA 2IA6A 4DEZA 1KRCC 4J9LA 2GWNA 2J6TA 4JV0A 5KT3A 2AQ4A 2AGOA 3IV8A 4QWDA 3GRIA 4QWAA 1EJTC 4ECTA 4AQLA 1V51A 1S3TC 2J6SA 2BQUA 1N56A 1KCXA 4V1YA 2BQ3A 4F0LA 1T3NA 1A5MC 3MR2A 3GV8B 4IRDA 3FEQA 5EDWA 4JV2A 5KG5A 2DPIA 2IMWP 5KFNA 3RBDA 1FWEC 1JIHA 5KFJA 4DYKA 1A5OC 3ICJA 3RB0A 1K6WA 3QGKC 4CQCA 3UBPC 4B3ZA 5F9NA 3E0LA 4CQDA 2W9BB 4WGXA 3M9MB 4Q43A 2R8GA 3T5LA 4RZRA 3OSNA 5KFFA 3T8LA 4YR3A 3SI8A 2JEJA 1YBQA 4EPDC 4BKNA 4O3PA 3KHGA 2C22A 5EWEA 4ECRA 1EJSC 5KFUA 1E9YB 4DL5A 4J9NA 5KFWA 5L1JA 3RB3A 1T94A 3HM7A 5DGAA 2XGQA 3H40A 4M51A 2UVUA 4LH8A 2KAUC 3O7UA 5DQHA 4RNOA 2IBKA 3MR6A 3BJYA 2R8KA 1GKPA 5KFTA 1RA5A 5KFQA 4J9KA 1RAKA 2FLPA 2UVWA 4WHBA 1YNYA 4O3QA 3T81A 3PW0A 4FBTA 5A6TC 3MFHA 3GV5B 1N48A 5DLGA 5DG8A 5HMFA 5HMEA 4ECXA 2V9WA 2W8KA 4QW9A 1K70A 4DL4A 4O3NA 4YIWA 4F4YA 3GGMA 2C2DA 4ED8A 4RZBA 3MTWA 5KFSA 3G6VA 3LSCA 5LXXA 2P53A 2ICSA 4U7CA 4EYHB 5T14A 2ASDA 2C2RA 5KFIA 1IM4A 2W9CB 4U6PA 2FLNA 4J9SA 1XRFA 2FTYA 1EJUC 4RU9A 2QT3A 4F4WA 5KFEA 3DUGA 4EEYA 3GIPA 5DG7A 4CEUC 4J9OA 3V6JA 1S0OA 5KG4A 1IE7C 2UVVA 2RDJA 5L1KA 5KG1A 3PW4A 4ED0A
chains in the Genus database with same CATH topology
3G77A 1YRRA 3T8LA 3NQBA 4Z42C 1YBQA 4EPDC 4BKNA 2OOFA 2PAJA 4G7EB 3E74A 4RDWA 4F0SA 1V4YA 1ONXA 2Q09A 1O12A 1EJSC 2BB0A 4R85A 4GOAA 1E9YB 5FSEC 1FWFC 1UBPC 1P1MA 4KIRA 1RK6A 4EPBC 1RJRA 3MDUA 2G3FA 1K1DA 5G4HC 1A5KC 3LSBA 3HM7A 4L9XA 1RK5A 4R7WA 2VHLA 4C5ZA 4M51A 1R9XA 1FWBC 1FWIC 1YMYA 2KAUC 1PO9A 3O7UA 4LH8A 4CNTA 2Z00A 1R9ZA 2AQVA 4V1XA 3QGAC 1A5NC 1FWDC 4EPEC 2GSEA 4DZHA 1RJPA 3MPGA 2I9UA 3OOQA 4C60A 1EJVC 1GKPA 3IGHX 3RN6A 4C65A 2AQOA 4R88A 3D6NA 1XRTA 3LA4A 4F0RA 1RA5A 1FWGC 2P9BA 1RAKA 2GOKA 1A5LC 1FWCC 2PUZA 4BJHA 2PLMA 1FWHC 1POJA 2OODA 3GIQA 4G7EA 1KRCC 4WHBA 4RDVA 1J6PA 3LS9A 4UB9A 1YNYA 4GY7A 3T81A 1KRAC 2GWNA 3N2CA 1FWJC 5A6TC 3SFWA 1EJXC 3IV8A 3V7PA 3GRIA 2QS8A 3MDWA 3R0DA 4C5YA 1E9ZB 1POKA 1EJTC 1EJRC 5HMFA 5HMEA 4AQLA 3MKVA 1V51A 1S3TC 5HMDA 1NFGA 4CQBA 2VUNA 1K70A 1EF2A 1YBQB 1KCXA 4V1YA 2OGJA 4YIWA 4CNUA 4F0LA 3GGMA 1M7JA 1A5MC 4RZBA 4EP8C 3MTWA 5FSDC 1GKRA 3FEQA 3LSCA 3EGJA 4GBDA 1GKQA 2P53A 2UZ9A 5LXXA 4H9MA 2ICSA 1FWEC 2IMRA 2VM8A 1R9YA 2P50A 4KQNA 2FVKA 4DYKA 1A5OC 1EJWC 3ICJA 1ONWA 2FVMA 1K6WA 3BE7A 1RJQA 3QGKC 3UBPC 