3GGMA

Crystal structure of bt9727_2919 from bacillus thuringiensis subsp. northeast structural genomics target bur228b
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
75
structure length
75
Chain Sequence
b'MNVPDMILYNGKITTLDPSQPEVSAIAITDGLITAVGGDELLNSATEKTKKIDLKRKRAIPGLNDSHIHVIRGLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein BT9727_2919
publication title Crystal Structure of BT9727_2919 from Bacillus thuringiensis subsp. Northeast Structural Genomics Target BuR228B
rcsb
source organism Bacillus thuringiensis serovar konkukian
molecule tags Structural genomics, unknown function
total genus 9
structure length 75
sequence length 75
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 3ggmA00
1S3TC 3LNPA 3E74A 1FWJC 1FWHC 1EJUC 1RA0A 3GIQA 2GOKA 3R0DA 4CEXC 4R88A 1YNYA 2I9UA 1O12A 3IV8A 4EP8C 2VM8A 3E0LA 4V1XA 1K1DA 1XRFA 2AQVA 3GRIA 1R9ZA 4DZHA 1EJRC 1POJA 3EGJA 2P50A 4CQBA 5FSDC 5FSEC 1YBQB 1FWEC 1FWIC 4UBPC 4C5YA 4DYKA 4WHBA 4GBDA 4V1YA 4CQDA 1A5MC 4C5ZA 2OODA 2VUNA 3GIPA 1XRTA 2GSEA 3O7UA 4WGXA 4CNSA 3T81A 3DUGA 4M51A 3BE7A 3G77A 2QS8A 3LA4A 3MDWA 5AKQA 2FVMA 2OOFA 1POKA 1KRCC 4BJHA 1P1MA 1E9ZB 1UBPC 4GOAA 3GGMA 3LSCA 5HMDA 1RJQA 1YBQA 2VHLA 1RJPA 3QGAC 1R9YA 4Z42C 1KRBC 1GKRA 4YIWA 5HMFA 3OOQA 4KQNA 2G3FA 1R9XA 3T8LA 1K70A 1EJWC 3LS9A 3QGKC 4KIRA 2PUZA 5A6TC 4C65A 4LH8A 2QT3A 4AQLA 2P53A 1J6PA 4F0SA 4R85A 4EPEC 1A5OC 2ICSA 2P9BA 4F0LA 4B3ZA 3NQBA 1ONXA 1A5KC 1EF2A 1GKPA 1IE7C 3LSBA 3ICJA 2GWNA 1KRAC 3MDUA 3RN6A 2PAJA 4RDVA 4CQCA 4RZBA 3MTWA 1FWGC 1NFGA 1EJSC 3MKVA 2PLMA 1RK5A 1FWFC 1PO9A 4BKNA 4GY7A 4CNTA 4CEUC 1YRRA 4L9XA 4F0RA 1V4YA 2UZ9A 4G7EB 1FWDC 2KAUC 3V7PA 3HPAA 4UB9A 4EPBC 5LXXA 1E9YB 1FWBC 1KCXA 1RAKA 4H9MA 3MPGA 1EJVC 2UBPC 3IGHX 3D6NA 3SFWA 2IMRA 2OGJA 3HM7A 1EJXC 1FWAC 1RA5A 4C60A 1ONWA 5HMEA 3UBPC 1V51A 2FTYA 4AC7C 1A5NC 2Z00A 1GKQA 1M7JA 1EJTC 4CNUA 1FWCC 2BB0A 4EPDC 5G4HC 1A5LC 1YMYA 2FVKA 1RK6A 2Q09A 1K6WA 3FEQA 4R7WA 3N2CA 1RJRA 2AQOA 4RDWA 4G7EA
