2GSEA

Crystal structure of human dihydropyrimidinease-like 2
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
475
structure length
475
Chain Sequence
DRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dihydropyrimidinase-related protein 2
publication title The structure of human collapsin response mediator protein 2, a regulator of axonal growth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 181
structure length 475
sequence length 475
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.2: Dihydropyrimidinase.
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2gseA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2gseA02
3PNUA 2DVTA 1M65A 3LY0A 3GUWA 1NDWA 3GRIA 4C6EA 1KRCC 4R85A 1HZYA 2O4QA 2UZ9A 3ORWA 2HPMA 3UPMA 2R1KA 2R1LA 1RK5A 3UR5A 3F4CA 4IGMA 1GKQA 3E0FA 2FFIA 2VR2A 1YBQA 3S4TA 3MJMA 2Z2AA 1PSCA 1FWDC 3GIPA 4PBEA 3MDWA 2Z00A 4ICMA 4C6IA 3OODA 5CH9A 4GC3A 3MDUA 2GSEA 3OU8A 4H9ZA 2E25A 1UMLA 2HBXA 1ADDA 4EPKA 3LS9A 1QXLA 3GG7A 2R1MA 4ZSUA 3ITCA 1RAKA 1A5MC 4CEUC 3FDKA 3GU1A 3DCPA 3WMLA 1P1MA 4F0LA 4IQJA 4DNMA 4R88A 4LCSA 4IH3A 2XIOA 2Z2BA 4HK5A 4C6BA 1J79A 4QTGA 4TQTA 3TN5A 3F4DA 3LSCA 2D2GA 1M7JA 4C6DA 3IARA 2PGRA 3DUGA 2WJDA 1R9YA 4LAOA 3N2CA 4G7EA 4LAMA 3HTWA 2Y1HA 2P50A 4C5ZA 4C6QA 1XGEA 2BGNE 2Z4GA 1RJPA 4EP8C 3MKVA 3BE7A 4G2DA 3GTXA 4H9XA 2PUZA 2FTWA 2HNHA 4HK6A 4DI8A 4XAYA 4INFA 3MSRA 4ERGA 2Q09A 4RDYA 1A4LA 1RA0A 1XRTA 3GU9A 4R7WA 1FWIC 3JZEA 1V79A 3OOQA 2FTYA 1POKA 4GBDA 3DC8A 4QROA 1J5SA 4DLMA 4KF1A 2QVNA 3WYZA 2YB1A 3LGDA 3EGJA 1RK6A 2OOFA 2Z29A 4J2MA 4H9VA 1K6WA 4GYFA 1V4YA 4CQCA 2Z26A 4KEUA 2GWGA 2PAJA 2D2JA 3IPWA 1FKWA 4DYKA 5FSDC 1FWAC 1EJVC 3GTIA 2FVMA 2Z27A 3AU6A 2R1PA 4C65A 2HBVA 4DZIA 4AQLA 4H9TA 4J5NA 3AU2A 1FWBC 1J6OA 4L9XA 3QY7A 4CNSA 3GU2A 1KRAC 3SFWA 4DLFA 3HM7A 5HMDA 3NQBA 4LCRA 3WZ0E 3MTWA 3CJPA 4C6OA 3F2DA 4PCPA 3R0DA 5E5CA 3URQA 2DVXA 3O7UA 4M51A 3GIQA 3GTHA 5HMEA 4H9MA 1IE7C 4WVXA 2P53A 4L6DA 2WJEA 1W1IE 4HJWA 1NDYA 3CAKA 3ICJA 4B3ZA 4KETA 4LFYA 3S2NA 2Z25A 2EG8A 1K1DA 1O5RA 1POJA 1YRRA 1PB0A 1KRMA 4P5UA 4GZ7A 4GY1A 4EPEC 2QPXA 2WJFA 1A4MA 1J6PA 2Z7GA 3AUOA 4F0SA 1RJQA 4Z42C 3UBPC 1NFGA 4WGXA 3A3XA 1EJSC 2YZ5A 3IGHX 4PE8A 4F0RA 4IG2B 4RDVA 3OVGA 1EJRC 1FWHC 1GKPA 3E74A 3URNA 2P9BA 3OQEA 1WXZA 3PBMA 4RZBA 3URBA 2GZXA 4IFKB 3ISIX 4WHBA 4BJHA 4C6LA 4ERIA 1YIXA 4CEXC 4C6KA 3RYSA 1VFLA 2OQLA 4C6JA 3RHGA 4DZHA 2VUNA 3NURA 3CS2A 3GTFA 1K70A 4XD5A 4C6NA 2G3FA 4LAKA 4B92A 3IV8A 2CZVA 1JGMA 3IACA 1FWGC 4XAFA 4GX9A 2BB0A 4DI9A 1A5KC 1A5LC 3TN3A 4J35A 4GY0A 4UB9A 4HA0A 4C6FA 3LA4A 3E3HA 1XRFA 3K5XA 3GGMA 3V7PA 2EG6A 3O0FA 4I6VA 1WXYA 4JOMA 1I0DA 4C6PA 3G77A 3F2BA 4KESA 3S2LA 1ITQA 2GWNA 1FWCC 1YBQB 2YB4A 1FWEC 3QGAC 1NDZA 2ZC1A 4GK8A 2F6KA 3B40A 2VHLA 4KEVA 4XAGA 4IF2A 4ZSTA 2ADAA 2PLMA 2E1WA 1QW7A 1ITUA 3MVTA 3PAOA 3QY6A 1KCXA 1YNYA 1ZZMA 4H9YA 2AQOA 4QS6A 2VC5A 4GX8A 4PCNA 3FEQA 2W9MA 4YIWA 5HMFA 2HQAA 2VM8A 3S2MA 5FSEC 3SO7A 3LU2A 1R9XA 1KRBC 2EG7A 2R1NA 3TNBA 3TN6A 4KIRA 3FDGA 3QY8A 4LANA 3B0YA 4NG3A 3RCMA 2ANUA 4NI8A 5A6TC 4KQNA 1P6BA 2KAUC 1EYWA 1R9ZA 4RE0A 3T1GA 2DVUA 1FWFC 3F2CA 1EF2A 2OODA 2O4MA 5G4HC 3K4WA 4H01A 4C5YA 2RAGA 3IJ6A 3UF9A 4XAZA 3IRSA 2HPIA 1ONWA 1UBPC 4HK7A 1I0BA 3EWDA 4RDZA 1A5OC 1GKRA 1ONXA 4AC7C 4G7EB 3QGKC 2IMRA 2AMXA 3KM8A 4QRNA 4C6CA 1XWYA 4LCQA 2D2HA 1FKXA 3C86A 3LGGA 4CQBA 1V77A 3UR2A 2QT3A 2PGFA 5AKQA 4EPBC 1P6CA 3EWCA 4OFCA 3MVIA 2UBPC 1EJXC 1V51A 4C6MA 2Z24A 1E9ZB 3LNPA 1EJWC 3E2VA 2ICSA 4PBFA 2OGJA 4CNUA 4H9UA 3HPAA 4LALA 3OJGA 1RJRA 4IFRA 4XD6A 4LEFA 4UBPC 4H00A 1O12A 3T8LA 2OB3A 3E38A 5LXXA 3PNZA 3A4JA 3TN4A 4MUPA 4KEZA 4QS5A 4I6KA 3B0XA 3ID7A 4CNTA 2Z28A 1PTAA 2FVKA 1V7AA 4GXWA 3NEHA 4BY3A 3A3WA 3E0LA 4GY7A 2AQVA 3RN6A 3LSBA 2YXOA 1NDVA 2I5GA 2VC7A 4C60A 1PO9A 1UIPA 4B91A 4EPDC 4NP7A 1YMYA 1UIOA 4D8LA 4QSFA 4V1XA 4RDWA 1EJUC 2A3LA 4B90A 3K2GA 4IGNA 2GOKA 2QS8A 4V1YA 4LH8A 4IFOA 4XD3A 4IG2A 1DPMA 4XD4A 4DO7A 3D6NA 1FWJC 2WM1A 1A5NC 3S2JA 4ERAA 4GOAA 4KERA 1BF6A 3URAA 4CQDA 2I9UA 3MPGA 1RA5A 1EJTC 1EZ2A 2Q01A 3PANA 4IFKA 4BKNA 4E3TA 4DIAA 3T81A 1S3TC 1M68A 1E9YB
chains in the Genus database with same CATH superfamily
2G41A 2QZRA 1M65A 3OBEA 4O1FA 4HHPA 1GVEA 2XGIA 4WXYA 1KM6A 5T91A 2OYMA 3V75A 3ZO9A 1TV7A 3APYA 2QGYA 1UUQA 5K4ZA 4RPPA 2YGYA 5E1QA 3BICA 4EX4A 4O16A 4OIFA 3SCSA 1BWKA 4PGLA 4R53A 1W0MA 4M29A 1KTBA 3FNDA 4GACA 4A8NA 3T2PA 2R82A 2WAGA 2FVLA 5FF3A 3CWNA 3LHYA 2XZ7A 2BHYA 1X7FA 2TSYA 1O4UA 3IGXA 1FWDC 4O0ZA 1M6JA 2VX7A 2P10A 1W3HA 4HHHA 5EY5A 3SRDA 2QVHA 4C6IA 2Y5EA 1Y5XA 4WZHA 4TU1A 2GSEA 2AL2B 2DQWA 4GIYA 4M6UA 3GIMA 1E4LA 4K3ZA 3BC9A 1RQEA 3FEMA 2TAAA 3QPZA 1KV8A 3O16A 4NNBA 5GPRA 2NQ9A 2ZC8A 3VGBA 3B05A 3RX3A 3SM0A 1JCNA 1KCZA 2V63A 1NARA 3R5EA 3L23A 1ONRA 1J5TA 4H2HA 3Q8SB 3CHCA 2PZ0A 1XH2A 2C1GA 4W8BA 1JNEA 3R0KA 8XIMA 4YR0A 4HMEA 1OC7A 4A05A 3EMQA 5DQIA 3S83A 2Y4SA 4YTSA 3HFYA 2F84A 2JEIA 2BGNE 2F7FA 3SCTA 3RPTA 5JUVA 4H9XA 5ABFB 3NQ7A 3V5CA 5I03A 2EPKX 3PUDA 2DSVA 1KXHA 5KTLA 4NF7A 4QJ3B 1NWTA 1YX1A 5A6KA 1FWIC 2RGMA 1QNVA 1QHOA 4PTXA 2VZOA 2CIPA 