2GSEA

Crystal structure of human dihydropyrimidinease-like 2
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
475
structure length
475
Chain Sequence
DRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of human collapsin response mediator protein 2, a regulator of axonal growth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Dihydropyrimidinase-related protein 2
total genus 181
structure length 475
sequence length 475
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.2: Dihydropyrimidinase.
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2gseA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2gseA02
2WM1A 5HMEA 5HMFA 1KRCC 4B90A 4HA0A 4GZ7A 2VR2A 3GUWA 3LA4A 4XD3A 4EP8C 3QY8A 1O5RA 1V77A 2AQVA 2P9BA 3LS9A 5LXXA 2VC5A 2AMXA 4LCRA 3QY6A 4AQLA 1RAKA 1ITQA 2PLMA 1POKA 1IE7C 2OOFA 3QY7A 4WHBA 1I0DA 1PSCA 3E3HA 1FWIC 3EWCA 1NDWA 1XGEA 3LY0A 2Z26A 1BF6A 4B92A 1I0BA 1P1MA 2P50A 2WJDA 4GBDA 3O0FA 1P6CA 2D2GA 2YB1A 3NEHA 4M51A 1XWYA 1JGMA 4QS5A 3F2DA 2OB3A 2Q01A 4CNUA 2XIOA 4EPDC 4CNSA 3GU1A 3UR5A 3IGHX 4C6IA 3EWDA 4C5ZA 3A4JA 1R9YA 3DUGA 3NQBA 3IARA 1UIPA 3WMLA 1RJQA 2FFIA 4ERAA 4GC3A 1UIOA 3OJGA 4ICMA 2FTYA 4WVXA 4XAFA 1FWAC 2A3LA 3ID7A 4I6KA 1EJXC 3FEQA 1ZZMA 4KEUA 5A6TC 4PBEA 1RK6A 4LH8A 2R1KA 2UBPC 1XRTA 3DC8A 3HPAA 2W9MA 4QTGA 3MDUA 3HTWA 1EJVC 2Z28A 5CH9A 2EG8A 1A4MA 4EPBC 2AQOA 2VHLA 3LNPA 2O4QA 2HBVA 3B40A 3F4DA 3UR2A 4DO7A 4C6KA 4L9XA 4H01A 2Z25A 2WJFA 2R1LA 3RHGA 3GU2A 1YBQA 3A3XA 4DLFA 4C60A 4L6DA 4CQBA 4KF1A 2GSEA 4IGNA 4LCQA 4LEFA 1EYWA 3TN6A 4C6OA 2VM8A 3ITCA 1FWFC 3T8LA 4H9TA 4UBPC 1EJSC 3GTXA 2GWGA 2DVUA 2IMRA 3FDKA 4LALA 3AU6A 4HK6A 1J6OA 1RJRA 2RAGA 1ADDA 2EG6A 3MSRA 4LAKA 4XD4A 3TN5A 4C5YA 4Z42C 4UB9A 4H9MA 2P53A 4F0RA 3QGKC 1FWJC 3LGGA 1QXLA 4RDZA 2E25A 2G3FA 1POJA 3GTIA 2KAUC 1NDYA 3IPWA 1E9YB 1FWEC 3URAA 4CEXC 3K4WA 2I9UA 3AUOA 4C6NA 1FWBC 2FVKA 2Z2AA 1WXYA 2R1MA 3IRSA 3NURA 3MTWA 2Z4GA 3ISIX 1YBQB 4BJHA 3AU2A 4QROA 2BB0A 1A5NC 2OODA 3PANA 3URNA 2YB4A 3LSCA 1EJTC 3K2GA 4J2MA 3ICJA 4C6QA 4D8LA 4CQDA 4DZHA 3E38A 1EJUC 4LCSA 4RE0A 2R1NA 3E2VA 4PE8A 1J5SA 4XAZA 4ERIA 4KEVA 3S2JA 4GY0A 4QS6A 1YNYA 3IACA 4HK7A 3GU9A 1VFLA 2ADAA 4IQJA 3CAKA 1K70A 1RK5A 4C6CA 4DLMA 3LGDA 1KCXA 4ZSTA 1YIXA 3TN3A 2Z24A 1A5LC 2O4MA 3PBMA 1V79A 3B0YA 4DI9A 3S2LA 2Z27A 1S3TC 4GX9A 4IH3A 1RA5A 2UZ9A 4GX8A 4H9VA 4BKNA 3PAOA 2BGNE 5FSDC 3OODA 4G7EA 4H9UA 1O12A 4B91A 4KETA 4XD6A 3TNBA 4DI8A 3GGMA 4KIRA 4GK8A 3SO7A 2VC7A 4IG2A 2QPXA 3S2MA 4R85A 3MJMA 1FWHC 1W1IE 3T81A 2HNHA 1K1DA 3MVTA 4EPKA 5FSEC 3ORWA 4LAOA 3OOQA 4WGXA 4YIWA 4IG2B 4V1XA 4GOAA 1GKRA 4KQNA 2CZVA 1KRMA 4XAGA 3DCPA 4GXWA 2YZ5A 1HZYA 4R7WA 3MVIA 4DZIA 1NDZA 2Z00A 4BY3A 2QS8A 3LU2A 4NI8A 3WYZA 3FDGA 4LFYA 1A5KC 2PAJA 4E3TA 3PNZA 4CEUC 3RN6A 4H9ZA 3F2CA 4J5NA 4G2DA 4PBFA 4C6DA 3S4TA 1YMYA 2QVNA 3G77A 3A3WA 1QW7A 1NFGA 3HM7A 3R0DA 1EJWC 1EJRC 1XRFA 2Z29A 4H9XA 3BE7A 4P5UA 4KESA 1M65A 3GG7A 5E5CA 4NP7A 1FWCC 1DPMA 2D2HA 3T1GA 4C6FA 2HPMA 1J6PA 1PTAA 2ICSA 4B3ZA 3C86A 4QRNA 3QGAC 4R88A 4KEZA 2PGFA 3TN4A 1R9XA 4KERA 2YXOA 2WJEA 1V51A 1YRRA 2GOKA 4IFKA 1A4LA 3UBPC 4C65A 2OQLA 3CJPA 4RDVA 4RZBA 2FTWA 3RYSA 1RJPA 2PUZA 4HJWA 2HBXA 4F0LA 2PGRA 4GY7A 2ANUA 4DIAA 3CS2A 1ITUA 3IJ6A 4DNMA 3F2BA 3EGJA 2GWNA 3OVGA 4XD5A 4C6PA 4IFKB 3UPMA 4IGMA 1GKQA 3O7UA 3LSBA 3S2NA 3F4CA 4NG3A 4LAMA 3D6NA 2F6KA 3V7PA 1M68A 1ONWA 1ONXA 3WZ0E 4CQCA 1P6BA 3GIQA 3URQA 4XAYA 3JZEA 1RA0A 4PCPA 4ZSUA 3MPGA 1FKWA 1EZ2A 4IFOA 3PNUA 4H00A 1M7JA 3UF9A 5HMDA 3SFWA 1FWDC 2Y1HA 3E0FA 3OU8A 4TQTA 4OFCA 4C6BA 4G7EB 2Z2BA 2GZXA 1E9ZB 1PB0A 1A5MC 1NDVA 1J79A 2HPIA 2Z7GA 4V1YA 3K5XA 1FWGC 3GIPA 4EPEC 3GTHA 3N2CA 1WXZA 1GKPA 2ZC1A 2Q09A 2E1WA 4MUPA 3RCMA 4C6MA 4LANA 2DVXA 3URBA 1KRAC 1KRBC 4I6VA 4C6LA 5G4HC 2EG7A 4PCNA 1UBPC 2VUNA 5AKQA 3B0XA 1V7AA 2HQAA 2OGJA 2I5GA 4CNTA 3KM8A 3OQEA 4GY1A 4QSFA 4RDWA 4AC7C 4DYKA 1UMLA 4IFRA 3IV8A 4IF2A 2QT3A 2DVTA 2D2JA 4JOMA 1A5OC 3E74A 4ERGA 1R9ZA 3E0LA 1PO9A 4J35A 4RDYA 3GRIA 4C6EA 1EF2A 1V4YA 2R1PA 1K6WA 4F0SA 4H9YA 4C6JA 3MDWA 3GTFA 4HK5A 4GYFA 2FVMA 4INFA 1FKXA 3MKVA
chains in the Genus database with same CATH superfamily
2RKXA 3PF3A 2J6VA 1FH9A 5KZ6A 2VEIA 3HU7A 3OVRA 2NX1A 3O63A 4N6EA 4DBWA 1MW2A 3EDJA 3N25A 1TFVA 1RBAA 2XIQA 3GFXA 3SCQA 3EWCA 2Z26A 1JD9A 2ZRZA 1ITXA 4D72A 3MY9A 3PZQA 1P6CA 3L12A 3IV3A 1UWRA 4F4YA 4QS5A 1TR1A 1BTMA 3ARSA 3GU1A 1NM9A 2V38A 3AIRA 2FDMA 3EWDA 1PXGA 3ZLGA 1Z6KA 3DUGA 1UZ1A 3PR2A 4EVZA 3I7RA 2WCAA 1E40A 3GE7A 5EMUA 3EX4A 4GI4A 5A8OA 2RDUA 2E09A 5LIUX 1KW1A 4IMEA 2NQLA 2QKFA 5KFIA 3DC8A 4ECLA 4QW9A 4QTGA 2ACRA 1F3TA 3FX4A 2Z28A 2PLJA 3LHTA 1IEIA 1MRQA 4FS1A 3W2JA 1ENUA 3F4DA 1KXQA 2OZ8A 1FH8A 1H63A 2W27A 4FOKA 1N8IA 4IPNB 1I2RA 3LMZA 1O60A 3KVJA 3SIZA 1T94A 3H23A 5HNUA 5T14A 3W28A 1XICA 4QX4A 1E1FA 3W84A 4JZ5A 3SJNA 1V6WA 4AF0A 3B9EA 4D6DA 3BLDA 3FAWA 3EB4A 1CECA 3BCDA 1RJRA 1EQPA 2IXUA 5A2AA 2PLKA 2P53A 2DZWA 4IX2A 4DZAA 1SGJA 3C2FA 2VXNA 4GQQA 3MP3A 4HN4A 4IPPA 1FFRA 3NQDA 3TAKA 1E9YB 1ESWA 1PS9A 4C6NA 4O0ZA 3CQJA 5KETA 3MO4A 1RPKA 2QUMA 5FEZA 1S0NA 4BJHA 