3GGMA

Crystal structure of bt9727_2919 from bacillus thuringiensis subsp. northeast structural genomics target bur228b
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
75
structure length
75
Chain Sequence
MNVPDMILYNGKITTLDPSQPEVSAIAITDGLITAVGGDELLNSATEKTKKIDLKRKRAIPGLNDSHIHVIRGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein BT9727_2919
publication title Crystal Structure of BT9727_2919 from Bacillus thuringiensis subsp. Northeast Structural Genomics Target BuR228B
rcsb
source organism Bacillus thuringiensis serovar konkukian
total genus 9
structure length 75
sequence length 75
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 3ggmA00
4CNTA 1FWEC 1UBPC 1RA5A 3D6NA 4R7WA 1A5MC 1FWFC 3G77A 4GY7A 4C5ZA 5FSDC 3R0DA 3MDUA 4C60A 2UBPC 3T81A 1EJXC 2PUZA 3N2CA 4M51A 1POKA 1YNYA 4DZHA 1RAKA 1R9XA 2P53A 3QGKC 3T8LA 2PLMA 1P1MA 1FWHC 1YMYA 5G4HC 2P9BA 5AKQA 2ICSA 5FSEC 3LS9A 1A5KC 5A6TC 3IV8A 4UB9A 1IE7C 1FWIC 3DUGA 1ONWA 3E74A 3FEQA 3QGAC 1XRTA 4GOAA 4B3ZA 5HMDA 1M7JA 2Z00A 3ICJA 4EPEC 3O7UA 1KRCC 1EJWC 2QS8A 1FWGC 4EPBC 3V7PA 2FVMA 1YRRA 2FTYA 1KRBC 4CQDA 2P50A 3HM7A 2QT3A 4Z42C 1A5OC 4AC7C 2BB0A 3MPGA 4BJHA 4RDVA 3GGMA 3UBPC 4YIWA 4DYKA 1GKRA 1O12A 3IGHX 1A5NC 3GIPA 2OGJA 1EJSC 1FWBC 3E0LA 1GKPA 4RZBA 4RDWA 4CQBA 4F0SA 5HMEA 1J6PA 2I9UA 3HPAA 4V1XA 2AQOA 4R85A 1YBQA 3SFWA 4AQLA 1K1DA 1S3TC 4BKNA 3NQBA 2KAUC 3GIQA 1R9ZA 3LSCA 3GRIA 4R88A 1RK5A 5LXXA 2IMRA 3EGJA 4EP8C 1KRAC 1PO9A 4V1YA 1ONXA 2OOFA 1V51A 1EJTC 1NFGA 4L9XA 1EF2A 2GWNA 1YBQB 1A5LC 3LA4A 1FWDC 1R9YA 4C65A 1KCXA 1RK6A 1FWJC 3LSBA 2UZ9A 4GBDA 4G7EA 1EJRC 1RJQA 4WHBA 1E9YB 2GOKA 4CNUA 2VM8A 4H9MA 2VHLA 3RN6A 2Q09A 1FWCC 4WGXA 1GKQA 1XRFA 3BE7A 1K6WA 1K70A 3MKVA 4F0LA 4UBPC 4CEUC 3OOQA 2OODA 5HMFA 1EJUC 4KIRA 4CNSA 2FVKA 1RJPA 4G7EB 1FWAC 2PAJA 4CQCA 4KQNA 1E9ZB 1V4YA 4C5YA 4F0RA 2VUNA 2G3FA 3LNPA 1RA0A 3MDWA 1POJA 1RJRA 3MTWA 4LH8A 2GSEA 4EPDC 2AQVA 4CEXC 1EJVC