4CQCA 1RA0A 1XRFA 2FTYA 1EJUC 2QT3A 3DUGA 4B3ZA 4CNSA 2UBPC 3GIPA 3E0LA 4AC7C 4CEUC 4CQDA 4UBPC 4WGXA 3HPAA 1IE7C 1FWAC 3LNPA 4CEXC 1KRBC 5AKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G77 A;  1YRR A;  3T8L A;  3NQB A;  4Z42 C;  1YBQ A;  4EPD C;  4BKN A;  2OOF A;  2PAJ A;  4G7E B;  3E74 A;  4RDW A;  4F0S A;  1V4Y A;  1ONX A;  2Q09 A;  1O12 A;  1EJS C;  2BB0 A;  4R85 A;  4GOA A;  1E9Y B;  5FSE C;  1FWF C;  1UBP C;  1P1M A;  4KIR A;  1RK6 A;  4EPB C;  1RJR A;  3MDU A;  2G3F A;  1K1D A;  5G4H C;  1A5K C;  3LSB A;  3HM7 A;  4L9X A;  1RK5 A;  4R7W A;  2VHL A;  4C5Z A;  4M51 A;  1R9X A;  1FWB C;  1FWI C;  1YMY A;  2KAU C;  1PO9 A;  3O7U A;  4LH8 A;  4CNT A;  2Z00 A;  1R9Z A;  2AQV A;  4V1X A;  3QGA C;  1A5N C;  1FWD C;  4EPE C;  2GSE A;  4DZH A;  1RJP A;  3MPG A;  2I9U A;  3OOQ A;  4C60 A;  1EJV C;  1GKP A;  3IGH X;  3RN6 A;  4C65 A;  2AQO A;  4R88 A;  3D6N A;  1XRT A;  3LA4 A;  4F0R A;  1RA5 A;  1FWG C;  2P9B A;  1RAK A;  2GOK A;  1A5L C;  1FWC C;  2PUZ A;  4BJH A;  2PLM A;  1FWH C;  1POJ A;  2OOD A;  3GIQ A;  4G7E A;  1KRC C;  4WHB A;  4RDV A;  1J6P A;  3LS9 A;  4UB9 A;  1YNY A;  4GY7 A;  3T81 A;  1KRA C;  2GWN A;  3N2C A;  1FWJ C;  5A6T C;  3SFW A;  1EJX C;  3IV8 A;  3V7P A;  3GRI A;  2QS8 A;  3MDW A;  3R0D A;  4C5Y A;  1E9Z B;  1POK A;  1EJT C;  1EJR C;  5HMF A;  5HME A;  4AQL A;  3MKV A;  1V51 A;  1S3T C;  5HMD A;  1NFG A;  4CQB A;  2VUN A;  1K70 A;  1EF2 A;  1YBQ B;  1KCX A;  4V1Y A;  2OGJ A;  4YIW A;  4CNU A;  4F0L A;  3GGM A;  1M7J A;  1A5M C;  4RZB A;  4EP8 C;  3MTW A;  5FSD C;  1GKR A;  3FEQ A;  3LSC A;  3EGJ A;  4GBD A;  1GKQ A;  2P53 A;  2UZ9 A;  5LXX A;  4H9M A;  2ICS A;  1FWE C;  2IMR A;  2VM8 A;  1R9Y A;  2P50 A;  4KQN A;  2FVK A;  4DYK A;  1A5O C;  1EJW C;  3ICJ A;  1ONW A;  2FVM A;  1K6W A;  3BE7 A;  1RJQ A;  3QGK C;  3UBP C;  4CQC A;  1RA0 A;  1XRF A;  2FTY A;  1EJU C;  2QT3 A;  3DUG A;  4B3Z A;  4CNS A;  2UBP C;  3GIP A;  3E0L A;  4AC7 C;  4CEU C;  4CQD A;  4UBP C;  4WGX A;  3HPA A;  1IE7 C;  1FWA C;  3LNP A;  4CEX C;  1KRB C;  5AKQ A; 
#chains in the Genus database with same CATH topology