5LHFA 2OODA 2VOTA 2XPKA 3EOUA 4Q8UA 4NU7A 3B0UX 1V93A 1UUOA 5AZ1A 4E6MA 3AC0A 4XBKA 4GCXA 2I57A 3CC1A 2YSWA 4KCVA 4H04A 3GC5A 5J04A 1LLWA 2CIPA 3QFEA 1VYSX 4BR1A 3QHOA 4DJED 1A5LC 1CXEA 2O4MA 5FJOA 4BA0A 3O05A 2PBGA 2ATSA 3A5VA 1VFUA 1OFEA 5B7YA 2DT2A 2C71A 2OMAA 3RPMA 2GQ8A 2CC0A 1KKRA 2BGNE 5FSDC 2PODA 3KOZA 4GKLA 4UR9A 4X61A 3ZQ9A 3JW7A 3KCOA 1O12A 4J27A 2B31A 3T44A 4HTBA 4D8ZA 1PIGA 1U83A 1OB0A 4R27A 3FSTA 3W2KA 1JCJA 3AXXA 3W1AA 3GXIA 1QTWA 3CO8A 3CUHA 1XSKA 3LHZA 4F2UA 1I2OA 4AB4A 2G3MA 3SQSA 1EDTA 4DBSA 2BHZA 5DXYA 3U57A 3BOLA 3EAUA 3P0XA 1LG1A 2FZMA 1ADSA 3SB0A 4KWWA 4K1WA 2ONEA 2POZA 1SR9A 2YBUA 5HINA 4M29A 4I7UA 4GQGA 3H2EA 2ZZ4A 4PSPA 3R0DA 2BXVA 4W7WA 3S6OA 3VNYA 1XLHA 3M0HA 2WC7A 2OQHA 1AQHA 5KT6A 2HPMA 1UHVA 2W8LA 1PTAA 1TX0A 4JDBA 1U5HA 4IGHA 4GNVA 1HW6A 1V6VA 4R88A 4CQ9A 2XFYA 3VNZA 4DX3A 2ZICA 3CIWA 1J0YA 1EC7A 4DQWA 1GOQA 3FJ4A 3L65A 3A4AA 5I00A 4OT7A 3TTOA 3ZR5A 4OIFA 5BNKA 2PA6A 3C8NA 4L9ZA 4LXFA 4KWVA 2FPYA 3VUPA 4EBEA 4JUZA 2QULA 3WFAA 7ENLA 5CG7A 3VAVA 4Z1CA 3DHUA 5CZTA 1UZDA 4I90A 4LVAA 3VIHA 3S1XA 1US0A 3LK6A 2CBIA 1WXJA 4BEQA 4PUMA 1X96A 5C54A 3CMJA 3V1PA 2J66A 3UJSA 4EYHB 4ASTA 4C90A 3DH7A 3PVXA 2PS2A 2VCAA 5A8PA 4JKLA 3W7HA 1RPXA 4Q4QA 4IJRA 1VPXA 1P5BA 2A5HA 3LV5A 1E3ZA 4HT3A 1NIUA 1DXEA 1FKWA 2EBNA 4IPJA 3S1WA 4HPXA 3WMBA 4H19A 4LEQA 3T2OA 5KFKA 3DEQA 1FWDC 4QWBA 2WC3A 4D1JA 4HU8A 3LZ5A 3LBMA 4PRWA 3UXAA 1DWGM 2GZXA 3QPZA 4AZ7A 3R4IA 1R3TA 2JF7A 2J13A 1O68A 3AHYA 4RCXA 1DP0A 2DSUA 1BF2A 3VVGA 1P0DA 3QH2A 3QQWA 2W66A 4PGLA 1BQCA 2PWUA 2HK1A 1A5UA 4I6VA 1GCYA 4GGBA 3MZ2A 1CGUA 4IFRA 2ZX6A 1W0MA 3GO2A 2IKJA 4JIHA 1R9ZA 4UTIA 3BCJA 5ABFA 1AW2A 1PO9A 3PUEA 1JCNA 5ECUA 3NQEA 2XVGA 4J9QA 4ZTYA 1V4YA 4EX4A 4I7VA 4TUFA 1JJKA 1EBHA 1TRDA 3TQ0A 4AWEA 4LYRA 1KLZA 4WKHA 3S42A 5HMEA 4FNQA 4AEOA 3E9AA 1TSIA 2ZZ6A 3LA4A 1TV8A 5AHEA 4NL1A 5EKYA 4LAZA 1V77A 2Y0FA 4QQUA 3W1UA 4DJFA 3HQ1A 4NHVA 4IP5A 3FV9A 4S1FA 2J47A 3W6YA 4K37A 4S3JA 3P61A 5EU9A 1MYRA 3R7MA 3SGGA 4GNJA 5HMSA 2GJXA 4GE8A 1XIBA 3INPA 2W8KA 2CITA 4YPJA 1R9YA 3RFAA 1AJZA 3BQ5A 3BQ6A 3SAZA 3LERA 4K36A 1IIHA 3OJGA 1BTCA 4LUJA 5EY5A 3ID7A 4I6KA 1EJXC 3A4XA 4YR3A 3Q58A 4PMZA 4RUAA 3UQNA 2ZTKA 5EMJA 3G0UA 3N73A 4A2SA 3BJTA 3TYBA 2YDRA 2ABAA 3VX0A 1VYPX 3FYOA 3LNPA 3KZSA 2YA0A 3LMYA 1A0CA 2ZA3A 1B3WA 2Z25A 2R1LA 4GNKB 1K02A 4M6UA 3EOSA 3A3XA 3QMTA 4CQBA 3P3BA 2BQ3A 2D3LA 4O3NA 2GSEA 3ZWTA 1TIMA 3VKKA 4M1BA 5AHNA 2Y61A 3BANA 1XIJA 5F4XA 1EJSC 1K8YA 4PB5A 3CHEA 3WEMA 2G95A 3NTYA 4HK6A 3T2PA 3H55A 2X0YA 1ZPTA 1OCJA 1EX5A 4RNIA 1F5ZA 5F4WA 4ONVA 1XIGA 2EG6A 4XD4A 1X1OA 2PC8A 3BJSA 2FTPA 1TUFA 2ISDA 1QO2A 1FWEC 2I9UA 4JV1A 3FJLA 3OG2A 3ZJ6A 2JEFA 2DY3A 5HANA 2C8NA 3AIEA 3RF9A 1AD1A 1LT8A 2QCFA 3G1YA 3ZLHA 2CLLA 4C7GA 3LTPA 3KLLA 1EJTC 3WK3A 3LCGA 1QPNA 3PFRA 4UOZA 4G8TA 2V81A 4WXZA 4UTHA 3VNKA 4OVXA 1UJPA 3GU9A 4P8VA 2XFWA 3CAKA 3QBUA 3UT0A 3WLSA 1TZ7A 1B3ZA 2PPGA 3QZAA 1TMLA 1TQXA 5L1JA 3TXVA 3WENA 3V5OA 2CFFA 3QM3A 3UU0A 1J2WA 1UYQA 3COTA 2J8FA 1OIMA 3MI2A 1N56A 2VJXA 3VE7A 1Q7ZA 3WFLA 2XFFA 1YTDA 2ZRXA 1OFBA 1P43A 1PCWA 4U5KA 2E8ZA 4Z1AA 1NWTA 2YCEA 1MQRA 3MVTA 3VD5A 2C2RA 4DL5A 4ORMA 1M3UA 2VFHA 3TQKA 3VNJA 1W37A 1ADOA 4V1XA 1Q6QA 1E43A 2XGZA 3Q8PB 2D73A 1ZBVA 3H22A 1S0MA 1K3UA 5IBXC 4XB3A 5JU6A 4ZQNA 1FCVA 1PZ1A 4UNIA 3N2TA 4MJ4A 1Y5VA 3ZR6A 3WQGA 3M0XA 2CLKA 1JZ7A 2ASHA 1OCNA 1G69A 2XVPA 5G4WA 4IL0A 4PMDA 2BTMA 3P0WA 3ZJ7A 2Y7FA 4D2JA 4MWAE 4P5UA 3RLVA 2IPGA 1GW1A 1VB9A 3PWAA 5GJMA 1JI2A 3W7CA 4IOTA 2OEMA 2ZTJA 4KWUA 3OBAA 3KBNA 2ZZ7A 1FXQA 4CLMA 2OKTA 2PTXA 3I6RA 4IFKA 3D47A 4EF9A 5AVHA 2ZZ3A 1RJPA 5I78A 4L4MA 3NYZA 1LUCB 5AYZA 2J79A 4DF0A 2OQYA 3VCCA 1OZMA 3ABXA 5I3GA 4NILA 4OECA 4DWDA 3EXRA 1DWIM 3TTSA 1E70M 3OVGA 1C92A 1K4HA 3DBPA 1ZAIA 2ZZ1A 1OYBA 1OD8A 3AXMA 5CSYA 4GZEA 2IPWA 1GKQA 3O16A 4I8YA 2HMCA 1OVDA 5A94A 3WMSA 4HZMA 2B7NA 3KCLA 2GYIA 3ELFA 5I06A 1SZRA 3DU0A 1W3TA 5XIMA 1XQLA 4CQAA 4FIRA 5I3IA 5LIXX 1W54A 3URQA 5M2FX 3GXDA 3TJIA 5BZAA 3WUBA 4O3SA 4UNLA 3RRXA 3WELA 3TLLA 4TQTA 4OFCA 4EYIB 1U5VA 3KUMA 4R5EA 3I6TA 2YKKA 3WFZA 1KGUA 4N4PA 3N9RA 2DPJA 4AWSA 3O06A 4DWSA 3IVTA 1FXPA 4CD7A 5BU9A 2E1WA 4QM1A 1KBJA 3CLMA 5DELA 4NNBA 5E93A 4C7DA 2YLLA 4J3ZA 1RBOB 1V7AA 3TSBA 1ELSA 4RW3A 1P0KA 4IF2A 1NOFA 3BLPX 1LBFA 4YVPA 5EBAA 3UWYA 3AZRA 1B1YA 3QEZA 5M03A 5JIWA 1EP3A 3NPXA 3U0HA 4EE9A 4E2OA 5C2CA 3MBFA 5A1AA 2DZVA 1V02E 4JN6A 3DYMA 5C9XA 3CUGA 4HVXA 2P76A 4H41A 1KRCC 1FBAA 4AD2A 1UASA 4WD0A 5IFPA 1GQNA 3TE9A 4FXFA 1S97A 2WHKA 2F84A 1AH3A 1KFEA 1AZ2A 3BMVA 4UQDA 4D6FA 2OU4A 2G8ZA 3I10A 1JX4A 5DQPA 2ZE3A 2CLEA 3GNDA 9XIAA 2JALA 4PL2A 3NEHA 3F2DA 5D4YA 4CNUA 3UYCA 5KT4A 4Q8FA 3CPUA 3OA5A 3VIKA 4IIFA 2BXZA 1A0DA 1RJQA 3I4EA 4ED8A 4WVXA 4LUIA 1OGBA 1VFTA 2VD9A 1S5MA 3PULA 5FJJA 2XCAA 2R1KA 2WVUA 5AC6A 3W86A 2ALZA 2V5BA 4UUIA 3MDUA 2RH9A 3VDGA 3LM3A 2Y62A 2BX7A 3N6JA 1BVZA 1M7OA 4NQ1A 2QUUA 1X39A 3RAOA 1B0IA 4U28A 1X6NA 4NAFA 1CX9A 4Q4PA 4XZWA 2DIKA 3N6QA 4LT9A 3EA2A 4DLFA 1PZ0A 1QW9A 3M5YA 3P5YA 4W9TA 4WCJA 3ATYA 5LA1A 2B7QA 2WHMA 2A7NA 1JXLA 2IKIA 3VC6A 3QR0A 2GWGA 4DY1A 2PDIA 