2X7VA 4H9VA 4GYFA 3C56A 4E8DA 1VCVA 1QTWA 4FS2A 3H4DA 4UCFA 5HA7A 3AIWA 4W8AA 1E4NA 2Q02A 3LCLA 4QW9A 3U7VA 2FMOA 2X42A 1QHZA 4K37A 4J5NA 1FWBC 3ZR5A 4QAWA 4W7VA 1WDDA 4O8RA 1G0CA 2DVXA 2G8ZA 2DZXA 5EGRA 5CBJA 4CVWA 4M6VA 5HMEA 2Y8KA 4G1NA 4O0KA 1XLHA 4XZHA 4HJWA 4X9SA 3M0MA 2CBJA 2QCEA 1KM5A 5E70A 3FW6A 2CBVA 3VINA 1Q7MA 1LWJA 1O94A 5HNRA 1JF5A 2WJFA 1Q4WA 3AIRA 5FF0A 5JH2A 2V3FA 4WGXA 4PR4A 1OM0A 3VD3A 5KFLA 4UFKA 2ZUTA 4YTQA 1UD5A 1BG9A 3OLIA 1W5QA 4BEQA 2YFNA 1N48A 5GJNA 4IQEA 1GPFA 4PMDA 3SI9A 4CEXC 1BF2A 1W3JA 3T40A 1CGWA 2V5CA 2PDQA 1H7PA 4WDWA 3B8DA 4A8RA 1K70A 5KG6A 4JQ2A 3F1QA 7A3HA 3V5OA 3IACA 1SJDA 2D24A 2BB0A 3TN3A 1ZAIA 3PZPA 4C6FA 3E3HA 4W8LA 3V7PA 5SWUA 1PE1A 2ZX6A 2XJ7A 1FP9A 3HJZA 5A95A 1AMYA 3S2LA 1MXDA 3QSRA 4DJEA 4CLMA 5K2ZA 1NDZA 2Y0FA 2YX0A 2DSUA 4UOJA 1SZGA 5FJIA 1W32A 4FB7A 2AOSA 1AH0A 3V5FA 5JH1A 2ADAA 4KKXA 2E1WA 4XSLA 1QW7A 4E2BA 3LBOA 1TV2A 2Z1BA 5FD0A 3CQIA 3OEXA 4R34A 3GDRA 5M1TA 3NZRA 3HO8A 3SO7A 2YR1A 3RAOA 1R9XA 4GIRA 5J8LA 3SN4A 2OX1A 3XINA 2ANUA 1OWQA 5CSSA 5FAJA 1KM2A 3ZT7A 2PWHA 4ZOEA 3H7VA 3F5LA 1LL7A 5CBIA 3KHJA 1RV8A 4TTGA 2Y5SA 4JTCA 3CZEA 3RGTA 3BGAA 2BTMA 2BZNA 1JDFA 1SUXA 2G3NA 4RUBA 1OINA 1C92A 4L1WA 1JYVA 1UWRA 4IM4A 1BVZA 3T5KA 3M6DA 2DT3A 3WUGA 1W9PA 5D8WA 3EOOA 4O54A 1FTXA 1DL3A 2HS6A 2DZAA 4BQ5A 4L7ZA 3EWCA 1F61A 3MVIA 5AHNA 3O0KA 4C6MA 4IJBA 4Z1DA 4CCDA 4AZIA 4MJ2A 4WSKA 2VWTA 4DL4A 1CLKA 4Q4QA 1CECA 4JZ5A 3KDNA 4IPNB 4E5TA 4MZ1A 2Q6ZA 4R8UA 2UY5A 3EX4A 1RJRA 4JFSA 3SQSA 1O12A 3TWAA 3NDZA 3QQ1A 3PNZA 3TSMA 3VIIA 3M0JA 3A4JA 5BXPA 1GQJA 3QW3A 2V2DA 3LM7A 4N4QA 1MUWA 4GXWA 1KGXA 3VO0A 3V0SA 4ORIA 3CL7A 3G1DA 3C4UA 4XSMA 1UCWA 5DG7A 1TPC1 4MWAC 3WLHA 4HJFA 1GZ1A 2WOQA 1GK8A 5CJ5A 3HMJG 1KQYA 2VX5A 3TAKA 3IIXA 2ZA3A 3NWRA 4RE3A 4IOTA 4H19A 3B9OA 4EPDC 4JTDA 4B91A 1HQTA 3G1HA 1CGUA 3U8GA 1TPUA 1WDWA 1KBIA 4MTVA 2EKGA 4DBSA 1DPMA 3SZ8A 3NM3A 3ARZA 3PTKA 2B7PA 2PRLA 1VYRA 3A21A 5F1UA 3HV8A 1OFRA 1NWSA 1OF6A 2J47A 3H40A 2E40A 1M68A 4XZ9A 2DVTA 3GDBA 1E3ZA 2FYMA 2VA3A 2BXZA 3VIOA 3WQOA 4I8YA 3SUSA 1B57A 1KWGA 1W1YA 4O3SA 4J3TA 3NG3A 2NSXA 2ON3A 3L12A 5FF4A 1DWGM 3R11A 3LHUA 1OEPA 1W6TA 1M7XA 2INFA 1XIMA 4UMBA 4ZFMA 4J9LA 4UQDA 2XHYA 3EOSA 5HQMA 1W5MA 1NWUA 3QQ0A 4XIAA 3N6QA 2WKGA 4U2YA 4WCJA 3UPWA 2WV8A 1JG9A 4UZSA 1EWDA 2AAAA 5EKYA 1XF0A 4US5D 3NYDA 4M82A 3MO7A 3THUA 2J6SA 1S5WA 1ZJIA 1JZ7A 1FDJA 4XZBA 1UZDA 2X30A 3GHUA 5KZMA 3A64A 1QXLA 1E5NA 2DUXA 3UWUA 3H4BA 2PWUA 2B0MA 1A5BA 1XLIA 4CEUC 1BLIA 3FDKA 3WENA 1VFSA 3WMLA 1P1MA 4R88A 2I9EA 1UOZA 3PW2A 3VIGA 2WK2A 1LL4A 1GVFA 1VS1A 2CWXA 2GSHA 4UTIA 3UFYA 4H8UA 4ES4A 4GIEA 3AWNA 4Q8NA 5HPOA 1NSJA 4JV1A 5C2GA 5I3DA 1G9HA 5D9NA 4L4PA 4DJFC 3KL5A 3OVQA 4AMCA 5HAOA 2A7RA 2D0FA 3UJFA 4LAMA 5A5WA 1WOBA 4YVXA 2Y1HA 2A3HA 4MAVA 3CYVA 4W9TA 3E12A 3OW1A 1NQ6A 5KFBA 2J78A 5IDIA 4ECWA 2Y88A 3OLDA 5C2XA 3QZ8A 4ATLA 1UKTA 3VFLA 3WF4A 1RA0A 3PPFA 4P61A 3RAQA 1R3SA 1POKA 2QJIA 1YTEA 5K9CA 4ZOAA 2TRSA 2V2HA 4EACA 3AMLA 4WKAA 4Z1CA 1J96A 1XLFA 2J9YA 2GWGA 1VGAA 4JTTA 1BGGA 4D6GA 2R1PA 3BVJA 2HBVA 4V27A 4LX4A 3AU2A 1H63A 1TR1A 3SRHA 1FHDA 3GU2A 3CLWA 3WZ0E 4C6OA 3L21A 1GQIA 3USZA 4ACYA 3WNOA 2X2GA 1PIGA 5E0KA 4D6CA 3SCPA 3TONA 1G7UA 3GIJA 2Z25A 1POJA 1OG0A 2JEFA 1DXFA 4ZXLA 4WY0A 1F6YA 5GNXA 3GX9A 3VKBA 1GVOA 5JMUA 2OT0A 2ZUNA 3R13A 3V18A 5BZAA 3UBPC 3NQDA 1EC8A 3QKEA 3VC5A 5KFHA 2D1ZA 4HCLA 4LUIA 3APGA 1QNQA 2IQTA 4H3DA 1IXNA 4PTWA 3E74A 3L0GA 2UWFA 4JN7A 4ZQNA 3VCNA 5E0FA 1GQKA 4HYWA 2C2DA 1WDRA 3BK0A 2PDPA 2FDMA 2CLFA 4QGCA 2EPHA 1TMHA 1B3WA 3CIVA 1L6GA 3PZGA 3WH5A 3UPBA 2GDQA 3VCRA 1K9FA 3QGVA 4G6CA 2V4QA 4QWDA 4TMBA 1YBQB 4D6EA 3QGAC 5CZTA 3IUHA 1BQCA 5KITA 4GVHA 4G1KA 2RFGA 3ZOAA 4JFVA 2C7FA 3M5ZA 2WNWA 3FEQA 1IXOA 2V30A 4JYEA 4LF1A 5HMFA 4ZEPA 3N9KA 3OZOA 3QMRA 4PUKA 1QATA 3FSTA 2XFRA 1VYSX 3CEPA 1GOXA 4CQ8A 3CV7A 4NZ4A 2PWDA 3GR4A 2VCAA 1PIIA 1O5XA 2VVSA 3QZAA 1GGOA 1TVLA 4FX8A 5CSYA 3T0BA 2OZ8A 3VKDA 3AHXA 3UNDA 3ZVHA 3K4WA 4IJCA 1HKJA 4PMZA 1ZRQA 4WD0A 1UD2A 1UBPC 3SUWA 1GKRA 4BA0A 4GWEA 2DU2A 3M5VA 4DNHA 1ONXA 2PWFA 1Q3NA 1TKKA 3OO2A 2NV2A 3TTQA 3AHYA 3QQWA 1TA3A 2A3CA 1HL2A 1XWYA 3FS2A 5DEZA 3EA3A 4UCGA 1P6CA 2IS7A 4OFCA 4GUFA 3VOJA 2DIKA 4HNLA 3ZSTA 4FR1A 3E2VA 4I7VA 3GXFA 5ECUA 4CNUA 7TIMA 1WE5A 7PTDA 4AEFA 3W84A 3H6OA 4RKAA 5HJLA 4LALA 2VFIA 1QPOA 4ZO7A 3PJXA 4XD6A 4JIEA 3PPHA 2YYTA 4KW2A 1HJXA 3GHRA 3WUEA 4JTFA 3O1NA 2YYUA 3SCUA 4GQGA 1QR7A 3NCOA 2VNCA 1SJBA 2JKPA 3BAXA 3EDFA 2NX9A 4U7CA 3P62A 3CZKA 2WSPA 1EDQA 5FJUA 1NP2A 2YJQA 5DGAA 3K1GA 3EKZA 4RJEA 1M7PA 1T8QA 3QLLA 1NDVA 1GOQA 4RNOA 1OT1A 2I5GA 1OT2A 2ZXDA 2E6FA 3OVRA 2YDRA 1ECEA 1WUEA 3OZYA 4WDUA 1E1EA 1US0A 1VZWA 2HV5A 3WLQA 1X8CA 1V3HA 2WVVB 5KG1A 1QPNA 4IG2A 5HATA 1NFPA 4TVUA 3HN3A 1RLCL 4U3AA 1UB3A 2VD9A 3A23A 1DJWA 3W6LA 4GQRA 1AW2A 3ABRA 3L4YA 1VBGA 3PNUA 4LF2A 3GUWA 1E6QM 5CC5A 1O68A 1XV8A 1O60A 1FWNA 2WBKA 1GOOA 1H0IA 4WOZA 1VBJA 1CTNA 1SVDA 3V35A 1UZHA 2VZUA 1WKDA 3D0CA 3TEVA 2J24A 4B5NA 1F7BA 3DKJA 4QSHA 2Z7KA 3TDFA 3GVQA 3KBNA 2XINA 2QUUA 2CPUA 2EGZA 2P8BA 1T3NA 3S4TA 3MJMA 1UKPA 2DIJA 5G1TA 