chains in the Genus database with same CATH superfamily
3RAQA 4R7WA 1A5MC 3G77A 5KG1A 4YP3A 4TQSA 3R0DA 4ECWA 3RBEA 2UBPC 4O3OA 4ECRA 3QGKC 4Q43A 2PLMA 1P1MA 4QWAA 4J9RA 5AKQA 5FSEC 5KFQA 5DG9A 2W9BA 5KFSA 3RB0A 4EBEA 1IE7C 3FEQA 3EPIA 1ONWA 4ED3A 2JEJA 3GIJA 5KT7A 3PR4A 1S97A 4ED2A 3O7UA 1KRCC 1N56A 1EJWC 4RUAA 2BQ3A 4R8UB 2QT3A 4Z42C 2XC9A 2JEIA 3GGMA 5F9NA 4RNNA 2R8HA 1T94A 3GIPA 2OGJA 3E0LA 3H40A 4RDWA 3T5JA 3GIKA 4F50A 4F0SA 4O3SA 5HMEA 2I9UA 5KFJA 4TQRA 4AQLA 1K1DA 1S3TC 4F4WA 2KAUC 3KHLA 5EWEA 5L1JA 2W7PA 4R88A 2ATLA 2DPIA 2UVRA 1ONXA 3Q8SB 2W9BB 1EJTC 5KFHA 4Q44A 1YBQB 4G3IA 2AGOA 4GBDA 2FLLA 2ASDA 4FBUA 2UZ9A 1E9YB 2V4RA 2C2DA 2R8JA 4CNUA 5KG7A 5KFOA 3RN6A 3RB6A 4U7CA 3H4DA 1XRFA 3PW7A 2BR0A 4F4ZA 4Q8FA 4F0LA 3RB3A 1EJUC 4DL2A 5KFMA 4CNSA 1S0NA 3PW0A 4IRKA 5L1KA 5DLGA 1FWAC 5F9LA 2R8IA 5KG2A 3GV5B 3G6XA 1POJA 1RJRA 3T5LA 2GSEA 4J9NA 4J9PA 3GV7B 1FWEC 5L1LA 2UVWA 2J6SA 3BQ0A 4GY7A 4RUCA 5FSDC 4DL3A 3MDUA 4ED6A 4QWCA 3T81A 4U6PA 4R8UA 1K1SA 4DL6A 4DZHA 1RAKA 4YR3A 2W9CB 1R9XA 5KG3A 5KFWA 5DQIA 4FS2A 1FWHC 3GV8B 2P9BA 3MR5A 1A5KC 2XGQA 4J9OA 4UB9A 4IR1A 1FWIC 3QGAC 4B3ZA 4DEZA 1XRTA 1S9FA 4RU9A 3ICJA 4F4YA 3MR2A 1FWGC 3V7PA 2FVMA 2FTYA 3HM7A 3MPGA 4RDVA 4YIWA 2R8KA 3OHAA 4DYKA 1GKRA 1O12A 4ECUA 5KFUA 1T3NA 1EJSC 1FWBC 4RZBA 2FLPA 4CQBA 3OSNA 4QW9A 4EYIB 1YBQA 3SFWA 4O3PA 4IRCA 3NQBA 2RDJA 3GIQA 3LSCA 2JEFA 5C5JA 4RNOA 4ECYA 3Q8QB 4GC7A 1KRAC 4L9XA 4JV2A 3KHRA 1EF2A 4EBDA 5KFNA 1N48A 3LA4A 2VA2A 2FLNA 4ECVA 1RJQA 5KFAA 5KFDA 2GOKA 5KFTA 5KFXA 4H9MA 4ED1A 5KFLA 3BJYA 1S0OA 1FWCC 3SI8A 1GKQA 3Q8PB 2BQUA 3H4BA 4O3RA 2C28A 3MR6A 5KFZA 5HMFA 4KIRA 4YR2A 1S10A 4CQCA 2VUNA 4J9QA 4F4XA 2G3FA 3LNPA 2BQRA 1RYRA 2W9CA 2W9AA 3RAXA 2V9WA 4NLGA 2ICSA 4BJHA 4CNTA 4YR0A 1FWFC 1S0MA 4C60A 3N2CA 4M51A 3PW4A 1YNYA 4ECTA 2C2RA 2W7OA 3GILA 2OH2A 5G4HC 3KHGA 3G6VA 3LS9A 3GIIA 3IV8A 3V6HA 3DUGA 3E74A 3KHHA 5EDWA 3OHBA 