 1YRR A;  3OSP A;  1S0N A;  4QW8 A;  4Z42 C;  4R8U A;  2OOF A;  4Q44 A;  5F9L A;  4ECW A;  4G7E B;  5KFV A;  1K1S A;  2Q09 A;  4IRC A;  3Q8P B;  4HYK A;  1UBP C;  4QWC A;  3MR3 A;  4ECZ A;  4EPB C;  2ALZ A;  2R8I A;  3GIL A;  1K1D A;  4O3O A;  1A5K C;  5KFR A;  5KT6 A;  2R8H A;  5KFO A;  4R7W A;  3EPI A;  1FWB C;  1PO9 A;  4CNT A;  2Z00 A;  5L1I A;  4V1X A;  4Q8E A;  3M9N B;  3QGA C;  2BR0 A;  1A5N C;  4J9P A;  3PW2 A;  3MPG A;  3PR5 B;  3PW7 A;  3RN6 A;  4F4Z A;  3EPG A;  3LA4 A;  4F0R A;  2P9B A;  5KFB A;  3QZ8 A;  1A5L C;  1FWC C;  4FS1 A;  4BJH A;  4EBE A;  1FWH C;  2XCA A;  5DQI A;  3RB4 A;  2XC9 A;  2W9C A;  4RDV A;  1J6P A;  5KFX A;  4GY7 A;  1KRA C;  3Q8R B;  4J9M A;  3N2C A;  4FBU A;  3G6Y A;  1FWJ C;  2W7P A;  3V6K A;  2JEI A;  3SFW A;  1S0M A;  3V7P A;  2QS8 A;  4C5Y A;  1E9Z B;  3OHA A;  4ECV A;  3MKV A;  4JUZ A;  1NFG A;  2VUN A;  1YBQ B;  1EF2 A;  5KFL A;  4R8U B;  5KFG A;  2V4Q A;  2OGJ A;  4CNU A;  4G3I A;  3PR4 A;  5FSD C;  1GKR A;  4YQW A;  4RUA A;  3M9O B;  2VM8 A;  4KQN A;  2P50 A;  2FVK A;  1S9F A;  4ED3 A;  1EJW C;  5EWF A;  3GV7 B;  4F4X A;  2FVM A;  3BE7 A;  5KFD A;  4CNS A;  2V4R A;  5DQG A;  3RBE A;  3H4B A;  5KFZ A;  5KG7 A;  5EWG A;  3HPA A;  4J9Q A;  3RAQ A;  3Q8Q B;  4DL2 A;  5KFY A;  3LNP A;  1KRB C;  1RYS A;  2R8J A;  3QZ7 A;  3NQB A;  5KG2 A;  4YR2 A;  5C5J A;  4ECY A;  3Q8S B;  2PAJ A;  3E74 A;  4Q8F A;  4F0S A;  1O12 A;  4TQS A;  2FLL A;  3T5J A;  4GOA A;  2UVR A;  5FSE C;  1FWF C;  1P1M A;  4KIR A;  1RK6 A;  3MDU A;  5JUM A;  5G4H C;  2WTF A;  4RNN A;  4L9X A;  1R9X A;  3PZP A;  2AQV A;  3MR5 A;  1FWD C;  4QWB A;  4DZH A;  2W7O A;  1RJP A;  2I9U A;  1EJV C;  4C65 A;  1JXL A;  3PVX A;  1JX4 A;  4IR1 A;  2PUZ A;  2PLM A;  2OOD A;  4GC6 A;  4ECU A;  4FS2 A;  4EBC A;  3LS9 A;  4UB9 A;  4Q45 A;  5KG3 A;  5L9X A;  3RB6 A;  2ASL A;  3PW5 A;  4YP3 A;  2W8L A;  3T5H A;  4GC7 A;  1EJX C;  5KG6 A;  5KT5 A;  5KG0 A;  3MDW A;  3R0D A;  5DLF A;  1POK A;  1EJR C;  4F50 A;  3RAX A;  3OHB A;  5KFH A;  5HMD A;  4CQB A;  2BQR A;  4QWE A;  2XCP A;  3H4D A;  5KT4 A;  2VA3 A;  1M7J A;  4EP8 C;  2AGP A;  5KT7 A;  3KHH A;  3EGJ A;  4GBD A;  1GKQ A;  2UZ9 A;  2JEG A;  4H9M A;  2IMR A;  3TQ1 A;  4EYI B;  1R9Y A;  2W9A A;  1ONW A;  5KFA A;  1RJQ A;  5KFK A;  2ATL A;  2VA2 A;  2AU0 A;  1RA0 A;  1S10 A;  4O3S A;  5KFP A;  