2GSEA

Crystal structure of human dihydropyrimidinease-like 2
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
475
structure length
475
Chain Sequence
DRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Dihydropyrimidinase-related protein 2
publication title The structure of human collapsin response mediator protein 2, a regulator of axonal growth.
pubmed doi rcsb
source organism Homo sapiens
total genus 181
structure length 475
sequence length 475
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.2: Dihydropyrimidinase.
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2gseA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2gseA02
1V7AA 3GU2A 1IE7C 2GOKA 5FSEC 4IGMA 4IF2A 2R1KA 3GIQA 3FDGA 1V77A 2R1LA 1RK5A 4QS6A 1XGEA 3S2NA 4DLFA 2VUNA 2WJFA 4LEFA 2PGRA 4B91A 1A5LC 3HPAA 3TN6A 3KM8A 4DYKA 2FTYA 1M65A 2UZ9A 2RAGA 4DLMA 2VM8A 1O5RA 4J35A 3OU8A 4G2DA 1FWDC 3MDUA 2YB1A 2D2JA 4XD6A 3IGHX 1A5NC 3OJGA 3OODA 4C6DA 4J2MA 1S3TC 4ICMA 4GC3A 3UPMA 4CQCA 1NDYA 4DZIA 2OQLA 4H01A 4B3ZA 3MKVA 1EJTC 4GX8A 3GGMA 4XAGA 3K2GA 3A4JA 1V79A 1XWYA 3PAOA 2Z2BA 4LFYA 4C6PA 4EPDC 3S2JA 3DUGA 1FWEC 1QW7A 1EZ2A 3CS2A 4LAMA 1YNYA 3GU1A 4RDYA 4L6DA 3ID7A 3R0DA 4DI8A 3D6NA 3LU2A 1YIXA 3MTWA 4WGXA 3E3HA 3LSBA 1FWJC 4V1XA 4QTGA 3B0YA 3WZ0E 2ZC1A 4IFOA 2PAJA 4C6FA 3F2DA 4G7EA 3TN4A 1YRRA 4ERIA 1KCXA 2OODA 3OOQA 3UR2A 5G4HC 2O4QA 4C6QA 4CNTA 4F0RA 3S4TA 4C6IA 3SO7A 1YBQA 4WHBA 3UF9A 3T8LA 2VR2A 1DPMA 3GUWA 2GZXA 3MVIA 4QROA 4CEXC 1GKPA 2P9BA 3GIPA 2ADAA 1A4LA 4RZBA 1NDZA 3F2BA 1K70A 2D2HA 4DIAA 1FWCC 1FWAC 3IACA 4QSFA 1XRFA 2Z25A 2Z4GA 2GWGA 2E1WA 4KIRA 1EJRC 4GK8A 3IRSA 3UR5A 2YZ5A 4BY3A 4GX9A 3GG7A 4D8LA 4IGNA 4C65A 4XD5A 3RHGA 1M68A 3PBMA 4CQDA 4GY7A 1K6WA 2Z7GA 1POKA 1A5OC 3E38A 3SFWA 2AMXA 2QT3A 2FFIA 3B40A 4UBPC 3K5XA 3QY8A 1EJWC 4IFKA 3MVTA 4LCQA 2PUZA 4EP8C 3ITCA 1ONXA 1E9ZB 1PB0A 1M7JA 2ANUA 4R7WA 2HBXA 4IFRA 3B0XA 4I6KA 4LALA 4IFKB 2W9MA 3JZEA 1FWGC 4GOAA 3OQEA 2OOFA 2IMRA 2G3FA 2WJDA 4EPKA 4GZ7A 1K1DA 4HK7A 4QS5A 4TQTA 2WJEA 4UB9A 4KESA 3DCPA 4GBDA 1V51A 4H9ZA 1BF6A 4CQBA 1WXYA 4NP7A 2GWNA 2Y1HA 4B92A 1J5SA 4C5ZA 3E0LA 3EWCA 3T81A 3URQA 3LGDA 3K4WA 5HMFA 4C60A 1EJXC 1UBPC 4AC7C 1UIPA 1PO9A 4HA0A 4ZSTA 4C6OA 3URNA 4LCRA 2AQVA 4M51A 5LXXA 4XAFA 2HQAA 4GYFA 2Z24A 5CH9A 2EG6A 2R1NA 2Z27A 