3K4AA 2X0SA 3GIPA 2C14A 3NVDA 4PBEA 4LGXA 1X38A 3BUVA 4JCMA 4DJED 2QDGA 3UY7A 3V0TA 4YPJA 2VOMA 3HG3A 4LPCA 1UZ1A 3MHGA 1TE1A 3WY1A 1HFBA 5DO8A 3M5YA 4I9MA 4FI4A 2CC0A 3SUVA 3U3HA 1A5MC 4L4OA 3GU1A 3ITYA 3OQ8A 2YOCA 3WNLA 4NAFB 3WNMA 2IKGA 2BY1A 4DN1A 4IH3A 3TJLA 2V67A 4AZCA 3P84A 2D0HA 4K68A 4M81A 4QTGA 3F4DA 1C90A 3B0UX 4KFNA 1JXLA 1AA1B 1TPEA 2BHUA 2PGRA 3GLCA 4U5IA 4Q8VA 4LRSA 1E71M 2GPTA 1DE6A 1XPYA 4A35A 3WQDA 4BQ4A 5EMYA 4MG4A 4FMVA 1VIWA 1G7VA 2CZFA 3W9ZA 3PW5A 1IM4A 1EL3A 2E9MA 2J7EA 1WKYA 1F3EA 3D3AA 2PC4A 3GTXA 2FTWA 1OCNA 2G37A 2ZVIA 4TQRA 3BAWA 4ECTA 3NGDA 4NKCA 1UQYA 1MXSA 4F2TA 4S39A 1UWSA 1P6WA 1Z69A 4OV9A 4CNOA 3R79A 4JKMA 3RK8A 1EIBA 1QUMA 3KCLA 5HXMA 3W7JA 4JYDA 1CT5A 1RD6A 1J0HA 3O6YX 1UBSA 3KZSA 1B90A 3AYSA 4GFIA 2DT2A 4FO4A 4MWAA 4NNAA 2QUVA 4DELA 4JHMA 2BY2A 2OMAA 2RGLA 3EEZA 4J7RA 3CJPA 1OX6A 3D46A 3KWSA 2W9CA 3GYEA 4W89A 1CXEA 1TZ9A 3SY8A 1V3JA 3BCJA 1QMLA 3REQB 3VGHA 2X0YA 1JAEA 4PL2A 2BS9A 4NIRA 2IQ0A 4H6EA 1MZRA 2VFDA 4GFSA 2A1YA 2I7GA 2WZEA 4M80A 2VEPA 3IJQA 4M19A 1QO5A 2BOEX 4UMCA 1A47A 7REQB 4MAZA 5AHMA 2H3BA 1XYLA 5D4YA 3URNA 1W3NA 2BQUA 1SJCA 3URBA 3GYCA 3VOFA 3T55A 4MVAA 1CYGA 2BP1A 1GEQA 2XVKA 4ZTXA 1SMAA 5EU9A 5DMLA 5BCAA 3VI2A 5M03A 3MB9A 1A3XA 2PP3A 3P7YA 2VVNA 4XG1A 3CUGA 4F0KA 4K6AA 2XG9A 4ACZB 1UUOA 1D2KA 1A5KC 1ZL1A 4J35A 1HL9A 3WD4A 4DXXA 4PMXA 3LPPA 1V08A 2P1FA 3K5XA 5AFDA 3TQ0A 1V6UA 4IP4A 3F2BA 4PB5A 1FWEC 1X1OA 3II1A 1BD0A 1A80A 1GEHA 2QPUA 3E9AA 4FSAA 1XIEA 3ATYA 1GOKA 3NM1A 2QJMA 4MOZA 1S2UA 4WF7A 5C71A 4KCWA 4AHQA 2QDEA 2PLMA 2VDIA 3W72A 1K7EA 2YCLA 5PTDA 3NQ2A 3W7RA 1KCKA 2AQOA 3EB3A 4QLLA 4QS6A 4AYGA 2ZUMA 2NVDA 4BI6A 4C1LA 1PYFA 2ZE0A 2BBFA 5ENLA 4HU4A 4OBRA 3SN1A 4DJFA 4O10A 1JRCA 3B8TA 5LA0A 3TNBA 1JDAA 2QCNA 3GW3A 4HNVA 4IL0A 5FL0A 3LOTA 3LXBA 3U0HA 3WD1A 4LV4A 5DCDA 5BRBA 3WG6A 1DJNA 3BANA 5L1LA 2I5QA 3E0VA 3G5EA 1X8FA 2A6LA 4E2OA 3SFKA 3L5AA 1P7TB 4EXQA 5TBOA 4HK7A 4S3FA 1EHAA 2NQJA 1OK6A 2NLYA 4JFTA 1AZ1A 1ZP3A 4QWCA 1SW3A 1FKXA 2A3EA 4FALA 1HGWA 3SGZA 1ZB5A 1RYSA 4KIEA 1DJXA 1X96A 1UWQA 1F8MA 2C15A 2F6XA 3OP2A 4JFUA 2A3BA 1F3WA 4B5VA 3FOKA 3DEQA 3M0HA 1HO4A 3PZQA 5KFMA 4PBFA 1SO3A 5M3WA 3W7PA 1EX5A 1WCGA 2PDHA 3OJGA 4QWBA 4FEZA 4LEFA 3S47A 2VFFA 2E4TA 5KFXA 1WUFA 4FS9A 1X97A 1G6CA 3R43A 2GVGA 4UTHA 3WFAA 3ME3A 5A6LA 2H8ZA 3UWVA 1EOMA 3WMBA 2UVVA 4JTEA 4PCSA 1W1VA 3ATZA 3A3WA 3SQMA 2AGOA 4XAPA 4LTSA 3ZFHA 4GY7A 3WQ5A 4GI6A 4WSHA 3G1FA 1DIEA 5FIPA 5K7JA 1JL8A 1W37A 2J9ZA 3RNDA 2GDVA 2FHCA 2QDDA 4C1NA 1XIDA 1UIOA 3RMJA 3N15A 3TC7A 1ICSA 4V1XA 4TOQA 3W1MA 3VDHA 4JTLA 3EYPA 3MBFA 5MKGA 1W3KA 1WA3A 1PZ2A 3C3UA 1FX6A 3VABA 4LH8A 3P8JA 4Z2HA 3WK2A 4CN6A 2I9UA 3MUZ1 5AYXA 4IFKA 4IMFA 5C54A 2CNCA 4X2RA 2YW4A 3FYPA 3WQ8A 1D9EA 4OBSA 2WHJA 4FXJA 4RX0A 4I5UA 1DORA 9XIMA 3COTA 3I3DA 3VKKA 3PR2A 4P8XA 1FWTA 3BV4A 3TE9A 3WLIA 1K3UA 3VX0A 3LM3A 4M8UA 4HP5A 3UY8A 3GTNA 1S0NA 2QUMA 4DWSA 4O57A 1GOIA 4J4KA 3TROA 3N2MA 3W6YA 5T26A 3T9PA 2PWVA 2VGBA 3OG3A 3FXYA 2F61A 4IL2A 2DJXA 2OQYA 4H9ZA 3GXTA 5LIWX 2E25A 2C3ZA 2WCGA 2XGBA 3KL3A 1VFMA 4DZAA 4UTTC 8TIMA 4C7GA 2XFFA 3CV2A 5I77A 4S3BA 2BVWA 2OWWA 2V9DA 1BWVA 3PZOA 1ZTVA 1WAUA 2W6RA 1TJRA 4EYHB 4HOWA 3GNOA 4DUOA 1TO3A 2HISA 3KRBA 4XBSA 4Q6XA 3VE9A 5HBFA 1UJQA 4LUTA 4XTDA 1S3HA 2OKOA 3K8KA 1E55A 4PMYA 4AEOA 3EXRA 1UD8A 5IOBA 3WL0A 1H7XA 4ZQPA 1H61A 1FH9A 1GVYA 1M53A 1LBLA 3HOJA 2PDWA 2YDQA 3ABOA 1RP9A 3W53A 3DOPA 2ISSA 2NSOA 2PUZA 3GB6A 4BF9A 4ZGYA 1JGIA 3MSRA 4I3GA 3WBYA 4I9JA 3S5OA 3S0CA 4RCXA 4ZZ9A 4DO6A 3BLEA 4ROQA 1XFBA 2IUZA 4Q43A 2OJPA 4EVZA 4HPXA 2A3AA 1ADOA 4QROA 3VIHA 3LGDA 4UQ9A 4J2MA 3W86A 1XX1A 2AMGA 2XN0A 4XTIA 3WNPA 5KG3A 4NRSA 3FIGA 3IPWA 4AUBA 3B03A 3I3BA 4FOKA 2YA1A 1T40A 1JPMA 3AU6A 3KBWA 3PZMA 4P7OA 3W3OA 4O4WA 4P8WA 1J6OA 4QEEA 1SR0A 3WJSA 2E9BA 4E2VA 1KR1A 2ZRXA 3MTWA 5LIXX 4IR9A 3G1VA 3R0DA 1XG3A 3DG7A 2QIWA 1GW1A 4AY8A 3GTHA 5ABEA 2P53A 3H2OA 3N19B 1RH9A 2ALZA 1QBBA 3LV5A 4CUCA 3ARWA 2WVTA 4HNOA 1K8CA 1Q65A 2GQ3A 3PPGA 4GHRA 2INZA 1O5RA 1FH7A 2QPXA 2WPBA 2WPGA 1Z42A 2EPOA 2HCVA 3RLHA 1RJQA 1F74A 1EDTA 3RR4A 3EXSA 2OSYA 1CCWB 4U4MA 4KH2A 4ZENA 2Z1VA 1SO4A 3CUJA 1EJRC 1GKPA 3SCOA 1R5YA 1RALA 4KWVA 5LA1A 3E5BA 5EWGA 4UFMA 3BJTA 4YVPA 4IWWA 1PYMA 1ZSXA 2DT0A 4RZ5A 3H22A 3WH9A 3DYPA 3MP3A 1EQCA 5D33A 2E67A 1JZ3A 1JGMA 1VHCA 4ED3A 1EX1A 4D6FA 5DMNA 3NSXA 4GX9A 5AC5A 3CUIA 3GV5B 3AHZA 3M44A 2GJXB 3P80A 3UJEA 2I56A 1V0MA 3UCQA 1IXQA 1KC7A 3UCDA 3BOXA 4QE4A 2FH8A 3WH6A 1FWRA 3JRKA 2IPGA 4XX6A 3ZJ6A 1Z7AA 1J0KA 2FZBA 2WZMA 1M5WA 3DESA 1TJ2A 5KETA 2VC5A 3CAWA 1WDSA 3D5HA 3TYDA 1YTKA 3DKLA 4AWSA 4OOZA 2REQB 3MV11 3QR0A 1R7AA 3XIMA 3PSVA 2QW5A 2DZPA 1IYXA 2PTWA 4DJDC 2ZZ1A 2NUXA 2FDSA 3QPEA 1EYWA 5LGXA 4QNEA 4CD6A 1X7IA 1D7FA 3HGRA 1AL7A 4AAJA 1JFHA 2J9XA 2R8IA 3AXMA 4H01A 1YADA 3MYOA 3EWDA 2VELA 1NEYA 3NVTA 5LIKX 1X1ZA 2FLPA 3NJ3A 1KA9F 4QRNA 5C2CA 4XV0A 3EDEA 1U5HA 4B16A 3GWQA 4YP3A 3ARUA 1ZJHA 3V16A 3W07A 3QOKA 3Q67A 5A8NA 1E9ZB 4ECUA 2VA2A 3LNPA 1A5SA 4LUYA 1FDYA 5AYYA 2JEGA 3DBPA 1QJWA 4TVCA 3W23A 5BMWA 3HPAA 1QHPA 2VEGA 3AWOA 3UR8A 2JIWA 3OSNA 