2GSEA

Crystal structure of human dihydropyrimidinease-like 2
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
475
structure length
475
Chain Sequence
DRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dihydropyrimidinase-related protein 2
publication title The structure of human collapsin response mediator protein 2, a regulator of axonal growth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 181
structure length 475
sequence length 475
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.2: Dihydropyrimidinase.
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2gseA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2gseA02
4RZBA 1E9YB 3V7PA 1KRAC 3PNZA 4ICMA 4IFOA 2Q01A 2QVNA 4C6OA 2HQAA 5AKQA 4AC7C 1KRCC 3E2VA 4C5ZA 4KIRA 4EPEC 2HPIA 3PNUA 2HPMA 3LNPA 4IFKB 3F4DA 5HMEA 2A3LA 4IFKA 2R1NA 3S2MA 4PCNA 2R1LA 3A3XA 3MJMA 2WM1A 4F0SA 4LANA 4XAFA 1KRBC 3URAA 3GRIA 4LAKA 1NFGA 3KM8A 3RYSA 3AU2A 4H00A 4IGNA 3WYZA 4LEFA 3RCMA 4J5NA 3GIQA 3B40A 1PB0A 4EPBC 4QSFA 4ERAA 3LA4A 4H9VA 4UBPC 3A3WA 3PAOA 1WXYA 4GZ7A 2ANUA 3LGGA 1XGEA 2EG7A 4GXWA 5E5CA 1EJSC 2HBVA 1FWGC 2ICSA 4DZHA 4C6NA 1R9YA 4GBDA 3OJGA 3TNBA 1R9XA 3UF9A 2OOFA 2P50A 1E9ZB 1ITUA 1NDWA 2I5GA 3GU9A 4LCQA 3URBA 3CAKA 2QS8A 4XAGA 1A5OC 1P6CA 1ADDA 2Q09A 1QW7A 4KESA 4C6BA 1W1IE 2PGFA 4WGXA 1JGMA 5FSDC 4IFRA 2PUZA 2YXOA 3S4TA 2YZ5A 1YIXA 4LALA 4C5YA 1WXZA 3OODA 4DIAA 3DUGA 1V7AA 4IG2B 3RN6A 4H01A 4RDYA 4QS6A 2Z00A 2Z24A 4IG2A 4CQCA 3MVIA 2W9MA 3MPGA 4HK5A 4NP7A 3T1GA 4RE0A 1EJXC 3EGJA 4YIWA 4C6QA 4C6CA 4GOAA 1EZ2A 2VC5A 3O7UA 1NDYA 4QROA 2Z27A 1O12A 3TN5A 4M51A 1M68A 3OQEA 4LCSA 3QGKC 4BY3A 3PANA 2GZXA 3ISIX 2HBXA 3NURA 3ID7A 4IQJA 1GKPA 4P5UA 3WMLA 3HPAA 3GTIA 4TQTA 1HZYA 3TN6A 4CQDA 1FWAC 1K70A 2FVKA 1J6OA 3OU8A 4V1YA 4PBEA 2Z7GA 2VR2A 4CEXC 1POKA 3BE7A 3F2DA 1R9ZA 1BF6A 4XAZA 4R7WA 2AQOA 4KQNA 4GK8A 4R85A 3C86A 4HK7A 2Z4GA 1NDVA 2VUNA 4JOMA 3IACA 1A5LC 1YBQB 3ORWA 4GY1A 4MUPA 2PLMA 3LS9A 4DI9A 3UBPC 1YBQA 1K1DA 2O4QA 3URQA 3E0FA 4G2DA 3QY6A 1FWFC 2P9BA 4DI8A 3AUOA 3IGHX 2O4MA 4IGMA 1ITQA 3SO7A 4C65A 1V51A 1PO9A 4KEUA 2EG8A 3MKVA 3CS2A 3F4CA 1A5KC 4EPKA 3FDGA 4QS5A 2Z26A 2XIOA 3E74A 3GU2A 1FWDC 4PCPA 4XAYA 3MVTA 4ERIA 1EJWC 3IRSA 4RDZA 1I0BA 2WJDA 2FTYA 4HK6A 4C6LA 2GOKA 5HMDA 4GY7A 2BB0A 3GU1A 3F2CA 3GTHA 4GX8A 4L6DA 2AQVA 4C6EA 1A4LA 2GSEA 3IJ6A 4GX9A 3IPWA 2HNHA 4KEZA 3LSCA 2OQLA 3FDKA 4GY0A 3UR2A 4LH8A 1FWBC 4DLFA 3HM7A 4DYKA 1RJPA 1EJTC 1DPMA 4LFYA 4C6DA 3MTWA 2RAGA 1V4YA 1PSCA 3GIPA 1P1MA 1FWCC 4V1XA 4NI8A 1V77A 4CEUC 1M65A 3S2LA 1EJVC 3OOQA 3E0LA 3DCPA 3NEHA 5LXXA 2G3FA 4C6PA 4DZIA 4UB9A 1VFLA 1RA0A 4C6FA 4EPDC 1J79A 3R0DA 4LAMA 4WVXA 2QPXA 4XD4A 4H9YA 3S2JA 4H9UA 2Z25A 4RDVA 2E1WA 3HTWA 3MDUA 4XD3A 4QTGA 4DO7A 1EYWA 3CJPA 4HJWA 1UBPC 2WJFA 3S2NA 2I9UA 2OGJA 3URNA 4D8LA 3E3HA 4L9XA 1FKWA 4BKNA 1O5RA 2EG6A 3SFWA 4H9ZA 3GGMA 1RJQA 4I6VA 4DLMA 1J5SA 1EJRC 2VC7A 3FEQA 1ONXA 2F6KA 1FWEC 2D2GA 1IE7C 2QT3A 1XWYA 4H9XA 3N2CA 3LGDA 4CNTA 1XRTA 1NDZA 1A4MA 1ZZMA 1UIOA 2Z28A 2FVMA 3T81A 4INFA 4Z42C 4QRNA 2R1MA 1EJUC 3WZ0E 4ZSUA 3A4JA 1S3TC 2R1PA 3MSRA 4BJHA 3EWDA 2DVXA 2WJEA 3F2BA 3GTXA 1ONWA 3QY8A 4ZSTA 1FKXA 2AMXA 4XD6A 1V79A 2R1KA 3B0XA 2D2JA 2GWGA 2VHLA 3TN4A 2Z29A 1EF2A 1RAKA 3OVGA 2KAUC 4IF2A 4OFCA 4B90A 4C6MA 5G4HC 4J35A 4EP8C 4XD5A 1PTAA 2IMRA 3K4WA 3LU2A 4RDWA 4GYFA 3JZEA 4I6KA 2PGRA 1RK6A 4G7EB 4C6KA 2Z2AA 4C6JA 4CQBA 3O0FA 1RK5A 4G7EA 1J6PA 4R88A 1FWIC 4PBFA 2ADAA 2BGNE 2YB4A 2DVTA 2OB3A 4KERA 3UPMA 2Y1HA 1GKQA 4GC3A 4KEVA 2VM8A 1KRMA 3B0YA 3NQBA 2ZC1A 3RHGA 4IH3A 3K5XA 2FFIA 1YNYA 3GUWA 4B3ZA 3DC8A 4LAOA 4CNSA 4ERGA 4PE8A 4C60A 1FWJC 4WHBA 4DNMA 4NG3A 5HMFA 1XRFA 1K6WA 4J2MA 1UMLA 3EWCA 1GKRA 1QXLA 3PBMA 3G77A 3TN3A 2FTWA 3MDWA 3E38A 4C6IA 3LSBA 4CNUA 3QY7A 2E25A 3D6NA 4H9TA 2GWNA 3K2GA 4AQLA 2DVUA 4B92A 3IARA 4F0LA 3T8LA 1RA5A 1FWHC 1M7JA 2P53A 3GG7A 5A6TC 2Z2BA 2YB1A 1A5MC 4HA0A 2OODA 2UBPC 2D2HA 1YRRA 3QGAC 1P6BA 5CH9A 4H9MA 4KETA 1YMYA 3ICJA 4KF1A 2UZ9A 4E3TA 4LCRA 3AU6A 3IV8A 1I0DA 2PAJA 1A5NC 1UIPA 3ITCA 1KCXA 1RJRA 4F0RA 3LY0A 2CZVA 5FSEC 3UR5A 1POJA 3GTFA 4B91A
chains in the Genus database with same CATH superfamily
2G41A 4QE4A 5I24A 4QW9A 5CXPA 6TIMA 2VX6A 1FDYA 1A5AA 5EWFA 4IFOA 2Q3RA 3K8MA 1SFTA 4QAIA 3TK7A 1U83A 3TV8A 3WD1A 3CWOX 3Q8QB 3AWOA 2R24A 3WH5A 6CGTA 1I75A 3VFCA 2R1NA 3M44A 4H7ZA 1W8SA 4MAZA 5CLTA 3T0AA 4EANA 1PIIA 1TZZA 3L65A 2C79A 4MJZA 4MZ1A 3GIQA 4H8VA 2DPIA 3OIXA 4NYUA 4N7QA 3CHCA 5FAJA 1THFD 1PCKA 5KFEA 4PMDA 3TNBA 2V4RA 1F61A 4RNJA 4URIA 3NXLA 4H6QA 4HU8A 3GO2A 1NJJA 4RZ6A 1CXKA 3WD2A 4EBCA 3V5OA 5K9CA 4C6BA 1V0NA 4BQ3A 1ZAHA 1JGMA 1R3RA 3P14A 4O1FA 1BQGA 4E38A 3IIXA 3N73A 4AHOA 2R8IA 8XIMA 4AY7A 4DY1A 3CUHA 5CKSA 1CPUA 4NZCA 3WK1A 4GKLA 3MR5A 2ATMA 2NV2A 4I9MA 4OV9A 4JYFA 4Q8WA 3L4TA 5D09A 4A2RA 5FESA 2VC5A 5L1JA 3GW3A 2DJXA 4QHRA 5C9WA 1ICPA 3FN9A 3TQ1A 3ABSA 3PANA 3VKAA 2DT3A 1FDZA 4HCDA 3IJIA 4YMZA 5FJRA 4G1KA 4LUSB 3V16A 3W72A 2YA2A 3VOHA 5A6BD 4MTVA 3PUOA 5EMLA 4PUKA 4CQDA 1Z44A 1W1TA 2VR2A 4PODA 3GHUA 4DO5A 3TYBA 3T6CA 4U3CA 5E1QA 4LV4A 