4BQ4A 3GWQA 2BY2A 2NXIA 1E4IA 1TV7A 3A9BA 4XZMX 4W8BA 4ZO7A 3SCVA 2CHNA 2Z7KA 4LAKA 3OZYA 1XFCA 3KRSA 4UB9A 1UPMB 3PJTA 4FS9A 3LB0A 2QCDA 4O13A 4OUEA 3S5NA 5KFMA 3BAWA 1QBAA 4DM1A 4ZE4A 3IK4A 2VYOA 5CPQA 4CEXC 3SN4A 1LBMA 4RL3A 3AJXA 2NV2A 2CKSA 3WQEA 1X97A 4Q32A 2FGLA 5AY7A 4J9OA 5XIAA 5BMXA 2VQUA 2IUZA 4S38A 1ISWA 1WKEA 3AICA 4M81A 3WDIA 2GVGA 4AHOA 4LCSA 1QW8A 4PSRA 3U6WA 1J5SA 2A21A 3HPXA 2A3EA 2ZZ5A 1ZU8A 2CWNA 1W2VA 4JNYA 2YJQA 4GVHA 5D09A 1US2A 2PDCA 2CZFA 4IH3A 3GVQA 3VGHA 2W0UA 2PMQA 1VLWA 4KFNA 1DYSA 3GUGA 2Q6ZA 4N6FA 1VQTA 3R1ZA 2BASA 2CZEA 1BYBA 1LWHA 4W93A 4HD5A 5KFQA 3DZ1A 1XIMA 3QMSA 1MEIA 4IHCA 3IJDA 3E6EA 7ODCA 3T5KA 1I2NA 1WQ5A 5G2IA 1XG3A 4ML9A 4FA3A 1SO5A 3TMQA 2A3CA 1ZCOA 2NLYA 1W17A 1DKWA 4FNUA 3R79A 2PU0A 4XAGA 1A80A 4H8HA 4GXWA 1IT0A 2GOUA 2QJMA 4XX6A 2I9EA 3CUFA 3KTXA 3MVIA 1Z44A 2REQB 2YL8A 1RD6A 2QCCA 5HWJA 1XLIA 4QP0A 4MJ2A 4JTSA 3KE0A 1F61A 1OF8A 1TPVA 3FCPA 3HF3A 4G2DA 2OSWA 3QPYA 2Y88A 2RHGA 1EEPA 1IF2A 1QW7A 2VDGA 3P6LA 3HM7A 4DNHA 3WD4A 3B04A 3SGZA 1IR1A 1H09A 2Z29A 3B0PA 5LA2A 4OUIA 5E5CA 3TYCA 4UCFA 4GVGA 4UTJA 2XWEA 3BW3A 2YW3A 3D3FA 5EYWA 4XKYA 2OLAA 3NWRA 1MW0A 1XRVA 1FX6A 3ARZA 2VA3A 4QDPA 4R34A 2Q8LA 1UP0A 3GNPA 3TN4A 1B5TA 2QJNA 1I9CB 4BFAA 4QBXA 3BG5A 3ZJ8A 2H8ZA 2FTWA 1UB3A 3GBDA 4PMRA 2HS8A 1GYLA 2J77A 1HKKA 2PGRA 3IIZA 2H3DA 4IRDA 4U3AA 2E40A 1VENA 4QSHA 3CTTA 4QWEA 3AJ7A 4WDXA 5KMYA 3UPMA 1F8MA 3QKEA 4HN8A 4F40A 1T96A 3GVWA 4ZMGA 2HTMA 2DU2A 4TX6A 4WUIA 1TPUA 3L7RA 3OHBA 1NH6A 3MR2A 5BWAA 1ONXA 2WMIA 1OFAA 3CAWA 1WX0A 2FPTA 4JFSA 1U22A 5PTDA 2HXTA 3VOJA 1EPXA 1J93A 3NUKA 4GCAA 2NT1A 2BMBA 3DGBA 1OFPA 4PB3A 4ZSUA 3C0JA 5FJIA 1LOQA 4F4WA 2Z2BA 1CTNA 3V5CA 1I4NA 1S46A 1W5PA 5TBOA 3IWPA 2QMJA 1ECEA 1OM0A 1GKPA 1TRIA 4DRSA 4GMEA 1WUFA 1E6SM 4F66A 1XYBA 1CGWA 1HVQA 2WNWA 1PUDA 4UTLA 5DBUA 4AZ5A 3IS4A 2AKMA 2OYLA 1O5QA 4QSFA 3AFBA 1UMLA 2QT3A 3REQB 2D2JA 1J0HA 2BY1A 1KLYA 3M16A 4FNRA 5FESA 4RDYA 2VVNA 1QI2A 3H2FA 3V18A 4ML4A 4FK9A 4JFUA 4WK9A 4Z1YA 1HGYA 2E4TA 2E5CA 1D9EA 2PSNA 1P7TB 4HK5A 2OR2A 2R82A 1OFDA 3VZYA 2PDWA 1R6WA 4GZ7A 3PJXA 2VR2A 4JDYA 3QY8A 3PW7A 2ZVRA 1JNDA 4IUGA 5DGAA 1WAUA 4LCRA 2RUSA 2NVDA 1ITQA 3MSYA 3QRHA 3TZNA 5DO8A 4J2PA 4PRRA 3MV11 3TTYA 3WNKA 2NSOA 3UNTA 1OBAA 1FWIC 4IJCA 1KFKA 4MLJA 1OF6A 3DG7A 3VKAA 3SRDA 3BGAA 1PX3A 1V8EA 5KFRA 3Q65A 4QWDA 5FACA 1UQZA 4F79A 1QNQA 4KCWA 4UFJA 3UR5A 1HN1A 2QPSA 1O5XA 1Q8AA 4ZEPA 3NM1A 5BXTA 2FFCA 3CIVA 1Z69A 2XGIA 2A3LA 3MUCA 1QCWA 2O9RA 3UG4A 1LLZA 4JY9A 2WZEA 2Y4SA 1JXJA 5HUPA 3TCEA 4LH8A 3DN5A 2HVNA 2V9WA 5CAHA 1SJAA 3S0CA 4GA8A 3CHCA 4HHPA 4Q3MA 3THCA 5C6MA 1PDYA 1JZ6A 4OE7A 3UXDA 4GVFA 3QR3A 1B30A 4MZ8A 3NPVA 5K2ZA 3KDNA 2D0HA 4QJ5B 5G4EA 2FVLA 3KL0A 4M8UA 4NYUA 2ASDA 2IMRA 3C52A 4UTUA 3ENLA 5DRCA 3W25A 5AN7A 3G3DA 3G1XA 4GABA 5DRIA 1AH4A 5CPNA 3L4UA 4FHAA 1LL4A 1BAGA 2WM0A 3RBDA 2EPOA 1XQKA 4LV9A 1XX1A 2VTFA 3UZ5A 4ECWA 1R87A 3LHVA 3PZIA 3OVPA 4Q8PA 3FHAA 4ECZA 1UC4A 3SUSA 3IPWA 4RUBA 4WY0F 1TREA 2ZOXA 1HL9A 4AWTA 1NWSA 2R8KA 4QJ4B 2FLIA 4TOQA 1R2SA 3EEZA 1TCMA 4X60A 3URNA 2YB4A 1W1VA 2C3ZA 2PTZA 2ZBTA 3QF0A 1GVYA 3UY8A 1W1YA 4CN1A 4RE2A 2XN0A 4OJYA 2ZADA 4CVUA 1EUAA 1E6QM 3GG1A 4A3QA 4OOUA 1ISZA 2F2KA 3K8MA 1E56A 4IRCA 1RK5A 1K6AA 2NVCA 2TSYA 4PMOA 1YNPA 3MI3A 3U3HA 5IHRA 2VGGA 1V79A 2TAAA 3N1AA 4GX9A 1XCFA 3WDPP 1KWGA 4GBUA 1RA5A 1G4TA 2UY5A 5AHFA 1ZETA 2Y89A 2RGLA 2DT1A 3VK5A 3LTYA 1VCGA 3ARXA 2CBUA 3E02A 1L8NA 4A35A 4X3ZA 1L9WA 1RP8A 1WZMA 1Z32X 5A6SA 1ISVA 4YJ5A 3GV7B 1FRBA 3NL5A 4WGXA 1GPFA 1LWJA 1GKRA 3HJZA 4MB3A 4DO4A 1GORA 3WD1A 4KQNA 1DBTA 4J3XA 3AZSA 3RLHA 2AL1A 4A05A 1H7WA 3S47A 3LU2A 5J8LA 5HK4A 1A49A 2PC4A 3OHMB 1A5KC 3N9KA 1SPQA 3GKAA 4O4WA 2R91A 4B5TA 2PP1A 2W91A 1M1BA 2PURA 2VRKA 1TCDA 5C70A 3N2OA 1K7FA 3UCDA 2VA2A 1HJUA 1KXTA 1C8VA 1LRTA 3KX6A 3FYPA 3PZMA 5CJMA 1WBHA 1XGZA 2W9CB 9CGTA 5FAJA 2YW4A 1XV8A 1TJRA 3OZMA 3K1GA 4JEJA 2BOFX 1VKFA 1K9DA 3M07A 2E6DA 3JR2A 3L5LA 4AVFA 3PZPA 2PRHA 2V63A 3CNYA 1AQ0A 3H2CA 3M1ZA 4UIOA 3BUVA 4MZYA 2WK2A 4DL2A 1UMYA 1QUMA 3WBWA 4ZOEA 3T78A 3WN6A 1A47A 5EGRA 4OTKA 2DH2A 1N55A 4BI6A 1GZ1A 3C2YA 3WY1A 5JBFA 4DIAA 3FYYA 4B5NA 1AW5A 3LHUA 2X09A 1YHTA 4ICNA 1IXOA 1H2JA 2VEKA 1SM9A 3HPFA 3NDYA 2OLHA 6TAAA 3MCNA 3T05A 4ES4A 4PYSA 2YL5A 2B81A 3V6KA 2RJHA 3BGGA 2PDBA 4CQCA 1C9DA 1S5WA 1KD0A 2IKGA 1CGYA 2VR4A 3O6AA 1DJQA 4KKXA 3TYDA 4V27A 3MR5A 5CZJA 4PCPA 5G1MA 1EZ2A 3PNUA 1TPH1 5HMDA 2Y1HA 3OU8A 5KFSA 3UG5A 3NQMA 1DVJA 3H7RA 4MFEA 1UR9A 1NARA 3UR8A 1DWAM 3DG6A 3H2OA 5AZ0A 4TR9A 3LHYA 3QXBA 1SMDA 1JPKA 4WY0A 1W8SA 4S3DA 1KQZA 4LANA 2GGJA 5LA0A 3G6XA 4LUSA 1FFQA 1EX1A 4X0NA 2VUNA 1YDNA 4Z1BA 1GVQA 2HQAA 4GZJA 2XSXA 3SRFA 3FA5A 2OGJA 5DQIA 3F5KA 3KM8A 4GH3A 4HOWA 5I07A 4KMQA 5DG9A 1TJ0A 1ZENA 1QT1A 5M1TA 3E74A 5D9NA 3TAOA 4OGZA 3ZJKA 5H8MA 3WNLA 4Q7NA 1VFSA 5D30A 2VGIA 3W82A 1K6WA 3GIIA 1XLMA 4EANA 1JYWA 1O4UA 4FBTA 3S1VA 1PV8A 3G22A 4ADTA 1QK2A 4B2DA 4Q7BA 3NQAA 2AU0A 4HGXA 3VGEA 2X2YA 3UY7A 4NZ4A 1J18A 2AQVA 1K9TA 2YCLA 1F07A 5D2YA 4O18A 4LVFA 3LBCA 3BSHA 1DJZA 3EPIA 1HL2A 1IE7C 5K4ZA 1BWVA 3CV7A 