5HMDA 3RB4A 1M7JA 4J9SA 4ED7A 4EPBC 3QZ7A 1K1QA 1KRBC 2BB0A 3GQCA 3Q8RB 3M9OB 2RDIA 3IGHX 1A5NC 1GKPA 2IBKA 2W8KA 3HPAA 4V1XA 4R85A 4JUZA 5DG7A 2J6UA 4YQWA 1JIHA 5EWFA 5T14A 4Q45A 1RK5A 2XCAA 2IMRA 2IMWP 2AU0A 4ECZA 3FDSA 4V1YA 2OOFA 3RBDA 1V51A 2AQ4A 2GWNA 5DG8A 1FWDC 1R9YA 1RK6A 3LSBA 1FWJC 4O3QA 4QWBA 5DGAA 5DGBA 3OSPA 4WHBA 4IRDA 4ECSA 4DL4A 2VHLA 4JV0A 2UVVA 4WGXA 5KFPA 3BE7A 1K6WA 4JV1A 1K70A 3MKVA 2VA3A 4CEUC 3OOQA 4J9LA 4IR9A 3NGDA 2FVKA 4G7EB 1RYSA 5KG4A 2PAJA 5KT2A 2DPJA 1V4YA 4C5YA 5KFVA 1IM4A 3MDWA 5L9XA 4LH8A 4EPDC 3TQ1A 2AQVA 4ED0A 2UVUA 3M9MB 3PW2A 1UBPC 1RA5A 3D6NA 4C5ZA 1ZETA 3MFIA 2W8LA 3BQ1A 5KFIA 2IA6A 1EJXC 4QW8A 2PUZA 4QWDA 1POKA 5KFCA 2XCPA 5KFEA 2V4QA 4HYKA 2P53A 3T8LA 5DLFA 4GC6A 5L1IA 4ECQA 1YMYA 3MR3A 5KFGA 5A6TC 4GOAA 3V6KA 2Z00A 4EPEC 2QS8A 4J9MA 5JUMA 2J6TA 1YRRA 4CQDA 2P50A 3GIMA 1A5OC 4AC7C 2C22A 4EYHB 3PW5A 3UBPC 4EEYA 5KFYA 2WTFA 4ECXA 2ALZA 2XGPA 3MFHA 1J6PA 5DQGA 2AQOA 4DL5A 3T5KA 4DL7A 4BKNA 3V6JA 2ASJA 2C2EA 2ASLA 5KG0A 4Q8EA 1R9ZA 4FS1A 3GRIA 4J9KA 5LXXA 4RNMA 4FBTA 5KFFA 5KG5A 3EGJA 4EP8C 1JXLA 1PO9A 3T5HA 1NFGA 3PR5B 3PZPA 5KT5A 1A5LC 4C65A 1KCXA 4G7EA 4O3NA 1JX4A 1EJRC 2AGPA 2R8GA 2VM8A 5EWGA 2JEGA 2Q09A 4RZRA 3IN5A 3M9NB 3G6YA 3BQ2A 5KT6A 3QZ8A 4UBPC 2OODA 5KG6A 5KFBA 1RJPA 5KT4A 4KQNA 1E9ZB 5DQHA 3EPGA 4EBCA 4F0RA 3PVXA 1RA0A 2AGQA 5KFKA 5KT3A 4ED8A 3MTWA 4QWEA 5KFRA 4CEXC 1EJVC
chains in the Genus database with same CATH topology
4CNTA 1FWEC 1UBPC 1RA5A 3D6NA 4R7WA 1A5MC 1FWFC 3G77A 4GY7A 4C5ZA 5FSDC 3R0DA 3MDUA 4C60A 2UBPC 3T81A 1EJXC 2PUZA 3N2CA 4M51A 1POKA 1YNYA 4DZHA 1RAKA 1R9XA 2P53A 3QGKC 3T8LA 2PLMA 1P1MA 1FWHC 1YMYA 5G4HC 2P9BA 5AKQA 2ICSA 5FSEC 3LS9A 1A5KC 5A6TC 3IV8A 4UB9A 1IE7C 1FWIC 3DUGA 1ONWA 3E74A 3FEQA 3QGAC 1XRTA 4GOAA 4B3ZA 5HMDA 1M7JA 2Z00A 3ICJA 4EPEC 3O7UA 1KRCC 1EJWC 2QS8A 1FWGC 4EPBC 3V7PA 2FVMA 1YRRA 2FTYA 1KRBC 4CQDA 2P50A 3HM7A 2QT3A 4Z42C 1A5OC 