2UBP C;  4AC7 C;  3GII A;  3KHR A;  4UBP C;  4ED2 A;  3GIJ A;  4ED6 A;  1FWA C;  4CEX C;  3BQ2 A;  3IN5 A;  3NGD A;  5AKQ A;  3G6X A;  4IRK A;  3BQ1 A;  3G77 A;  4RUC A;  2W9B A;  2ASJ A;  4DL3 A;  4RDW A;  1V4Y A;  1ONX A;  4TQR A;  3GIM A;  1S97 A;  3BQ0 A;  4O3R A;  2BB0 A;  4R85 A;  4DL7 A;  3FDS A;  5DG9 A;  5L1L A;  3GIK A;  4J9R A;  3MFI A;  1RJR A;  2DPJ A;  5KFC A;  2G3F A;  3GQC A;  2C28 A;  3LSB A;  1RK5 A;  2VHL A;  4C5Z A;  5DGB A;  1FWI C;  1YMY A;  4IR9 A;  4RNM A;  2RDI A;  1R9Z A;  5KFM A;  1RYR A;  4YR0 A;  4EPE C;  2GSE A;  1ZET A;  3OOQ A;  4C60 A;  2JEF A;  2XGP A;  3IGH X;  4ED1 A;  1K1Q A;  2AQO A;  4R88 A;  3D6N A;  4NLG A;  1XRT A;  2J6U A;  4JV1 A;  3T5K A;  4ED7 A;  2AGQ A;  1FWG C;  4DL6 A;  4ECQ A;  2OH2 A;  2GOK A;  5KT2 A;  3V6H A;  2C2E A;  1POJ A;  3KHL A;  3GIQ A;  4EBD A;  4G7E A;  4ECS A;  2IA6 A;  4DEZ A;  1KRC C;  4J9L A;  2GWN A;  2J6T A;  4JV0 A;  5KT3 A;  2AQ4 A;  2AGO A;  3IV8 A;  4QWD A;  3GRI A;  4QWA A;  1EJT C;  4ECT A;  4AQL A;  1V51 A;  1S3T C;  2J6S A;  2BQU A;  1N56 A;  1KCX A;  4V1Y A;  2BQ3 A;  4F0L A;  1T3N A;  1A5M C;  3MR2 A;  3GV8 B;  4IRD A;  3FEQ A;  5EDW A;  4JV2 A;  5KG5 A;  2DPI A;  2IMW P;  5KFN A;  3RBD A;  1FWE C;  1JIH A;  5KFJ A;  4DYK A;  1A5O C;  3ICJ A;  3RB0 A;  1K6W A;  3QGK C;  4CQC A;  3UBP C;  4B3Z A;  5F9N A;  3E0L A;  4CQD A;  2W9B B;  4WGX A;  3M9M B;  4Q43 A;  2R8G A;  3T5L A;  4RZR A;  3OSN A;  5KFF A;  3T8L A;  4YR3 A;  3SI8 A;  2JEJ A;  1YBQ A;  4EPD C;  4BKN A;  4O3P A;  3KHG A;  2C22 A;  5EWE A;  4ECR A;  1EJS C;  5KFU A;  1E9Y B;  4DL5 A;  4J9N A;  5KFW A;  5L1J A;  3RB3 A;  1T94 A;  3HM7 A;  5DGA A;  2XGQ A;  3H40 A;  4M51 A;  2UVU A;  4LH8 A;  2KAU C;  3O7U A;  5DQH A;  4RNO A;  2IBK A;  3MR6 A;  3BJY A;  2R8K A;  1GKP A;  5KFT A;  1RA5 A;  5KFQ A;  4J9K A;  1RAK A;  2FLP A;  2UVW A;  4WHB A;  1YNY A;  4O3Q A;  3T81 A;  3PW0 A;  4FBT A;  5A6T C;  3MFH A;  3GV5 B;  1N48 A;  5DLG A;  5DG8 A;  5HMF A;  5HME A;  4ECX A;  2V9W A;  2W8K A;  4QW9 A;  1K70 A;  4DL4 A;  4O3N A;  4YIW A;  4F4Y A;  3GGM A;  2C2D A;  4ED8 A;  4RZB A;  3MTW A;  5KFS A;  3G6V A;  3LSC A;  5LXX A;  2P53 A;  2ICS A;  4U7C A;  4EYH B;  5T14 A;  2ASD A;  2C2R A;  5KFI A;  1IM4 A;  2W9C B;  4U6P A;  2FLN A;  4J9S A;  1XRF A;  2FTY A;  1EJU C;  4RU9 A;  2QT3 A;  4F4W A;  5KFE A;  3DUG A;  4EEY A;  3GIP A;  5DG7 A;  4CEU C;  4J9O A;  3V6J A;  1S0O A;  5KG4 A;  1IE7 C;  2UVV A;  2RDJ A;  5L1K A;  5KG1 A;  3PW4 A;  4ED0 A; 