4LU0A 4RNHA 2V4RA 1BYBA 1RBAA 3NQFA 3BQ1A 1C9WA 1CB7B 3ARSA 5DMYA 4KMQA 4MWAD 5FI8A 1JPIA 4O28A 2Y62A 5A2CA 2J62A 4KEZA 1TR9A 1GOWA 4NAEB 3THQA 3SCWA 2WLYA 2W4XA 1W5PA 2O55A 3W00A 3RM9A 4ED2A 3PR4A 2GQ9A 3PN8A 3V6KA 4QCFA 3WEZA 4L5ZA 2TMDA 1XGZA 4JAWA 2A3LA 3E6EA 1W1B1 3NA8A 3KFTA 4V1YA 1I1XA 4XO6A 3UETA 4KERA 3N2TA 3G1AA 5D2YA 5BOEA 3GDLA 3WCZA 4GYJA 5M2FX 4KGJA 3WJXA 1E9YB 4LBUA 1WXJA 3GFXA 3FHAA 3NNTA 4X9YA 2ZRZA 2WMFA 5KFWA 3H2CA 5DQHA 1ITXA 1OQFA 2OLHA 4JIIX 3NPWA 2OXNA 3KTXA 5C8BB 3U2ZA 4OHQA 4EWND 4OVXA 1V5XA 2XGZA 2PSNA 4M3PA 3LG3A 1BYAA 3WMCA 1UC4A 2AGTA 1NH6A 1SFLA 1RK5A 4JFWA 4Q8TA 3UNTA 2E6YA 3WDIA 9RUBA 2FFIA 3BTNA 3ITTA 3DERA 4MLRA 1PSCA 2FPVA 3AALA 2XH0A 4JTAA 1ISYA 3WQGA 3AXHA 2PURA 1KTNA 5KZEA 3VU2A 2ZCGA 5KFZA 4D6HA 3GZAA 2VX4A 5H91A 2VI0A 3ALFA 1ADDA 1TTJA 3CMGA 5DGBA 4GVIA 1F73A 3RILA 3DHFA 2IKIA 3GKAA 4TV6A 4IPPA 3AIEA 1JCMP 2ACUA 3SSZA 4DJFD 5ECVA 3T0DA 1VH7A 1HGYA 5ABGA 3G6MA 4AY7A 3TN5A 3T8QA 5CSRA 5C9UA 2D2GA 2XTKA 4M6QA 2HE5A 3MHUA 5EFFA 1CI1A 3FKRA 4YTRA 3UXIA 5I3FA 3UCCA 3S9YA 1UA7A 3TNOA 1TG7A 1GQNA 2PDUA 4AZHA 4GI9A 4BI7A 2V38A 1EIXA 1KXTA 4RDYA 4ED1A 3WEMA 1EZWA 5M5DA 3GO2A 1ZHAA 1P1XA 4R7WA 5H8MA 4NXSA 1F6KA 4ED8A 1PTDA 2EAWA 2YB1A 5L9FA 3GDKA 2XIBA 1ISZA 3W2KA 3NUKA 2Z26A 5I3GA 3WK3A 4O15A 5CGMA 4RV3A 3RG6A 1OFAA 3CZGA 4XZLX 1FWAC 3NEVA 3W82A 4FLSA 1DWHM 2I17A 3GW0A 3PUEA 4C65A 2OPJA 2D73A 1KWKA 4N9BA 1P5BA 3QY7A 3Q45A 3IJ7A 2CBIA 1EJ7L 4YN5A 4DRSA 1H49A 3BAJA 2XISA 4QLJA 4A6GA 2EHHA 1Y7VA 3SCVA 1L2QA 3EKLA 3WQEA 5I79A 3MO4A 3UVIA 3AYRA 1L9WA 1E73M 1PX8A 3VC6A 4J9KA 2CZEA 4HU3A 3L0KA 3N12A 3FDSA 1DYSA 1BXBA 2CFFA 1K1DA 1YRRA 3WK0A 4P5UA 3HMCA 1U2YA 4EPEC 2E5BA 3MYPA 2PP1A 1W56A 2IPFA 3DYMA 1UWUA 3LCWA 2F2KA 1Z89A 3LBMA 5G2HA 1OVDA 4OOUA 1EJSC 2Y7GA 1T6MA 1TUFA 2YZ5A 5CKSA 2XVLA 3EAUA 3OG2A 3NO5A 3QHNA 1VPQA 3E2RA 1KD0A 3IN5A 3MS8A 1K03A 2J6VA 4IZGA 4KCVA 3CUHA 4AIOA 1IGWA 2OQLA 4C6JA 2VL4A 1BQGA 2H9AB 1Q7QA 1Q6DA 1Q6QA 4Q4OA 4AX6A 4C6NA 4LAKA 2J66A 3QTGA 5J5DA 5DF0A 2J88A 1B3OA 1U83A 4DWSD 2PDBA 4GIAA 5KFFA 1IIHA 4UTTA 3F5JA 5I3JA 1I0DA 3SSJA 3NGJA 1JZ4A 4I5XA 5LA2A 4FZIA 4PSPA 8A3HA 4JNYA 4YCPA 2OLSA 1W3LA 5EL1A 2QXWA 3QC0A 1HL8A 3EOUA 4QG6A 2XZ9A 4L4MA 3CIXA 1WBJA 3E0WA 4Z2IA 2HQAA 3M0IA 4N7QA 1QNOA 1VQTA 4O3QA 1OSEA 2NV1A 8RUCA 6XIMA 4ADUA 5A6TC 2V81A 3NL6A 1LM1A 4QE5A 1LT8A 3P0XA 2CU0A 1OFDA 5DQGA 1OJXA 1Q6CA 3B8UA 3BOLA 1EF2A 2PS2A 3PB2A 1ISXA 1KLYA 3W85A 3NFUA 1D3GA 4UNIA 3VNYA 3IRSA 3MP5A 3H55A 3SURA 4DL5A 2ZKMX 4NZJA 4RZRA 4UQAA 2OG9A 2AMXA 3ZZ1A 1IEWA 5A2AA 3KBJA 2YL8A 3TW7A 2QHAA 2X1TA 3UR2A 4EPBC 3W7GA 5HWNA 1EH9A 3W1TA 1V51A 2B31A 2Z24A 3DYOA 1K4GA 3CLMA 2GVJA 4LSBA 4GNVA 1E43A 5BWAA 1AVAA 4K7VA 2W79A 4ICCX 3FX4A 3T05A 3PULA 4I9AA 2YSWA 1QI4A 3AXXA 4B9ZA 4PUWA 1NIUA 1N82A 1QBAA 4S3EA 4FAMA 4S3KA 2HXUA 2VMFA 3C52A 1O1HA 4FR6A 4NX0A 4RNFA 2VUYA 1EWEA 3WDJA 3M43A 3W1NA 3ABQA 4N6FA 4CU8A 1CGXA 3DG6A 3CPUA 3F5KA 4GE8A 1N7KA 3G24A 3TW6A 4YQWA 3VIKA 1BG4A 3M9YA 5AZ1A 1Y5WA 4AF0B 2X41A 1V6TA 1UKSA 1XH1A 3W6MA 3BO9A 2TPSA 2EEXA 3S2JA 1KBLA 5KFVA 3MPGA 1JD7A 3KZPA 4NQ1A 1GNXA 1V6VA 2G50A 2C2EA 2B7NA 3N4AA 1KFEA 5HINA 4ECVA 1NOFA 1NDWA 2PC8A 4MY8A 4R85A 3QYQA 1QW8A 4QWAA 1ODZA 1B3VA 4NLGA 4FOJA 1BWLA 2VFGA 1GVQA 4WJEA 3KOZA 2YCIX 5DX7A 3ITVA 1AJ0A 3KS6A 1J11A 1DTNA 1S5NA 2PLCA 2NV9A 3MFIA 4MADA 1GKQA 3M9MB 3T7VA 3V4BA 5BXRA 3UESA 4PTDA 3TXVA 2QV4A 2GDUA 2R14A 3TK7A 5TAOA 4GJJA 1OY0A 4H2CA 2OYLA 5FAGA 5KG2A 1XGDA 3UWQA 3M1ZA 1E4MM 4GC3A 4LS0A 3VDBA 1Q8JA 2D22A 3SCRA 1OG6A 2HBXA 4E6MA 1TYGA 1TSIA 1LT7A 3R2GA 4FS1A 4DJDA 1SGJA 3G6VA 4QIUA 3TP4A 2D69A 4LCSA 4E4PA 3LMYA 1DXIA 4Y9PA 3N1AA 2WQDA 4HN8A 4JTIA 4AZ5A 1N2VA 2E0PA 4ZA0A 1ZETA 4KRZA 2A0NA 2VCBA 4ZB5A 4FXFA 3K1DA 1ECQA 4FA3A 1WP6A 5G2IA 3TKFA 3G2GA 1HKWA 7ODCA 1B9ZA 5KT3A 3L9CA 1VB9A 2F8QA 1H7WA 1KTCA 2PDMA 4Q32A 3O05A 5FCZA 1V79A 4Q8UA 4AH7A 3DFNA 4YYCA 1FOBA 3NQCA 4DLMA 4WIWA 2ASHA 4PMNA 4URIA 4FNQA 1B30A 4I9TA 1K6WA 4CQCA 4V28A 5I5RA 1PDYA 4B9YA 4KEUA 3U6WA 3C0SA 4UFHA 1JQXA 3ARXA 1XPGA 3WF3A 2DH3A 4U10A 1LLWA 1M41A 1XINA 3KOYA 4OKDA 3TQPA 1ZBKA 4L9XA 2C91A 3SFWA 3S6DA 4PZVA 3HM7A 1FXPA 5CPQA 1VCGA 4HMNA 4PCPA 4J3SA 4AG0A 3VKAA 4EF8A 3EPMA 1DJIA 4JL2A 3GK0A 3EX3A 3W2UA 2PLJA 1ZAHA 2PRHA 3FJ6A 1TMQA 3MZNA 1RUSA 2CCRA 5CPMA 1ODUA 3M47A 1HKIA 2R8JA 3VAVA 1TPDA 5KEZA 4GZ7A 1E0UA 3MSDA 2DIEA 1OFBA 4IQLA 5BRQA 3AZRA 2G3IA 4DYJA 1J6PA 2ODOA 2WMIB 1K9DA 4FPSA 3S1UA 4O3NA 2NQZA 2QCGA 2YPIA 4MJZA 3DDMA 2CXEA 4A22A 2B7QA 5KT7A 2W63A 3GKFA 5C0QA 4MB4A 3GSMA 4IX2A 3WDPP 2A4AA 3A3HA 2Z1SA 5JUMA 3C2FA 3CO8A 3DAQA 3WLPA 5K9DA 4J9QA 5C9WA 1XG4A 3FFSA 3E2SA 3L68A 4QM1A 4FNTA 1HN1A 1YQ2A 4DZHA 1WZMA 6ENLA 2VEFA 1XM3A 4B92A 4JIHA 1JDCA 2ZRWA 4UTFA 4GG9A 5HJYA 1S9FA 3A4XA 2BG5A 4Y8FA 4Z17A 4RUAA 5CPSA 3TWBA 1OZMA 4WXZA 1R85A 3SQLA 2V5DA 1DJGA 2FZ8A 1WXYA 3KOXA 2QAFA 4HHMA 2GGHA 5BW6A 4QISA 2ALRA 3UWYA 1BTCA 4HNCA 2J75A 3KE0A 3WDRA 3U2EA 3U48A 3FXGA 1DIKA 3VDAA 3H12A 2ASDA 1OX5A 1ONEA 5AOUA 3B8WA 3B40A 5FEZA 3H7RA 1JF6A 3TMLA 1BRLB 5EMUA 3P60A 1CIUA 3OB8A 4I5RA 2KX9A 3L4WA 2D3NA 