4AC7C 2BB0A 3MPGA 4BJHA 4RDVA 3GGMA 3UBPC 4YIWA 4DYKA 1GKRA 1O12A 3IGHX 1A5NC 3GIPA 2OGJA 1EJSC 1FWBC 3E0LA 1GKPA 4RZBA 4RDWA 4CQBA 4F0SA 5HMEA 1J6PA 2I9UA 3HPAA 4V1XA 2AQOA 4R85A 1YBQA 3SFWA 4AQLA 1K1DA 1S3TC 4BKNA 3NQBA 2KAUC 3GIQA 1R9ZA 3LSCA 3GRIA 4R88A 1RK5A 5LXXA 2IMRA 3EGJA 4EP8C 1KRAC 1PO9A 4V1YA 1ONXA 2OOFA 1V51A 1EJTC 1NFGA 4L9XA 1EF2A 2GWNA 1YBQB 1A5LC 3LA4A 1FWDC 1R9YA 4C65A 1KCXA 1RK6A 1FWJC 3LSBA 2UZ9A 4GBDA 4G7EA 1EJRC 1RJQA 4WHBA 1E9YB 2GOKA 4CNUA 2VM8A 4H9MA 2VHLA 3RN6A 2Q09A 1FWCC 4WGXA 1GKQA 1XRFA 3BE7A 1K6WA 1K70A 3MKVA 4F0LA 4UBPC 4CEUC 3OOQA 2OODA 5HMFA 1EJUC 4KIRA 4CNSA 2FVKA 1RJPA 4G7EB 1FWAC 2PAJA 4CQCA 4KQNA 1E9ZB 1V4YA 4C5YA 4F0RA 2VUNA 2G3FA 3LNPA 1RA0A 3MDWA 1POJA 1RJRA 3MTWA 4LH8A 2GSEA 4EPDC 2AQVA 4CEXC 1EJVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CNT A;  1FWE C;  1UBP C;  1RA5 A;  3D6N A;  4R7W A;  1A5M C;  1FWF C;  3G77 A;  4GY7 A;  4C5Z A;  5FSD C;  3R0D A;  3MDU A;  4C60 A;  2UBP C;  3T81 A;  1EJX C;  2PUZ A;  3N2C A;  4M51 A;  1POK A;  1YNY A;  4DZH A;  1RAK A;  1R9X A;  2P53 A;  3QGK C;  3T8L A;  2PLM A;  1P1M A;  1FWH C;  1YMY A;  5G4H C;  2P9B A;  5AKQ A;  2ICS A;  5FSE C;  3LS9 A;  1A5K C;  5A6T C;  3IV8 A;  4UB9 A;  1IE7 C;  1FWI C;  3DUG A;  1ONW A;  3E74 A;  3FEQ A;  3QGA C;  1XRT A;  4GOA A;  4B3Z A;  5HMD A;  1M7J A;  2Z00 A;  3ICJ A;  4EPE C;  3O7U A;  1KRC C;  1EJW C;  2QS8 A;  1FWG C;  4EPB C;  3V7P A;  2FVM A;  1YRR A;  2FTY A;  1KRB C;  4CQD A;  2P50 A;  3HM7 A;  2QT3 A;  4Z42 C;  1A5O C;  4AC7 C;  2BB0 A;  3MPG A;  4BJH A;  4RDV A;  3GGM A;  3UBP C;  4YIW A;  4DYK A;  1GKR A;  1O12 A;  3IGH X;  1A5N C;  3GIP A;  2OGJ A;  1EJS C;  1FWB C;  3E0L A;  1GKP A;  4RZB A;  4RDW A;  4CQB A;  4F0S A;  5HME A;  1J6P A;  2I9U A;  3HPA A;  4V1X A;  2AQO A;  4R85 A;  1YBQ A;  3SFW A;  4AQL A;  1K1D A;  1S3T C;  4BKN A;  3NQB A;  2KAU C;  3GIQ A;  1R9Z A;  3LSC A;  3GRI