4ROQA 4R85A 1ZJAA 4JZ5A 2Y62A 2AQ4A 1K1SA 2ZA1A 3KVMA 2PLMA 1BFNA 1XF0A 3IVSA 3N18A 5DXXA 2FPYA 2PD9A 3R11A 1X38A 4Y96A 1UR0A 4LU0A 1Y0EA 2GJRA 4NAEA 1BXCA 3A21A 4CCEA 1H09A 2CLOA 2CXEA 2P8CA 4QCFA 4XAYA 2R94A 3KFTA 3OLEA 4AZCA 3K4DA 5F1VA 2DZWA 4XWUA 1LQ0A 2INEA 4ZB2A 1W3HA 2BOEX 2QV5A 3GTHA 5SWUA 2RHGA 1PBGA 4G9PA 3OZYA 3NQ6A 3UWQA 5BXSA 4EXQA 1RVGA 1B2YA 3C56A 1MDRA 1MW2A 4GFIA 3RILA 5CG0A 1JIHA 1EFZA 4L6OA 4N0RA 5FEZA 4X9SA 1XLAA 1TV4A 2ACRA 4ML9A 5AHNA 1TWIA 4DF0A 1FWCC 3BLDA 4LWWA 1V77A 4CEUC 1S2CA 1V6XA 3CO4A 1KBBA 3GQYA 3AIEA 2YYTA 5CGQA 4EE9A 3RX4A 3CWNA 3G1SA 3V35A 4RPQA 2WHLA 2W9CA 3W7IA 4I7WA 2I56A 2X30A 1X96A 4AX6A 5DBUA 4TO8A 2WJFA 1LL6A 3W02A 4O3PA 3GYEA 1PZ2A 2WZEA 1AVAA 1U1JA 2V0TA 3E5PA 1O5QA 3V0UA 1H4PA 3GIIA 4OGZA 2J6TA 2I16A 3CUIA 3VE9A 3ZR5A 5HNRA 1NDZA 4N9CA 1F6YA 2DIEA 4O1EA 1WV2A 1VBRA 3BJTA 4L1GA 1JCTA 1WDQA 3RU8X 1FWNA 1OYAA 6A3HA 1M7XA 3GDBA 3Q58A 4LNYA 4NJIA 1UQZA 7XIMA 3HGJA 4HU4A 1E71M 3AHXA 3BQ6A 3KLLA 4E5TA 2VHLA 3LCLA 1TJPA 4HSNA 2GUBA 3DYPA 3TYZA 2Z29A 3DERA 4UTWA 2FPTA 4JTUA 4C6MA 2Z1BA 5G4HC 1VBJA 3QZAA 4GYFA 5D30A 3CM4A 1PUDA 3RCNA 3GC4A 1K02A 3DI1A 1XISA 4UMAA 4O3QA 1SW7A 2Y85A 1OFEA 3UZZA 1CTNA 2DH3A 4IZGA 4C90A 1RALA 4AXKA 4JGDA 3M41A 3AYTA 5DLFA 5HR7A 3AXXA 2CEQA 4LAOA 2CYGA 3FX4A 3WNNA 1KQZA 4DM2A 1K6WA 3OZMA 4EBDA 2F2KA 3TTOA 4RNNA 3HPSA 4DNHA 1XXXA 2NX3A 4OU1A 4MPKA 3O8AA 1HJSA 4XKYA 1WOBA 3CEPA 2DVUA 3Q94A 4EBEA 2WKLA 3DXIA 2HE8A 3TC6A 3NQVA 4QJ1A 5GQBA 2P53A 3MI2A 3GG7A 4UOQA 1CI1A 4NZ5A 4KFOA 4HA0A 2FZ9A 1YRRA 2C2EA 3WJXA 2YKKA 4FNTA 1JNDA 3QQ0A 3CZJA 2VZSA 1YMYA 3OHAA 2CZEA 4F79A 2P0IA 1ISVA 1I0DA 3WFAA 4DWDA 3KCOA 4N6EA 1JYXA 2R8KA 1LCOA 3LBMA 1K6AA 4OHQA 2Y7GA 3EEGA 3V7PA 1TPEA 3LBCA 2WC4A 2PBGA 5KG3A 1YTKA 2H6RA 5IHSA 7PTDA 2XINA 3LTSA 2CNCA 4HPJA 4DXKA 3G1VA 4AF0A 3G1FA 1ICSA 4UFHA 2PCQA 3BURA 4GYPA 5JU6A 3QHMA 4MY8A 2YCLA 3RYSA 1DWGM 1ODZA 2Z2UA 5AVHA 1K8CA 2NQLA 3B9OA 4JTAA 3MMTA 4HQVA 1YADA 5CGTA 5FJJA 4MNLA 3TQ0A 4JUZA 4H4IA 2ZFAA 2EG7A 3DZ1A 4GIRA 1PTGA 3KTXA 2BQ3A 3WBEA 1AJ0A 3EDJA 7A3HA 3MUCA 1GQNA 4GO8A 4W4QA 1OFAA 4D6GA 3BCJA 5KFCA 4NZFA 3CAKA 1DWJM 4YTTA 1CECA 2WKJA 4EXBA 4FF7A 4OBSA 4Q8PA 4DL7A 4FXSA 5C6MA 4BI7A 3NYDA 3FJ6A 3WQCA 3CPGA 3SBFA 1YIXA 4CNOA 3ARZA 4GJ1A 1L6WA 1U5JA 3DEQA 2D0FA 7ENLA 4R9OA 3RB3A 3GBDA 3EPNA 1BG9A 3OVQA 3G3DA 3VM5A 4JTGA 1US0A 1XIEA 2X40A 1XLKA 4HNTA 1K9EA 3HFTA 5BWFA 3N4EA 3EGJA 1L6YA 1JAKA 4YIWA 2X42A 4ECUA 5F1UA 3GYCA 3EDDA 3AXHA 2YL9A 1BXNA 1JULA 2VRQA 3PUDA 3QPZA 2PCEA 3ARPA 4AZGA 4CU7A 3NO5A 1B0IA 4O53A 3QC3A 1US2A 4GQQA 3HQNA 6XIMA 3QQWA 4O3RA 1AA1B 2CWXA 1IGSA 2YXXA 3NURA 3STCA 1FDJA 4MOZA 2V3DA 3W4RA 4TQTA 2EO7A 3KE0A 1A0DA 4C7GA 5G4EA 5E93A 4F66A 4YCOA 1I8JA 4A3HA 1O5KA 2ZZ3A 2FGBA 3IGXA 2W7OA 2Z4GA 3P8JA 2XGQA 3GS6A 1DHKA 1W5PA 1JEZA 1A5UA 4GGBA 2C18A 3BLPX 3WQFA 3KBWA 4D1IA 3RBDA 5K9DA 1V51A 1RHCA 2YR1A 2WM0A 3W6YA 4WXZA 2WO5A 3B3DA 3EMQA 4TQSA 1XGZA 4Q4MA 1RD6A 2Y88A 4AD1A 3F5JA 2INZA 1TR9A 2QJJA 3FGCA 3IRSA 4U3AA 2WJDA 2OMAA 4HK6A 1S0MA 1J9YA 2ZKMX 4PMRA 5J5RA 4GX8A 1V02E 4B5WA 4K8GA 3CMFA 5B7ZA 2YYUA 1WZAA 2HWGA 2C22A 3F7JA 2H8XA 2OQLA 2X16A 2J7DA 3BQ1A 3T2PA 3UWVA 5D9OA 4JFTA 4CN4A 4O8RA 2ASHA 4AVOA 4BF5A 5KTLA 3KS6A 3CIWA 2NV9A 3GVRA 3UZ5A 3NPUA 3TEVA 4V1XA 2V5JA 3TX9A 2NUWA 4RZ4A 3S2LA 1FHDA 3USBA 4P2VA 3QJAA 4C6PA 1C90A 3E2RA 4GI8A 4RNIA 2JFEX 1GYMA 3WEMA 5HK4A 2PF8A 3WH9A 4ECWA 1OZMA 1NF7A 1TIWA 3BW2A 1EYWA 2OLAA 3LZ3A 3U8GA 5KG4A 4YWSA 5CZSA 1TCMA 1DORA 3JW7A 1LDCA 2EG6A 4FSAA 3ZVIA 1TMLA 3VK5A 5JMUA 1OHLA 2DSWA 2GQ9A 3AMDA 4AD4A 4CNNA 4XZIA 1ONXA 4OQVA 3GHTA 4PB3A 2G5WA 3DYMA 4JIIX 2FVMA 3HURA 1DWFM 4ICCX 4U7CA 2QCNA 3A4JA 4NJHA 3LUTA 3EWDA 2OR2A 5BROA 3ONBA 2I7GA 2AMXA 5D9MA 3H6OA 1S38A 1XJBA 3LQGA 3OVGA 1X7FA 2IKIA 2REQB 4IF2A 1UZ4A 3B8DA 2JBMA 5A2BA 4RDWA 3JZEA 1RPXA 5ABGA 5BYWA 2PWEA 4PRWA 2P3EA 7TIMA 1XBVA 4R88A 5L1KA 3GXFA 3WL1A 1OC5A 1L9WA 2FLLA 1AH4A 2JKPA 4GC3A 4P7LA 2OLHA 4Q8UA 4NHVA 3U2OA 3RHGA 1W1B1 5JBEA 2RDIA 3GM8A 3T8QA 5TF0A 5HJYA 5AYBA 4F2BA 3MC5A 2J13A 3APTA 3TKFA 3DC8A 1CXHA 1V6WA 5HPCA 1KCZA 3G6YA 3RUBL 1SR9A 1HKVA 2YBUA 3PJWA 1KB3A 3KX6A 3TN3A 3G77A 3FAWA 1GUVA 1SO3A 3QV9A 3R94A 5EL1A 2C2DA 2E67A 2GGGA 1G7UA 4BI5A 3P5ZA 2Q3OA 2BXVA 3TYCA 5C0QA 2CLHA 4X3ZA 1GZJA 3NM1A 4GO9A 4HNLA 3EB3A 4A6GA 2J88A 3EX1A 3IIZA 4ZOEA 3ABOA 1VCVA 3UY7A 1B31A 3W7JA 4J3WA 3WUBA 1JR1A 1GOWA 2QCFA 3G1DA 4Y9PA 3KOWA 2W4XA 5KETA 3PHAA 1KCXA 9XIMA 5LIKX 1LBFA 2A6NA 3S5SA 2Z1WA 3CH0A 2XHYA 1N55A 4J1OA 5MF5A 3UXDA 4A3RA 4LS0A 4GC6A 3QMRA 4V27A 4ICMA 4S39A 4UNKA 5A95A 2GLKA 3NJ3A 2HQAA 2JEJA 3T7VA 4S3BA 3E2VA 3CZ8A 3PP7A 2ZCGA 1HGWA 4S3KA 3CQHA 4ADUA 3EX4A 1QPKA 2XU2A 4AIEA 2BSLA 3RF9A 2PDIA 3P60A 4L1WA 1HGYA 2D0GA 2KZHA 3A3XA 1TPH1 3OHMB 1S1PA 4LYRA 2ZX5A 2EXOA 2ZTKA 2W9BB 3I6EA 2R14A 1KA9F 4TIMA 4PMOA 1Z6KA 3WH7A 3T9PA 5KFYA 3HQOA 4R8UA 2TAAA 3A4WA 4P8XA 1HL9A 3WQPA 3C3UA 5I5RA 4UBPC 2PB1A 4Y2WA 4H6RA 1Q4NX 4GQRA 1EJSC 1R9YA 1NQ6A 3B04A 2OOFA 5M3WA 3M0IA 4GVIA 3GV8B 5FJTA 3ECQA 4MNMA 5EBAA 3PF3A 1C8VA 2PRMA 1PX3A 1O68A 2ZRYA 5AZ0A 2G97A 1UH2A 