#chains in the Genus database with same CATH homology
 3G77 A;  1YRR A;  3T8L A;  3NQB A;  4Z42 C;  1YBQ A;  4EPD C;  4BKN A;  2OOF A;  2PAJ A;  4G7E B;  3E74 A;  4RDW A;  4F0S A;  1V4Y A;  1ONX A;  2Q09 A;  1O12 A;  1EJS C;  2BB0 A;  4R85 A;  4GOA A;  1E9Y B;  5FSE C;  1FWF C;  1UBP C;  1P1M A;  4KIR A;  1RK6 A;  4EPB C;  1RJR A;  3MDU A;  2G3F A;  1K1D A;  5G4H C;  1A5K C;  3LSB A;  3HM7 A;  4L9X A;  1RK5 A;  4R7W A;  2VHL A;  4C5Z A;  4M51 A;  1R9X A;  1FWB C;  1FWI C;  1YMY A;  2KAU C;  1PO9 A;  3O7U A;  4LH8 A;  4CNT A;  2Z00 A;  1R9Z A;  2AQV A;  4V1X A;  3QGA C;  1A5N C;  1FWD C;  4EPE C;  2GSE A;  4DZH A;  1RJP A;  3MPG A;  2I9U A;  3OOQ A;  4C60 A;  1EJV C;  1GKP A;  3IGH X;  3RN6 A;  4C65 A;  2AQO A;  4R88 A;  3D6N A;  1XRT A;  3LA4 A;  4F0R A;  1RA5 A;  1FWG C;  2P9B A;  1RAK A;  2GOK A;  1A5L C;  1FWC C;  2PUZ A;  4BJH A;  2PLM A;  1FWH C;  1POJ A;  2OOD A;  3GIQ A;  4G7E A;  1KRC C;  4WHB A;  4RDV A;  1J6P A;  3LS9 A;  4UB9 A;  1YNY A;  4GY7 A;  3T81 A;  1KRA C;  2GWN A;  3N2C A;  1FWJ C;  5A6T C;  3SFW A;  1EJX C;  3IV8 A;  3V7P A;  3GRI A;  2QS8 A;  3MDW A;  3R0D A;  4C5Y A;  1E9Z B;  1POK A;  1EJT C;  1EJR C;  5HMF A;  5HME A;  4AQL A;  3MKV A;  1V51 A;  1S3T C;  5HMD A;  1NFG A;  4CQB A;  2VUN A;  1K70 A;  1EF2 A;  1YBQ B;  1KCX A;  4V1Y A;  2OGJ A;  4YIW A;  4CNU A;  4F0L A;  3GGM A;  1M7J A;  1A5M C;  4RZB A;  4EP8 C;  3MTW A;  5FSD C;  1GKR A;  3FEQ A;  3LSC A;  3EGJ A;  4GBD A;  1GKQ A;  2P53 A;  2UZ9 A;  5LXX A;  4H9M A;  2ICS A;  1FWE C;  2IMR A;  2VM8 A;  1R9Y A;  2P50 A;  4KQN A;  2FVK A;  4DYK A;  1A5O C;  1EJW C;  3ICJ A;  1ONW A;  2FVM A;  1K6W A;  3BE7 A;  1RJQ A;  3QGK C;  3UBP C;  4CQC A;  1RA0 A;  1XRF A;  2FTY A;  1EJU C;  2QT3 A;  3DUG A;  4B3Z A;  4CNS A;  2UBP C;  3GIP A;  3E0L A;  4AC7 C;  4CEU C;  4CQD A;  4UBP C;  4WGX A;  3HPA A;  1IE7 C;  1FWA C;  3LNP A;  4CEX C;  1KRB C;  5AKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...