A;  4R88 A;  1RK5 A;  5LXX A;  2IMR A;  3EGJ A;  4EP8 C;  1KRA C;  1PO9 A;  4V1Y A;  1ONX A;  2OOF A;  1V51 A;  1EJT C;  1NFG A;  4L9X A;  1EF2 A;  2GWN A;  1YBQ B;  1A5L C;  3LA4 A;  1FWD C;  1R9Y A;  4C65 A;  1KCX A;  1RK6 A;  1FWJ C;  3LSB A;  2UZ9 A;  4GBD A;  4G7E A;  1EJR C;  1RJQ A;  4WHB A;  1E9Y B;  2GOK A;  4CNU A;  2VM8 A;  4H9M A;  2VHL A;  3RN6 A;  2Q09 A;  1FWC C;  4WGX A;  1GKQ A;  1XRF A;  3BE7 A;  1K6W A;  1K70 A;  3MKV A;  4F0L A;  4UBP C;  4CEU C;  3OOQ A;  2OOD A;  5HMF A;  1EJU C;  4KIR A;  4CNS A;  2FVK A;  1RJP A;  4G7E B;  1FWA C;  2PAJ A;  4CQC A;  4KQN A;  1E9Z B;  1V4Y A;  4C5Y A;  4F0R A;  2VUN A;  2G3F A;  3LNP A;  1RA0 A;  3MDW A;  1POJ A;  1RJR A;  3MTW A;  4LH8 A;  2GSE A;  4EPD C;  2AQV A;  4CEX C;  1EJV C; 
#chains in the Genus database with same CATH topology
 3RAQ A;  4R7W A;  1A5M C;  3G77 A;  5KG1 A;  4YP3 A;  4TQS A;  3R0D A;  4ECW A;  3RBE A;  2UBP C;  4O3O A;  4ECR A;  3QGK C;  4Q43 A;  2PLM A;  1P1M A;  4QWA A;  4J9R A;  5AKQ A;  5FSE C;  5KFQ A;  5DG9 A;  2W9B A;  5KFS A;  3RB0 A;  4EBE A;  1IE7 C;  3FEQ A;  3EPI A;  1ONW A;  4ED3 A;  2JEJ A;  3GIJ A;  5KT7 A;  3PR4 A;  1S97 A;  4ED2 A;  3O7U A;  1KRC C;  1N56 A;  1EJW C;  4RUA A;  2BQ3 A;  4R8U B;  2QT3 A;  4Z42 C;  2XC9 A;  2JEI A;  3GGM A;  5F9N A;  4RNN A;  2R8H A;  1T94 A;  3GIP A;  2OGJ A;  3E0L A;  3H40 A;  4RDW A;  3T5J A;  3GIK A;  4F50 A;  4F0S A;  4O3S A;  5HME A;  2I9U A;  5KFJ A;  4TQR A;  4AQL A;  1K1D A;  1S3T C;  4F4W A;  2KAU C;  3KHL A;  5EWE A;  5L1J A;  2W7P A;  4R88 A;  2ATL A;  2DPI A;  2UVR A;  1ONX A;  3Q8S B;  2W9B B;  1EJT C;  5KFH A;  4Q44 A;  1YBQ B;  4G3I A;  2AGO A;  4GBD A;  2FLL A;  2ASD A;  4FBU A;  2UZ9 A;  1E9Y B;  2V4R A;  2C2D A;  2R8J A;  4CNU A;  5KG7 A;  5KFO A;  3RN6 A;  3RB6 A;  4U7C A;  3H4D A;  1XRF A;  3PW7 A;  2BR0 A;  4F4Z A;  4Q8F A;  4F0L A;  3RB3 A;  1EJU C;  4DL2 A;  5KFM A;  