4LYQA 5D8ZA 2FJUB 3L2MA 1F9CA 1H7RA 4LGXA 1YE4A 3KBJA 1WOAA 2WJDA 1FWTA 4O53A 4DPPA 3LLDA 1GONA 2PP0A 2D2GA 2P0IA 2WWCA 1OADA 1HJXA 4JTKA 3P82A 3W01A 5D2XA 2OSXA 4QHRA 4YQWA 4Q8MA 3HV8A 1QNVA 5ABHA 1MI3A 3T5LA 4XUYA 2BY3A 4O19A 3EPMA 2J75A 2YR1A 3F5JA 1QO5A 3OB8A 5DG7A 3KRZA 1DWFM 5C5YA 1FWSA 3HFTA 3UGRA 1XRTA 1B2YA 4HA3A 1HX0A 1EJVC 2WPGA 1A4MA 2H8XA 4EPBC 4HIBA 1ZJIA 1PTDA 3BK0A 2P1FA 3H2MA 1W1ZA 3S3GA 1L0PA 3QYQA 1N8WA 4J4KA 2XGQA 3C4UA 3IIOA 1Y8BA 4ECXA 4LCQA 1QU4A 5BYWA 4LS1A 4G56A 4IICA 4MZ1A 4UBPC 3BMXA 4QAWA 2GSJA 1SVDA 2H3BA 3PUDA 5G1YA 1FH7A 4WXYA 3H12A 2PWHA 3BOXA 5LZLA 2J6TA 3DXIA 3OZOA 4UZUA 3ZIZA 3CXOA 4W4QA 1QJWA 3CHDA 3LCHA 3WQ5A 1JCMP 5AYIA 4HZ7A 4B3KA 3B3DA 3CMFA 3BQ1A 2W61A 5I3DA 4GUIA 4LYKA 3LTSA 3G5EA 1D2KA 3W73A 4L4OA 4AG0A 3S2CA 3EYPA 2FQIA 3ZSTA 4HYKA 3VGDA 4JTUA 2CLMA 1CYGA 5F7UA 2BXYA 1U33A 3NFUA 3DFPA 4JN8A 1WZKA 3EPGA 5CGTA 4DZHA 2NQ5A 3G1RA 5BRQA 3TW7A 2ZFAA 2WZMA 2YYTA 4PMNA 2D24A 1VPYA 1WCGA 3NQGA 4FI4A 1E4NA 2B4GA 2OPJA 1Q66A 1U30A 5FJPA 3JRKA 5F2IA 5E6ZA 5LSMA 1VRDA 4GX8A 1TWSA 5F1VA 5FJTA 4BF9A 2Q3RA 2AQ4A 5KT2A 3WX7A 3OBKA 3QOMA 1VJSA 1KGWA 1GQIA 3XINA 4TMCA 1IEXA 3GGMA 3QZEA 4GK8A 3TH6A 5A6AA 4KS0A 1H51A 3UWQA 1FWHC 3DFHA 5FAGA 1K1DA 4WSJA 4M24A 3RAQA 3GHTA 4RX0A 2R94A 2EKGA 1NY1A 3JU2A 1UA3A 4FLRA 5KFUA 2V3FA 3C61A 1JIBA 3TDFA 4MM1A 2YZ5A 2GVYA 1K03A 1LRNA 2BNJA 2GVJA 3GIKA 1DJHA 2CESA 3PY2A 4JYDA 4GUGA 1O95A 4PTNA 1S2VA 3VTRA 5CCZA 3H53A 3Q67A 5G2WA 3T6CA 4YNGA 5A6MA 1RALA 3PFMA 1I6NA 1YDOA 1EPVA 2FMNA 2VELA 3NO1A 1JEZA 4ZOAA 2XM2A 1TTIA 2J7BA 3MUZ1 4DJDA 5E9XA 3ARVA 3BLFA 5C7VA 3LDVA 3TC6A 1FDYA 1XIDA 1FP8A 2XN1A 4J3UA 3C86A 1XF0A 2MANA 4L61A 2UVWA 2CBVA 1V0KA 4AHPA 2A7PA 4DB7A 1IEQA 3QVQA 1QVBA 1EIBA 2I14A 3AALA 4GH1A 1SFJA 2OQLA 3VO0A 1M01A 4QCFA 3O6DA 2W7OA 4GUJA 3RR4A 3EWWA 3EX3A 4AH7A 4GY7A 3QFWA 5DCBA 3VDAA 3MQTA 4OZOA 2ANUA 2OGYA 2J25A 3PWGA 4J3WA 1CB7B 3NL6A 2DP3A 2GWNA 4W8LA 2WKGA 4CKQA 1IEVA 1YE6A 3L4TA 1LRQA 2C19A 4XISA 2W62A 1XIHA 5U4NA 1B54A 3A6OA 3W22A 1M68A 3V75A 5I7GA 1ONWA 4HNOA 3APTA 5D05A 2C7FA 5DGBA 3VFCA 4HNUA 3GDLA 2JEPA 4W7UA 3WDQA 3GDMA 3GIQA 4FX6M 3VKJA 4DHGA 5BOFA 3EWYA 3L21A 3DKJA 2G5WA 2NUWA 2QV4A 3GXTA 2KX9A 4Y9NA 4G7EB 5IFTA 1XLJA 1KTNA 1BYDA 4PCSA 2Y7DA 3N13A 4MMWA 2ZCGA 1JNEA 2C16A 2Q09A 4UQCA 2XSAA 1AODA 3T0TA 3RCMA 4A6GA 4MB4A 2D0GA 4LS0A 4Q8QA 3VDCA 3URBA 5G4HC 1SW0A 5TD4A 5ECVA 3OQ8A 4MY9A 3UPBA 3OQEA 1JVNA 1NQKA 1H7XA 4RU9A 4S23A 1GOOA 3LXAA 1R3QA 1FHLA 1DORA 3VIJA 4X0VA 1PKMA 4C6EA 5DCDA 5CSUA 1S2CA 2WZTA 5RUBA 4H9YA 4GC6A 1W56A 3NGJA 2FPVA 3MWCA 1NWUA 3G0SA 1WA3A 2XUCA 1Z41A 1CXHA 2EJ1A 5HMFA 1CB2A 2OLSA 2VX4A 2IS7A 1UW9A 1EF3A 2D23A 3DENA 2QAPA 5I02A 1D3HA 3ANVA 4FXRA 2O7SA 4L6HA 1XS2A 2GQAA 1LCOA 4MIMA 3TFXA 1NDWA 4FALA 4S3KA 1E4MM 4GBDA 4Y7EA 1BSIA 2Q01A 3UETA 3W7PA 4CNSA 1BPLB 3K4DA 5C71A 3QYSA 1S10A 1JFHA 3I7QA 5L9FA 5FL1A 2EO7A 3TYUA 2BSLA 4HOXA 2W7PA 4HHLA 2LLEA 4LOCA 3N3TA 4QEHA 1W9UA 1H60A 1VJIA 1I1XA 1LJYA 4AVNA 2VQTA 5A6TC 4PBEA 4WOQA 1XLLA 3BSMA 1J0JA 3DOPA 1QPRA 1A0EA 1IZCA 3P7YA 1V0LA 3UR7A 2EG8A 4GYPC 3DFQA 1ZBKA 1E73M 1S1PA 1H7OA 4C6KA 4IXXA 4A3UA 4REQB 2PF0A 3DG3A 2WZHA 5KFTA 3EKLA 1OC5A 4R53A 4OBTA 1WPCA 1EYWA 4B4FA 1JR1A 2QGYA 1XBVA 3V36A 2XFRA 3MW7A 3B05A 3TTQA 1VZWA 2J7HA 1UP2A 4OHQA 3T8LA 1J9YA 2WNQA 4JEQA 4YL2A 3EDEA 1Q4WA 2QPUA 4GJIA 1DJYA 4E4UA 3CZEA 3P93A 3PW0A 4HPHA 4Y90A 3LRMA 2WSKA 1Q6FA 1TV5A 1WDQA 4RK8A 2YX0A 1Q13A 4XSMA 4IP4A 3AMDA 3W76A 1IWAA 4AD3A 1BD0A 4IMDA 3URAA 2BVWA 1ZQ5A 4WDTA 2PWDA 2YL9A 2J7CA 1E6RA 4AD0A 1JXKA 3PZVA 5A8MA 3SY5A 3AU2A 2SFPA 4YTQA 3UJ2A 3APGA 3W9ZA 3LSCA 3APYA 4FR1A 1JQVA 5JIPA 4RE0A 1IXNA 4B5VA 4QG8A 4OOZA 4JNMA 2QV5A 4PE8A 3ZOAA 5I09A 3MKCA 1JCTA 1VIZA 4FOUA 2QIWA 3N12A 2FHBA 2WB5A 1TVPA 1UR3M 1ZAJA 2PCQA 2Z1XA 3OLGA 3CPRA 2Y85A 3MU7A 5LHEA 3T4WA 2WMFA 3W7NA 1C93A 2EJAA 4YLWA 3EOLA 4LF1A 3IJQA 3O15A 4QGCA 2E5DA 1UUMA 3AZTA 2VR5A 3M9YA 3LHWA 4AFYA 1QI5A 1KM0A 3M0IA 4H9UA 2W67A 4NLGA 5A6KA 3GIMA 1TPDA 3G3MA 2R8HA 2NQHA 2WAGA 2Z1WA 2YOCA 1E55A 5FF3A 2OOGA 4AISA 3FAXA 1P48A 2HRWA 1R3RA 1R85A 2W9BB 3F4WA 1PCKA 1T99A 1XHGA 3RX4A 3BO9A 1NFBA 5BRPA 3PTKA 2B0MA 5HNNA 1VPQA 3M0KA 1Q7QA 4MDOA 3WSUA 1BWKA 2GQ3A 2BOGX 5CKSA 3AHTA 3M4HA 4F0MA 1Z7AA 1MSSA 1UG6A 3EMQA 4R8UB 3AWNA 1K8CA 2Y63A 5D8WA 4MADA 1EJ7L 4H9ZA 3W27A 3MMWA 4HU0A 3SBFA 1KM4A 3WQ6A 2GJLA 2QZRA 3BMWA 1IIGA 3UP8A 2FLNA 3GAKA 4N02A 2EPLX 4UTWA 4HHHA 4CNOA 5H1WA 2D2HA 1G6CA 3PZTA 3RO8A 3NGDA 4E5TA 2XC9A 5TIMA 4MJZA 2P3EA 3SCOA 3T7VA 3CEUA 1CXIA 3RIKA 3Q4DA 3U5UA 2EGZA 4JCLA 2X8RA 3GM8A 5DQGA 2WMJA 3VM5A 3CL8A 1KBBA 4HJWA 3VOGA 4LUYA 4QWCA 2G37A 3HG4A 4JV2A 3B8IA 4XAPA 3PZOA 3CS2A 4TO8A 2DSWA 1EIXA 5H91A 3AMKA 1DE6A 2VEPA 4FF7A 5LNVA 4LVGA 4Q22A 1UD6A 5K4XA 4K8GA 1QNRA 1RQHA 5G1TA 3EPOA 1UD4A 4QISA 3FVMA 1CDGA 2PDQA 2C79A 4J7RA 1D8WA 3ITVA 3HBLA 4D8AA 3SFWA 4US5D 1ZP3A 3CU2A 2OJPA 4WSKA 3V3WA 4Z2HA 4W85A 1AL8A 5HDRA 4GXMA 1W3LA 4HA1A 4JTGA 3PZUA 3PN8A 3WLRA 2WVTA 4WJ8A 2JGYA 1PKNA 4MUPA 1SZNA 2F9RA 1F3WA 1TB3A 1EB3A 4PTXA 3S9ZA 4U3CA 2FIQA 3L68A 1NTHA 2AGTA 1HQTA 