5D05A 1AUSL 1OEPA 2PGFA 1ZS2A 2GVJA 2G95A 2PUZA 2GJPA 1XLHA 3H4DA 1GOQA 1DHPA 2BOFX 3SAZA 3TTSA 1V7AA 3CC1A 4DJEA 3RN6A 5AZ1A 2RGLA 4ED1A 3NSNA 3CL8A 2YSWA 1EP3A 4AIOA 2WNNA 1EKOA 5AC5A 3N9KA 4ZB5A 3I3EA 1XKJA 1BVWA 2ISWA 1HN1A 1WX0A 5KG0A 3GXDA 1XBYA 4FNSA 1ICQA 1HVXA 1NDYA 4D9PA 4QROA 4D2JA 2WPGA 4LUJA 1P48A 3BPWA 2XIBA 1OK6A 3FFSA 1DJGA 4JQ3A 2PRLA 2ZZ7A 3L2MA 4F40A 3GTIA 3WQ5A 4UWMA 1AK5A 3QR0A 3TN6A 2WSPA 3GIYA 4MWAB 4WOQA 2FVKA 1UC5A 1XIDA 2ALZA 2C14A 1ZJBA 4GC7A 3EA3A 4OKDA 3ZJKA 1WKDA 4L6HA 3TJ4A 3HG3A 2XC9A 3M16A 2VEGA 1XFCA 5M5DA 1SZFA 2PRHA 1BRLA 4B9YA 4Z2LA 3EYPA 4OT7A 2DFAA 1LLZA 3MW7A 4DEZA 3EWYA 4ACZB 4RE2A 2V9WA 2DH2A 4DJDD 5KZ6A 1XC6A 2Z26A 2Q8ZA 3AIRA 1L8PA 3GG0A 5H8PA 1J2BA 3E74A 4CVUA 1TJ1A 3W37A 3BL3A 3P0XA 5KFLA 1WXJA 3U0HA 1H41A 1ME8A 4W93A 4QDPA 5LNVA 1GVOA 3LRKA 2A0NA 1PTDA 1TPUA 3RPMA 3W87A 3HPFA 1AZ2A 2VEIA 4JCLA 2PLCA 2AQVA 2J75A 5KT5A 2F2HA 4O54A 3IPWA 3PW5A 3J7HA 3PWAA 5A2AA 2ZDSA 4YTUA 3QYSA 4KT2A 5C8BB 5C55A 4CQ8A 3RB4A 1WNOA 4S3JA 1CCWB 2RDXA 3PVFA 5CJ5A 3UJRA 2YCIX 1RJPA 4UFLA 2VUYA 1D3GA 3W2JA 1LOQA 3M5XA 3QLLA 2GDQA 2XGPA 3R8GA 1I4NA 4DAIA 4DJDC 3N2BA 4O12A 1UPMB 3ZFHA 1JAEA 2VCAA 1J01A 1UZ1A 2QJGA 2V30A 2OPJA 3GV5B 4MYXA 3S2JA 1J2WA 3ENLA 3HTWA 1QBAA 1S2UA 3WK2A 3MMUA 3HF3A 3O0KA 2Q8XA 1JGIA 3UW6A 4JV0A 4ED0A 1W3KA 2QUMA 3BLLA 4L9XA 3K13A 1JZ4A 5C7VA 4PTVA 1U1HA 1MXDA 4L61A 3WJSA 4I6VA 4LUTA 1IGWA 1RZMA 3PPGA 5I0DA 4IT1A 4OUEA 3UWUA 3V75A 1EEXA 2F6KA 4H9XA 3LGDA 2P10A 3DH7A 1D9EA 4MDOA 2OFJA 2P1FA 1EJ7L 3H12A 3TH6A 1UIOA 1A3WA 1JZ3A 3BSMA 5MKGA 4MMWA 1W56A 4HA4A 1FRBA 4MZ8A 3MR6A 2OZ0A 4H6KA 3TSMA 2VVSA 3VYLA 3OHBA 5LKYA 2OLSA 4NUWA 3B0XA 3G1XA 2GWGA 3CUXA 3FXYA 3TN4A 1ZPTA 4MB1A 5I6SA 4OFCA 4ZB0A 3TSDA 1JUKA 1KFLA 3TXVA 4U5KA 4MWAD 5FACA 4US5D 1JDFA 2PE4A 2Y70A 4RW5A 3BV4A 2XPKA 3O0FA 2A3HA 4IIFA 3PBWA 2OB3A 2CLPA 2WVTA 3R12A 1DTUA 1ISWA 4D6EA 4P8VA 4P7OA 1Z7AA 2OO6A 2QCDA 1MUWA 5FD0A 4DN1A 4Q8OA 1I6NA 1JRCA 1JZ5A 1VCGA 3VIFA 1XUZA 3NQ7A 4C60A 3I7QA 4WCJA 2PF0A 3WBXA 3AHYA 1N82A 3SUUA 4XIMA 3M5ZA 4O3NA 3TOPA 1V7YA 2V63A 1W6TA 3OG3A 3BH4A 3CHEA 3MI6A 3ATZA 3W76A 3EWZA 1CLVA 2W8KA 1HT6A 4PUDA 4TVUA 2YDSA 4X0NA 2VX7A 4DVOA 3QGAC 4GYPC 2W5FA 3L5MA 4NAFB 6REQB 3UNTA 1H1NA 4HTYA 3B97A 3STGA 4AHPA 3G6VA 1UWAA 2PAJA 4N02A 5D33A 1A5NC 3VC5A 3MMWA 3C2VA 2CZVA 3I68A 4IXHA 1S39A 3WFLA 4HU0A 4IIEA 1Z41A 1IEXA 2ACSA 4EKJA 3PNZA 5AHIA 4IJBA 3D47A 3P81A 1WA3A 2J8FA 1EC8A 2F6XA 2J6SA 2H3BA 2PDXA 5A6KA 4EPEC 4JQ2A 2VTFA 3EKLA 2F61A 3W86A 3RGTA 3AMCA 2PSNA 1UR4A 4J9QA 1K4HA 4V28A 1VFOA 4JEQA 5DQHA 3W2KA 3LQLA 4XZLX 3KM8A 3VKDA 1W5QA 1KO0A 5C2CA 3GSMA 3HJEA 4DHGA 5H1WA 4PTDA 2X05A 4IISA 2RKXA 4ERAA 3LA4A 3FNDA 1FCUA 2BOGX 4YL2A 1EC7A 3NQ8A 4WJXA 3OJGA 4DBWA 1S46A 3NO1A 1Q7QA 2W79A 5KT3A 3TUUA 4FS9A 4J3UA 3SCUA 4HNCA 4YXGA 1EYEA 3KBJA 1AFSA 5F9LA 1KM6A 1TMQA 2ZX6A 2OTDA 3U5UA 4CD4A 2B31A 1VBGA 1BTCA 2QKFA 3VD7A 2JF7A 3GD6A 2ZX8A 5D2VA 3MYPA 3ITTA 3PZIA 1XBXA 2E09A 3WQOA 1AW5A 2X0YA 4JL1A 1TV5A 5G5IA 2GVYA 4H8UA 1N8FA 3KTSA 5KFXA 2IPJA 1J0KA 2GGIA 4HKPA 4Z2HA 1UKOA 2ZUNA 4NNAA 2J9XA 2PTWA 5CPOA 3FSTA 4AY8A 3VNDA 1Q85A 2QJNA 4J9LA 5DLCA 1LUCA 2YDAA 3GV7B 1IEIA 1DIOA 5GVJA 2WNQA 4LYPA 1C7TA 5EU9A 2FDMA 4B15A 3QGKC 1EBGA 1OF6A 1VEMA 2VD8A 1AJZA 1ESWA 1QDSA 5AY7A 2GQAA 5F2GA 3ID7A 1GKPA 4BI6A 3RITA 4GD0A 4K68A 2UVUA 5C71A 1QPOA 1OFBA 4I3GA 1BLIA 2X1IA 4HMNA 3AXKA 1YPXA 5DT5A 4PBGA 4KFNA 4L9ZA 3T4WA 1E15A 3VNIA 3HGRA 2BXZA 3BW4A 3DBNA 2DZBA 1WUFA 1G5AA 4I9AA 3UGVA 5AC7A 4Q8EA 2QIIA 3KHGA 4ECXA 4ZQMA 3TC7A 1DXEA 2NZLA 2AAMA 1MUCA 5HANA 1F8IA 1ML1A 1JPDX 1PX4A 3Q65A 2EAWA 1F8MA 2VGIA 3WELA 4E4UA 3EA1A 3K46A 2VEKA 3S6OA 1LBMA 4JX5A 3GDLA 3AXMA 1GVEA 4HPXA 4QITA 5T91A 4CU8A 3NDOA 4M19A 1S10A 2DW7A 3L4YA 1VEPA 2ABAA 2VR4A 3F1QA 1QO2A 2GYIA 4GVHA 2CHRA 3BVJA 4Q6JA 1EHAA 4JIHA 4R34A 3SY8A 2O55A 1XIIA 1YXYA 5D32A 3TP4A 4GJJA 1HJVA 5TQLA 1R46A 1JDEA 4OE7A 3S5ZA 3W83A 1EJTC 5IBXA 1VJSA 5EMUA 1EDTA 4LSBA 1IWBA 1WAWA 3OVPA 4WZHA 5D04C 1H60A 3E49A 2CBUA 2CHNA 3C2RA 3DCPA 1CW2A 5KT7A 1KFJA 4M80A 4L4MA 3UETA 1ADOA 4GRSA 4ICNA 4PTXA 1PDZA 2O56A 3CV7A 3WG6A 1JCLA 3O15A 3WEOA 1JD9A 2X7VA 4S2CA 1FKWA 1GG1A 1LJYA 4JL2A 2ZWZA 3GGMA 1JDCA 4F4RA 2ZZ6A 4JN8A 4TQRA 1EX5A 1AQ0A 3PTQA 2CBJA 4D6CA 1FWEC 2Q71A 1LOLA 4PCFA 4B5TA 4J9RA 4YYFA 2X1SA 1OT2A 1EOKA 1A80A 2PGWA 1UD6A 1HP4A 2UY3A 5E9XA 1AODA 1UOZA 4MG4A 2HS6A 3WFZA 3L7RA 1QTWA 5K7JA 3GTXA 1ONWA 1B9BA 4J9NA 2OX1A 1JNEA 2YLAA 5CC6A 3FOKA 4WDXA 4XD6A 3JU2A 4IMDA 4B9ZA 4WD0A 3KHDA 3GFZA 1OX6A 2NQHA 2Z1VA 3EWBX 4GUHA 1UR8A 4L5ZA 1QOPA 4REQB 4XKMA 2IMRA 4BQ4A 1I9CB 1C3FA 1UH3A 3VIIA 3N9RA 1RK5A 3RLHA 2AL1A 1JDAA 3RBEA 4P8UA 4HSOA 3PZPA 1LROA 5LA1A 4LTSA 2WC3A 1GOOA 4K1WA 5EFDA 4IH3A 1JPHA 8TIMA 3W7RA 4FNRA 3E2QA 4QAWA 2VENA 2D69A 4WKAA 3NG3A 1TJRA 3SJNA 4ERGA 3NFUA 1E5NA 5DO8A 5HMFA 4B5VA 4ADSA 1GKRA 4CD7A 2PURA 4DB7A 2VI0A 1H1YA 2H9AB 4J9JA 2VX5A 1OT1A 3VKJA 2GWNA 4B92A 1Q6QA 4QLKA 3BGGA 3W29A 4MVAA 2GVEA 4NL1A 5XIAA 3OIHA 4JTRA 3WLLA 3ITVA 1LORA 2GJLA 3TE9A 5FOOA 1KC7A 2GQ3A 2E4TA 3UY8A 3N2TA 4JTHA 4KF1A 1ZY9A 