chains in the Genus database with same CATH superfamily
3H4BA 3E74A 3RB6A 1FWJC 1FWHC 2GOKA 2R8HA 4YR0A 3IV8A 4EP8C 2BQRA 4V1XA 5EWEA 3M9OB 2P50A 4CQBA 4YR2A 3RBEA 4ECYA 3BQ1A 1T94A 1S0OA 3O7UA 4CNSA 5KFYA 5L1KA 2RDIA 3G77A 3OHAA 3KHHA 1RYSA 2W7OA 3GILA 1UBPC 4RNOA 4GOAA 3LSCA 3MFHA 5KG5A 2VHLA 3MR3A 4Z42C 1KRBC 5KFWA 2ASLA 4O3PA 4Q43A 4RNMA 3GIIA 4ECWA 3LS9A 3QGKC 3OSNA 2PUZA 4LH8A 4F0SA 1J6PA 4J9PA 2P9BA 4F0LA 5L1LA 3H4DA 4EYIB 4IR1A 5KFNA 3RAXA 5KG3A 5L9XA 5KT7A 5KG6A 4TQSA 4CQCA 5KFXA 4ECUA 1EJSC 5KFEA 2PLMA 1RK5A 1FWFC 2WTFA 5EWFA 3MR6A 1T3NA 1PO9A 4BKNA 4GY7A 4CNTA 2W9BA 2VA2A 3PW2A 4F4ZA 3SI8A 4J9NA 2BQ3A 4Q8FA 3QZ8A 5LXXA 1KCXA 4YR3A 1RAKA 3MPGA 2UBPC 3IGHX 3SFWA 1FWAC 5KG0A 1ONWA 4ECRA 1K1QA 5DQIA 4O3RA 2AQ4A 4EBCA 4GC6A 1M7JA 1EJTC 4CNUA 1FWCC 5DG7A 3FDSA 5KFQA 2IA6A 1YMYA 4R7WA 4QW9A 3N2CA 2AQOA 3RAQA 3LNPA 1EJUC 4R88A 2BR0A 4R8UB 1ZETA 3T5HA 1O12A 2XCAA 5KFKA 5KFHA 4IR9A 5FSDC 5KFMA 3RBDA 4EEYA 2XCPA 4C5YA 3MR2A 3GIKA 4DYKA 4WHBA 5KFOA 4V1YA 1A5MC 3PW0A 2OODA 3GIPA 4QWDA 4DL5A 5DG9A 3GV5B 2W9CA 3IN5A 3BE7A 3LA4A 2QS8A 5KFVA 5AKQA 5KT4A 1POKA 3Q8SB 3H40A 5T14A 5HMDA 1RJQA 5DLGA 1YBQA 4G3IA 3QGAC 5KFAA 5HMFA 4ECSA 1JXLA 3OOQA 3GIJA 4DL2A 1R9XA 4U7CA 5F9LA 4AQLA 2P53A 5KG2A 4FS2A 4QW8A 4R85A 4O3NA 3PR5B 2FLLA 2XGQA 1A5KC 1EF2A 1GKPA 3LSBA 3G6YA 2C28A 1KRAC 4J9RA 3M9NB 4J9KA 3BQ2A 4RDVA 4RNNA 3MTWA 4J9QA 2IMWP 4EBEA 1NFGA 3PW4A 4ECZA 3MKVA 5DGBA 2AGPA 2DPJA 2OH2A 5DQGA 5JUMA 2R8JA 1V4YA 2ASDA 4G7EB 5DGAA 1FWDC 2R8GA 4EPBC 4UB9A 1K1SA 1FWBC 5KFIA 5DQHA 2W8KA 4H9MA 2C2RA 2IMRA 2JEGA 4QWBA 4DL4A 2J6UA 1V51A 2FTYA 1A5NC 3V6KA 2AU0A 2BB0A 4EPDC 3BQ0A 4EYHB 5EDWA 1RK6A 3FEQA 3QZ7A 1S3TC 3GIQA 3EPGA 3R0DA 3RB4A 4FBTA 1YNYA 4ED6A 2I9UA 4O3SA 2FLPA 4F50A 1S9FA 3E0LA 3G6VA 1K1DA 2C2DA 1XRFA 2BQUA 4NLGA 1R9ZA 4DZHA 1POJA 3EGJA 5KT2A 2AGOA 1FWEC 1FWIC 2AGQA 4UBPC 