3I65A 1T6MA 1RCXB 4F2BA 4RDWA 3Q8SB 4NNCA 1CLXA 1U5JA 1YADA 2PU1A 1F8IA 4IPIA 2WC4A 5EWFA 2BLEA 1EF2A 1BKSA 4K2SA 3NZPA 2PE4A 5TAOA 4P61A 4QWAA 4S3GA 3MB9A 1JL8A 4BHYA 2BR0A 4O3OA 3TX9A 5G5IA 3VM7A 2CZDA 1UPPA 3BAXA 3H4GA 3VOIA 5BW6A 2P9BA 5D37A 5LXXA 1OHLA 3ME3A 4JTJA 3QTPA 3LLFA 1DJNA 1JPIA 3BSGA 1WBJA 4IZGA 3CTLA 1XYMA 3H2NA 4PEEA 4DJEC 2XM1A 3U7BA 2CKRA 4GO9A 3STEA 1I0BA 1P1MA 2QNEA 4I3GA 3RMJA 4GO8A 3R8HA 5FOOA 1UWAA 5AC4A 3N18A 3PTMA 4HMNA 2XIOA 1I1WA 2IQTA 3VPLA 1LLOA 3QZ6A 1U1JA 1UIPA 3ALFA 3WLMA 1A5CA 2CLHA 4WLCA 2Y5JA 4ERAA 4ICMA 4AAJA 4UWMA 2J7GA 1N82A 1VHNA 4MWAA 2O0TA 3WLTA 1ZZMA 3VKCA 2YXXA 2ZIDA 1FHVA 2A6LA 4GYKA 4HMCA 2OYKA 5A69A 4L7ZA 4ATLA 2UWFA 1JIHA 4MVAA 4XUGA 3IAPA 1D7FA 2B7PA 1TKKA 4BWLC 3S5YA 1Y5XA 1PZ3A 4PN2A 3GHRA 4Q8OA 2GK1A 2RDTA 1Q6LA 1HKMA 4G1NA 3R5EA 4HMDA 1XD0A 1PEZA 4L1GA 3W7IA 4NXKA 1MEWA 2ZWZA 5T9CE 2ZA1A 3NO3A 3BV7A 3TA9A 3N14A 2V9DA 5JQ9A 3GTXA 2ZUVA 4TV5A 3VC5A 3BTNA 3DFOA 3T09A 2YDSA 3AU6A 4EK7A 2DUXA 5KZMA 1SO3A 4CD8A 3BJFA 4RNMA 1PJ9A 1F76A 2Y8VA 1OYAA 3WF3A 5JH2A 4AZ6A 1QATA 3VGFA 3QGKC 4GUFA 4CVWA 3LGGA 2WKJA 3NSMA 4FO4A 4AXNA 4ECSA 2V30A 3BLIA 4WDUA 1RV8A 5L1KA 3M5ZA 3GQCA 1JYXA 3VIPA 2ON3A 4I9TA 3TCSA 5GNXA 3ISIX 4QROA 5KFXA 3KZPA 4JKMA 3IUHA 4B15A 1AK5A 2FB2A 1UH3A 1VIWA 2V5CA 4PTDA 3A13A 3NA8A 3W0KA 4AD1A 4WEVX 2DPIA 2FZDA 2QJIA 4O12A 4ZL1A 3PK7A 3QHNA 3T9PA 2E67A 2R1NA 3E2VA 1EHAA 1KCKA 4ERIA 3EWXA 1TG7A 1YKWA 5ABGA 1R7AA 2ADAA 3S46A 2FDSA 1J0IA 1YTKA 3G6YA 4LC8A 1J10A 4UZSA 2ZDSA 2E9BA 1KA9F 2VGFA 3WQFA 2O9PA 4JFTA 4ZO9A 3LQGA 3S2LA 1XIIA 3RCYA 4PMUA 1XLDA 3STPA 4NNAA 4XZLX 4YR0A 1V0MA 4GYJA 5CC5A 2YBVA 4ZOBA 1DHPA 3KVLA 1B4EA 1GPWA 4OBSA 1DOSA 1N8FA 3ARRA 1Q2SA 3SCUA 1GUVA 5ABEA 3W71A 1TPWA 4MKVA 1CT5A 1CLKA 1WP6A 3ORWA 3GC4A 1GOWA 4NSBA 3RJYA 5CLWA 5I3FA 4IG2B 4HNNA 3Q8QB 3P84A 3RG6A 4MB5A 3H54A 4AY8A 4XZBA 3WLJA 2CERA 1ALDA 4UTTA 4U33A 3MMUA 3STFA 2O55A 1Z48A 2WBKA 4YHEA 5E9AA 4QLLA 2Q8XA 3E2SA 5GVJA 4BY3A 4LW7A 2DT0A 3WUEA 1PWLA 4Q8VA 3JS3A 3NG3A 3UCCA 1JCLA 2JFEX 3G77A 3TQ1A 1XR2A 2DDXA 1W5MA 4NAEA 1Q85A 3SW6A 1DTUA 1PIFA 2PTWA 3ITLA 4IIGA 3RB3A 4Z0JA 3FEMA 2WZIA 3EXSA 3GK0A 3WBXA 3DHFA 2WWDA 3R94A 2TMDA 1LP6A 2YXOA 5FJUA 3CZGA 3NVTA 1XDJA 4F48A 1IT7A 4F4RA 4PMXA 2X1SA 3WF1A 1E5NA 1A4LA 2YFOA 4WY0B 2XG9A 4CCCA 4MSSA 4OV4A 4RW5A 2ZUMA 3AYVA 3ZMRA 2HBXA 2WNZA 5IDZA 4TVUA 1EKOA 4H8NA 1AH0A 4KIEA 4QR6A 1REQB 3UZJA 4H1ZA 5J5RA 3W72A 4DNMA 2BDQA 3F2BA 3W1MA 2OO6A 3RBEA 2VWSA 4IFKB 1W3JA 3TA6A 2VFEA 3H21A 5KSWA 4ZGYA 3TFCA 1G01A 2W79A 1S0OA 3S2NA 1M53A 2RGMA 4L80A 2AL2A 1V6XA 2WBGA 1IZJA 1XBYA 3G6LA 4KCTA 1VF8A 1ZP4A 3WLLA 1K8XA 1YXYA 2QUVA 4Q33A 1X98A 3USZA 3OVQA 4XTIA 2HCVA 3VUSA 1UKPA 5HR7A 1ME9A 4DL3A 4JX5A 2NWSA 4AXKA 2C22A 1B3VA 2WHLA 3QTGA 1REQA 4YWIA 1C90A 1SJBA 3UF9A 3RUBL 5M3WA 4LTSA 4Z2GA 1J0ZA 5F2MA 4ZXOA 1CEOA 3OYZA 3CEPA 3R6IA 5T8GA 4H83A 3K5XA 5K9DA 1H1YA 2Q02A 4Q45A 2QCEA 4UMAA 1VGAA 1JDDA 4M0XA 3WLOA 1C7SA 3GXPA 3H24A 4DEZA 1O66A 3ARTA 4TX8A 1KRAC 3RAXA 3ZVHA 3SDOA 4LUTA 3H4WA 1F73A 1Q2RA 1FDZA 4ZODA 2DJLA 2YZRA 3R58A 3ZFHA 2ZWYA 3UGVA 2DVTA 3V0SA 3AXKA 3AYRA 4JOMA 4ERGA 5A2CA 1TWWA 4UFLA 3N2XA 2C0AA 2WSYA 3CM4A 5D9PA 1DIOA 1OFOA 3N19B 5T26A 1QWKA 4Q4KA 2IPFA 3MDWA 5EWEA 4FR6A 1XG4A 1BXCA 4XSLA 3PR5B 1UR0A 2ISFA 3CHFA 3BAIA 3GIYA 2BODX 1US3A 4ZO6A 3SCRA 4YP3A 1PBGA 4IUOA 2WMKA 1MFUA 3Q37A 4I5XA 1IR2A 4EP8C 3ARWA 1O5RA 3M41A 3GR7A 1GVEA 1WKDA 5KG7A 3CYVA 1U2YA 4NX5A 2NVAA 3DI0A 2G3JA 2TPSA 4JTLA 2P5NA 5GPRA 3PS7A 4AZCB 3NCOA 3A9IA 4J9KA 3NXFA 3VINA 3GNNA 1XSJA 3BG3A 3CQHA 2P50A 3UEQA 2OELA 1RLDA 3AUJA 4EF8A 4M51A 3MP4A 5CZ0A 3VIIA 2D20A 2XDFA 5CQ1A 1G4PA 4C6IA 1QPQA 3PW5A 4DXKA 5LKYA 4JYFA 2GSHA 2HDJA 4J28A 2D69A 4L4LA 1FWAC 5BROA 1KFBA 5BMWA 3C2RA 1GOIA 4Q8TA 3T55A 1RK6A 2UBPC 2TYSA 3TSMA 3DKLA 3Q45A 3C3NA 3W81A 2VEGA 1WKYA 2O4QA 2AQOA 1RXOB 1W2PA 4XZIA 4DO7A 2C28A 1HO4A 3A47A 2E9MA 2NLIA 3RHGA 1ODUA 4HNVA 4JL2A 2XIBA 1E15A 4KF1A 3MV01 3O2LA 1E6ZA 2PRLA 4GZIA 3AMCA 3WLQA 4J1OA 1XCWA 4WQ6A 2R8IA 1BGAA 1XBZA 3VNDA 4XZNX 4UMBA 3PAJA 1ZY9A 1C8QA 1J6OA 1K7EA 3RM9A 4DM2A 1ADDA 3MI6A 1EC8A 1OGGA 3ARYA 3MBDA 1CW2A 3BW4A 4H9MA 4PRTA 1R38A 1XLCA 1Q6EA 2PDMA 3VE9A 1E3XA 2EQDA 3GTIA 1E0WA 1L6FA 3WH7A 1P1XA 3ZR4A 4AZHA 4RZ5A 3QKZA 3UZYA 2HJPA 2ZRWA 1T8XA 1QOXA 2Z2AA 4HNLA 4KH2A 3WK0A 1TA3A 3G1AA 1KM1A 2VO5A 3VCNA 2ZX7A 3TOPA 2L5HA 5HNTA 4J2MA 5MF5A 4RV3A 2PDUA 3H4BA 1Q6CA 2PCEA 4QEEA 3DFSA 3NQFA 3NXLA 1MXDA 3MCOA 3WBEA 4AUBA 3IACA 1Z89A 4EAMA 1PKYA 2ZKMX 3NQVA 5KG1A 2V3GA 4PTWA 4YTTA 3G8EA 2DSZA 4FXJA 5DXXA 1W1A1 1WNOA 1KFCA 1ZJHA 3H4DA 3GH5A 3PZGA 2W9AA 2UZ9A 1VBJA 1TJ2A 4EWJA 4F0KA 3PZNA 4B2DD 5DCEA 1PYMA 4I5RA 3TONA 3KVMA 1B90A 3GFYA 1O1HA 2WNNA 4NVTA 1QDSA 2OCZA 3TSDA 5HQEA 4A4AA 2A3HA 4K8HA 3RPTA 4XBJA 3CV6A 4Q8NA 4EBCA 2DZXA 4IIEA 3E2RA 1UBSA 2OWWA 1M7PA 3WEZA 1GEQA 2E6FA 3RDKA 2YCKX 1JF6A 4ECVA 2VCBA 1NDZA 2GGIA 3WNOA 4W86A 1HTIA 2QYGA 4PUEA 5HJYA 2FZ8A 5KFEA 3L0NA 7CGTA 3NPWA 1LZOA 1OT2A 4IXHA 5KITA 1XYFA 1ZJBA 1X6LA 4O4VA 3S4TA 5HQMA 3A3WA 2WXDM 4RNHA 1HG3A 1H5YA 4S3EA 4FLQA 4DJFD 3BE7A 