3R10A 3KEHA 4AZ5A 1FFRA 5H91A 1UIPA 3BANA 5JBFA 1QNQA 1AQFA 3MP5A 3A47A 4RZBA 4DL6A 2VCCA 3FJ4A 3IV3A 3WD3A 1P0NA 1WB0A 2QZRA 4K7YA 4NX5A 1P0DA 5AKQA 4NRRA 5A8GA 2PGEA 4FI4A 4KH2A 4YPJA 4FHAA 2BFGA 4HVXA 2EKGA 3BWWA 5BNKA 2WLZA 4JNZA 3FLUA 5IFTA 2MANA 5L1LA 5BXPA 2A3LA 3DC0A 3AIBA 3ZOAA 3VTRA 3F5LA 1YW1A 1EDQA 2VJXA 4U2ZA 3EX6A 1CDGA 2QUVA 1JRBA 3ARUA 4LVAA 4AEOA 3B9NA 4HPNA 5K3VA 1HJQA 3NQGA 3PSVA 3ZVHB 4J5NA 1IV8A 1QATA 4GABA 4GH1A 5T9BG 3ARQA 4Z0SA 4JN7A 4PB4A 4Z2IA 1IXQA 4GIAA 3W7LA 3KHRA 3WJZA 5XINA 1FP9A 1WXYA 2PMQA 3OW1A 1OC7A 3G2GA 5HQMA 1XGEA 1M1BA 1G67A 4GZIA 1BWKA 1AQHA 2PC8A 2WQDA 1FWGC 4DZHA 3OTRA 3SDOA 1S1RA 3CQ0A 1E72M 3SN0A 2IPWA 1V6TA 1Q2SA 2G4JA 6ALDA 5GJPA 3WLQA 4Z0JA 1ITUA 2JIEA 4S3DA 1O1HA 4JTEA 1SGJA 5J04A 2PWDA 2BGSA 2XVGA 4KESA 3VOCA 4K7VA 2IPFA 4PUUA 2FFCA 3F4VA 4HNOA 2OVLA 4XISA 1W2VA 1PXGA 1JL8A 4LALA 2EJ1A 3BK0A 3G0UA 2C0HA 3RAQA 3P61A 3IAQA 4KRUA 3R8RA 4FNQA 2HV5A 4ZGYA 3M0XA 4J4KA 4IG2A 2WTFA 1S9FA 2X2YA 4QNEA 2F84A 2BX7A 4FB7A 1XLJA 3MV11 1P5BA 1JZ8A 3U7VA 4GE8A 2OQYA 3TROA 4PTNA 5M03A 2BVWA 3VGBA 2RDWA 2NVDA 3GNRA 4H1ZA 4WY0F 2WXDM 3NAVA 2NWSA 2DSKA 3ZT5A 4ECSA 4IIHA 4IQJA 1S0OA 3I6TA 2TPSA 1CB2A 2NVAA 2Z7KA 1TA3B 3C2EA 4XZWA 4W87A 3LCHA 4GH3A 4KRTA 1WDDA 4HOXA 5BRPA 3KAOA 4J9KA 3W07A 5F2IA 4KWWA 3DESA 2DSZA 2QEZA 3TNOA 2FH8A 1X1NA 3HV8A 2VD9A 2QR6A 3VMNA 1BYBA 1GYLA 1YBQA 3OBAA 1QUMA 5A3HA 3QY6A 3RO6A 5DELA 1FQ0A 4M7TA 1ZRQA 3B4YA 4KEUA 1O7AA 5FJUA 3EBVA 3CB3A 2QDGA 4OBRA 4PCPA 4AEEA 4TMCA 3WN6A 3WNPA 5LGXA 1S5WA 4ZVJA 3TLQA 2TYSA 3PAJA 1DXIA 1ZBWA 1YE4A 4JFVA 4ZOCA 4IR9A 3C61A 5I3JA 3P8IA 5CJMA 3OGSA 3H4GA 4GGHA 2HXUA 4UXDA 1UP2A 1DWIM 3TVAA 1H7OA 3S8HA 3RO8A 2XFRA 5A8MA 3TWAA 3KZPA 3I65A 3TJIA 3BAWA 3LHYA 3G6XA 3OYXA 1DPMA 3DHUA 1H49A 2I17A 4C1KA 1QFEA 4AYSA 2JKEA 3NOYA 2WVUA 1ITXA 2XIJA 3WDRA 4EWJA 5CPMA 2BODX 2GUYA 1EUAA 1YNPA 4W8BA 4Y9NA 4FS1A 3TJLA 3A5VA 4QTGA 2NWRA 1BYCA 4HJWA 4QGCA 1RD5A 3UWYA 3GQCA 3VM7A 4D8LA 4XTIA 1E6SM 1JCMP 4ECRA 3UVAA 3BOFA 4YP3A 2UVVA 2PWVA 3SRDA 4Q4KA 1RJQA 2BHUA 4J9PA 3WLNA 4DLMA 2FZMA 2WMKA 4DL5A 3FEQA 4H7CA 2ZUUA 5A5WA 4CNTA 1UR2A 3V4BA 2VFHA 1A4MA 3CH9A 5DF0A 1XYZA 2DZSA 4EYHB 4NVTA 2XDFA 1E9IA 2XJ7A 1EX1A 1VIZA 4MY1A 4QRNA 1MNZA 1EJUC 1OSEA 3PZGA 5HOSA 4K37A 2V67A 1FA2A 1HF6A 1V3KA 3GK0A 1NOUA 4LUIA 3BG5A 3V0SA 3I7SA 5DCDA 3HPXA 4EP8C 4XD5A 1P7TB 1X39A 4TUFA 3P93A 2J79A 1GVIA 3G18A 3VZZA 1K77A 4QLLA 1TQXA 4C6KA 3GNXA 3U7BA 3TW7A 4IIGA 3ALFA 3HB9A 2JEFA 1HUVA 3BSHA 3LOTA 1UD5A 3M64A 1TWZA 1OGSA 3CL6A 3G1RA 3NQBA 1TV2A 2OCZA 2FJUB 4IGHA 3UXAA 1PAMA 2DQXA 4F0HA 3GNNA 1ZAIA 4A8IA 4D8AA 3MB9A 4S3FA 1VHNA 1X1ZA 1RLCL 1B3YA 4WHBA 2EPKX 1XRFA 1I45A 4J2MA 4JTTA 5IHRA 2I9EA 4Q33A 3T07A 1ZGDA 1KR1A 3WUEA 4C1NA 3KOXA 3LMYA 3Q8RB 2PDYA 2G4FA 4O14A 3VOGA 2ZDRA 4ALDA 3L21A 1OCJA 3UJSA 4HBKA 2ZZ4A 2VYOA 3TTYA 3N9SA 4IJRA 1QPQA 3W73A 4KETA 3P82A 4O1DA 4UQDA 2QDEA 2YBTA 1KBLA 3MJYA 1EGMA 2EPNA 2PA6A 2ZE3A 3LY0A 3GHSA 1E55A 2PDJA 5EMMA 1LG1A 2QJIA 1GYNA 5KFHA 4G6CA 5D2YA 4AWUA 2WPBA 1EP1A 1F74A 3THQA 1TUFA 3VOIA 1VD6A 3GZAA 4HN8A 1WDWA 2DZUA 2BDQA 2V4QA 1TJ0A 3EA2A 5KT2A 1KRCC 4ZEPA 3SB0A 4C5ZA 4KIRA 3SEPA 5K9XA 5JIPA 4TX8A 1HL8A 3VNJA 2QUUA 3C4UA 1HVQA 3DHPA 4BCEA 3W1UA 3VKBA 3CV2A 1ZLPA 3PK7A 1W54A 4ATDA 5ABFA 1UZHA 4XAFA 1RY0A 4NJJA 1KRBC 1GTHA 1VAHA 1DOSA 3M5YA 4TX6A 5CQ1A 3OVRA 1B4KA 4A22A 2QCLA 1V03A 1F3XA 3IAPA 3V36A 3RNDA 1SZRA 2DZPA 3B8VA 4EPBC 5K4XA 2GJNA 2A4AA 1XHGA 4ZA0A 2WOQA 3WLOA 1T8XA 1LZOA 3BMWA 3AIQA 7CGTA 5CPLA 5I23A 3YPIA 3W22A 1FHUA 3GWQA 3G0SA 4DXXA 1VGAA 4ECVA 1IR2A 4FLRA 3W1QA 3HIJA 1RQHA 5FSDC 4D6FA 1EZWA 2V68A 3FA3A 2YA1A 1KKRA 1OYCA 3GDRA 4L7ZA 1KFBA 4IPJA 3CL7A 2P3ZA 4ILSA 3KW3A 3BDKA 1T96A 4LBRA 1GJPA 3GDMA 2VEPA 3DECA 4WJ8A 1LTDA 3ZT6A 4L4LA 4NLGA 3MBDA 4LNCA 4YR0A 3N11A 2A3AA 4UTKA 3ITLA 3KL5A 3QZ6A 2J8GA 2WNZA 3T44A 1VFHA 2W61A 4M51A 1M68A 1TVPA 4KWOA 4V15A 1AG1O 4B4FA 4ZE5A 3WNKA 1AD4A 1TV7A 5EBUA 2C1IA 1LP6A 1XW8A 3WMSA 2BXYA 3CZGA 1J6OA 3ABZA 3NL5A 2ISVA 1WZKA 3W27A 4GBUA 5I3DA 2W7PA 2GK1A 1WDSA 4XAZA 2C6QA 1DKWA 2P76A 4Q3MA 1A0EA 4KQNA 5GNXA 1Q7MA 6ENLA 1UHVA 3KRZA 3R6IA 1FWWA 3AS3A 4UTHA 1IEVA 3SRKA 3WH6A 2CKSA 3LV6A 3KS5A 3MR2A 2EEXA 4NU7A 5L1IA 4M0XA 1DWHM 1W3NA 4G2DA 1FWFC 2P9BA 4GISA 5EFFA 3G8EA 3S2CA 5IBXC 1S97A 3V6JA 3NQ2A 4Z2KA 2QCHA 5DQPA 2XIOA 1VFMA 2I5IA 2YCEA 1FWDC 1DL3A 4HNUA 4ZL1A 3W26A 1XLGA 1SSDA 5JIWA 4ORMA 4N2YA 3MO4A 4XZMX 5DY3A 1NF0A 4KPLA 3DENA 5G2IA 5DBTA 4UFJA 4H83A 2VO5A 5I7GA 2PP0A 1HG3A 3W7OA 1EWEA 2HNHA 3PN8A 3EMCA 4MB5A 3PZQA 1B30A 3ZM8A 3CYJA 4UQBA 4U6PA 4FLOA 1VEOA 1EC9A 2J78A 4I5XA 3N12A 3RPTA 1FH7A 5KFNA 4JICA 1UZDA 1BEUA 3WLIA 3LPPA 5BCAA 2V69A 3OA5A 1WUEA 3H55A 1XYAA 1WBJA 3MI3A 3ZS4A 4ZQOA 3U4AA 2FGLA 4W8AA 2ZIDA 4WVXA 3TMLA 5BWAA 4YVPA 1BVNP 4LC6A 3TTQA 1W91A 1J0YA 4QCEA 2I9UA 2OGJA 2V2DA 4J28A 1JZ6A 1R38A 3DFTA 4BKNA 1Q6LA 4PMXA 5REQB 2OEMA 3MANA 4AD2A 2TRSA 3H4XA 3B8SA 2CLLA 1EA0A 3KBMA 3LLFA 4UTFA 1NOFA 3BLKA 1QT1A 3O6DA 4UQCA 2ASDA 1EXBA 2Z28A 4DO6A 2QVHA 3T81A 4PFMA 3VCNA 3BW3A 4WEVX 3UVIA 1E56A 1YDYA 4JNMA 3WZ0E 3L0KA 