4R88A 5HMEA 1RK6A 1GKQA 1V4YA 2VHLA 4AQLA 4EPEC 3O7UA 5HMDA 4H9MA 3A3XA 4NI8A 4C6LA 3N2CA 1EYWA 4KF1A 1FWFC 1FWHC 4H9UA 4H9YA 4NG3A 5AKQA 3RCMA 4LCSA 4C6MA 2D2GA 3PNUA 4LAOA 1P6BA 4LANA 4KERA 1RAKA 5A6TC 4IH3A 3G77A 2OB3A 4L9XA 4PCNA 2EG8A 2Z2AA 3URBA 2P50A 4EPBC 3NEHA 3GTIA 3DC8A 1FKWA 3S2LA 2XIOA 4B90A 4H9TA 4RDZA 4C6BA 4PBEA 1PTAA 2OGJA 3LSCA 1HZYA 3FEQA 3WMLA 1KRBC 1POJA 4PE8A 5E5CA 2EG7A 4HK5A 1KRMA 2DVXA 3OVGA 2O4MA 3HM7A 1EJUC 3E0FA 3F4DA 2Z28A 3LY0A 1R9ZA 4H00A 4H9VA 2P53A 1PSCA 4IG2B 1VFLA 4LH8A 4CNSA 4ZSUA 3RN6A 1RA0A 4OFCA 2F6KA 2PGFA 1J79A 4BJHA 4QRNA 5FSDC 3LS9A 2HPIA 4ERGA 2YXOA 1A4MA 3QY6A 4H9XA 1J6PA 3IARA 2CZVA 1YMYA 4RDWA 2BB0A 1ONWA 3C86A 1ADDA 1UIOA 2BGNE 1QXLA 2YB4A 3URAA 2VC7A 1WXZA 2R1MA 3MJMA 3MSRA 4GY1A 3LGGA 4XAYA 1XRTA 4HJWA 4DO7A 3F4CA 2DVUA 1ITUA 3BE7A 3UBPC 1RJRA 3AU6A 4DNMA 3A3WA 3LNPA 3MPGA 3RYSA 4C6NA 3CJPA 2Z26A 3V7PA 3GTFA 3E74A 4V1YA 3NURA 3ORWA 4F0SA 1R9XA 3IJ6A 4Z42C 1EJSC 1FKXA 4KEZA 3GTHA 3S2MA 1A5MC 3LA4A 2WM1A 2HBVA 4KEUA 3CAKA 4WVXA 3GTXA 3WYZA 4R85A 4PCPA 1EF2A 3PNZA 1EJVC 4MUPA 1RA5A 2QS8A 1I0DA 3GRIA 2UBPC 4C6KA 1O12A 4YIWA 3T1GA 2ICSA 4P5UA 2QPXA 2DVTA 4F0LA 3TN5A 4CNUA 1I0BA 2FVMA 4C6JA 4IQJA 4KETA 1FWIC 1FWBC 2AQOA 1KRCC 2GSEA 4INFA 3QY7A 4E3TA 3NQBA 2Z00A 3PANA 1W1IE 3TN3A 3QGKC 4LAKA 1P6CA 4XD4A 4C6CA 4JOMA 2A3LA 1NDVA 1UMLA 2VC5A 2Z29A 3ICJA 4I6VA 4CEUC 3AUOA 1ITQA 3EWDA 3GU9A 1A5KC 4IG2A 3HTWA 1RJQA 4RE0A 2R1PA 3ISIX 4G7EB 3E2VA 4GY0A 2PLMA 3EGJA 1GKRA 4HK6A 1JGMA 2KAUC 1P1MA 4C6EA 4GXWA 3O0FA 2FVKA 2I9UA 4PBFA 4KEVA 4ERAA 1J6OA 2Q01A 1RJPA 1YBQB 4RDVA 4XAZA 3MDWA 1E9YB 3AU2A 3F2CA 1NDWA 3IV8A 4DZHA 4J5NA 3TNBA 2QVNA 1NFGA 3QGAC 1ZZMA 3IPWA 3FDKA 4XD3A 1R9YA 4DI9A 4KQNA 2Q09A 2FTWA 2E25A 1KRAC 4BKNA 2HNHA 2HPMA 2I5GA 4C5YA
chains in the Genus database with same CATH superfamily
3LCGA 5E9AA 4ZCWA 2QNEA 3GIQA 1TQJA 5J8LA 2AAAA 4WXYA 2X16A 3BXWA 3LPFA 1ZCCA 1BVNP 3KM8A 4F79A 4A8RA 4FXSA 1P48A 2A7RA 4RNOA 2D2JA 1LORA 3W26A 3HMJG 3LV6A 3SI8A 4CVUA 1UWRA 1GOMA 3JW7A 2ZXAA 1H49A 4GC3A 4X0VA 4NJIA 3GW0A 2PGWA 1HVQA 3PAOA 1XWYA 2AGPA 3VAVA 1PPIA 2GVYA 5GJPA 3B06A 1HXJA 2GJLA 4YYCA 1YNYA 4DF2A 1WE5A 2XG9A 3WJZA 4GYPA 1RALA 1VF8A 1BVZA 3W2MA 4G1NA 4V1XA 3TQKA 2REQA 2FLIA 1EB3A 4D6DA 1PTGA 3VMPA 3P82A 3UR2A 1FCUA 2I1OA 4AF0A 4F0RA 3QKEA 