4O3QA 2J6TA 4C5ZA 2VUNA 5KFLA 4IRKA 1XRTA 4Q8EA 4WGXA 2XGPA 3T81A 4F4YA 2C2EA 4M51A 4IRDA 2OOFA 5KT3A 4BJHA 2V9WA 1P1MA 3GV8B 3GGMA 4RU9A 3V6HA 3G6XA 2RDJA 5C5JA 5KFDA 2IBKA 3PVXA 4DEZA 4YIWA 1JX4A 2G3FA 4F4XA 1JIHA 1K70A 1EJWC 4KIRA 5KFUA 5DLFA 4QWAA 5KFSA 3MR5A 2W9BB 4B3ZA 2ATLA 3T5KA 5KFPA 3BJYA 4DL7A 2J6SA 1ONXA 3TQ1A 1S10A 3ICJA 4TQRA 3OHBA 3MDUA 2R8KA 2UVUA 1S97A 1FWGC 1N56A 4FS1A 4ECXA 5KFTA 5KG4A 2V4QA 2R8IA 4CEUC 1YRRA 4JV1A 4L9XA 4F0RA 3GV7B 5KG1A 2JEIA 3MFIA 3V7PA 2W9AA 4ED3A 3KHGA 2C22A 4F4WA 4DL6A 2VA3A 4FBUA 2ASJA 1EJXC 1RA5A 4C60A 3PZPA 1S0MA 3UBPC 4Q45A 2ALZA 4ECTA 5DG8A 3PW5A 3T5LA 5G4HC 3KHLA 5F9NA 2Q09A 2FVKA 3NGDA 4GC7A 4J9OA 1RJRA 2W9CB 3M9MB 2XC9A 4HYKA 2W7PA 1RA0A 3GIMA 4RUAA 4CEXC 2UVVA 4JV0A 2JEJA 2VM8A 5KFRA 4RZRA 4IRCA 5KFCA 2AQVA 3GRIA 4ED8A 1EJRC 4QWEA 5KT5A 3V6JA 3RB0A 5FSEC 1YBQB 2DPIA 4YP3A 4GBDA 4CQDA 5EWGA 2GSEA 4U6PA 1RYRA 4JV2A 3OSPA 3DUGA 4ED1A 3MDWA 3RB3A 3PR4A 2FVMA 4R8UA 1KRCC 2V4RA 1E9ZB 1S0NA 5KFZA 4J9LA 4DL3A 5KFGA 1RJPA 3Q8RB 1R9YA 4ED7A 1GKRA 1IM4A 4KQNA 3KHRA 3T8LA 4RUCA 5KFBA 5A6TC 4C65A 2QT3A 4ECQA 3Q8QB 4EPEC 1A5OC 2ICSA 2JEFA 3PW7A 2W8LA 3NQBA 3Q8PB 1IE7C 4ED0A 2GWNA 5KFFA 3RN6A 2PAJA 4ECVA 4RZBA 3EPIA 4J9SA 2UVRA 2UVWA 2UZ9A 2KAUC 3HPAA 1E9YB 3T5JA 4Q44A 1EJVC 4YQWA 3D6NA 4O3OA 5KFJA 2OGJA 3HM7A 4EBDA 1N48A 5HMEA 4ED2A 2FLNA 4AC7C 5KG7A 2Z00A 1GKQA 5KT6A 1A5LC 4QWCA 4J9MA 3GQCA 1K6WA 4JUZA 5L1IA 5L1JA 4RDWA 4G7EA
chains in the Genus database with same CATH topology
1S3TC 3LNPA 3E74A 1FWJC 1FWHC 1EJUC 1RA0A 3GIQA 2GOKA 3R0DA 4CEXC 4R88A 1YNYA 2I9UA 1O12A 3IV8A 4EP8C 2VM8A 3E0LA 4V1XA 1K1DA 1XRFA 2AQVA 3GRIA 1R9ZA 4DZHA 1EJRC 1POJA 3EGJA 2P50A 4CQBA 5FSDC 5FSEC 1YBQB 1FWEC 1FWIC 4UBPC 4C5YA 4DYKA 4WHBA 4GBDA 4V1YA 4CQDA 1A5MC 4C5ZA 2OODA 2VUNA 3GIPA 1XRTA 2GSEA 3O7UA 4WGXA 4CNSA 3T81A 3DUGA 4M51A 3BE7A 3G77A 2QS8A 3LA4A 3MDWA 5AKQA 2FVMA 2OOFA 1POKA 1KRCC 4BJHA 1P1MA 1E9ZB 1UBPC 