3BLFA 4PUWA 1Z48A 3O07A 1VS1A 4ZSTA 3L4VA 2HVNA 2D2JA 1MVYA 4ED8A 1WDPA 2P0OA 3BG3A 1V6UA 3NZRA 5IOBA 2BGQA 1LL4A 4MJ4A 4M24A 1TQJA 4H8NA 3TQPA 3N2XA 4RXGA 4M56A 4PRRA 1Q63A 1N2VA 2Z1XA 3QGVA 3VILA 1XDJA 3WQEA 2ADAA 4BQ2A 3UJEA 3B8TA 3I4EA 4ZO8A 4NRSA 1KRMA 4TTUA 4UTIA 4WK9A 1OADA 3GIMA 3GR8A 4IX2A 3UEQA 5CBJA 3S47A 5HXMA 4PMZA 3L0NA 4DWSD 2E5BA 2BQRA 4GYKA 1E6XM 3NPVA 1KXTA 3AUJA 1JUBA 4DNMA 3B9EA 4TV6A 2GVLA 1HQTA 1YLVA 4FOJA 2E25A 3D6NA 4GFSA 3OEXA 3XIMA 1VH7A 2A21A 4FIRA 4FA3A 3RAXA 4UZUA 5C70A 3T8LA 3AROA 2WMIB 2UY4A 1KM0A 2WBGA 2VFDA 1LRNA 2Z2BA 4NZJA 1H7NA 2D2HA 4UOJA 3PW7A 3EEZA 3AS0A 5FL0A 5CH9A 3K8LA 3T05A 4A3UA 1TR1A 1U30A 3C52A 2VQUA 4HHMA 3RM8A 4UR9A 1DIEA 2G8ZA 4Y9OA 1GCYA 5RUBA 3LPOA 4GUFA 1W9PA 3S5NA 2JEQA 5LNSA 2ZZ5A 3RXZA 4HHHA 1OX4B 4A3YA 4QJ3B 3HN3A 4DBSA 2CPUA 3W53A 4WY0A 3S6DA 2E8ZA 1PKLA 1GVYA 1TPFA 3FA4A 5IXEA 3W3OA 4IFKB 3UWWA 3RX2A 1PWMA 3CZLA 1U2YA 1E6RA 3LNMA 5KFJA 5A2CA 1TO3A 4WF7A 4D6DA 5CZKA 1TE1A 2DV0A 4KW2A 5KFBA 4Y8FA 3H53A 3LCWA 3ZLFA 2IXVA 1W9VA 4JS3A 4BR1A 3PZUA 4I9TA 1YX1A 1J5TA 4Q7IA 4Z1BA 2AKZA 3FEMA 4QW8A 1F4HA 4FEZA 1XM3A 2OYMA 3UF9A 1V0LA 4DYJA 3WF2A 1WE5A 1U22A 2DJLA 4QE5A 4S3EA 2QS8A 3QTPA 4I7VA 4XAGA 1KKOA 1DIDA 1DJIA 3P84A 5JH2A 2QF7A 3E0VA 1OC6A 4Z1CA 3OQ8A 1NARA 2ZBTA 1X98A 2BLEA 3GLCA 3ARWA 1LWJA 1E1EA 4H19A 4YN5A 4FLSA 1XCXA 1EA9C 3AJXA 5KFWA 3T42A 2JGYA 4KCVA 1MQPA 5F2LA 3VVGA 5FJPA 2EPLX 1IT7A 4UMBA 4YVXA 4EX4A 7REQA 1ZJHA 2AGKA 1UW9A 2ZUWA 3SSJA 3NWRA 4PN2A 3V0TA 5I09A 4M6VA 4GOAA 1MZRA 4H2CA 3W7NA 5CBIA 5KFIA 4ZMGA 1S2AA 2Z27A 4DPPA 3MHGA 4MF4A 3AXIA 3PWIA 5KITA 3DN5A 1O66A 4GUIA 4RU9A 2OYLA 2JQXA 2DEPA 2PP3A 4GNKB 3ARTA 4P5UA 5C9UA 3ZWTA 4D71A 3PZOA 1WP6A 3BTNA 2VL4A 2VC9A 4E8GA 3OU8A 1T3NA 4CCCA 4CEXC 3MHFA 4GI6A 1W17A 1UKQA 3M0LA 1DTNA 4ZQNA 1F3EA 3PR4A 3AMLA 4PUJA 3UJFA 4YNGA 1RPKA 2QJMA 4HK7A 4QQ3A 4QX4A 2J62A 1H5YA 1GPWA 2QCEA 2YPIA 4F9DA 4DI9A 3UZWA 1OVDA 2O4QA 4JKMA 3URQA 1H1ZA 2ZUMA 4WR3A 1BD0A 2FGZA 3SO7A 4DL3A 4J3ZA 2CC0A 5EPDA 3P74A 1PYMA 2DQWA 3REQB 1AZ1A 1ISYA 1J10A 1T94A 1KM1A 3I4KA 1XYLA 3VX1A 1FHLA 4GCAA 2QYGA 3KHLA 2INFA 3UG5A 3B4UA 5HDRA 3QZ8A 1OABA 1ZFJA 4DF1A 1SO5A 2J7BA 4ECQA 4GX9A 4ES4A 1QNSA 4DELA 1KR0A 2DY3A 2NQZA 5BXTA 3VMPA 1EWDA 3EOSA 3SURA 1F4AA 5U4NA 4XUYA 4W9TA 4PZVA 4WKFA 1WKEA 1QR7A 3MTWA 3Q37A 1CT5A 2VELA 2X2GA 1LL7A 3WMBA 4HHLA 4GUJA 4J3VA 1OY0A 2XVLA 1CZ1A 5HUPA 4TXEA 3QFEA 1F6PA 4PGLA 2W91A 4G5DA 2UWFA 4G7FA 1OBAA 5HPOA 3PZMA 2UVRA 3AZTA 3ZYZA 1FWSA 3QW3A 5FKYA 4WDWA 1XIBA 1VJIA 2V5BA 4XVEA 3O16A 1EQPA 3D3AA 3RR4A 3CUFA 2HVMA 2XGBA 3AQUA 3QC0A 3BJSA 3AO0A 3GVVA 2BTMA 4U5IA 5ABEA 4RR4A 2IPGA 1ZZMA 3OLDA 4UTMA 1UKTA 2IXUA 4NI3A 1JZ7A 2CLKA 3A9IA 3TIMA 4FXRA 5XIMA 2C19A 1VCFA 2DVXA 1HKWA 5D8WA 2NSOA 1OIFA 5LNWA 1DJXA 1ZJIA 5A6JA 3FJLA 4K6AA 4DQWA 3O6YX 5TD4A 4LUYA 1JG9A 3QR3A 3L66A 4ECTA 4B90A 1H62A 3NSMA 1YYAA 1EBHA 3L2IA 3TJXA 1UA7A 4EVZA 4I9JA 4CD5A 1NWRA 3EDKA 2WMGA 4G7EB 4C6JA 3N6QA 1W9DM 4GZEA 1Z89A 3WF3A 2YB4A 4CN1A 4PCTA 3CAVA 3DKJA 4KEVA 2B7OA 3TYDA 3HPZA 3RPDA 3UA4A 4EAMA 3BAJA 4O0KA 1YTDA 5HA7A 1MI3A 4DJFD 2D3NA 2J47A 3N1AA 3UJ2A 4O19A 1M7OA 1LT7A 2HS8A 5HQEA 4U28A 3RLVA 1K1QA 1M9HA 3PBMA 3BAKA 3E38A 2UV8G 2IA6A 1CGYA 4HYVA 4TOQA 2G3IA 3GDTA 4JQ1A 2IUZA 3M5VA 1REQA 3WDQA 3UPWA 4AQLA 1A5SA 1WAUA 1XSJA 4N6FA 5LNRA 1GZ1A 1UR9A 1Q4WA 3O1NA 1SMAA 3C8FA 3UG4A 5DG9A 1HIZA 3VI2A 2OSXA 4J3XA 1DVJA 3WBWA 3R2GA 3P67A 3AMKA 1H0GA 2EKCA 3EWXA 2OU4A 5KFZA 3LHVA 4DJFC 2A3EA 5AB3A 1U5VA 3T5JA 5BRBA 4ZZ9A 2VNCA 2C7FA 1DE5A 3W01A 4Y8EA 4XSMA 5HQLA 1J0ZA 5CG7A 3FA5A 4NZ3A 3M1ZA 3VZYA 1VFTA 4JBRA 2J74A 1XLLA 4LVDA 2FB3A 5JVLA 4B2DA 1Q6EA 2Y89A 4PCNA 3BOXA 3S46A 1XYFA 5DQIA 1Q5MA 4M6PA 1B3OA 4PC8A 3WLHA 3HV9A 3PPCA 4OBTA 3PZ9A 4AY1A 2WBKA 2QMJA 3T0DA 2ZYFA 3L68A 1C8XA 3EOOA 3WDJA 1CWYA 3Q8SB 2FMNA 4F3HA 5M17A 4JTDA 4O0ZA 4W5ZA 4DX3A 3ABXA 4HD5A 4QSFA 2CXGA 1TPVA 2ANUA 1C7SA 2HBVA 5AHEA 4EAYA 4BEQA 4N9BA 1R9XA 2JKAA 3GH7A 2CBVA 3R5EA 2FVLA 3CGTA 1VYRA 4EF8A 2PDLA 3AS2A 1KFKA 1X97A 3SRHA 3UU0A 2H8ZA 5I3HA 1RP8A 2DT1A 1M41A 3XINA 3KUMA 3UD6A 1D2KA 1I1XA 2XVPA 4IFRA 3E12A 4AVFA 3MS8A 4JTSA 1XG3A 1LLWA 4I5RA 5DRCA 4DZ5A 1L6FA 4DIAA 2OEKA 3VD4A 2B81A 3D5HA 3WNLA 4UFKA 4RDYA 4TVDA 1GQLA 3TR9A 3WF4A 2G96A 1CBGA 4JTLA 4ZXOA 4U33A 1KXVA 2J6XA 2V3EA 4KBXA 3T1GA 3CWHA 2VFEA 1B3ZA 4JIQA 4QBXA 3VD5A 3A3HA 4TU1A 4RNHA 4MLJA 3MO7A 3MSDA 1Q6GA 2J8TA 3ELFA 2V2HA 4NILA 3OO2A 2GSJA 3PTKA 2V9DA 3PBYA 4A4AA 1AQMA 3WMLA 3UR7A 1UG6A 1JD7A 3VGGA 1NIUA 1C92A 2CU0A 3CT2A 5DMMA 3NYZA 4PBEA 4A21A 3LB0A 4YLWA 3GFYA 3T0CA 4UZSA 4FXJA 1KLYA 3OP2A 2V3GA 4K39A 4NSBA 3FIGA 4MUPA 1SW3A 3N6JA 2OYKA 4FMVA 1E1CA 3AUOA 1F76A 2R9RA 2OT0A 3PTMA 4QDWA 2EG8A 5H2ZA 2ALDA 3M0MA 1S3HA 2QGHA 1EPVA 1XLIA 1T8QA 3CLMA 2VEFA 3ZJ6A 1LF1A 2YXGA 3O06A 1OWQA 4N4QA 4ERIA 4HZMA 1X6NA 4QWCA 2WSKA 4E2OA 4AC1X 1Z32X 3GU1A 1XCWA 3KWSA 2PBOA 2OQHA 1A53A 1A4LA 4B5UA 5DGBA 3QSRA 4GQ0A 4MFDA 1PE1A 3LSCA 3NCOA 1G9HA 2DW6A 1XBZA 3LDVA 1XICA 1W1PA 4NY2A 1FOBA 3FYOA 3T78A 2ZUVA 4AWTA 3TYAA 1OF8A 5AYYA 1SUXA 3CQIA 2YL8A 3PZNA 3WLRA 4NI8A 