2E9LA 1MNSA 3DGRA 3LRMA 3TU9A 2JEPA 1TWDA 4LW7A 1OCQA 4YYFA 4ZOBA 1X39A 2WC3A 2PBGA 3V0UA 6REQA 3LDVA 5EMKA 3AHTA 3OYZA 5MF5A 1T7LA 3UW6A 4KQNA 1YLVA 3H2NA 3MT1A 2GGJA 3GNPA 3IAPA 1RY8A 1LQAA 4ZQOA 3BLFA 3L0NA 3T1GA 1ADSA 4ADTA 2R24A 2GVEA 3M7WA 2HWGA 3BG9A 1CGTA 5I00A 4PTVA 2HK0A 4DM2A 3L67A 4Q7BA 2OH2A 3VYLA 1H62A 4G7EB 3P2VA 4MPKA 1G4SA 4OBTA 4H8VA 4TQSA 2D2HA 1MEWA 4PUNA 2XGQA 4FNPA 4GXMA 2UBPC 2GJLA 2E8YA 4IUGA 1E0XA 3AIUA 4IRDA 3HPSA 5DQPA 3H2MA 1DJYA 3WJWA 3VZYA 4ZMGA 4JICA 2W8LA 1U5JA 2CKRA 4ZFCA 4K36A 3W1XA 1A3WA 2A85A 3PVFA 3NPVA 2D2OA 4EBCA 4KGLA 2YL6A 1YPIA 1JZ2A 2O0TA 2AL1A 4BQ3A 2ZRVA 4OECA 4O1CA 1R3TA 2AQVA 3KBMA 5AHFA 3LRLA 5FF2A 1E1CB 5DANA 3SRKA 1EO7A 1U30A 3UERA 1ML1A 4D8LA 4QSFA 4RDWA 2CHRA 3IGSA 4L6OA 5IFPA 3C2RA 4LYQA 2JEJA 3G6LA 4HYVA 4GZIA 1LJYA 4XIMA 1FWJC 2PBOA 1UOKA 1BF6A 2VRQA 4IR1A 1BKHA 1S3TC 3IANA 1TZZA 1KKOA 4TUFA 2E28A 3PUOA 3PBGA 4CQ9A 3N4EA 1B3YA 3DFSA 4NJIA 1Z41A 3GVWA 3EX2A 1V0KA 2XU2A 3B9AA 4ZO6A 4MPQA 3R10A 1UD6A 4Q8PA 2HPMA 2HXTA 2ZVRA 5D04C 3Q8QB 1EXPA 3B9NA 2WMKA 2R1KA 3CH0A 3H53A 3F4CA 3BW3A 3TJIA 1XC4A 1JXJA 1J9YA 4OJYA 3BQ0A 4KWWA 2X8RA 5CCZA 1G67A 5D37A 2QUNA 1UW9A 3G6XA 5TD4A 1JPDX 3FA3A 3OHIA 1MXGA 3G0SA 2C22A 3FYOA 4IPLA 4JY9A 3AISA 3FGCA 4EIVA 1VEOA 4KEMA 3ABZA 2CITA 2FPYA 3HB9A 3QHMA 1XBYA 3DFTA 3W1UA 1IT8A 4UC5A 1MMFA 1RPKA 3GXNA 4NZ3A 4F48A 1IV8A 1DE5A 3NTYA 3PW0A 2WHLA 2ZRYA 2Q8LA 2Z2BA 5AC6A 4PMVA 4TVDA 3OA3A 2PLKA 4JIQA 5A8OA 4PRRA 3WFLA 3ITXA 4UFJA 1ITCA 4HMCA 4J9JA 1ENUA 3E2QA 1CX9A 4HT3A 2CLPA 5I7GA 2YCKX 3C2VA 4G5DA 3WDHA 2HZGA 1OGBA 2Z4GA 1RJPA 3STPA 2XCPA 3VNDA 5F2GA 4DI8A 1G4EA 3CNYA 3GR8A 2ZQ0A 3L4XA 3FVDA 5FF7A 1X6NA 3KVJA 1QDSA 3AJ7A 4KS0A 2W8KA 3GVGA 2X1RA 1J18A 1SMDA 2Z1WA 3SN0A 1J5SA 4ENLA 4GVGA 4ECSA 2QVNA 3MWAA 4LVGA 3CT2A 2XH7A 1XL9A 4LUJA 5JIPA 4KFOA 2D2JA 1SZEA 3P6LA 1PKYA 4KWSA 4L64A 2OSWA 1CXIA 2OT1A 4GC6A 3UXLA 1M1BA 4AQLA 1JXKA 4B5SA 3M0ZA 5DLGA 2O9TA 2MANA 2QULA 3TC6A 3NQVA 2DJLA 1S5MA 2J7GA 2ZDRA 3H8AA 1F2JA 4LXFA 4GKTA 1WX0A 4WLCA 4EANA 4OUEA 4BZYA 1JI2A 5L6UA 4HU8A 1BPLB 1BXCA 4XKYA 3BJYA 4BS0A 2I57A 1QI2A 3IIVA 3VNJA 4IGSA 3P93A 2GGGA 2B81A 1PUDA 1DQUA 4NJKA 1US3A 2QV5A 3RX2A 4IUOA 4C1KA 2HEJA 1L0PA 2DUAA 2P76A 3MUIA 3ZT6A 1XLKA 3AUJA 4EYIB 2V69A 3T4WA 3G1SA 3EPNA 1PHQA 2IA6A 4LEQA 7CGTA 1VBRA 1WXZA 1OFQA 4OUIA 4WHBA 3R89A 3WF0A 1CW2A 3PWIA 4ERIA 3W02A 4HIBA 5LNVA 3B9EA 1X1NA 4ML9A 3L5MA 1B3ZA 4DBDA 4J9MA 1LRNA 1XS2A 3GNRA 4FXSA 3GTFA 3LTPA 3ZLHA 3F4VA 2X1UA 4LVBA 3W88A 4WGHA 4X60A 3OGVA 6TIMA 2ATSA 3LYEA 4DI9A 3JVAA 2ZFAA 4UB9A 4O50A 3IIZA 2JFEX 1YKWA 5DCEA 3N9SA 4QJ5B 3LHVA 3G77A 2E8ZA 3M46A 1ITQA 5IM51 2ZDSA 3AAMA 4Z2GA 1KXVA 5AHLA 3GIYA 1GYNA 1N8IA 4DYEA 1OHLA 3VD4A 1MEHA 3WF1A 3TTSA 3BCFA 4FXRA 3WLKX 1UR8A 4YLWA 4DJDD 2W9MA 2PTZA 2GK1B 4YIWA 4CCZA 1TQXA 3NAVA 4ZTYA 2CERA 3QMSA 2W27A 3H2FA 3KP1A 5BXTA 2J77A 2ZZ3A 3GY1A 3B0YA 3QZ7A 5I6SA 5F9NA 4XB3A 2KAUC 5H1WA 1L8PA 1SFJA 2JKEA 3SY5A 2W5FA 1XD1A 4O3PA 5ABFA 3Q94A 1H41A 2OFJA 1UD3A 3RXZA 4MJ4A 4W5ZA 4GYPC 4GZJA 1IWPA 1V6YA 1KM0A 3NOYA 2BY0A 1F3XA 3BG5A 2XUCA 3O6DA 4Q22A 1W9VA 1LQ0A 4UR8A 4F0MA 5L1JA 4CQBA 1VPXA 5AKQA 4AD5A 1EJXC 4PA8A 1VLIA 3TMQA 2LLEA 2WTFA 1C8YA 4GD0A 3WBAA 3RX4A 1NAL1 4MB1A 4YTTA 4H9UA 4ZO8A 1MFUA 1SW0A 1DQWA 3NOEA 4KFPA 3DECA 2DP3A 3SGGA 1EKOA 3MUAA 4QG8A 1OGSA 3QV9A 4MDOA 4DQWA 1E70M 1T5AA 4H7VA 4F9JA 4WY0F 1XHGA 5C9RA 4QWEA 4HPHA 2NZLA 4RPQA 2QUTA 3LNMA 3QFWA 1JCJA 3BW2A 3KRSA 3CQHA 3FA5A 1R30A 3QSTA 1E56A 3GC5A 1A5NC 3CB3A 3URAA 1W2PA 4O4VA 4JV0A 4S3JA 3NSMA 1YE4A 3CL6A 4J3XA 3R8GA 5GVJA 4XVEA 1WDPA 4BF5A 3OGRA 3CPGA 4H04A 1B31A 3AS2A 3QRHA 3KP0A 4JBRA 4JNMA 1H5VA 2GJRA 4MSSA 1IXPA 2YKKA 2WHMA 1E72M 3CBWA 5AECA 3MCOA 4AHPA 3RAXA 2V3DA 2PCEA 3CB8A 2A7PA 1JYXA 3U5YA 3PC0A 4QX4A 2O92A 4JKKA 1WZKA 3C6CA 4Y7EA 4Q4RA 1IF2A 1Q85A 5D9PA 3KRUA 3PK7A 4P7LA 5ABHA 2C8NA 3B06A 2W7PA 4DBWA 4LJ3A 1XFCA 3S42A 1HJWA 4AEEA 3KX6A 4ZE4A 1JRBA 3DCPA 4GC4A 1XXXA 3A9IA 3W22A 5JXQA 3QV6A 4NASA 3MWCA 4IQJA 4BK9A 4MY1A 1JPHA 2XIOA 3K46A 1Q13A 3W74A 1F6PA 4R9XA 4C6BA 1S2WA 4F2BA 1JZ8A 3IVUA 2FMNA 4GJIA 1D3HA 4UTUA 2FH6A 2BOFX 2QJGA 1TJPA 4G56A 3KW3A 1CB2A 5D02A 4H6QA 1NM9A 2HVOA 4G3IA 2W7OA 2ZWZA 3TYBA 5LKYA 1XLAA 4MB3A 2PP0A 3WMSA 2VT0A 4BF7A 5EWFA 3MUCA 3PWGA 1H7NA 4MLJA 2DDXA 1XRTA 3LGEA 3GBDA 1OD8A 1VHNA 4TR9A 1J0JA 4A3HA 3Q8RB 3LRKA 3FCPA 2ZWYA 1P0KA 2VFHA 4FX7A 1CEOA 1V4YA 4KT2A 2FKPA 3HPFA 3O15A 3POHA 3M16A 3H70A 4O1EA 1B1YA 4RE4A 1FKWA 5A6BA 4DYKA 5G1MA 1SO5A 2A6NA 5I23A 1LOQA 1KFLA 3S6OA 3QW4B 4RXFA 2J79A 2Z0IA 3TYAA 1UKQA 3L2IA 4N6EA 1XQLA 4YJ5A 3GR7A 1XCFA 3W83A 3UG8A 5EFDA 3B8IA 5EMLA 3QF0A 4EEYA 3CQKA 4DVOA 2PDKA 2Y85A 3GDMA 3GXIA 3TSBA 4LFYA 4C90A 2QCHA 3CC1A 3FYYA 1B4EA 3RFAA 4NYUA 1XW8A 1MQPA 1HT6A 2C0AA 3FHQA 4B5TA 3WO8A 4WEVX 4F0SA 5LIUX 1TRDA 5HR7A 4ZQRA 1PBGA 1NFGA 1TV3A 2Y7DA 1TX2A 3MMUA 4Z2JA 1KFJA 1PXGA 2QMKA 4AIBA 1JD9A 3DC0A 1YDVA 3B04A 1C7TA 3INPA 4Q4MA 1KBJA 2GGEA 1Z48A 1X98A 3W70A 2G3JA 1YNQA 5HDRA 4D1IA 1XIIA 3FKKA 1I9CB 4JYFA 1YIXA 4C6KA 3SRFA 1R46A 1XIGA 3VIJA 2FZ9A 2P0OA 2WWDA 2R8HA 