4GOAA 3GGMA 3LSCA 5HMDA 1RJQA 1YBQA 2VHLA 1RJPA 3QGAC 1R9YA 4Z42C 1KRBC 1GKRA 4YIWA 5HMFA 3OOQA 4KQNA 2G3FA 1R9XA 3T8LA 1K70A 1EJWC 3LS9A 3QGKC 4KIRA 2PUZA 5A6TC 4C65A 4LH8A 2QT3A 4AQLA 2P53A 1J6PA 4F0SA 4R85A 4EPEC 1A5OC 2ICSA 2P9BA 4F0LA 4B3ZA 3NQBA 1ONXA 1A5KC 1EF2A 1GKPA 1IE7C 3LSBA 3ICJA 2GWNA 1KRAC 3MDUA 3RN6A 2PAJA 4RDVA 4CQCA 4RZBA 3MTWA 1FWGC 1NFGA 1EJSC 3MKVA 2PLMA 1RK5A 1FWFC 1PO9A 4BKNA 4GY7A 4CNTA 4CEUC 1YRRA 4L9XA 4F0RA 1V4YA 2UZ9A 4G7EB 1FWDC 2KAUC 3V7PA 3HPAA 4UB9A 4EPBC 5LXXA 1E9YB 1FWBC 1KCXA 1RAKA 4H9MA 3MPGA 1EJVC 2UBPC 3IGHX 3D6NA 3SFWA 2IMRA 2OGJA 3HM7A 1EJXC 1FWAC 1RA5A 4C60A 1ONWA 5HMEA 3UBPC 1V51A 2FTYA 4AC7C 1A5NC 2Z00A 1GKQA 1M7JA 1EJTC 4CNUA 1FWCC 2BB0A 4EPDC 5G4HC 1A5LC 1YMYA 2FVKA 1RK6A 2Q09A 1K6WA 3FEQA 4R7WA 3N2CA 1RJRA 2AQOA 4RDWA 4G7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S3T C;  3LNP A;  3E74 A;  1FWJ C;  1FWH C;  1EJU C;  1RA0 A;  3GIQ A;  2GOK A;  3R0D A;  4CEX C;  4R88 A;  1YNY A;  2I9U A;  1O12 A;  3IV8 A;  4EP8 C;  2VM8 A;  3E0L A;  4V1X A;  1K1D A;  1XRF A;  2AQV A;  3GRI A;  1R9Z A;  4DZH A;  1EJR C;  1POJ A;  3EGJ A;  2P50 A;  4CQB A;  5FSD C;  5FSE C;  1YBQ B;  1FWE C;  1FWI C;  4UBP C;  4C5Y A;  4DYK A;  4WHB A;  4GBD A;  4V1Y A;  4CQD A;  1A5M C;  4C5Z A;  2OOD A;  2VUN A;  3GIP A;  1XRT A;  2GSE A;  3O7U A;  4WGX A;  4CNS A;  3T81 A;  3DUG A;  4M51 A;  3BE7 A;  3G77 A;  2QS8 A;  3LA4 A;  3MDW A;  5AKQ A;  2FVM A;  2OOF A;  1POK A;  1KRC C;  4BJH A;  1P1M A;  1E9Z B;  1UBP C;  4GOA A;  3GGM A;  3LSC A;  5HMD A;  1RJQ A;  1YBQ A;  2VHL A;  1RJP A;  3QGA C;  1R9Y A;  4Z42 C;  1KRB C;  1GKR A;  4YIW A;  5HMF A;  3OOQ A;  4KQN A;  2G3F A;  1R9X A;  3T8L A;  1K70 A;  1EJW C;  3LS9 A;  3QGK C;  4KIR A;  2PUZ A;  5A6T C;  4C65 A;  4LH8 A;  2QT3 A;  4AQL A;  2P53 A;  1J6P A;  4F0S A;  4R85 A;  4EPE C;  1A5O C;  2ICS A;  2P9B A;  4F0L A;  4B3Z A;  3NQB A;  1ONX A;  1A5K