4CNS A;  1S0N A;  3PW0 A;  4IRK A;  5L1K A;  5DLG A;  1FWA C;  5F9L A;  2R8I A;  5KG2 A;  3GV5 B;  3G6X A;  1POJ A;  1RJR A;  3T5L A;  2GSE A;  4J9N A;  4J9P A;  3GV7 B;  1FWE C;  5L1L A;  2UVW A;  2J6S A;  3BQ0 A;  4GY7 A;  4RUC A;  5FSD C;  4DL3 A;  3MDU A;  4ED6 A;  4QWC A;  3T81 A;  4U6P A;  4R8U A;  1K1S A;  4DL6 A;  4DZH A;  1RAK A;  4YR3 A;  2W9C B;  1R9X A;  5KG3 A;  5KFW A;  5DQI A;  4FS2 A;  1FWH C;  3GV8 B;  2P9B A;  3MR5 A;  1A5K C;  2XGQ A;  4J9O A;  4UB9 A;  4IR1 A;  1FWI C;  3QGA C;  4B3Z A;  4DEZ A;  1XRT A;  1S9F A;  4RU9 A;  3ICJ A;  4F4Y A;  3MR2 A;  1FWG C;  3V7P A;  2FVM A;  2FTY A;  3HM7 A;  3MPG A;  4RDV A;  4YIW A;  2R8K A;  3OHA A;  4DYK A;  1GKR A;  1O12 A;  4ECU A;  5KFU A;  1T3N A;  1EJS C;  1FWB C;  4RZB A;  2FLP A;  4CQB A;  3OSN A;  4QW9 A;  4EYI B;  1YBQ A;  3SFW A;  4O3P A;  4IRC A;  3NQB A;  2RDJ A;  3GIQ A;  3LSC A;  2JEF A;  5C5J A;  4RNO A;  4ECY A;  3Q8Q B;  4GC7 A;  1KRA C;  4L9X A;  4JV2 A;  3KHR A;  1EF2 A;  4EBD A;  5KFN A;  1N48 A;  3LA4 A;  2VA2 A;  2FLN A;  4ECV A;  1RJQ A;  5KFA A;  5KFD A;  2GOK A;  5KFT A;  5KFX A;  4H9M A;  4ED1 A;  5KFL A;  3BJY A;  1S0O A;  1FWC C;  3SI8 A;  1GKQ A;  3Q8P B;  2BQU A;  3H4B A;  4O3R A;  2C28 A;  3MR6 A;  5KFZ A;  5HMF A;  4KIR A;  4YR2 A;  1S10 A;  4CQC A;  2VUN A;  4J9Q A;  4F4X A;  2G3F A;  3LNP A;  2BQR A;  1RYR A;  2W9C A;  2W9A A;  3RAX A;  2V9W A;  4NLG A;  2ICS A;  4BJH A;  4CNT A;  4YR0 A;  1FWF C;  1S0M A;  4C60 A;  3N2C A;  4M51 A;  3PW4 A;  1YNY A;  4ECT A;  2C2R A;  2W7O A;  3GIL A;  2OH2 A;  5G4H C;  3KHG A;  3G6V A;  3LS9 A;  3GII A;  3IV8 A;  3V6H A;  3DUG A;  3E74 A;  3KHH A;  5EDW A;  3OHB A;  5HMD A;  3RB4 A;  1M7J A;  4J9S A;  4ED7 A;  4EPB C;  3QZ7 A;  1K1Q A;  1KRB C;  2BB0 A;  3GQC A;  3Q8R B;  3M9O B;  2RDI A;  3IGH X;  1A5N C;  1GKP A;  2IBK A;  2W8K A;  3HPA A;  4V1X A;  4R85 A;  4JUZ A;  5DG7 A;  2J6U A;  