1JUBA 3CS2A 1E1FA 4IISA 4HHLA 3N2BA 2CZVA 4FLOA 1JR1A 5DFAA 3UU0A 1TZ7A 1UWTA 1VEPA 1UHVA 2VYOA 4K2SA 5I07A 1TPWA 2P88A 4JHZA 4CD4A 3EWYA 4UFLA 2J27A 1EP3A 1ZU8A 3ZJ7A 5I06A 3ECQA 3AMDA 2XIIA 4GISA 5LNUA 2GWNA 4NU7A 4JQ1A 3VIFA 4ZQMA 3ZXWA 2ZC1A 5MHBA 3KTCA 1DBTA 4JX4A 4LYPA 3UXAA 4F2UA 2C1IA 1LOSA 1KNWA 1OF8A 3EKGA 1EB3A 4BWLC 1KCXA 1ZZMA 2EO7A 1K77A 1IGSA 4FK9A 5XIMA 3QPYA 4AY1A 4OTKA 3WEOA 5KFRA 2YIHA 2VR5A 3NZQA 1TIWA 1VJIA 1ZCOA 1IWAA 3FDGA 4JQ4A 4V2XA 3RCMA 3N9RA 3GILA 4NI8A 1AJ2A 2WVSA 3EWUA 4O3RA 1UPPA 4JIRA 1IR1A 1S1PA 5FJPA 2PCQA 4IJRA 2NVAA 4DEFA 4Z1BA 3F2CA 5FEXA 3FLUA 4GPNA 2PTDA 4LBRA 1JQVA 4XAZA 1R3YA 2BHZA 2X1IA 4S2BA 1I1WA 4M5PA 4RDZA 1A5OC 1WKEA 1E0TA 3L4VA 3V6HA 1FCBA 1FHUA 5FJTA 3KM8A 3N6JA 4MJMA 4NNCA 1S1RA 1KM1A 3FAXA 1EPXA 2ZYFA 5D09A 1F9CA 2AGKA 1DIOA 1EJWC 1MVYA 2XWEA 4NX5A 3AC0A 2FQIA 1XI3A 5REQB 3R0UA 3HA1A 3TYEA 1B5TA 1DIDA 4UBPC 2V5LA 4GABA 3EWXA 4Y9OA 1RQHA 3TV8A 2VRKA 2FFCA 5EPDA 5TQLA 4Z2LA 4RNNA 3W0KA 3T8LA 3NO3A 2JF6A 2IXVA 6XIAA 1O5QA 3TUUA 2BVTA 3RRXA 3N13A 3J7HA 1HKVA 5KINA 4B5XA 3S9ZA 1JX4A 3E1F1 3UJRA 2C79A 1XYMA 1XLMA 3UEQA 1O95A 3RN6A 2WM0A 5HUOA 2VURA 2RDIA 3GIIA 1UR4A 3ZSSA 3U2OA 4L61A 1V6WA 4KCUA 2XCAA 2PZNA 3PF3A 4Y96A 3MW7A 1Z44A 2GQ8A 2Q8XA 4IFOA 4Q8EA 4H1ZA 1BVWA 3WL1A 2Q01A 1DV7A 2XN1A 3GE7A 4ORMA 3N11A 3RB3A 2Y63A 1V3IA 1TCMA 3HF3A 4AWUA 1G4TA 3QKZA 3BJSA 4MIMA 1E3XA 4K8HA 2OLAA 2FB2A 2Y6ZA 2J8TA 1VC4A 1HVXA 1FQ0A 1FCUA 2XVNA 4PFMA 4JTRA 2VZTA 5CG7A 5LNSA 4YMZA 3M0VA 2VR2A 1YBQA 1E40A 2WW5A 4YR2A 4LNCA 1KFBA 3SBFA 2Z2AA 3LCXA 4N0RA 2VCCA 3IJ8A 3QR3A 1Z8AA 1NTHA 4PBGA 1UMLA 3LTYA 2ZZ5A 3GIKA 2O9RA 3T78A 1AZ2A 1B4KA 3ITCA 1XQKA 1LWIA 4QXIA 2Y7EA 3KHLA 4NJHA 3AOFA 3GC4A 3P74A 4RNMA 4DNMA 3CV6A 1R2RA 3TA6A 1SZFA 4QCEA 5XIAA 1UPMB 4H8HA 1RCXB 2XPKA 5KFTA 4PCTA 1S0OA 4GYPA 2IQDA 4A29A 3VCCA 2JBMA 5K9XA 2VQUA 2YBUA 4ALDA 1QFEA 1V6XA 3T0TA 1KBBA 1B9BA 1IT7A 2FHFA 3EX1A 3LPGA 1H4PA 3T07A 3ENLA 3EEGA 3BE7A 3SY1A 1JZ5A 4GJ1A 3STFA 3E96A 5A8MA 1ZFJA 4YU1A 1EBHA 4NZCA 2WKLA 4CNNA 1OX4B 1CZ1A 2NQ5A 5DBTA 2QIIA 3ANVA 4AD1A 3N3MA 3R8RA 4LUSB 1KR0A 2FTYA 3LD5A 3DC8A 3WLJA 1US2A 4R27A 4Y2WA 3EGJA 1HJSA 3NGFA 3W7HA 3GXPA 1LDCA 1KBKA 2QCDB 3TZNA 1C8QA 5GJMA 1EHNA 3BH4A 1RYRA 3GH5A 2ZZ6A 1ZP4A 3PFMA 1VD6A 5B80A 4GXPA 3DENA 4K1WA 4A3RA 3VD5A 3L2MA 2E6AA 3R58A 4J9RA 2ATMA 4S3DA 2ZADA 4L6DA 1PKNA 3LPOA 3MP4A 4UUIA 1K4HA 2F6UA 2QYGA 3IJ9A 2W9BB 2WVVA 1OB0A 3UZZA 4MMWA 5DT7A 3MR2A 4RR4A 4S23A 1E9IA 3VKCA 5F9LA 1F5ZA 2DT1A 2PDCA 4MZYA 4WDXA 4E2DA 5A6MA 6TAAA 1JUKA 1LROA 1S2AA 4J9PA 1XUZA 2CW6A 2I16A 2YXGA 2DW7A 4MYXA 3MFHA 1RSCA 6REQB 3OBAA 3G3DA 4Q8WA 1XCWA 3T42A 4RU9A 2WO5A 2IKHA 2GVYA 2B4GA 2X7WA 4DEZA 2J6UA 4AC1X 4WUIA 4IRKA 1VAHA 2VP8A 4LNYA 1U33A 4PMRA 4Q4KA 1JZ6A 1XRFA 2EG6A 2VFEA 3VOHA 1TE6A 1T96A 3P3BA 5E6YA 1IIGA 2E09A 1UR9A 3W28A 4EWJA 5EB8A 4GA8A 4WKHA 3WJYA 2Q3OA 1QCWA 3HQ1A 4J9SA 3O07A 3GG0A 3A47A 4PEKA 1KFKA 3UGRA 2X0HA 4NAFA 1JIBA 3LN3A 3TXZA 1A5CA 4PCNA 4DWDA 1AD1A 4AYSA 4KBXA 4AZGA 4AVNA 2GUUA 5AVHA 1FDZA 3UG5A 2ZUUA 4L56A 1PEZA 2W62A 1A5UA 5LIYX 5TIMA 3HV9A 4NL1A 1HJUA 2D20A 1TFVA 3EBVA 4IIEA 4M0XA 1CNVA 3B8VA 4UTJA 4WSJA 2WQPA 3UF9A 5IBXC 3M6YA 4AZBA 1YTDA 4NZ1A 4XZWA 3UZJA 2V68A 1FWWA 1G1YA 2HJPA 3QEZA 3CT7A 5CZ0A 1BEUA 3FVMA 3KVLA 2NQHA 5A8GA 3OYXA 2WC7A 5BOFA 5EBUA 2Y61A 4NUWA 4Z0SA 1V3KA 1YXCA 1WBHA 3N14A 4J40A 4D6JA 3OLEA 4M6PA 4J3VA 2WCAA 1MWOA 4HD5A 5FOOA 4BHYA 2XSAA 2YL9A 3AS3A 4GO8A 1UR3M 5CAKA 1J4EA 5FEWA 3BWWA 1PX3A 1N8FA 2Z6IA 1RXOB 1HF6A 1MI3A 4QS5A 2J6XA 3CL8A 4CN1A 1PTAA 3GXDA 1UMYA 3REQA 1TPFA 1ME7A 5FKYA 6PTDA 5HR6A 1A0DA 3VK5A 1U1UA 3LSBA 1D8CA 1Z32X 3G3MA 1C3FA 4QFUA 5KFGA 4O3OA 1W1TA 3W76A 1RY0A 7REQA 1J12A 2B7OA 3WNKA 4PUDA 4K1GA 1IEVA 1SJAA 4B90A 1WYIA 3EX6A 4JD4A 2QS8A 3L7RA 4W86A 2PDLA 1BSIA 4DO7A 3VNIA 3W4RA 2OELA 1K02A 1Q5MA 5F4WA 4PUUA 4PUEA 2YFOA 3PANA 1WKFA 1SZNA 4UTWC 3IVSA 5E09A 2J7HA 4HCHA 4IMEA 3IGUA 4A21A 2CLLA 4B3KA 4GGHA 3RJYA 3ES7A 5KG5A 1LUCA 4P7QA 5D32A 3VDGA 1ESWA 1HZYA 3SUTA 1FUYA 3VFCA 4ACZA 3ORWA 3KOFA 4LVDA 5GNYA 4GLEA 2YZRA 1DHKA 3UPMA 2VD8A 4Y6GA 4Z2KA 4GCAA 3DFHA 3OIXA 2EJ1A 1EEPA 3E0FA 3B4UA 2C16A 1BKSA 4J9NA 4PTMA 2J13A 3UVAA 5KFOA 3QTPA 3R4IA 3S9IA 2RKXA 4F4XA 4QJ1A 3KEHA 4JTGA 4NRRA 4P2VA 2V5BA 1Q6RA 4ED6A 1WB0A 1HO1A 3A4AA 3ZIZA 1WPCA 1BYDA 1DP0A 5AHIA 1XRVA 3S5NA 4D6IA 4XZNX 1S2VA 1RBLA 1RCQA 2R91A 3AZTA 1FA2A 4LVFA 4E3VA 1GTEA 1SSGA 2HROA 1S5TA 1QT1A 3OSPA 2Y7FA 4NSBA 4IXHA 1REQB 2ATLA 3THAA 2BGSA 1J79A 5AVNA 3T4CA 1JCYA 1VP5A 3CZJA 2NT0A 5G2WA 1L6FA 3NIYA 4KWOA 1S5VA 4N9CA 3L4UA 2OO0A 5BU6A 3WLSA 4LY4A 5DELA 4GQBA 1P7TA 1TMLA 1GG0A 1OIFA 5G4WA 1FFRA 4OGZA 3PBUA 1R9YA 2NX1A 4YNGA 2DPJA 3QYSA 3HTWA 3W29A 3MR3A 1XSKA 2ZTKA 4LY8A 4J27A 3I7QA 3UGVA 1XBXA 2HNHA 1V3MA 3I6EA 5DN1A 3CPRA 1EQPA 3TH6A 1GJUA 3VD9A 2OWCA 1RHCA 3K30A 2TYSA 3OLGA 4RW5A 2DFAA 1HTIA 2J25A 3VE7A 5CGTA 3U4AA 1XIHA 1G4PA 1F4HA 3PPCA 1J8VA 4NXKA 4R5EA 4NILA 3APTA 2PAJA 2ASLA 1E6ZA 4JV2A 3UYCA 3S8HA 1RVGA 4Q4SA 1YEYA 4DBEA 1VPYA 4H9TA 2CETA 3VGDA 3GDTA 3NQAA 4W85A 1PCWA 3AI0A 4DLFA 4PYSA 5HMDA 4AIEA 4W7UA 1V93A 4XKMA 1XISA 1DJHA 3MC5A 3CUXA 2XGPA 5KG4A 2OX4A 3MZ2A 3GIQA 1BTMA 4H9MA 5EMMA 2ABBA 1GJWA 2JEQA 1PKLA 2X40A 3ICJA 1C8XA 3PTMA 1JPKA 5HWJA 3VUPA 5CZJA 4KCTA 4N42A 1KRMA 4IMDA 4TIMA 5FESA 1F8IA 3AUOA 1Q6EA 4Z42C 1DVJA 4JUZA 1VBHA 3HIJA 4ECYA 5F1VA 3S46A 3NQ6A 3IUIA 1GYLA 1XLDA 2UY2A 3KHDA 3CQJA 1RVKA 3PTDA 2PF0A 1XYZA 3OPSA 4N02A 5KFYA 4Y8EA 5RUBA 1W3IA 3PBMA 2GZXA 3ISIX 1LCOA 4MNMA 4NZ5A 3QMTA 3BARA 3PW4A 4Q8FA 4FP1A 1VFLA 1QOXA 4E8GA 3AICA 2NT1A 3MU7A 3RCYA 2CBUA 1ZNNA 3DIPA 4IICA 1A5AA 1YXDA 1PKMA 3BMWA 3IV8A 1ISVA 1FWGC 1KB3A 3VVGA 1J01A 1A5LC 3CWOX 3IEBA 4UXDA 3HGOA 1VFFA 5A8QA 5JBEA 2BQ3A 2CESA 3I10A 5KT5A 1JJKA 2YDAA 2BASA 2QCLA 3W24A 4GK8A 2Q8ZA 2YLAA 4O1DA 3WUBA 5FA5A 2ZBTA 5IXEA 2ASJA 4BR1A 3T0CA 2ALDA 1YNYA 4ZVJA 1XKJA 3ARYA 1NOUA 2PI6A 1B0IA 1AODA 2VKZG 3S2MA 1MW2A 5HNUA 9XIAA 3PB0A 2OEJA 1FWSA 2PRMA 5CEWA 2H6RA 4UNLA 2QPSA 5CXPA 3DGBA 3M9OB 1EGMA 5I09A 1AJZA 3SADA 1S10A 2VXNA 2OWXA 3DU0A 5EYWA 4HPNA 4ZB2A 1N56A 1QK0A 3B8SA 1BAGA 1EC7A 3JZUA 4TO8A 1UH3A 3IJ6A 7TAAA 3OBKA 1VFHA 4TX9A 1PJ9A 3MI3A 4JS3A 5E0CA 3I65A 5BNKA 4O11A 3W7IA 4DF0A 3QFEA 1GONA 3C86A 1I2OA 1SYTA 3F4NA 2QT3A 3VPLA 2RDTA 1AMKA 3PJUA 3H4XA 5C70A 1YYAA 4Q7NA 1TWZA 4ZBCA 1YPFA 3U7BA 2JE8A 3GVVA 1LYXA 1XDJA 1EA9C 3WD2A 1DWIM 3QH2A 1FHLA 3AO0A 3CM4A 1W9XA 3EWZA 4NYYA 4XO7A 3W27A 5KT2A 1E6NA 1XIBA 4WDTA 4UR7A 1G94A 5EDWA 1OFPA 1C91A 2YBVA 3LLFA 1MW3A 4BY3A 1I2PA 1OCJA 4L4LA 2H90A 4GCXA 3W7DA 2EBNA 1IR2A 4EKJA 3VGEA 1YXYA 2YXOA 1EF3A 2VC7A 1PO9A 4Y9AA 4MGGA 1W9UA 2CLHA 4JR5A 1ME8A 3POCA 2UVWA 1PWLA 2FZDA 1ZENA 1KGUA 1O7AA 1EO5A 4GOAA 3CMFA 5T14A 3E02A 4DIAA 1W1ZA 3GG8A 1GQLA 3C2YA 3O6CA 4WRHA 4HPJA 9CGTA 1SU5A 1K7FA 4XISA 2BXVA 4O1BA 2PDGA 4RK8A 5D05A 1J2WA 4PTNA 4J28A 3IIOA 2BOGX 2GJXA 4DF1A 1Y8BA 1PL9A 1QOQA 2SFPA 4MM1A 1VIZA 5A2BA 3N17A 4HNUA 1MSSA 5A6JA 3UXKA 3GNDA 4EBEA 3MDWA 3NQ8A 3RITA 2Z00A 1UR2A 4ATWA 3VTRA 3MR5A 3OIHA 3OZPA 3SDOA 3THDA 3BQ6A 2HDJA 3GS6A 4P8UA 1EA0A 4PB3A 1XLGA 1T8XA 5K3VA 3SECA 4EPKA 5CC7A 2YXXA 2W61A 1QI5A 3A12A 4E38A 3UA3A 1VENA 2REQA 1VRXA 2UVUA 1AQHA 2KZHA 1P0DA 2BSLA 1JIHA 4ZSUA 3PJTA 2NWSA 2DEPA 1W17A 3LLDA 2WSQA 4UFIA 2VEKA 3BL3A 4LV9A 1VBUA 1A0EA 4TQTA 5IBXA 4RV8A 3EPGA 3VGFA 1AK5A 5DT5A 3I7RA 4QJ4B 4UTKA 4D8AA 3N2CA 2GVLA 1DWAM 3LBCA 1LRQA 4Q33A 2R6OA 4A3YA 4C5ZA 3ZWSA 1K9TA 2G5WA 3FV9A 4UIOA 4RW3A 4KPLA 4HK6A 3U2CA 3M5XA 3LCFA 3A5VA 4FHAA 1YDNA 4Z1YA 4HPGA 3I7SA 1P48A 1RPXA 3W38A 4BI5A 4AD4A 3OOQA 2DZTA 4B3LA 2XM2A 4L1XA 4GO9A 3WYZA 4U2ZA 2OOFA 2BQRA 5F2IA 5LNWA 3WQFA 3BSGA 2ZUWA 1XLJA 3N4FA 6CGTA 4CQAA 3PHAA 1MZHA 2ZX5A 3VNKA 3UZ5A 4XUGA 4GUJA 3R8HA 2OR2A 3EWWA 4NAEA 1VF8A 5CSUA 4F4YA 4R8UB 4CNSA 3C5QA 4H7ZA 2JF7A 2PF8A 2HS8A 3SB0A 4M51A 1UP0A 2JGQA 1AFSA 4AVFA 4DZ5A 1HP4A 3CO4A 2CHNA 3KLKA 3T2OA 2G97A 3VILA 4CNPA 1E51A 2VTFA 4D72A 1LORA 5HWMA 3QOMA 4GUHA 5FEPA 4UTWA 2QKFA 3G1XA 3C0JA 5JQ9A 4PMJA 5M17A 2Z7GA 4GI8A 1VJZA 1QOPA 3PZTA 2QDHA 3R1ZA 2V3EA 3XISA 1A49A 3IGHX 4HNTA 1XBVA 3B0PA 1OCBA 4Z08A 3S1WA 4S3AA 2WHKA 3O9NA 1K1SA 3CUFA 4UQBA 3NZGA 3TR9A 2NXGA 3UR7A 1UH2A 4KWUA 4X63A 5T9BG 3RYSA 4GNJA 3OA5A 4H83A 4X0NA 3QZEA 3QM3A 1V8EA 3S3GA 3HG5A 3IIPA 1P0BA 4JQ3A 3RMEA 3WKZA 2R8WA 3C8NA 4M1RA 3B9DA 4A8LA 5C9ZA 1OK4A 4IP7A 3NSNA 1ZGDA 1QO2A 4UZUA 3O0FA 5I24A 2OEKA 1UASA 5DRIA 5L1KA 2CLOA 5KZ6A 4KESA 2FGLA 5I02A 1Q4NX 2PDIA 5I0DA 5DG9A 3H2AA 4I7UA 1K8ZA 3ONBA 1FCQA 4GH3A 2BXYA 2E5DA 1L6YA 1UR0A 3ZMRA 1LLZA 1R0MA 1PWMA 5FSEC 2E1DA 2EG7A 1QNPA 3WBXA 3GHTA 3T09A 3C0LA 4K7YA 4AFYA 2DPIA 3PY2A 3RLUA 3RUBL 2NQLA 1WV2A 2QLYA 1FWFC 3VD7A 1KKRA 1S46A 2VC6A 2PD9A 3CGTA 3DFQA 1LQ2A 3AIQA 3TJ4A 1EDGA 3IK2A 1KQZA 3TLQA 1GTHA 4X2PA 5DMMA 3WSUA 2XSBA 4GINA 4JEJA 3QV7A 1RBOB 4LCQA 2OOGA 4Y90A 2J7FA 3VKJA 1H51A 3TR2A 1ZJAA 3ARPA 3K8MA 1SW7A 2C1HA 4Q44A 3HJEA 3I3EA 1GWJA 3S5SA 3SJ3A 1OC5A 3STEA 1EXBA 3KBVA 1ZAJA 2VWSA 1J10A 3IVTA 4UOQA 4U3CA 2BWGA 3M0LA 3SJNA 4C7FA 3FJ4A 2YDSA 3PBYA 4M1BA 5E93A 2CEQA 3CIWA 3E38A 1AQ0A 2PD5A 1H60A 4FLQA 3WH7A 2DZWA 1LZOA 3PJWA 3ARTA 1TPVA 3TYZA 3UZWA 3NEHA 3YPIA 3CHVA 3E0LA 2DORA 2WB5A 2Z1KA 2NWRA 1CBGA 4PH6A 3CU2A 3ZLFA 4RUCA 4IRCA 1WDQA 4DWSC 3P0WA 4AMAA 3WN6A 3K2GA 3WQ6A 3GQYA 4ML4A 1H50A 3RM4A 4ZO9A 1YHTA 1ALDA 3WBEA 5IRPA 1W8GA 3N73A 1GOMA 3LENA 3N2OA 4WY0B 4AIUA 4XBKA 4O14A 5H8PA 4QITA 2QGHA 1FVPA 3T6CA 1HXJA 2D23A 2H9AA 1ICPA 2YCEA 1FXQA 2AKZA 4IIBA 1CXHA 3HFTA 4IMGA 4CU6A 3O2LA 4ZL1A 1A50A 1HNYA 4JDYA 1YPXA 3AYVA 4U5KA 5A3HA 3UR5A 4O12A 3WELA 4YXGA 4IGMA 1KO0A 1FFQA 3I4KA 3BG3A 3LZ5A 5G1YA 2IPWA 3NR0A 5AYBA 1J2BA 1RP8A 4AX7A 4JX6A 2FJKA 2G3MA 1K9EA 3W81A 5AYZA 4CKQA 2WSKA 2WSRA 1GZGA 1EBGA 1QNSA 4W87A 5CPNA 2PODA 3UXDA 4WR3A 5KZDA 1JCTA 2FIQA 4CD8A 3DG3A 2ZZ7A 1XDMA 2UVRA 2OZTA 1XP3A 3BLOA 3AJXA 5I3KA 3MSGA 3RB0A 4MNJA 3TQVA 4US6A 3GV7B 2R1MA 1EOKA 2W92A 2RDJA 1I75A 1HKMA 3OVPA 3W71A 4MDPA 3G22A 1IT0A 3VZZA 3BLKA 2IW0A 2DV0A 2ZXQA 2FB3A 3W1PA 1Q45A 2ZA1A 1MW0A 4E4UA 3EZ4A 3LCHA 4D8ZA 1L8NA 4QDWA 1M7JA 3ZQ9A 4NHVA 4CCCA 5DLFA 2CLKA 5TF0A 3QBUA 2GUBA 3T2QA 1VFTA 2BODX 3SI8A 4PUMA 4E8CA 3BV7A 1P4CA 