C;  1EF2 A;  1GKP A;  1IE7 C;  3LSB A;  3ICJ A;  2GWN A;  1KRA C;  3MDU A;  3RN6 A;  2PAJ A;  4RDV A;  4CQC A;  4RZB A;  3MTW A;  1FWG C;  1NFG A;  1EJS C;  3MKV A;  2PLM A;  1RK5 A;  1FWF C;  1PO9 A;  4BKN A;  4GY7 A;  4CNT A;  4CEU C;  1YRR A;  4L9X A;  4F0R A;  1V4Y A;  2UZ9 A;  4G7E B;  1FWD C;  2KAU C;  3V7P A;  3HPA A;  4UB9 A;  4EPB C;  5LXX A;  1E9Y B;  1FWB C;  1KCX A;  1RAK A;  4H9M A;  3MPG A;  1EJV C;  2UBP C;  3IGH X;  3D6N A;  3SFW A;  2IMR A;  2OGJ A;  3HM7 A;  1EJX C;  1FWA C;  1RA5 A;  4C60 A;  1ONW A;  5HME A;  3UBP C;  1V51 A;  2FTY A;  4AC7 C;  1A5N C;  2Z00 A;  1GKQ A;  1M7J A;  1EJT C;  4CNU A;  1FWC C;  2BB0 A;  4EPD C;  5G4H C;  1A5L C;  1YMY A;  2FVK A;  1RK6 A;  2Q09 A;  1K6W A;  3FEQ A;  4R7W A;  3N2C A;  1RJR A;  2AQO A;  4RDW A;  4G7E A; 
#chains in the Genus database with same CATH topology
 3H4B A;  3E74 A;  3RB6 A;  1FWJ C;  1FWH C;  2GOK A;  2R8H A;  4YR0 A;  3IV8 A;  4EP8 C;  2BQR A;  4V1X A;  5EWE A;  3M9O B;  2P50 A;  4CQB A;  4YR2 A;  3RBE A;  4ECY A;  3BQ1 A;  1T94 A;  1S0O A;  3O7U A;  4CNS A;  5KFY A;  5L1K A;  2RDI A;  3G77 A;  3OHA A;  3KHH A;  1RYS A;  2W7O A;  3GIL A;  1UBP C;  4RNO A;  4GOA A;  3LSC A;  3MFH A;  5KG5 A;  2VHL A;  3MR3 A;  4Z42 C;  1KRB C;  5KFW A;  2ASL A;  4O3P A;  4Q43 A;  4RNM A;  3GII A;  4ECW A;  3LS9 A;  3QGK C;  3OSN A;  2PUZ A;  4LH8 A;  4F0S A;  1J6P A;  4J9P A;  2P9B A;  4F0L A;  5L1L A;  3H4D A;  4EYI B;  4IR1 A;  5KFN A;  3RAX A;  5KG3 A;  5L9X A;  5KT7 A;  5KG6 A;  4TQS A;  4CQC A;  5KFX A;  4ECU A;  1EJS C;  5KFE A;  2PLM A;  1RK5 A;  1FWF C;  2WTF A;  5EWF A;  3MR6 A;  1T3N A;  1PO9 A;  4BKN A;  4GY7 A;  4CNT A;  2W9B A;  2VA2 A;  3PW2 A;  4F4Z A;  3SI8 A;  4J9N A;  2BQ3 A;  4Q8F A;  3QZ8 A;  5LXX A;  1KCX A;  4YR3 A;  1RAK A;  3MPG A;  2UBP C;  3IGH X;  3SFW A;  1FWA C;  5KG0 A;  1ONW A;  4ECR A;  1K1Q A;  5DQI A;  4O3R A;  2AQ4 A;  4EBC A;  4GC6 