2VRQA 1CCWB 3HIJA 3UVAA 3PTDA 4NP7A 1YXCA 1W8GA 1S39A 4DPQA 1JF5A 1UCWA 2D3NA 4B3ZA 3DFTA 4U31A 1P0EA 1QPOA 3ZO9A 2ZX9A 4HCDA 1EXPA 4K8EA 4LNYA 4O8RA 3MKKA 4UOQA 3MUAA 3FK4A 4WRHA 3GC2A 5ABTA 4GQ0A 2DJXA 1C3FA 3U2ZA 4N2YA 5K3VA 2FHFA 1FVPA 3QSTA 2X0HA 3UBPC 4LYPA 1BGGA 3WDHA 3MP5A 4IIHA 4EKJA 4S39A 4CCZA 3TJ4A 3H2AA 2E5BA 1C9WA 3ABZA 3GW3A 3M46A 3W1QA 4O1CA 3BICA 5KTLA 1JGIA 3TQPA 2G96A 4QE1A 1B9BA 6ALDA 1VFHA 4MNMA 3H6OA 3W7KA 3AMGA 4JTHA 2J9ZA 1HUVA 4JQ4A 1L6WA 1XPYA 3R25A 4GKTA 1TVNA 4O57A 2VC6A 4LWWA 2GLKA 2F6KA 1BFNA 3KOWA 4GYPA 4NI3A 3M0ZA 4A2RA 3PP7A 4L56A 4LRSA 3S1UA 3QQ0A 3VDHA 4Y2WA 1RVKA 2HK0A 3OIXA 2PDHA 2FJKA 4GG9A 4PUJA 1VFMA 3R8RA 2C6QA 4UXDA 1J4EA 1Q45A 3PUGA 2PZNA 4AMCA 2IQDA 4QLKA 4ZB5A 2HPIA 4BI5A 2XIIA 4F9DA 3KHGA 1R5YA 3N2CA 3O6CA 3HQPA 3LM7A 5LNRA 5DT7A 2ZC1A 1EFZA 1C29A 2DZTA 1V6TA 2C2DA 4WOZA 3SFKA 2ZZ2A 1TV3A 4AZCA 1JAEA 2YDAA 4PCNA 1H50A 1QFEA 1F4AA 4NT0A 2DFAA 3IV8A 1F7BA 3W1LA 1GHSA 1IWPA 4YVXA 4DO6A 4XKYB 2OX4A 3UWZA 3PB2A 3HQOA 4I9JA 3G24A 4DXXA 2R1PA 4A3RA 4PEKA 1EZWA 3NZRA 4LVBA 4Q6JA 3NJ3A 5DFAA 3LQLA 1VFOA 4INFA 3ABQA 4C6OA 5E1QA 4P7OA 1W6TA 3IVSA 3CPGA 3OZPA 4R9XA 3M7WA 3R10A 2J74A 2FYMA 1OX4B 3QY6A 1AW1A 3C2OA 3W70A 1SR0A 3TC7A 3ZT6A 4B5XA 2DZBA 3NVDA 4B3LA 3QY7A 1EH9A 1XYZA 3KS5A 1ZLPA 2BFGA 1QNSA 3CLWA 4LPCA 2UY4A 5IHSA 3GFZA 4Q7IA 4FNPA 1LF1A 1BLIA 4QAIA 1XGDA 2YCLB 1P6WA 1SO4A 3LOTA 4L65A 1GK8A 2E0PA 1S2AA 4RLIA 3QHMA 4JTRA 5A6BD 4MUZA 4ATDA 5JBEA 1PAMA 1IXQA 2VL4A 4C5ZA 3BZJA 3PWIA 3TV8A 4RUCA 5BWFA 3WMLA 4DZ5A 1UC5A 4P2VA 3I6EA 4A8NA 1FHDA 3G1DA 1KR1A 4O15A 4DWSC 1T40A 1SFLA 2X1RA 4S3CA 4TQSA 3QLDA 3V0TA 3HPAA 1F74A 2DT3A 3LG3A 3NQ7A 2V67A 3HTWA 5TF0A 1L6YA 3RMEA 4AYGA 1A50A 4HYWA 2HBVA 3B40A 1DE5A 5JMUA 3M9MB 1DQUA 4ZB0A 2GVEA 4H01A 5D04C 5LIWX 3POCA 6XIAA 4S3AA 3WF2A 1J0KA 1YDVA 2VFFA 3BAJA 3KP1A 3M47A 3DERA 3TN6A 1BYAA 2EPNA 2VM8A 4GINA 3P74A 3GHSA 3ITCA 1XM3A 1A53A 3C0SA 3IEBA 8XIMA 3MR6A 2WV8A 1JYNA 5DT5A 4AEFA 3PR4A 5DX7A 1OABA 4B9ZA 4UTWC 2TODA 3CH9A 3LPPA 3WNMA 1FCBA 1XYLA 5K9XA 3TN5A 4Z42C 1SSGA 4KGLA 1QXLA 2FMOA 3PBVA 5JUVA 2ZUNA 1MVYA 1NDYA 1G4EA 3AIUA 4TTGA 4H2HA 1XLAA 4FNSA 5LNWA 3NIYA 3W2UA 3R12A 1XDMA 4J9RA 2V5LA 1GTEA 1UR2A 3MHFA 4U10A 3SRHA 4FPSA 4V15A 1AQFA 1H0IA 4OU1A 3CV1A 3K2GA 3NNTA 2D1ZA 1A5BA 3GR4A 1TZZA 5HNRA 3EB2A 4DVOA 1WB0A 1V7YA 1B57A 4MFDA 1J96A 3S2JA 3L0GA 1TVLA 2INFA 1H0GA 2AOSA 2V2HA 3TK7A 1JYVA 4ZENA 2EHHA 3GS6A 4YCOA 3SCTA 1VJZA 3WJYA 2G0WA 4N9DA 4ED3A 4YR2A 3OP2A 4DI9A 5HJLA 5U7SA 4BK9A 3VIMA 4JFVA 3GYCA 4AY7A 1Y65A 2HE5A 1ISYA 1V02A 3MMTA 4PUDA 4NZ3A 2HWGA 1JCYA 4R7OA 4C1KA 3TR9A 3VGBA 2A1YA 3SSJA 3SO7A 1R3YA 4MYAA 3P80A 1PX8A 2Z1BA 2UV8G 3PBWA 3T0AA 2V3EA 2G41A 3T81A 4PC8A 4ACZA 3TC3A 5FSEC 4JNZA 4HU4A 4LUSB 5CPTA 4I5UA 4XO7A 1YW1A 3W02A 1D7KA 4NY2A 4IT1A 1VBGA 3CBWA 3M9NB 2AGKA 2JQXA 1U1UA 2B7OA 3G1VA 4DF1A 1C91A 2Z00A 1ICPA 1OD0A 4PMVA 5K9CA 3GBEA 3IGXA 2QCLA 3II1A 4RZ6A 4C1NB 2GL5A 3OA3A 4H6KA 5AHMA 2JBMA 4CEUC 4C6DA 3KWSA 1KM3A 3BDKA 5MHBA 1EJWC 2VD8A 1JPHA 3N29A 4JFWA 1M65A 3GG7A 3PBYA 3DFNA 3G1HA 1YDYA 4AU0A 1E1CB 4B5WA 5AC8A 4HU3A 4G9PA 2E7FA 4BQ2A 4YU1A 2Y24A 3C6CA 4KERA 4TMBA 1Q4NX 2VFIA 2VMFA 3W74A 1YYAA 4K68A 1Q65A 3EB3A 3QW4B 4RZBA 3VOHA 3FKRA 4D6GA 4MTVA 3WQWA 3HG2A 2BG5A 3EZ4A 3MHUA 1K8ZA 3M5VA 5J5DA 3S5SA 5I2UA 4HBKA 3PW4A 7PTDA 3UESA 2VKZG 3IJ6A 3OBEA 3NAVA 1FWNA 4NAEB 3R8GA 1XKYA 4C6PA 5B7ZA 4MWAC 4GQRA 1RYRA 3TXZA 3OHAA 1T0OA 5CSRA 2PTYA 4LX4A 3AO0A 4NG3A 1X1ZA 2C14A 1UH2A 2OZTA 2QCMA 4GIEA 1V3LA 4MAVA 2OSYA 4NRSA 3WQPA 1TMQA 3HPSA 1XUZA 1RA0A 2PDNA 3CYJA 5C8BB 4DWSD 3E12A 3HPZA 4W5UA 4O54A 1A3HA 2NQ9A 4ECQA 4BI7A 3BAKA 4LAUA 2BHUA 3UA4A 1GVRA 3H40A 2JKEA 5DLGA 1NDVA 4LF2A 1J79A 2X30A 4WSHA 4EBDA 2E8YA 3DHDA 2RDXA 4JQAA 3IN5A 1EGZA 4NX0A 5AHIA 2AQWA 4PULA 4MNJA 3STCA 3UJEA 1NAL1 3T08A 3PM6A 1NEYA 4LU0A 4M82A 1WE5A 4PZVA 4UCGA 4TVCA 2A7RA 1KB3A 2WSRA 3AIQA 3TYAA 4DJDD 2QCGA 3HB9A 4UFMA 4BS0A 3MWAA 1VEOA 1AG1O 2E6YA 3GRIA 2C1GA 2AGPA 4D6CA 2ACUA 1HL8A 4GPNA 3ERPA 1HP5A 3ZXWA 4O10A 4ZB2A 1XI3A 4HSHA 4NJGA 1EO5A 4AVOA 4YHGA 1BVNP 1MWOA 1H41A 3MKVA 3WJWA 2XIMA 3UJRA 4HA0A 3P2VA 1J5TA 2ZX8A 2KZHA 2BZNA 3SCSA 1M7XA 1CGTA 4FB7A 3CZ8A 4Q4OA 4RE4A 3QV7A 3FSUA 2XN2A 3VNIA 3N15A 3HN3A 3SI9A 4AWUA 3WH9A 4NJHA 2VOMA 2AAMA 5F2LA 2RDIA 4CD6A 4K3ZA 4AZIA 3G2GA 5JVLA 1ZGDA 1TTJA 3S5OA 3EBVA 1GNXA 3M6DA 3LYEA 3U5YA 4HHMA 4AIUA 1EUNA 4QG6A 1I2PA 4PODA 4PTVA 2RJGA 1I60A 1OJXA 3W7GA 4XAFA 2XH0A 4B9YA 3SUTA 3VMNA 4HNTA 1UD5A 5AOUA 4Z0SA 1MQQA 3RM8A 1UH4A 1KCLA 4GACA 5AYBA 1LROA 3TJXA 2PDKA 3UZXA 3DGRA 1MDLA 4M80A 5AC5A 1OX5A 6TIMA 4QE4A 4FXSA 3D3AA 7A3HA 1G67A 2JEIA 4RKAA 3WUFA 2ZX5A 4ZQMA 1I75A 3CB3A 4RPQA 5C9WA 2OZ3A 4LY4A 2E77A 3SN1A 1Z3NA 4ILSA 5FF0A 1E51A 3RNDA 2DVUA 4GLEA 3T0CA 4H2CA 3EKZA 4IM4A 4KEMA 1UD3A 3EOEA 2GGHA 3GYEA 4JIEA 4ED0A 2X1IA 7REQA 1QPKA 1LL7A 3BLLA 1EDGA 1KO0A 2ZXAA 1TQJA 1JUEA 1ZJAA 4E4FA 3WH6A 1FWJC 2J27A 3POHA 1RBLA 8TIMA 4IP7A 4YMZA 2UY2A 2C1HA 3VD4A 3PB0A 4MPKA 1GOMA 1Z8AA 2V2CA 4WJEA 3PSWA 1CLVA 1W31A 3BQ2A 4P7LA 5CG0A 4LB3A 1OGSA 3U4AA 