4YQW A;  1JIH A;  5EWF A;  5T14 A;  4Q45 A;  1RK5 A;  2XCA A;  2IMR A;  2IMW P;  2AU0 A;  4ECZ A;  3FDS A;  4V1Y A;  2OOF A;  3RBD A;  1V51 A;  2AQ4 A;  2GWN A;  5DG8 A;  1FWD C;  1R9Y A;  1RK6 A;  3LSB A;  1FWJ C;  4O3Q A;  4QWB A;  5DGA A;  5DGB A;  3OSP A;  4WHB A;  4IRD A;  4ECS A;  4DL4 A;  2VHL A;  4JV0 A;  2UVV A;  4WGX A;  5KFP A;  3BE7 A;  1K6W A;  4JV1 A;  1K70 A;  3MKV A;  2VA3 A;  4CEU C;  3OOQ A;  4J9L A;  4IR9 A;  3NGD A;  2FVK A;  4G7E B;  1RYS A;  5KG4 A;  2PAJ A;  5KT2 A;  2DPJ A;  1V4Y A;  4C5Y A;  5KFV A;  1IM4 A;  3MDW A;  5L9X A;  4LH8 A;  4EPD C;  3TQ1 A;  2AQV A;  4ED0 A;  2UVU A;  3M9M B;  3PW2 A;  1UBP C;  1RA5 A;  3D6N A;  4C5Z A;  1ZET A;  3MFI A;  2W8L A;  3BQ1 A;  5KFI A;  2IA6 A;  1EJX C;  4QW8 A;  2PUZ A;  4QWD A;  1POK A;  5KFC A;  2XCP A;  5KFE A;  2V4Q A;  4HYK A;  2P53 A;  3T8L A;  5DLF A;  4GC6 A;  5L1I A;  4ECQ A;  1YMY A;  3MR3 A;  5KFG A;  5A6T C;  4GOA A;  3V6K A;  2Z00 A;  4EPE C;  2QS8 A;  4J9M A;  5JUM A;  2J6T A;  1YRR A;  4CQD A;  2P50 A;  3GIM A;  1A5O C;  4AC7 C;  2C22 A;  4EYH B;  3PW5 A;  3UBP C;  4EEY A;  5KFY A;  2WTF A;  4ECX A;  2ALZ A;  2XGP A;  3MFH A;  1J6P A;  5DQG A;  2AQO A;  4DL5 A;  3T5K A;  4DL7 A;  4BKN A;  3V6J A;  2ASJ A;  2C2E A;  2ASL A;  5KG0 A;  4Q8E A;  1R9Z A;  4FS1 A;  3GRI A;  4J9K A;  5LXX A;  4RNM A;  4FBT A;  5KFF A;  5KG5 A;  3EGJ A;  4EP8 C;  1JXL A;  1PO9 A;  3T5H A;  1NFG A;  3PR5 B;  3PZP A;  5KT5 A;  1A5L C;  4C65 A;  1KCX A;  4G7E A;  4O3N A;  1JX4 A;  1EJR C;  2AGP A;  2R8G A;  2VM8 A;  5EWG A;  2JEG A;  2Q09 A;  4RZR A;  3IN5 A;  3M9N B;  3G6Y A;  3BQ2 A;  5KT6 A;  3QZ8 A;  4UBP C;  2OOD A;  5KG6 A;  5KFB A;  1RJP A;  5KT4 A;  4KQN A;  1E9Z B;  5DQH A;  3EPG A;  4EBC A;  4F0R A;  3PVX A;  1RA0 A;  2AGQ A;  5KFK A;  5KT3 A;  4ED8 A;  3MTW A;  4QWE A;  5KFR A;  4CEX C;  1EJV C; 
#chains in the Genus database with same CATH homology