3OBEA 1EEPA 3P0WA 1D7FA 3G3MA 2ZTJA 3MA8A 3HQ1A 2YFOA 4C6FA 2BBFA 4XQ6A 5E9AA 3GG1A 3S1GA 3S3GA 1V0MA 4AYGA 3LTYA 2CZ5A 3ARRA 5L9XA 3P80A 2R82A 2PDKA 4Y9MA 3DHFA 1XP3A 3E1F1 3GVGA 4C7DA 1GW1A 2VKZG 3UWZA 4ZO6A 3L12A 5CPQA 1J5SA 3B06A 3A9BA 4QG8A 2VC7A 3WLTA 3VU2A 5H6HA 1E6QM 5IDZA 5J5DA 3MWCA 2I57A 4JAWA 3N25A 1TX0A 3CQJA 3A5FA 2AGPA 2VGBA 4I7UA 3EPIA 3A24A 1JFHA 2ZXAA 3I3DA 4TMBA 4J3TA 4QEHA 3PG8A 5KG6A 4PCSA 4Q4SA 4F4YA 1SPQA 2FH6A 4S2BA 2R1KA 4AD0A 4X2RA 7TAAA 1HKMA 1C8QA 1T5AA 1TTJA 2XGIA 4FBTA 5EYWA 3QBUA 2D3LA 3UCDA 4R3UA 3OLGA 1FTXA 2PGRA 3VGDA 4JQAA 3WEZA 2GDVA 2HNEA 2BY3A 3SI9A 4AZIA 5LA2A 3AS1A 4NNCA 2WVVB 4GCXA 3ONCA 2Y1HA 5CEWA 1TV3A 2R8WA 4OECA 2VM8A 3SCTA 4MIMA 1V02A 6TAAA 4B3LA 1XQLA 3L5AA 1U5HA 1R3WA 3S5YA 5K4ZA 1MXSA 4E8CA 1E1FA 1Q6FA 1N8IA 1QNRA 3FJNA 3H21A 4RLIA 4Q4PA 1TX2A 1MEHA 4JQ4A 1W9XA 2ODOA 2E6FA 3H2MA 4O1CA 3DGRA 4IMGA 4ECLA 1WZMA 2Y0FA 5E09A 2VMFA 4CNPA 1GJWA 1HKJA 1L6GA 1MEIA 3PSWA 1IWPA 1YDNA 3IARA 4HZ7A 3N6HA 4P61A 4XTDA 5CPSA 1LOSA 5A6BA 3TLLA 3DGBA 2GJXB 1DEDA 4HOWA 1TPB1 3M0HA 4JFSA 1R2RA 2I5QA 4ECZA 3TOYA 5GPRA 1TPDA 5FJOA 2WMHA 1JVNA 3COTA 1Q8JA 1FH9A 4D1JA 3QMTA 1OK4A 3QKZA 3AU6A 1XIFA 1KTNA 1CB7B 1CYGA 1GOKA 1RJRA 3HGOA 2WLYA 1QHPA 3O6CA 4IUGA 4JHMA 1XL9A 1E9YB 1TSIA 2IQ0A 3R58A 2CHOA 5DG8A 4BA0A 3GHRA 5I06A 3QHOA 3B9AA 3G1YA 3ARVA 3VABA 4LW7A 2ISDA 2Y5EA 3VIGA 1B5TA 2B7NA 1O94A 4EYIB 3WK0A 3HU7A 1E5JA 1UYQA 2ZRZA 1MFUA 2XIQA 4JTFA 2PDGA 1H61A 3ZZ1A 2PDPA 5E0CA 3PS7A 1H7XA 3W71A 3GDKA 2WWDA 1XYCA 1XCFA 4NJGA 3M46A 5JH1A 3LN3A 4QWAA 3RB6A 3EX3A 4E2DA 3A4XA 4O50A 1LRQA 2PLJA 1XIMA 3UNDA 3AMGA 4JXCA 1TV8A 3GG8A 4W89A 2HJPA 2NXIA 4AIBA 3QKEA 4JDYA 3ATYA 1ISZA 3W0KA 1FXPA 4ECYA 3FS2A 4V33A 1X7IA 4O1AA 3GW0A 2D22A 4RCXA 1DQXA 4Q8VA 3W7GA 2O0TA 1YTEA 2Q09A 1PHWA 3SIMA 3LV5A 4FLQA 4ZO9A 3LCGA 1UPPA 3NDZA 1XSKA 1HJXA 1QNOA 3H2EA 3WDIA 4Q4QA 1REQB 2V6AA 5BU9A 1IIHA 2MUCA 2A6LA 2O9TA 3OODA 1IXNA 4FNPA 1C93A 3BMXA 1LT8A 1Z8AA 2BMBA 3RX3A 1XS2A 3RLUA 1NU5A 1E0WA 1R3TA 1ZUAX 3HOJA 3SUSA 3M9NB 3PUEA 4XO6A 4UR7A 3EXRA 2EBNA 4RV8A 1S5MA 3AJ7A 3QSTA 1SQ7A 3H4WA 4RNMA 4GYJA 4JR5A 4DAFA 3HMCA 2WB5A 4UFIA 3DBPA 1K7XA 2XISA 5D2TA 4UQEA 1P4CA 3T09A 2NQJA 5IFPA 5CLWA 4O3OA 5HULA 4ZTYA 3HPAA 5AHMA 4LUSA 3WH8A 1KWKA 1HZYA 2XH7A 1V93A 2Z7GA 3UG8A 1F5ZA 1EO7A 1UBSA 5FAGA 4DPQA 1A0CA 3W7KA 2WZIA 2ZC8A 2AQOA 1HKIA 1JJKA 3ZMRA 4F0KA 1GG0A 1IR1A 4L80A 5JUMA 1VIWA 5D2WA 1IZCA 1BQCA 3EOLA 3C0SA 4JIPA 2RDJA 3DFHA 1CNVA 1OX5A 3MWAA 2F6UA 4X22A 3QRHA 3E0FA 1I60A 5U7SA 4DI8A 4Q4OA 2WHMA 4P7RA 4R9XA 1PO9A 5FF0A 4NAEB 1UOKA 3CS2A 1F7BA 3KRBA 2HZGA 2D73A 1BAGA 4GMEA 2PFHA 2GVGA 3GU2A 3W82A 4AZCB 3QQ1A 1BGGA 1SVDA 4C6LA 5KT4A 1QI0A 1WQ5A 2BB0A 3N3TA 4L6DA 4JV1A 3M07A 4HYWA 1OFRA 9XIAA 4Q8FA 4S1FA 2WV8A 4LQ1A 4FF5A 2WSYA 4OUIA 4UFMA 4QDMA 5AYZA 3ZSTA 3C8NA 3B0PA 1W3TA 3T0BA 1M01A 3UZJA 1MSSA 3SN1A 4QP0A 2GPTA 4J2PA 3STEA 3UESA 1GHRA 2WANA 1H51A 2Y7DA 1IYXA 1QI2A 3M0VA 4PULA 3OOQA 3Q2DA 2NX1A 3NEHA 3MR3A 3BC9A 2W9CB 3LM7A 3NTYA 4EPDC 2HISA 3R0DA 1QASA 3MDUA 4US6A 1VB9A 4XV0A 2BY0A 1RH9A 1UD2A 3VIKA 1OM0A 5I03A 3SZ8A 5DMLA 4UR8A 1O5RA 3IIPA 2QDDA 2PWHA 3NQEA 3AOFA 1ZB5A 3BOLA 1J8VA 3INPA 4QFUA 4I90A 3GXMA 4MKNA 4RK8A 4AAJA 2SFPA 2D2GA 1LQ2A 5C2XA 3EB2A 1JX4A 2OSWA 3CMGA 3MUIA 1Q2RA 4YR2A 3JUGA 1G6CA 4AMCA 5K2ZA 1GVRA 2ZE0A 3OYZA 4O52A 2ESCA 2J77A 3SCPA 3SQSA 3ANUA 1HXJA 2HVOA 4LY4A 1UD4A 3AWNA 5KZEA 3MSRA 3OLIA 4YVVA 3GUGA 5I3IA 1W1YA 5KFQA 3RCYA 1RBOB 3LCFA 2PU1A 4Z1YA 2VWTA 4IMCA 1KCLA 4RUCA 2Z6JA 2CLMA 4ED2A 4XZHA 2QUTA 3WQVA 1K9DA 3K4WA 3LU2A 5AC8A 3TCEA 5KFMA 2EGZA 4F2TA 2V8ZA 4CQBA 2GGEA 3S1UA 1J6PA 3HBLA 3RMJA 3F4WA 2DVTA 3EXTA 3ES8A 2J9ZA 3CB8A 3W1XA 3E0WA 2NUXA 2VC6A 4JYDA 2XCAA 4CCZA 5C5YA 2XGZA 1VKFA 4IQLA 1Q65A 3GUWA 5KMYA 2B7QA 7ODCA 5E6ZA 1YDVA 3KHJA 2XN0A 1QXLA 4F50A 5KSWA 3H23A 3MDWA 1Y5WA 1P0EA 2L5HA 2YLLA 4XKYB 1DJZA 3DX5A 1EGZA 3QTGA 2OG9A 2PZNA 1Q3NA 4PSPA 2XH4A 3H2FA 1DXFA 3U4FA 4IRDA 4ATLA 3RAOA 3PWGA 4XBJA 5CBBA 2UBPC 3W1MA 1TVLA 1NWSA 1C91A 4B5XA 4JX6A 3BXWA 3GXTA 3HG2A 1FUYA 3EX2A 1KGUA 1I2RA 4B16A 4S3GA 1EQCA 3UR5A 1POJA 4N9EA 1KV8A 1TFVA 2X09A 1GQKA 1IEQA 1KRAC 1MMFA 3DFSA 3GFXA 1TCDA 4PEEA 2IS7A 2W8LA 2DZVA 1J96A 3WNMA 4HSHA 3T55A 2YDQA 3N17A 4UOZA 1E9LA 2C71A 4YJ5A 1ZP4A 4AF0B 5BW6A 2PPGA 2GFTA 3VINA 2CKRA 1O95A 3S2MA 4JFWA 1CXIA 1CGXA 2YCLB 1QW9A 4MB3A 3E96A 3LCXA 1G1YA 2BV9A 3AU2A 3VNYA 4MFEA 3SCWA 3LRMA 3PW2A 5BOEA 3R13A 2OWXA 2J27A 3P5YA 1V6YA 4HYRA 2YDRA 1OFDA 2D2OA 4HZ6A 1IZJA 5B80A 3PM6A 3KP1A 5LIUX 4C6NA 1PIFA 2P50A 1OCQA 3GAYA 2W66A 3GU9A 3AIUA 1UWUA 4YS1A 2FIQA 1FX6A 1BPLB 2FKPA 4E4FA 1YDOA 2Y61A 3NPXA 2AGQA 1KD0A 2WC7A 3M6YA 1VBUA 3WLSA 2BG5A 3BO9A 3KVLA 1CGWA 2VFFA 3S4TA 5HJXA 1ZBVA 3AISA 4FK9A 1SZNA 2G3MA 1G69A 5J8LA 2YA0A 4I8YA 2QCGA 1NP2A 3OB8A 3TFCA 3WQDA 4AH7A 5I02A 2H90A 4KWUA 3SN4A 1UQYA 2RFGA 3TXZA 2ZQ0A 3APYA 3W23A 4EACA 1GGOA 4RW3A 3EZ4A 1F9CA 3PVXA 1IXOA 1QW8A 4R7OA 3C0LA 3UA3A 4NZ1A 1UR1A 1UWIA 4MPQA 4UTWC 1W31A 4KWVA 4JKLA 1X8FA 1JPMA 2HBXA 3U3HA 1R7OA 3WLKX 1VP5A 3KLKA 3RIKA 4HCHA 4J27A 1OQFA 3SCOA 