4D8LA 5HA7A 3VNMA 4XVEA 4KPLA 1M03A 5I0DA 5C9ZA 2VDHA 5B80A 3QZ8A 3LCWA 3EA3A 4F50A 1YNYA 1D3CA 2H9AB 2JF6A 3EX1A 2HVOA 1EXBA 4YCPA 4NF7A 3O1NA 2Z24A 4JL1A 5KFDA 4MLRA 2A3BA 3S1GA 3FW6A 5KEZA 4BKNA 1J8VA 5BOOA 3RM4A 1VP5A 2QJJA 4ZO8A 5HXMA 2J78A 2F6XA 4XD6A 3TWBA 2DW6A 1AZ1A 1DWHM 3ABOA 1LOLA 2WMGA 1JUBA 2HEJA 5LXEA 2NT0A 3L5MA 5KZEA 8RUCA 1IEWA 4R8UA 4O14A 1H61A 4DELA 4DN1A 3RU8X 4GOAA 1FDJA 2X1TA 3W1PA 4F4ZA 3VCRA 3WNNA 2WO5A 3UG8A 2OWXA 1H11A 3W37A 3ARQA 2XJ7A 2DPEA 1E0UA 3ZM8A 3EDFA 4NI8A 1GOKA 4LFYA 2FZBA 5EMYA 3RN6A 5CGQA 3IJIA 3E96A 1H62A 3ZWSA 3TR2A 1MUCA 5AHLA 3WQ4A 4N4QA 1EJRC 3MYOA 4DBUA 1WKFA 2WW5A 3WQDA 5HJXA 3CIXA 3V1HA 3GX9A 1JRBA 2I17A 1J12A 2HZGA 1T7LA 1FQ0A 4JPGA 3ITXA 5KFLA 2REQA 3FIGA 1K7XA 1N2VA 1GVIA 3BGJA 4ECUA 2Q3OA 1EA0A 2GGEA 1TWZA 2V6AA 4IMGA 3UD6A 2J8GA 4YYCA 4UTKA 4JTAA 3KCJA 4PUNA 3BW2A 1G5AA 3KVKA 3W2NA 5D33A 3KWXA 3HJEA 3BXWA 4EXQA 1ITUA 1DJGA 5JUMA 1V6YA 4W84A 1EWDA 4UC5A 5KFPA 4GD0A 3IANA 4DJDC 1WV2A 3LSBA 4P7RA 3F4CA 3K30A 4LAMA 1XKJA 2XGBA 5CC3A 2E3ZA 1EGVA 1HJQA 3KXQA 3NM3A 2WQPA 1X8FA 1BXBA 1JAKA 1J01A 3RXZA 3P62A 1RYSA 4BEUA 5EMMA 3ITGA 5H6HA 2OZ0A 3OLDA 3MPGA 4ICCX 1VFFA 4ZOCA 4A22A 4H00A 3RX2A 5BXRA 1M5WA 1AQMA 3VIFA 5CPMA 5REQA 1W3HA 3RB6A 4Q4SA 3WJSA 1YLVA 1I45A 4TV6A 3WLIA 2YXGA 1LBLA 3KFTA 1FWGC 4ACYA 3GIPA 3NZQA 1W5OA 4Z2KA 4H6EA 4ACZB 2P8BA 3W4RA 1TMHA 2XH4A 5CPOA 4NUWA 3LX9A 3HMCA 5KG4A 1KFWA 4FEZA 2FLLA 4MKSA 1PL9A 2XISA 2FHCA 2I5GA 3H7VA 1NOUA 4DYKA 1ZCCA 4E0CA 4Z2JA 4MG4A 4C7FA 3ZT7A 1A5OC 1HGWA 1FA2A 2PRMA 2GDUA 1NJJA 4MNKA 1EA9C 4TTUA 2X05A 1UR1A 3TW6A 3AHXA 1SYTA 3REQA 1GEHA 1OQFA 2INZA 3PPFA 3FDSA 5LGZA 3AIWA 4KWSA 4MYXA 3SM0A 4RNJA 1AA1B 4QLJA 1SQ7A 7TIMA 1KXVA 4X9SA 1S5VA 2GJXB 1PDZA 2UVUA 4X9YA 4KFOA 4Z2LA 4I7WA 3O6YX 1I0DA 4RJEA 3T40A 3D46A 3FA4A 3T07A 4HOZA 3LY0A 1BF6A 2AL2B 1E0VA 3GV5B 3AQUA 3E1F1 2YB1A 4RV8A 4FS2A 1Q6DA 3M5XA 1TZ9A 2V5JA 4HZ6A 4PMYA 3NQCA 4HMEA 4CNPA 3WD3A 4L5ZA 2IKHA 2GUUA 3N9SA 3USBA 3IARA 1RVGA 2FFIA 5C5JA 3VD3A 4W5ZA 1ISXA 4US5A 2VZTA 1MW3A 5HWMA 3NL2A 1OX4A 3KLKA 1QNPA 1AMYA 2QIIA 3AWOA 2VC9A 4IPLA 4PUUA 2BY0A 5GQBA 2OH2A 3HMJG 4FF5A 1W9PA 3W7MA 4FNTA 2V5DA 3B06A 4QFUA 1XXXA 3IGSA 5C2GA 2GJRA 2DIEA 1A3XA 1NSJA 4YN5A 4KRTA 4L6DA 2W6RA 3MCMA 4JYEA 3TKFA 2QHAA 3AYSA 3T0DA 3W7QA 2AGOA 4H9TA 4CD5A 1TR9A 4KWOA 1LQ0A 2A85A 1XLKA 1EBGA 2X7VA 3O3RA 5FA5A 3HURA 1V03A 3CMGA 4NRRA 4Y9AA 2I5IA 1GYNA 2VX7A 9RUBA 1UWIA 2CHRA 4C5YA 3QV8A 4R9OA 1R47A 4F0RA 2QF7A 1JFXA 4LUTB 2GJNA 2J9XA 5CC7A 5IBXA 1K1QA 4QJ1A 1MXGA 4FLSA 4Q8WA 5D2VA 2KAUC 5AC7A 1XLFA 1GTHA 5IRPA 2FVKA 4GJJA 3IJ7A 3ARPA 4U7CA 4CN4A 1ZRQA 3SJ3A 1FCQA 3U2EA 3VZXA 3OSNA 4CN6A 2WVVA 2CW6A 4JN7A 3UXKA 2EF9A 4JY8A 1IGSA 1LG2A 1XYCA 3SY8A 5KFHA 5KG0A 1DIEA 4Y9OA 3E38A 2HXUA 3B8WA 1VFLA 4KW2A 3WBYA 4YTUA 3GXFA 4IQLA 3M6YA 1WZAA 1R2RA 1YIXA 1SFTA 4AW7A 4Q44A 8A3HA 1S3TC 2ESCA 3HGRA 2CZ5A 4N7QA 4E8GA 1TV4A 3OODA 4X22A 2BGQA 1R30A 1Z9AA 3AIVA 4KETA 3TNBA 3AS0A 2VC7A 4IMAA 2QPXA 3S2MA 1XISA 6PTDA 5KFYA 4NJIA 2WVVB 4EPKA 3IUDA 1W9BM 4ZQCA 2VFGA 4LAOA 1CWYA 3WIJA 1QMLA 2F2HA 3M0LA 1RZMA 3TJLA 5HBFA 3EWUA 1NP0A 4ZVJA 3GZ3A 1KRMA 4UNKA 5A8QA 4JHMA 3DCPA 3QV9A 3N34A 3CL6A 3C8FA 1HZYA 2JKPA 1AD4A 1C7TA 1HJSA 3KBSA 1SZGA 1V08A 3MSDA 4FP1A 2P0OA 2ISWA 1YNQA 3UG3A 2CCRA 3RITA 4E3TA 2OG9A 2RFGA 2JEGA 5HPOA 3F2CA 3DYPA 4CCEA 4K6AA 4IIBA 4AZBA 1W1TA 1F6PA 1BYCA 3B8TA 4L1WA 3LRKA 1S38A 2VP8A 4J9PA 2ZYFA 2CXGA 3S6DA 1FWCC 1K9EA 4ECRA 5DF0A 1UP3A 3T1GA 3VZZA 2FH6A 3FS2A 4DUVA 3NOEA 4CGTA 1J6PA 2FLPA 4OBRA 1D3GA 2XWDA 4HCLA 3KHRA 3WL1A 4C1LA 1UROA 1WAWA 2ZXDA 1XUUA 4JS3A 4UFHA 1JI1A 3A22A 4IQEA 1GW9A 5C2XA 1RP9A 4MOZA 4RDVA 2IA6A 4RE3A 3UCQA 1CBGA 2V5KA 3WBAA 4F0LA 4E8CA 1VCFA 3W83A 1J11A 2DEPA 3WD2A 4O1EA 4A8IA 4GGHA 1GQLA 5A5WA 3N4EA 4ED2A 1GQJA 2JGQA 4JTQA 3EMCA 2A3AA 2OYMA 3R0KA 3PG8A 4O0QA 3B0VC 4WR3A 4C1NA 5AECA 3H8AA 5KFBA 3W29A 3WDRA 3VMOA 5A8GA 2QDHA 1QHPA 3WF4A 1L2UA 2VUYA 5SWUA 3ANYA 3M9OB 1M04A 2EPKX 2NQJA 1MFVA 5H2ZA 4MY8A 1XIEA 3CT2A 3ZVIA 1NP2A 3WKZA 3OGVA 3CASA 3PW2A 4O3QA 4UTFA 2ACSA 5H8PA 4J40A 4AC1X 3GNXA 1E71M 3VD7A 3UW6A 1OYCA 1TTPA 4PBGA 2CXEA 3M0YA 4IISA 5A3HA 3P5ZA 1A5MC 2PI6A 5FL0A 3KL5A 3YPIA 3TMLA 4PB4A 2NV9A 3AXIA 2GQ9A 1R8LA 2CETA 3DESA 2QMKA 1TWDA 1KRBC 4IR1A 4LBRA 3VXGA 3B0XA 1XJBA 3O8AA 1LOSA 2C91A 5KT7A 5HPCA 3W7RA 2XU2A 4MWAB 1QASA 1VLIA 5EBUA 3S8HA 5KFFA 1X7FA 3EXTA 4HP5A 1MDRA 2V2DA 3NSNA 1G7UA 1UKOA 1TUXA 5REQB 3GTFA 3C56A 4A29A 4HPGA 2AKZA 2WCSA 3M64A 5D03A 3IIPA 4DXVA 1UR4A 3FNDA 1L6GA 1RQEA 2GK1B 2WANA 3OPSA 1V6UA 3FLUA 4UQEA 4B4HA 1UR8A 2CBJA 2D22A 4FMVA 2AMXA 2J4GA 3EEGA 1QR7A 1SJCA 4JAWA 3G6MA 3S9IA 4EEYA 2JIWA 1R2TA 1POKA 3HO8A 1PWMA 1ONRA 1EO7A 4HTYA 2Z6IA 3Q94A 5E09A 3NZGA 4JX4A 1KBLA 3O0FA 4PMQA 4AMAA 3G6VA 2O7QA 3UZZA 3GKFA 3P14A 5I6SA 1DHKA 1OSEA 1LTDA 4MF4A 4EPDC 1FTXA 1I8JA 5C0QA 4ORIA 1EDQA 1DJXA 2ZUUA 1KGXA 2H9AA 4GISA 3TVAA 4N0RA 1NF0A 1ZNNA 2EXOA 3EPNA 3AMLA 2XH7A 2I16A 3HOJA 4H6RA 3IUIA 3FOKA 4ED7A 2R8JA 4J9MA 3D0CA 2YBTA 1B4KA 4Y8EA 5CH9A 3CQKA 3T42A 4X2RA 2PF8A 4N9CA 3KOYA 3ZLFA 1JZ5A 