A;  1M7J A;  1EJT C;  4CNU A;  1FWC C;  5DG7 A;  3FDS A;  5KFQ A;  2IA6 A;  1YMY A;  4R7W A;  4QW9 A;  3N2C A;  2AQO A;  3RAQ A;  3LNP A;  1EJU C;  4R88 A;  2BR0 A;  4R8U B;  1ZET A;  3T5H A;  1O12 A;  2XCA A;  5KFK A;  5KFH A;  4IR9 A;  5FSD C;  5KFM A;  3RBD A;  4EEY A;  2XCP A;  4C5Y A;  3MR2 A;  3GIK A;  4DYK A;  4WHB A;  5KFO A;  4V1Y A;  1A5M C;  3PW0 A;  2OOD A;  3GIP A;  4QWD A;  4DL5 A;  5DG9 A;  3GV5 B;  2W9C A;  3IN5 A;  3BE7 A;  3LA4 A;  2QS8 A;  5KFV A;  5AKQ A;  5KT4 A;  1POK A;  3Q8S B;  3H40 A;  5T14 A;  5HMD A;  1RJQ A;  5DLG A;  1YBQ A;  4G3I A;  3QGA C;  5KFA A;  5HMF A;  4ECS A;  1JXL A;  3OOQ A;  3GIJ A;  4DL2 A;  1R9X A;  4U7C A;  5F9L A;  4AQL A;  2P53 A;  5KG2 A;  4FS2 A;  4QW8 A;  4R85 A;  4O3N A;  3PR5 B;  2FLL A;  2XGQ A;  1A5K C;  1EF2 A;  1GKP A;  3LSB A;  3G6Y A;  2C28 A;  1KRA C;  4J9R A;  3M9N B;  4J9K A;  3BQ2 A;  4RDV A;  4RNN A;  3MTW A;  4J9Q A;  2IMW P;  4EBE A;  1NFG A;  3PW4 A;  4ECZ A;  3MKV A;  5DGB A;  2AGP A;  2DPJ A;  2OH2 A;  5DQG A;  5JUM A;  2R8J A;  1V4Y A;  2ASD A;  4G7E B;  5DGA A;  1FWD C;  2R8G A;  4EPB C;  4UB9 A;  1K1S A;  1FWB C;  5KFI A;  5DQH A;  2W8K A;  4H9M A;  2C2R A;  2IMR A;  2JEG A;  4QWB A;  4DL4 A;  2J6U A;  1V51 A;  2FTY A;  1A5N C;  3V6K A;  2AU0 A;  2BB0 A;  4EPD C;  3BQ0 A;  4EYH B;  5EDW A;  1RK6 A;  3FEQ A;  3QZ7 A;  1S3T C;  3GIQ A;  3EPG A;  3R0D A;  3RB4 A;  4FBT A;  1YNY A;  4ED6 A;  2I9U A;  4O3S A;  2FLP A;  4F50 A;  1S9F A;  3E0L A;  3G6V A;  1K1D A;  2C2D A;  1XRF A;  2BQU A;  4NLG A;  1R9Z A;  4DZH A;  1POJ A;  3EGJ A;  5KT2 A;  2AGO A;  1FWE C;  1FWI C;  2AGQ A;  4UBP C;  4O3Q A;  2J6T A;  4C5Z A;  2VUN A;  5KFL A;  4IRK A;  1XRT A;  4Q8E A;  4WGX A;  2XGP A;  3T81 A;  4F4Y A;  2C2E A;  4M51 A;  4IRD A;  2OOF A;  5KT3 A;  4BJH A;  2V9W A;  1P1M A;  3GV8 B;  3GGM A;  4RU9 A;  3V6H A;  3G6X A;  2RDJ A;  5C5J A;  5KFD A;  2IBK A;  3PVX A;  4DEZ A;  4YIW A;  1JX4 A;  2G3F A;  4F4X A;  1JIH A;  1K70 A;  1EJW C;  4KIR A;  5KFU A;  5DLF A;  4QWA A;  5KFS A;  3MR5 A;  2W9B B;  4B3Z A;  2ATL A;  3T5K A;  5KFP A;  3BJY A;  4DL7 A;  2J6S A;  1ONX A;  3TQ1 A;  1S10 A;  3ICJ A;  4TQR A;  3OHB A;  3MDU A;  2R8K A;  2UVU A;  1S97 A;  1FWG C;  1N56 A;  4FS1 A;  4ECX A;  5KFT A;  5KG4 A;  2V4Q A;  2R8I A;  4CEU C;  1YRR A;  4JV1 A;  4L9X A;  4F0R A;  3GV7 B;  5KG1 A;  2JEI A;  3MFI A;  3V7P A;  2W9A A;  4ED3 A;  3KHG A;  2C22 A;  4F4W A;  4DL6 A;  2VA3 A;  4FBU A;  2ASJ A;  1EJX C;  1RA5 A;  4C60 A;  3PZP A;  1S0M A;  3UBP C;  4Q45 A;  2ALZ A;  4ECT A;  5DG8 A;  3PW5 A;  3T5L A;  5G4H C;  3KHL A;  5F9N A;  2Q09 A;  2FVK A;  3NGD A;  4GC7 A;  4J9O A;  1RJR A;  2W9C B;  3M9M B;  2XC9 A;  4HYK A;  2W7P A;  1RA0 A;  3GIM A;  4RUA A;  4CEX C;  2UVV A;  4JV0 A;  2JEJ A;  2VM8 A;  5KFR A;  4RZR A;  4IRC A;  5KFC A;  2AQV A;  3GRI A;  4ED8 A;  1EJR C;  4QWE A;  5KT5 A;  3V6J A;  3RB0 A;  5FSE C;  1YBQ B;  2DPI A;  4YP3 A;  4GBD A;  4CQD A;  5EWG A;  2GSE A;  4U6P A;  1RYR A;  4JV2 A;  3OSP A;  3DUG A;  4ED1 A;  3MDW A;  3RB3 A;  3PR4 A;  2FVM A;  4R8U A;  1KRC C;  2V4R A;  1E9Z B;  1S0N A;  5KFZ A;  4J9L A;  4DL3 A;  5KFG A;  1RJP A;  3Q8R B;  1R9Y A;  4ED7 A;  1GKR A;  1IM4 A;  4KQN A;  3KHR A;  3T8L A;  4RUC A;  5KFB A;  5A6T C;  4C65 A;  2QT3 A;  4ECQ A;  3Q8Q B;  4EPE C;  1A5O C;  2ICS A;  2JEF A;  3PW7 A;  2W8L A;  3NQB A;  3Q8P B;  1IE7 C;  4ED0 A;  2GWN A;  5KFF A;  3RN6 A;  2PAJ A;  4ECV A;  4RZB A;  3EPI A;  4J9S A;  2UVR A;  2UVW A;  2UZ9 A;  2KAU C;  3HPA A;  1E9Y B;  3T5J A;  4Q44 A;  1EJV C;  4YQW A;  3D6N A;  4O3O A;  5KFJ A;  2OGJ A;  3HM7 A;  4EBD A;  1N48 A;  5HME A;  4ED2 A;  2FLN A;  4AC7 C;  5KG7 A;  2Z00 A;  1GKQ A;  5KT6 A;  1A5L C;  4QWC A;  4J9M A;  3GQC A;  1K6W A;  4JUZ A;  5L1I A;  5L1J A;  4RDW A;  4G7E A; 
#chains in the Genus database with same CATH homology