2P50A 4F4WA 1IZKA 1O66A 4DXVA 3ANUA 3AIVA 4DM1A 4I90A 5KFKA 4D9PA 2ZZ2A 4R7OA 3ZVHB 3H7UA 1V02A 5G4EA 1I4NA 4QQUA 4ERGA 5CQ1A 2WNZA 4JIPA 1TVPA 4O18A 3GU9A 5T9CE 3KWXA 1TA3B 4ECLA 3N3TA 1MDRA 3ARVA 1I2RA 1R47A 4HOZA 1I8JA 1Q6OA 1NELA 3BJFA 4RL3A 2WXDM 5CC6A 4DUWA 2FLLA 1UKOA 1KV5A 5CJMA 4CD5A 4GBUA 4JDBA 4O1AA 3CYJA 1N8WA 2W9AA 3LZ3A 1MNZA 2DGAA 3PZNA 1E6SM 3S1XA 3MY9A 4AVOA 1IE7C 2PU0A 1NDYA 2P0IA 1H11A 4AF0A 3S2NA 2WNQA 4HVXA 3PG9A 2DY3A 1JDEA 1OYBA 1X6UA 5L9XA 2ZZ4A 2AGQA 8XIAA 5FACA 4IT1A 4TV5A 2DZBA 1C93A 3C3NA 1UJPA 1C7SA 4QDMA 3V1HA 3N34A 3UJ2A 3P5ZA 2ZE3A 3DX5A 4H4IA 4IG2B 4RDVA 4MWAE 4CU7A 1LF1A 4JNZA 5LHFA 4HSHA 1LBMA 3HPXA 3QHOA 5KG7A 4NT0A 2Y2WA 3KOWA 4REQA 2ISVA 2E7FA 3PBWA 3C2EA 3AHVA 3RHGA 3NURA 3TVAA 4FNRA 1Q6GA 3NL3A 1M03A 5BRPA 1JAKA 1CLXA 3I68A 4JQAA 1FRBA 1HW6A 1U22A 5HK4A 1QK2A 3CASA 1WNOA 2QF7A 2WZHA 4HA0A 3QC3A 3GGMA 3ZLGA 4JOMA 3CUZA 4R7JA 2POTA 2DSKA 4GVFA 2ZTJA 2FHBA 1VYPX 4FX6M 1TB3A 2F6KA 3KL0A 1IEQA 4IP5A 3IWPA 1BFNA 2C18A 3TYCA 2V82A 5KMYA 3B4YA 3MVTA 2XH4A 2PTYA 4NJJA 4H9YA 4GX8A 3TFXA 4DXKA 3N04A 1QASA 1OGGA 2PDJA 3L5LA 3I6TA 3QXBA 1KRBC 3NQMA 3W25A 3LTSA 4AD0A 2W66A 2NX3A 4QEHA 4V33A 2VEIA 1T0OA 3HU7A 1U1HA 5K4XA 2CWNA 4JN8A 3UT0A 5AN7A 5KT6A 1O5KA 3W7CA 4AZCB 5CAHA 4A2RA 5XINA 1VFUA 4ASTA 4TX8A 2OODA 3TTYA 5LXEA 5G4HC 4WOQA 1JFXA 3U5UA 1Q63A 7XIMA 3UYIA 2BX7A 4M24A 1PIFA 2HVMA 3EB2A 1LP6A 4Q7IA 3RBDA 1OABA 2AGPA 4ZCWA 3WLMA 4ECZA 1NFBA 1QVBA 3S1GA 3GAYA 3LGGA 5GNZA 3B0VC 4HN4A 1R6WA 4Q8OA 3E5PA 4QQ3A 2V0TA 2JIEA 1FH8A 2AU0A 4L80A 1VKFA 3ITOA 2WMHA 3NZ1A 1V0LA 3K13A 3GC2A 3KHGA 4H00A 1PDZA 4PRTA 4LAUA 3VZXA 2P8CA 3VMNA 1LUCB 1NU5A 4AB4A 3W2LA 2OEMA 5LGZA 4MUPA 4O17A 1GUVA 1W1A1 4I6KA 4CNTA 4LC8A 2FVKA 4HU0A 2PTXA 2OQHA 1FCVA 4MWAB 2RDUA 3W7MA 4EBDA 1AQFA 3IRDA 1P0EA 4POCA 3WLRA 1XKYA 5E9XA 1JULA 5D38A 4LQ1A 3WLNA 3STGA 4DUVA 3KCJA 2W9CB 1UA3A 4C60A 2ZA2A 1YMYA 2WMIA 2A5HA 4W93A 2ZX9A 3IK4A 4IGNA 4UTMA 3OHAA 4H6RA 2VRJA 5CJNA 3M41A 3C8FA 4IX0A 3ES8A 1E6RA 4CN4A 4CQDA 4R3UA 1EZ2A 1EJTC 4QDPA 3PZVA 2OZ0A 3E49A 1F07A 1H1ZA 4E0CA 5BXSA 3L2LA 5IHSA 2WNNA 2QF8A 3DZ1A 5JVLA 2WKJA 3RO8A 3LY0A 4LWWA 2O9OA 3N29A 1K8XA 4JEQA 2PWEA 1GHSA 2WZTA 5DXYA 3H21A 1MFVA 3CHEA 2Z6JA 1V3LA 3DHUA 2UZ9A 1P0NA 1PS9A 3EXTA 4NY2A 2R1LA 2X2YA 1X6LA 5CZSA 4IMCA 1Z6KA 3WIJA 5A6AA 5KFCA 1S38A 1GW9A 4ICNA 1J0YA 3A9BA 2Y8UA 2C28A 1UUMA 3BAYA 2BFGA 2VZSA 3P81A 3FJLA 3QVQA 3M0XA 1BRLA 4UOZA 4UTLA 3OODA 4DO5A 3UG3A 3G8RA 3IUDA 2UY3A 3THCA 4JX5A 4E4FA 4KRUA 4WK9A 4GUIA 3LCGA 3A22A 3FA4A 1AQMA 4CD7A 3GG7A 1UR1A 2DH2A 4RNIA 1EYEA 5A69A 3KHRA 4L9YA 5BROA 4QNWA 3RPMA 3DXIA 2YCLB 3VIMA 3N25A 2GLKA 4JPGA 4U33A 2V5KA 1K1QA 3CEUA 2Y5JA 4OV4A 4TXEA 3VMPA 3IARA 4F3HA 4DO4A 1EC9A 2F9RA 3I6RA 3W73A 1XLCA 4G7EA 3NDYA 1CLVA 4YR3A 1XUUA 5D9OA 2GL5A 3P8IA 1F05A 5H6HA 3MQTA 3DI0A 1PV8A 5LZLA 3CZLA 2XN2A 3R12A 1JEZA 3W01A 1I2NA 1VR6A 3VDCA 2ABAA 3TW9A 4PCFA 1WZAA 4X0VA 1XIJA 4EAYA 4F66A 3DI1A 2G96A 4BCEA 5KFNA 5F7UA 3ITLA 3W37A 3VNMA 2V8ZA 3UWEA 1MYRA 1FY6A 1HVQA 4PFHA 5KFAA 3KHHA 1V0NA 2AQ4A 4LVAA 5H8UA 1TIMA 1Y0EA 2Y70A 4HGXA 2J8GA 3GTIA 3LK6A 4XBJA 1HX0A 1UZ4A 3OGSA 2ZUSA 1OYCA 1QPRA 1SM9A 4RLIA 5A8PA 5JU6A 2BNJA 2V9WA 1KW1A 3HBLA 3F2DA 2W0UA 3M64A 1E1CA 1Q8AA 4G9PA 3CQ0A 3URQA 4QE1A 4PRWA 3PZUA 3O7UA 3ZYZA 5B7YA 3VOCA 4L65A 4WVXA 1W1IE 1QAPA 2HE8A 3TFCA 4BQ2A 2FJUB 4HYRA 1GYMA 4K38A 4PULA 5U7SA 3GH4A 5AC8A 5KFIA 4J9OA 3DFYA 5T8GA 2V3GA 4K39A 4YS1A 3RCNA 3GXMA 3ABSA 4C1NB 4F79A 3F03K 3ITGA 3GFYA 3A3XA 1ZBVA 1VEMA 2E77A 3NPUA 5AY7A 1R8LA 5MKGB 3EA2A 1UG6A 1JI1A 3PZIA 1VLWA 3AS0A 1ELSA 2BVYA 4HOXA 3GV8B 4RZBA 1F76A 5HNNA 3BGGA 4IFKB 4V15A 3PSWA 2OCZA 5HANA 3MSYA 1TWIA 3H54A 3A6OA 3UQNA 1PCKA 2VDHA 4L1GA 4MF4A 1SFSA 4EK7A 4XD5A 4I7WA 5HPCA 1KM3A 4GYKA 1W8SA 4HMDA 5C9XA 1PAMA 2HRWA 2P3EA 3BZGA 4RZ4A 1Q6FA 5JIWA 4I6VA 4QR6A 2C6QA 2V5JA 4DWSB 1FWCC 2ISDA 2J7CA 5GJPA 4JKLA 4B5UA 2C13A 5D2WA 3Q58A 3QLDA 4OU1A 4KEVA 4PMQA 4TTUA 2NVCA 1ITUA 3PAOA 1E6XM 4GGBA 3T5JA 3H4WA 1I45A 3TOPA 3PP7A 4QG9A 1MW1A 4EXBA 3IJLA 4HTYA 2GJNA 4GMEA 1K7XA 2R1NA 1CWYA 4KIRA 4ROPA 5E9AA 3IAQA 1MEIA 3TQKA 1XLEA 1H0GA 1P6BA 2XYLA 3TTEA 4F50A 3JW7A 2OTDA 2XVPA 1DWJM 4LUTB 3CAVA 4DHGA 2DSWA 2FLNA 2YCJA 2EPNA 2AAMA 2O4MA 2IBKA 1GORA 3O3RA 1EPVA 3G8EA 1D3CA 2HPIA 1ONWA 2FZMA 4D1JA 1E5JA 1JCLA 3QGKC 3LCIA 2J6TA 4EXAA 3MUXA 4F40A 2W3ZA 3R7MA 1W2VA 2Y8VA 2I14A 1E15A 4IHCA 3WDQA 1J93A 3AS1A 1R7OA 1H7RA 2VO5A 2OVLA 3BAKA 3KUMA 3TCSA 1R3RA 3W75A 5HQEA 3S2CA 2QMJA 4DX3A 4HA1A 4EF9A 5A1AA 3S6TA 3RLGA 3ID7A 2Z28A 1QNRA 4A8IA 4QLKA 3LX9A 1UIPA 3T0AA 2XIJA 3SR7A 2DPEA 4DL2A 5EWEA 5CC3A 3MBDA 3RB4A 1UD4A 3IS4A 3ZR6A 2QAPA 3D6NA 3BSMA 4Y9MA 1CXLA 4H6KA 5C7VA 4PUJA 5AC7A 1YW1A 2ZRUA 2OO6A 1CPUA 1FHVA 2HNEA 4J2PA 3TC3A 5C5YA 5F4XA 3BCDA 3TQ1A 1H1YA 3CMJA 4ZOCA 2E68A 1OFOA 3NL5A 1W31A 2PPGA 2RHGA 3G0XA 3F7JA 2G0WA 4C6EA 1KRCC 8CGTA 3FK4A 1B2YA 5DXXA 1XICA 5DRCA 2FPTA 3ZJKA 3T5HA 1XSJA 4CVUA 1NJJA 2RDXA 3ZR4A 2WC4A 4XQ6A 1R3QA 3S1VA 2C2RA 4AD3A 1IEIA 4IMAA 1T99A 4C7DA 2AKMA 3MJYA 1ICQA 2XVGA 1RR2A 3BQ2A 2IKJA 7ENLA 2XDFA 1