 4CNT A;  1FWE C;  1UBP C;  1RA5 A;  3D6N A;  4R7W A;  1A5M C;  1FWF C;  3G77 A;  4GY7 A;  4C5Z A;  5FSD C;  3R0D A;  3MDU A;  4C60 A;  2UBP C;  3T81 A;  1EJX C;  2PUZ A;  3N2C A;  4M51 A;  1POK A;  1YNY A;  4DZH A;  1RAK A;  1R9X A;  2P53 A;  3QGK C;  3T8L A;  2PLM A;  1P1M A;  1FWH C;  1YMY A;  5G4H C;  2P9B A;  5AKQ A;  2ICS A;  5FSE C;  3LS9 A;  1A5K C;  5A6T C;  3IV8 A;  4UB9 A;  1IE7 C;  1FWI C;  3DUG A;  1ONW A;  3E74 A;  3FEQ A;  3QGA C;  1XRT A;  4GOA A;  4B3Z A;  5HMD A;  1M7J A;  2Z00 A;  3ICJ A;  4EPE C;  3O7U A;  1KRC C;  1EJW C;  2QS8 A;  1FWG C;  4EPB C;  3V7P A;  2FVM A;  1YRR A;  2FTY A;  1KRB C;  4CQD A;  2P50 A;  3HM7 A;  2QT3 A;  4Z42 C;  1A5O C;  4AC7 C;  2BB0 A;  3MPG A;  4BJH A;  4RDV A;  3GGM A;  3UBP C;  4YIW A;  4DYK A;  1GKR A;  1O12 A;  3IGH X;  1A5N C;  3GIP A;  2OGJ A;  1EJS C;  1FWB C;  3E0L A;  1GKP A;  4RZB A;  4RDW A;  4CQB A;  4F0S A;  5HME A;  1J6P A;  2I9U A;  3HPA A;  4V1X A;  2AQO A;  4R85 A;  1YBQ A;  3SFW A;  4AQL A;  1K1D A;  1S3T C;  4BKN A;  3NQB A;  2KAU C;  3GIQ A;  1R9Z A;  3LSC A;  3GRI A;  4R88 A;  1RK5 A;  5LXX A;  2IMR A;  3EGJ A;  4EP8 C;  1KRA C;  1PO9 A;  4V1Y A;  1ONX A;  2OOF A;  1V51 A;  1EJT C;  1NFG A;  4L9X A;  1EF2 A;  2GWN A;  1YBQ B;  1A5L C;  3LA4 A;  1FWD C;  1R9Y A;  4C65 A;  1KCX A;  1RK6 A;  1FWJ C;  3LSB A;  2UZ9 A;  4GBD A;  4G7E A;  1EJR C;  1RJQ A;  4WHB A;  1E9Y B;  2GOK A;  4CNU A;  2VM8 A;  4H9M A;  2VHL A;  3RN6 A;  2Q09 A;  1FWC C;  4WGX A;  1GKQ A;  1XRF A;  3BE7 A;  1K6W A;  1K70 A;  3MKV A;  4F0L A;  4UBP C;  4CEU C;  3OOQ A;  2OOD A;  5HMF A;  1EJU C;  4KIR A;  4CNS A;  2FVK A;  1RJP A;  4G7E B;  1FWA C;  2PAJ A;  4CQC A;  4KQN A;  1E9Z B;  1V4Y A;  4C5Y A;  4F0R A;  2VUN A;  2G3F A;  3LNP A;  1RA0 A;  3MDW A;  1POJ A;  1RJR A;  3MTW A;  4LH8 A;  2GSE A;  4EPD C;  2AQV A;  4CEX C;  1EJV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...