1CXEA 3GNPA 2WNWA 1XRVA 1J4EA 3JZUA 2FDSA 3W7DA 1K70A 4AW7A 4V1YA 3GXIA 1BF6A 4RL3A 3PR5B 3PR2A 2DUXA 1KM4A 3MP3A 2FQIA 1JFXA 2CETA 3PFRA 3D0CA 2QPUA 2JEIA 1BYDA 3FAXA 1QCWA 2ZVRA 3BQ5A 3H2OA 4GY1A 1W5MA 3NXFA 3WF0A 2E40A 1WDRA 3G1AA 1XR2A 4BZYA 2W0UA 1I1WA 2YOCA 4C65A 5HMSA 4D6IA 3W7QA 2O9PA 4BHYA 3TZFA 1A5KC 3U6WA 1ZETA 2WWCA 5EKYA 3R7MA 2OELA 3NZPA 1YHTA 3FGCB 3SADA 3QW4B 3MVTA 3FKRA 4RDZA 2FTYA 3R8HA 2PC4A 3U2ZA 2PDUA 5GNYA 3MCOA 4GY7A 3QPYA 3BQ2A 3VE7A 2A85A 5FIPA 3VNZA 3CK5A 3PY2A 3BZGA 2GSEA 3EPOA 1PX8A 1S2TA 3UQNA 4QQUA 2E9BA 4FX6M 1XDMA 3FDKA 4NKCA 1W32A 3KXQA 1RQEA 2VCBA 4RX0A 4DYKA 2XM2A 1G7VA 4JYEA 4RUBA 2Z1KA 1WYIA 3M9OB 3E6EA 1D8WA 4O3SA 3O3RA 2W9AA 4IPIA 2ZX7A 1NQKA 3NQFA 2RH9A 1W3LA 5CSRA 1Q13A 5GNZA 3EDEA 3VDBA 3KVJA 1MDLA 5LA0A 2GSHA 1JPIA 4H8HA 1ZSXA 4H9UA 2POTA 2OOGA 1CIUA 3GH5A 1IXPA 2WAGA 4PL2A 5DMNA 2WMFA 3GE7A 3SGZA 3ZR6A 4Q32A 4F4XA 4PB5A 3H4BA 4OV4A 2OT1A 3CUZA 3FVMA 1Q6DA 3AIVA 1UWSA 3KBNA 1D7KA 2VT0A 4WUIA 3C2FA 4WDUA 2KX9A 3S9ZA 3FXGA 4JTJA 4IR1A 4DUVA 4LF2A 3F2BA 4KFPA 1DQWA 1E6PA 1W1A1 3CU2A 3A4AA 3LPGA 3GVWA 2P5NA 2XIMA 3WCZA 1EF2A 3L4WA 1W5NA 3KCJA 1GW9A 1YE6A 1J11A 3W81A 2REQA 3KP0A 2BP1A 3PJUA 1N7KA 5DLGA 1IEWA 4RPPA 4JFUA 2XVKA 1TELA 4YHGA 4G1NA 1M5WA 3UPMA 1CEOA 2DPJA 1FWTA 1SFLA 1SYTA 3NQCA 2GL5A 3EKZA 4KS0A 5LNUA 3TR2A 4XZBA 3FHQA 3UERA 1N8WA 5A6MA 1RCQA 3CZKA 3WDHA 4W86A 4KKXA 2HDJA 3QR1A 4A8LA 1XD1A 2FTWA 3PZTA 3LSBA 5C9XA 1B54A 3QY7A 1NAL1 4GHRA 3V1PA 4ML4A 3KZSA 4KCWA 3QV7A 3FY1A 3LMZA 2AGTA 1OYBA 1SU5A 3VNLA 4ZE4A 3RU6A 3IK2A 3U2EA 3VC6A 1KM3A 1EF3A 4KCUA 1JUEA 2PTYA 4DF2A 1UH4A 1M04A 3VX0A 4G8TA 3ICJA 4UIOA 2CZDA 3RLGA 3AC0A 1MW0A 5AFDA 5HUOA 2DSVA 1VZWA 5HR6A 1YXCA 2C0AA 3BSGA 2JK2A 4RNOA 4B91A 5CGMA 4GNVA 1UASA 3CQKA 2RJGA 4UUIA 1DWAM 4Q44A 4DJDA 3DIPA 5C9ZA 1H7WA 1NSJA 2QVNA 3H2CA 1I2QA 3ZSSA 2E5CA 3W25A 4CVWA 1LWHA 1UP3A 4RZRA 4NIRA 5CAKA 3CNYA 3CAQA 4DL2A 1R3QA 2XYLA 1FH8A 1WKFA 2XIIA 1D3CA 1XYMA 1GTEA 2DPEA 5KFSA 3GRIA 1KM2A 1NFGA 2W9BA 1UCWA 3AZRA 4R8UB 5FF4A 2BR0A 1OFPA 1PVNA 3GIKA 1SFSA 4OJYA 4FS2A 2XVNA 1FVPA 3N14A 4H9VA 3A3WA 1ODUA 1E0XA 2VDIA 4RXFA 4BK9A 4AZ7A 1H2JA 2Q6ZA 3BZJA 4LVGA 4HN4A 1TUXA 1VR6A 1XGDA 3VIPA 2XN1A 4YYCA 3VKKA 4LCQA 3UWEA 3AI0A 3SUVA 2PWGA 5LZLA 1YXDA 3MKKA 1ADDA 3S1XA 3WSUA 4AHQA 3W38A 1GQJA 2FYMA 3LZ5A 2W67A 4FBUA 5I79A 4J40A 1QU4A 3IJQA 3KCLA 3MUAA 1T6MA 1CXLA 4H04A 3QMSA 4AEFA 5HBFA 2BQUA 4QS6A 4IP4A 3V6KA 1HFBA 5D4YA 2YL6A 1BSIA 2O92A 6PTDA 2JALA 4RE0A 3WK3A 2QV4A 2GOUA 1UWTA 1OZQA 3ARYA 4AD3A 4QJ5B 3G0XA 1P6WA 4GZJA 3BAIA 4BQ5A 3ES7A 1UP0A 1DBTA 1NELA 3AIWA 3MQTA 3SQLA 2O7SA 3GTNA 4BFAA 1JI2A 2CBIA 5F4SA 4MWAA 4US5A 5IRPA 5EDWA 2ON3A 1R8LA 3CBWA 4NYYA 3OGRA 2HCVA 3PB2A 2ZA2A 2V2CA 3C0JA 1J0IA 1JXJA 1V3HA 4JOMA 1BRLB 3CUGA 3VIJA 2WSQA 1BHGA 4UNLA 4E3VA 1P43A 5LXEA 3LS9A 5CC7A 4PRTA 3D3FA 4NXSA 3SM0A 3ARXA 2FMOA 3G6LA 3TYUA 1OB0A 3BGAA 3LK6A 4H7VA 4BF9A 2FLPA 1PKNA 4AXNA 1KFWA 4M6QA 3W6MA 4ACZA 1RYSA 3MKCA 2DUAA 1BGAA 3LHWA 1S2WA 3TQKA 2BY1A 1X1OA 2OWCA 1EJWC 1Z9AA 1ZQ5A 3NUKA 3CPUA 4G56A 4K8HA 4Q8NA 5AHFA 4IPLA 4GUGA 2ZX9A 3MUZ1 4QNWA 3C2OA 1KV5A 5TBOA 5G2WA 1DP0A 4UTUA 2V3FA 4XX6A 4KRZA 2W63A 1T7LA 2ZWYA 3Q4DA 5B7YA 2EHHA 3LLXA 2E9MA 3GC2A 5AOUA 5EA9A 4LFYA 3PUGA 1VF8A 1RBAA 3M6DA 1P1MA 4QM1A 2Y2WA 4UMCA 4NZ4A 1EJVC 2HEJA 3IANA 2W62A 3WUGA 1RA0A 3FYYA 1UA3A 2O7QA 4S3AA 2F8QA 2QPXA 3GZ3A 4ZOAA 1W3IA 4GXMA 3W7EA 1QAPA 4FIQA 3DU0A 4LXFA 4XD3A 4IPNB 2D0HA 1R5YA 1IT8A 2VR5A 1BG4A 2GGHA 2CFFA 3RJXA 4PSRA 4CQAA 2JE8A 4LUTB 4DJED 1V08A 1SMDA 2ZRUA 1KGWA 3IGUA 2E6AA 2QJHA 1YEYA 5MKGB 1HO4A 1TE6A 1G94A 2DIJA 1KFEA 2JEGA 2ATSA 3IJ9A 4E2BA 2F7FA 3N04A 4F9JA 4U31A 1KWGA 4W84A 4AB4A 1GOMA 4O4WA 1FKXA 1W1VA 4K2SA 4FPSA 5HNTA 1RV8A 1R86A 4XK2A 3AICA 2JF6A 3VO0A 2NXGA 1O6IA 3L9CA 2E6YA 2R8HA 3SGUA 4ED3A 5C2GA 1QBBA 3M43A 1NP0A 3FCPA 4DJEC 3TSBA 1S0NA 1T99A 4BWLA 3F03K 4ZXLA 1BTMA 2J9YA 1JF6A 1JF5A 1MUMA 3KOFA 4MUZA 2FHCA 3S9YA 2CZFA 4PL1A 1RUSA 3B0YA 3TONA 2QCDB 1UKSA 3HO8A 4PA8A 3WBYA 3CHDA 1EO5A 3T08A 1VFSA 3GH4A 3K5XA 1J0HA 4ZOBA 2IBKA 4IL0A 2AU0A 4RKAA 1I2NA 2B4GA 3U2CA 2PS2A 4CGTA 4DEFA 4WXYA 1JCJA 4A05A 3IN5A 2C1GA 2XH0A 3II1A 4IHCA 5KG5A 4CNUA 4A35A 3ZLGA 2JGQA 1DYSA 1XPYA 1UWRA 3P3BA 4M7SA 3WQWA 3T5KA 1Y65A 1RA5A 1EGVA 2X0HA 3AYSA 3W1RA 3CZEA 2QLYA 1SO4A 2E9LA 3WLJA 3ZR4A 3CO8A 1ONRA 4HTBA 2OODA 1T41A 4P8WA 4NAFA 6REQA 2UZ9A 4E3TA 3ZJ8A 4LCRA 5DXYA 3DG3A 2YZRA 1R30A 3ITCA 4O17A 1TMHA 3T40A 2HK0A 1FY6A 2A1YA 3P2VA 1PV8A 1XH2A 4IL2A 1R3SA 3B0UX 3T2OA 2HRWA 3TZNA 3IUIA 1FCBA 3ZIZA 2E3ZA 2V5KA 1MFVA 2TODA 3THDA 4M82A 4MSSA 4MM1A 4C6OA 4XZNX 3GNDA 4R33A 4LB3A 4LT9A 3ARSA 1K03A 1KBIA 1SO6A 1KW1A 1JXKA 3F4DA 4MJMA 3WENA 2WM1A 4PH6A 3TQVA 1Q6OA 1RP9A 3GKAA 1K9FA 1N56A 2PP1A 4JV2A 1EHNA 3PJXA 2X0SA 4EXAA 1E0UA 5CZTA 5A94A 5I3KA 2OX4A 4LEFA 3PULA 3NPWA 3H40A 1QNPA 2DIKA 2VZOA 1W3JA 3B40A 2D1ZA 1AMYA 4DO4A 5AYXA 3T5HA 4YTQA 3AHTA 4GZ7A 4MADA 2VXNA 3M9MB 2ICSA 3EWUA 1UR3M 8A3HA 5D38A 3UCQA 3NQDA 2NQ5A 3EMZA 1DV7A 1NDWA 4WGHA 1CXFA 3P7YA 1PEZA 1SZGA 1QW7A 5PTDA 2VDHA 1OCBA 1E40A 2YXOA 