 1S3T C;  3LNP A;  3E74 A;  1FWJ C;  1FWH C;  1EJU C;  1RA0 A;  3GIQ A;  2GOK A;  3R0D A;  4CEX C;  4R88 A;  1YNY A;  2I9U A;  1O12 A;  3IV8 A;  4EP8 C;  2VM8 A;  3E0L A;  4V1X A;  1K1D A;  1XRF A;  2AQV A;  3GRI A;  1R9Z A;  4DZH A;  1EJR C;  1POJ A;  3EGJ A;  2P50 A;  4CQB A;  5FSD C;  5FSE C;  1YBQ B;  1FWE C;  1FWI C;  4UBP C;  4C5Y A;  4DYK A;  4WHB A;  4GBD A;  4V1Y A;  4CQD A;  1A5M C;  4C5Z A;  2OOD A;  2VUN A;  3GIP A;  1XRT A;  2GSE A;  3O7U A;  4WGX A;  4CNS A;  3T81 A;  3DUG A;  4M51 A;  3BE7 A;  3G77 A;  2QS8 A;  3LA4 A;  3MDW A;  5AKQ A;  2FVM A;  2OOF A;  1POK A;  1KRC C;  4BJH A;  1P1M A;  1E9Z B;  1UBP C;  4GOA A;  3GGM A;  3LSC A;  5HMD A;  1RJQ A;  1YBQ A;  2VHL A;  1RJP A;  3QGA C;  1R9Y A;  4Z42 C;  1KRB C;  1GKR A;  4YIW A;  5HMF A;  3OOQ A;  4KQN A;  2G3F A;  1R9X A;  3T8L A;  1K70 A;  1EJW C;  3LS9 A;  3QGK C;  4KIR A;  2PUZ A;  5A6T C;  4C65 A;  4LH8 A;  2QT3 A;  4AQL A;  2P53 A;  1J6P A;  4F0S A;  4R85 A;  4EPE C;  1A5O C;  2ICS A;  2P9B A;  4F0L A;  4B3Z A;  3NQB A;  1ONX A;  1A5K C;  1EF2 A;  1GKP A;  1IE7 C;  3LSB A;  3ICJ A;  2GWN A;  1KRA C;  3MDU A;  3RN6 A;  2PAJ A;  4RDV A;  4CQC A;  4RZB A;  3MTW A;  1FWG C;  1NFG A;  1EJS C;  3MKV A;  2PLM A;  1RK5 A;  1FWF C;  1PO9 A;  4BKN A;  4GY7 A;  4CNT A;  4CEU C;  1YRR A;  4L9X A;  4F0R A;  1V4Y A;  2UZ9 A;  4G7E B;  1FWD C;  2KAU C;  3V7P A;  3HPA A;  4UB9 A;  4EPB C;  5LXX A;  1E9Y B;  1FWB C;  1KCX A;  1RAK A;  4H9M A;  3MPG A;  1EJV C;  2UBP C;  3IGH X;  3D6N A;  3SFW A;  2IMR A;  2OGJ A;  3HM7 A;  1EJX C;  1FWA C;  1RA5 A;  4C60 A;  1ONW A;  5HME A;  3UBP C;  1V51 A;  2FTY A;  4AC7 C;  1A5N C;  2Z00 A;  1GKQ A;  1M7J A;  1EJT C;  4CNU A;  1FWC C;  2BB0 A;  4EPD C;  5G4H C;  1A5L C;  1YMY A;  2FVK A;  1RK6 A;  2Q09 A;  1K6W A;  3FEQ A;  4R7W A;  3N2C A;  1RJR A;  2AQO A;  4RDW A;  4G7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...