2VEFA 1T5AA 2WHJA 1WUEA 3IRDA 4RNOA 2A0NA 1IYXA 1VRXA 3MANA 3KTSA 3K4AA 3M0MA 3UERA 4AIBA 3NQ8A 2XIJA 4IGNA 1TA3B 2BVYA 4FLOA 4JKKA 2CU0A 3KRUA 3K8LA 4S3BA 5DQHA 3GVRA 1OG6A 2AAAA 3T8QA 3EX6A 4S3FA 3KS6A 1UZ4A 2GVLA 1E6NA 2PZ0A 4G3IA 1EOKA 2IPJA 1S5TA 2Z6JA 2G4FA 2P10A 4RDZA 3LPOA 2HISA 2Z0IA 1QHOA 3P60A 1RD5A 3E0VA 3IIXA 3SR7A 1BSLA 4MY1A 3ITOA 4QXIA 3B4YA 3SCNA 1HO1A 3CHVA 2HV5A 3MTWA 2XVNA 3AISA 2W9BA 3VILA 3PANA 1LM1A 4MDPA 5KFGA 5D9MA 3HG3A 1DJWA 1HKVA 4LBSA 4EIVA 4I9MA 1YPFA 5KFNA 1E1EA 4H6QA 4TVDA 3B8UA 2WSQA 4PMJA 4QS6A 4HQVA 1DIDA 1WYIA 1GJUA 1AVAA 1Z42A 3WDJA 1EGMA 2NSXA 3UVIA 2CYGA 2RDJA 2X40A 2XH2A 3B0YA 3T4CA 4PUKA 3XISA 2Z27A 4XZHA 5KG6A 2GPTA 4IX0A 3SIMA 3S83A 4UQBA 3GILA 4OWGA 1OCBA 4O17A 3CH0A 4DI8A 3THQA 4E4PA 2ISSA 4KIRA 3V6JA 3C2VA 1PIIA 3B4UA 3FVDA 3T2QA 4P8XA 5KFAA 3M0VA 3CZLA 2J62A 3VIGA 5ENLA 1AUSL 1IXPA 1L2QA 1KV5A 2Z1SA 2XYLA 1HVXA 3I3BA 4YIWA 1KC7A 2Y2WA 3DIPA 3RB0A 2PGWA 4J3VA 1M9HA 1XW8A 1Q3NA 2ZC8A 2EEXA 2WCGA 1GVOA 2DIJA 1VBUA 1TELA 2NUXA 4E3VA 2ZVIA 5AVNA 2Z1VA 4LJ3A 3UWEA 3Q8RB 2CNCA 2PAJA 1UKTA 3HA1A 1GT8A 4GQBA 4D9PA 2OT0A 5CJ5A 3KAOA 2J7FA 4F4XA 1NFGA 3QLLA 1OK6A 2J7EA 4UR7A 2J7DA 4GJ1A 3DBNA 4LBUA 5LGXA 2EAWA 4YVVA 3KRBA 1FHUA 1OFRA 1RH9A 3I7SA 1XP3A 3F1QA 3EDDA 3L4WA 1JQXA 3OLEA 2Y5SA 3WJXA 4QIUA 3M0JA 4D6IA 3UXIA 1V51A 3FA3A 1NU5A 3CB8A 2YGYA 2CEQA 1H7PA 1JZ4A 5I5RA 2A6NA 4A21A 2ZE0A 2JEJA 4O11A 1BWLA 2FGZA 1W3IA 1XRSA 4HKPA 4M3PA 3CK5A 2PEVA 4MAZA 3VIOA 3OSPA 1ZS2A 1K77A 5FF7A 2HVMA 1FY6A 2R8GA 4GI8A 1VS1A 5A2BA 4S2BA 7TAAA 2NV1A 4L6OA 5CSSA 5D02A 1VBHA 1EYEA 1P0NA 4DJEA 3BL3A 2O56A 5H8UA 4L9YA 3ABRA 6A3HA 4PR4A 2GUBA 1WO2A 3LCXA 1B3XA 3VABA 3VKDA 2ATLA 3FGCB 1LWIA 3LI1A 1E4LA 5L1IA 4IFOA 4F3HA 3CO4A 1HJVA 1IZKA 4EWND 4C6BA 4WKAA 2YDQA 5HAOA 4GFSA 2ZUSA 1E9ZB 2CLFA 4RNNA 2OX1A 4DUXA 4O50A 4NZ1A 4EPEC 2XGPA 1C8YA 3W24A 1VEPA 2DV0A 1EC9A 3LXCA 3PUOA 1XCXA 3LUTA 3DAQA 4F0HA 3OYXA 3E5PA 5AYYA 3W1RA 2ZA2A 3V4BA 4BZYA 2WPBA 3ABSA 4YS1A 4L4PA 1RCQA 2GFTA 2V4QA 2VDIA 3KOXA 4P8WA 3LV6A 1KM5A 2J24A 4JTFA 1GYMA 3CV2A 1GJWA 1UOZA 5D2WA 3TW9A 1F6YA 4N9BA 4YXGA 2ODOA 3M43A 4M6VA 5CBJA 4NXSA 3W7LA 2BGSA 4MJMA 5CZKA 1QK0A 4Y96A 4XK2A 3OEXA 1DWJM 1JD7A 4RZRA 3GUWA 1JG9A 3CUXA 3MUXA 2QUNA 4NYYA 3W38A 2Q71A 4NZ5A 2E1DA 1RAKA 3KEHA 3M44A 2QJHA 4UQAA 4WDWA 4J3SA 4TX9A 1X1NA 3L4XA 3THDA 5KFCA 4BQ5A 1JCXA 1KKOA 1S1RA 4UQ9A 3ZVHB 1W1PA 1G94A 2BVTA 1JGMA 2IBKA 5EFFA 1E5JA 1X8CA 1UWTA 1P4CA 3NYDA 5MKGB 3IGHX 1ML1A 4HJFA 1KR0A 1XLEA 3QC3A 4EXAA 5LNUA 2NW0A 3A4JA 3NQBA 4ZCWA 3KL3A 3SADA 1UIOA 4OKDA 3BH4A 4EAYA 4P7NA 4TU1A 4H4IA 2QDEA 1B3OA 3GDBA 2ALDA 1Q5MA 5GJPA 4ROPA 5L6UA 3QOKA 3UWVA 3GD6A 4M1RA 3BV4A 4GWEA 2BQUA 4FZIA 4S2CA 2PB1A 4NJKA 5CEWA 3MC5A 1GZGA 2Y5EA 3R13A 3HGSA 3F7JA 5G2HA 4Z17A 3EMZA 1EEXA 3GDTA 3ARUA 4I9AA 3MUIA 4REQA 1NWRA 2X41A 1WDWA 3SUWA 3WEOA 1BVWA 1E6PA 2OXNA 1E9IA 2VGBA 3LCLA 3DI1A 1YEYA 2VURA 2QAFA 4FX8A 3CZKA 3SN0A 2CWXA 3C2EA 3U9IA 1MZHA 4JHOA 4B16A 1TE1A 3AROA 1W9XA 4FIQA 4HPNA 4QW8A 3U8GA 4U2YA 4Q4MA 1XH2A 1QNOA 2E25A 2X0SA 4JTEA 4QE5A 5FEWA 3TEVA 2XCPA 1TPFA 3LNMA 3FXGA 3VA8A 2FH8A 2HSAA 3BLEA 4LY8A 1FWBC 4M19A 3ONCA 4QDMA 8CGTA 3CL7A 5JH1A 4ZQPA 4GIRA 2BB0A 1FWWA 3ITYA 3PG9A 4N9EA 1ZBWA 4CQDA 1ZTVA 1IHIA 3MSGA 1O1ZA 4RNFA 1BG9A 2VRJA 4DF2A 4KEVA 1KTCA 2G3NA 1S5NA 2R6OA 2H6RA 4HK7A 1AJ0A 1K70A 5CGMA 3OG3A 2JKAA 4ZSTA 1UWUA 4M6QA 5M17A 1CGVA 1QI4A 4IIDA 3PBMA 2VZOA 5F9NA 2CHOA 2ZRYA 4JIRA 2QCDB 2Y8UA 4DYEA 3WF0A 4YTSA 1OX6A 5BXPA 1DL3A 3W00A 3WH8A 2FZNA 2C15A 3GB6A 3NSXA 3GDKA 2PD5A 1IM4A 1W1IE 2HNHA 3CGTA 1W5NA 3HFYA 1NOWA 5C55A 2D0FA 3VYLA 4LV4A 4CNNA 4ZA0A 2ABBA 1Q6GA 3QR1A 2CZVA 1ZAHA 3E49A 1QHZA 1EWEA 2C13A 1PX4A 5DN1A 2OT1A 4JGDA 5BU6A 2WLYA 1R3SA 3PNZA 1XL9A 2P88A 1T41A 3DYOA 2ALRA 3VD9A 1YMYA 3CQ0A 2ZXBA 2O92A 1L6SA 4LSBA 3N17A 3WQOA 1R7OA 1OK4A 4Y8FA 3GVGA 1HIZA 3CUIA 1YX1A 1KWKA 1Q8JA 3MYPA 4JX6A 2ACQA 1W3KA 2QR6A 1BKHA 3OHIA 4Z08A 1DV7A 4QRNA 3QGAC 3FGCA 1H1NA 2VX5A 1QAPA 5DMYA 4PL1A 1JUKA 4H7ZA 4LRTA 1OG0A 4TIMA 4MHBA 1TPB1 5CZSA 1SW7A 5AFDA 4U2ZA 4MB1A 5HWNA 3C5QA 1KNWA 1Q6RA 2PBOA 1UOKA 3W6LA 4D71A 3ECQA 1YPIA 1TPC1 3UZWA 1FP9A 3SUUA 3P67A 3J7HA 2XSBA 1PKLA 3JZUA 4QITA 4AIOA 3RLGA 3LBOA 2J88A 4BCEA 5IXEA 3THAA 4XIMA 5KINA 2ZXQA 1MO0A 1DEDA 2QF8A 3OGRA 4ZR8A 4E2VA 4JBRA 3D6NA 2BHYA 3CQIA 3I68A 3BWWA 4PFHA 3NDZA 3NR0A 5E0FA 4ZFCA 1IWBA 4Y6GA 2NXHA 3QZ7A 2J9YA 4MKNA 2MNRA 3CWHA 4XIAA 1DXFA 2E68A 4XAYA 3JZEA 2YIHA 4A3YA 2YA1A 1F3XA 5FIPA 3W3OA 4JQ2A 8XIAA 4GIYA 3GIJA 2R14A 4ALDA 1MNZA 4GIAA 3SEPA 2BOEX 5BXSA 2W92A 1EP2A 1WDRA 2Z7GA 1VYRA 1OIFA 3GTHA 1WXZA 1FUYA 2DSKA 3W6MA 4HNCA 3I3DA 3RU6A 1TV2A 3RGTA 2QQ6A 3HV9A 3MHGA 4LS2A 1UWSA 5DANA 4DL6A 2INEA 4FOJA 1E9LA 1B3YA 1S2TA 4GY1A 3MMDA 1XFBA 3U4FA 1UWQA 3P81A 4BQ3A 4XV0A 1JDCA 3L4ZA 4PCFA 1RSCA 4W89A 3V16A 2RDWA 5CJNA 3NDOA 4JR5A 5BOEA 3PBGA 4J35A 2YA2A 4PFMA 3F03K 4QNEA 3OTRA 4CCDA 2W3ZA 4Y9PA 3GLCA 4J9SA 4F8XA 2OEKA 5CLTA 5TNVA 4US6A 5HR6A 4JTTA 4XD3A 3QGVA 4XBSA 3MO7A 1KCZA 1KBIA 4GVIA 3NZ1A 2PTDA 5HULA 4ECYA 4D1IA 2PD9A 5AB3A 4GFIA 4O1FA 1ZB5A