3DI0A 1HJUA 3IEBA 3STPA 4DUOA 5MHBA 1QK2A 2QCMA 5FEWA 4GPNA 3DUGA 3V6HA 1OG6A 2YGYA 4H01A 1LG2A 1E4NA 1IWAA 3GB6A 5ECUA 2W9MA 4F2UA 4GA8A 1HJWA 1EJXC 2WCGA 1UD8A 4C6QA 1V3IA 3VIHA 4M29A 1LUCB 3QZEA 3G1HA 1ZCCA 4A3QA 1GEHA 4PFHA 3LTPA 2E1DA 4JDBA 2D23A 4FR6A 5EB8A 2EQDA 3OQEA 1Y7VA 3QPEA 2V82A 4FXFA 4PMVA 3H7VA 4Z2GA 1W37A 2BHYA 2QCCA 2ZZ1A 4L1XA 3VKCA 3LX9A 3O63A 4MY9A 2AL2A 4ZENA 4NF7A 3T2QA 4UQ9A 2XSAA 8RUCA 5JQ9A 3UZYA 2Y7EA 2GGJA 3AHVA 3TU9A 3WJWA 5EWEA 4OOUA 4GK8A 3IUHA 3C86A 4DYEA 4ADTA 5DRIA 3IACA 4E6MA 1A3XA 3ORWA 4HMCA 3UBPC 3SJ3A 1EB3A 3ITYA 1MRAA 1KXHA 4ZFCA 4KCTA 1V6VA 1B3VA 3CXOA 3KRUA 1W8GA 4PUNA 1FCQA 3MKVA 4BF7A 1PZ1A 1TTPA 3VDHA 1ZNNA 4MHBA 2V38A 4W7WA 3ITOA 1VRXA 3OG2A 4P7NA 3OPSA 5EWGA 1I0BA 3W2UA 4LS2A 5HMDA 4IQDA 1PZ0A 4QISA 3LXCA 1TB3A 4FO4A 3WF1A 2ZA3A 3F2CA 4ZTXA 3K30A 1E51A 1M3UA 1H11A 4YWIA 4X61A 4YU1A 1AJ2A 2HE5A 3JRKA 2C15A 4Q8TA 2QUNA 2YW4A 3RM9A 2O9RA 1XV8A 4W88A 1FWBC 1ZBKA 3HM7A 1MEWA 4O18A 3AAMA 2F9RA 3N4AA 3Q67A 4GNJA 1V4YA 3C0QA 1A5CA 2CITA 2IW0A 2R6OA 4HYKA 1FP8A 3E0LA 4DZIA 4UB9A 4O15A 1RLDA 2W92A 5LGZA 3LHTA 4GACA 3OZPA 3ME3A 3CJPA 1DE6A 2ASLA 4ZR8A 2PTXA 4ORIA 3Q8PB 1VJZA 4ED7A 3ZWSA 3BLOA 2FHBA 1QOXA 1TG7A 3W7MA 5HWMA 4IXXA 4NX0A 2VWSA 1AL8A 3GBEA 1EJRC 2EF9A 3EOUA 3RM4A 2E6DA 3CAWA 4AU0A 1B3XA 1KQYA 4ATWA 4J9SA 4AZ6A 2XZ9A 3GKFA 3QFWA 2PZ0A 5KFKA 1OJXA 3M0YA 5KG1A 5ECVA 2J6VA 5H8UA 4EIVA 5IM51 4JTIA 2A2IA 3R43A 1WBHA 4GWEA 3DDMA 1P0BA 2OO0A 1VENA 1EL3A 2ISFA 4HCLA 4J35A 5HWJA 1HX0A 4O57A 4ENLA 2V5DA 5I3GA 3BG9A 4REQA 2WHKA 4I6KA 4F4ZA 1ME9A 4A8NA 1A50A 1E4IA 1FWIC 2TMDA 2HK1A 1TPWA 3CIXA 4JHZA 2OH2A 5F7UA 4JY9A 1JYWA 1Q45A 3M47A 1JQXA 1VHCA 4LY8A 2NLYA 4R5EA 1AD1A 2Y5SA 4ROPA 2BVDA 1G0CA 5KFTA 3VDCA 3OHIA 2XSXA 3UFYA 4NXKA 3SY1A 1IT0A 1KTCA 5I07A 2RDUA 4FNUA 3H7UA 4QSHA 1K8YA 3NEVA 5LHEA 1T0OA 4PYSA 1H3GA 2C13A 2WCSA 3E02A 3ZQ9A 2BHZA 4WQ6A 1XLFA 3WQGA 2FTPA 1TJ2A 2H9AA 4V2XA 3PG9A 3BJFA 2ABBA 4AD5A 3E5BA 3CASA 4G3IA 1W9BM 2AAAA 5DGAA 4DUXA 2AQWA 3HGSA 1M7JA 2PWUA 3SCQA 1ZENA 3JR2A 4Z2JA 1A5MC 4R53A 1KCKA 3KWXA 4MGGA 4H9MA 1LRTA 4B5NA 5D03A 1L6SA 1ISXA 4D6HA 5JXQA 1JXLA 5I3FA 1TZ7A 4EF9A 1AW2A 1ALDA 3GIJA 3M0JA 3CUJA 4RNFA 3B0VC 3GTFA 3T0TA 4PTMA 5FL1A 4DRSA 4X9YA 2ZUTA 4YTRA 2P88A 3VGHA 1KGXA 4YCPA 3DHDA 2MNRA 1Q7ZA 3O9NA 2QMKA 4C7FA 2VGFA 4Y9AA 4MZYA 1O1ZA 1HTIA 1RQBA 4E4PA 1Z69A 1BKHA 1E4MM 4O10A 5BOFA 2ZVIA 2XFWA 4L4OA 1QWGA 1F6KA 4LBSA 2J6UA 2B0MA 1NWUA 4LANA 4NASA 3ABRA 1XD0A 3GY1A 3B8IA 4LAUA 3ZO9A 4HA3A 4R27A 3DFPA 4IGNA 2A3CA 1WOAA 4FP1A 4W7UA 1Y5XA 4C91A 1XLDA 5LYRA 3A22A 3DYOA 4QEEA 3WMCA 3ZVHA 1VFUA 1ITCA 2PDQA 4ZBCA 1UKPA 2YJQA 1CLKA 1F3WA 3WD4A 4K3ZA 3W1TA 2IMWP 2DT0A 3WNOA 3TAKA 5I2UA 3SFKA 1BWLA 2G3NA 4PUMA 2WW5A 5M2FX 3PTDA 5KFVA 3VUPA 1QNVA 3VNKA 1LWIA 3RK8A 1P6CA 3WJYA 3K1DA 1QHOA 4CU6A 5G1YA 3VD3A 2J24A 1R2SA 3KHHA 4WGXA 4IMFA 2J7HA 1TTIA 4OOZA 5CZJA 2WCAA 2XSBA 1WXZA 5E6YA 1DJWA 1PHQA 1XX1A 5L9FA 4IG2B 4MWAC 1LBLA 1WZLA 2ZADA 4IIDA 2Z24A 3CIVA 3RRAA 1XLMA 3MVIA 1H63A 3JS3A 3E2SA 1HP5A 5DANA 1S5TA 2VQTA 1Q6RA 2P8BA 4F48A 3HMJG 3M7SA 1ZL1A 1TTQA 2J7FA 1VC4A 3MFIA 3WDPP 3DFQA 2OXNA 3BAYA 1GEQA 3L2LA 5D37A 6XIAA 2J7EA 3MUXA 5AN7A 2GZXA 1TRDA 3N3MA 1C9DA 3BGJA 1PIGA 2I14A 3OGVA 1TA3A 3KBVA 1C9WA 1POKA 3F2DA 4XBSA 3FKKA 1SW0A 3EXSA 4OVXA 4ACYA 3LXBA 5BXRA 4DBEA 1DJNA 1NDVA 3TCSA 4Q6XA 1IF2A 3N2OA 4WJEA 1YBQB 5F2MA 1K1DA 1ADSA 1KFCA 4L64A 1PPIA 3IGHX 1IM4A 4CLMA 1XKYA 3IRDA 3F4CA 4FX7A 1QRQA 3UP8A 8XIAA 4DL4A 3APGA 1EOMA 3EPGA 3UT0A 2DDXA 5CJNA 3WY1A 1UWQA 1DQUA 3A13A 4WRHA 5T14A 1QWKA 1TKKA 3WO8A 3W70A 2X7WA 4L9YA 2OGYA 3H26A 3W2MA 2Z1SA 4C1LA 1WCGA 4C6EA 5CC3A 3LXAA 4GVFA 1ZHAA 4ZO7A 3S5OA 1PJ9A 4CKQA 3M4HA 4KEZA 3L4XA 2VA3A 3L23A 3HZ3A 2B7PA 1U33A 1V5XA 4NQ1A 5FI8A 2PDFA 3BCDA 3VGFA 3BICA 5KFRA 3GIPA 1CGUA 1W0MA 4LRSA 3SSZA 1M65A 1IIGA 3BLEA 5KEZA 3MHUA 1MRQA 3F5KA 1K4GA 4F0MA 3C6CA 3VGEA 1UB3A 1GWJA 3GC5A 1XLCA 1XIGA 3E9AA 2E1WA 3QYQA 3V1HA 1Q8AA 2X1TA 2XN2A 5HATA 3S2NA 1U1UA 3PW4A 2ZRWA 3S83A 2AL2B 3MUY1 3TW9A 1E6ZA 3UYIA 3V5CA 1Q6CA 4DUWA 3SCNA 1PKMA 3B03A 3IVUA 2NXHA 2PLKA 1QI4A 4XG1A 4X63A 2ZXQA 3N2CA 3NA8A 3VNMA 2VRKA 4BWLC 3VIOA 4DM1A 4E8DA 2PDMA 2ASJA 3VXGA 4BS0A 4JY8A 3UPBA 3ZLHA 1S3TC 4Q43A 4BJHA 3BCFA 1V3JA 2XWDA 1N48A 1M7PA 4JPGA 3W7PA 3VIMA 4AUBA 4KEMA 1P7TA 1X8CA 3S9IA 5G1MA 1UROA 2NUYA 4XZ9A 4QWDA 4PTWA 1O60A 4KERA 1QK0A 2PDHA 3UCCA 1ZBCA 4GINA 3O2LA 4L56A 1RY8A 4HNNA 3QEZA 5T9CE 3LHUA 2CLEA 3H2AA 1A5BA 2GDUA 1YNYA 2VVNA 3PPHA 1H7PA 4YR3A 3UXKA 4B3ZA 3R89A 4PEKA 1SJBA 5G2HA 3WQ4A 4KGLA 1KTBA 1UMLA 5CC5A 4HPHA 3DAQA 4LAZA 1BKSA 2OZTA 4KIEA 4C1NB 4N9DA 3VCRA 1HW6A 1ZTVA 4OZOA 1GOIA 1PZ3A 2X1UA 3IJDA 1E6NA 2W6RA 2Y63A 1M53A 2YCKX 1H5VA 5BMWA 3BJYA 3LLDA 4AZBA 5A6TC 4MAVA 3SUWA 2J4GA 1V0KA 4AZHA 3CEUA 2ZZ2A 1TWSA 4Q7NA 4A29A 4IJCA 1MW1A 4TVCA 4S3CA 2PU0A 2QW5A 3A12A 4DXVA 2C91A 5ABHA 4LYQA 4MJ2A 1GVFA 1NFPA 1E3XA 2VEMA 3SRFA 3UGRA 2C1HA 4QG9A 4Q7BA 4O13A 2JEPA 4XVDA 1CX9A 2FLNA 2Q01A 3HG4A 3NGDA 3MSGA 4AC7C 3IVTA 3W88A 3IS4A 2ACQA 2Y4SA 3M7WA 2IKJA 5D9NA 3LNPA 1OFQA 3S1WA 1VLWA 1