3B04A 2UVRA 6XIAA 4DM1A 1CPUA 2DP3A 2OZ8A 4REQA 2GZXA 1E1CB 5A8GA 4GUIA 5B7YA 3E2QA 6ENLA 2F38A 5FF3A 1S0NA 3F2BA 4JTUA 4HHLA 4XO7A 3UWZA 4MYAA 2KZHA 4EOUA 3UW6A 4Q4SA 2FVLA 4QEEA 1QJWA 1EO5A 1F4AA 2WMGA 2HCVA 1VKFA 3WMBA 3N6QA 3GR4A 2VENA 4JAWA 3NL3A 2C28A 4NI3A 1FP9A 4LB4A 2O7QA 2ZXDA 5MHBA 3VINA 5DT7A 3UYCA 4AY1A 2EPOA 4PB5A 1XHGA 2BVYA 3CUIA 1D3GA 2ESCA 3KOWA 5ABEA 3TU9A 1N56A 5IHSA 4GISA 3RK8A 4KGJA 1KGWA 4ORMA 1V51A 3AZRA 3BSGA 3ENLA 1NOFA 5LA0A 1V02A 4UQBA 3QHNA 3DESA 3UWUA 4MAZA 5D38A 1R86A 4Q3MA 4E3VA 1JI1A 1XCXA 1B3OA 2Y2WA 2PLCA 4KCWA 3C0JA 4EWJA 3INPA 1U33A 4JYDA 4JHOA 3OYXA 4JXCA 2FYMA 3MY9A 2DEPA 3DZ1A 1JDCA 3TSMA 4TO8A 4I3GA 2E6DA 1JPKA 3OIHA 2WC4A 3GNDA 4YMZA 1S2WA 3S1GA 2OTDA 4AYSA 2GVEA 5BU9A 3N14A 1Q7ZA 2EKCA 2VZOA 1B3WA 2ZX9A 3WK3A 1JRBA 4ATWA 3H26A 3RJXA 1PDYA 3KCOA 2VT0A 4UTJA 4NZCA 1VQTA 1UJQA 3QC0A 4O1FA 1XLAA 3EOEA 3I10A 5KT5A 3WD0A 1ISXA 4EXAA 4BCEA 1UH2A 3PUOA 5FJRA 3F5LA 5D2VA 4XZMX 3WDPP 5EY5A 3PFRA 3RGTA 4JY9A 3TDFA 4FR1A 1KRBC 1SZRA 3T7VA 3USBA 2GVJA 5HWMA 3NQ8A 2DVXA 5REQB 1QVBA 4WR3A 2HVOA 5E70A 3TLQA 1CIUA 3U2CA 2NZLA 3LTYA 4O52A 4O17A 1TTQA 3EOUA 5DX7A 2Q3RA 3PZIA 4AZ7A 2CESA 4LUTB 1KR0A 2ONEA 1OK6A 2PDXA 5A8PA 1VFHA 1XYZA 1W1ZA 1YDVA 3O9NA 4MYXA 5AC7A 4W86A 3GIMA 1WO2A 4K7YA 3PUDA 4KFOA 2CLHA 3VCRA 2YDAA 4C7FA 1TZ9A 2BFGA 3F4NA 5IDIA 4LNCA 4HJWA 4IQEA 4CU7A 3CIVA 1F6PA 2YL6A 2LLEA 3A3WA 3LUTA 4ZMGA 2EXOA 3QTPA 4F9DA 5K9XA 1UBSA 4S3KA 2QJIA 1JCJA 4FX6M 4O4VA 3VFLA 2XN2A 5DCEA 3G6VA 1HGYA 5DCBA 1WZKA 4PSPA 2BVTA 1HJUA 3K1GA 3A3HA 4F8XA 3TTQA 3CAQA 3BZJA 5TF0A 4J9MA 1LL7A 4QR6A 4CD8A 1TPC1 3AIEA 4J9RA 2C71A 4LVBA 3KE0A 4W85A 4PTNA 1BXBA 1UR1A 5FIPA 4HB7A 3KTXA 3OB8A 2A3LA 5JBDA 5H1WA 4DWSA 1VBRA 4IRCA 1QPOA 4AX7A 1UWTA 1TTPA 3OZYA 1AMYA 5DFAA 2J7HA 4GFIA 4A21A 3R94A 5KFIA 2R94A 3SY1A 4XISA 3RRXA 4PL1A 2VP8A 1MSSA 1NEYA 4NZFA 1XLBA 3VNDA 2FZ8A 2Y89A 3N9RA 4OIFA 1S3HA 4KWSA 3QOKA 4PGLA 3VABA 3DG7A 3OSNA 4B5WA 2TMDA 1E3ZA 3SDOA 3WFZA 1E6PA 2UWFA 5CKSA 3F2CA 2ZE0A 1E73M 1DWIM 3DGRA 3N19B 5G1TA 1JF5A 5IBXA 1W2VA 2WVSA 4X3ZA 3UGVA 1R2TA 5AOUA 4MG4A 2D24A 4TV6A 3W4RA 4EKJA 4ACZB 3MT1A 3KLKA 1V6TA 5I0DA 1PHWA 1G4EA 1CGXA 3OIXA 4FLRA 3Q45A 1ZBCA 4MLRA 1KXHA 3ALGA 1MO0A 3APTA 3TK7A 3G5EA 1RQBA 4OVXA 1LRQA 1PEZA 7REQB 3EB2A 3PW0A 2PZNA 2F7FA 1XBXA 2QJGA 3BQ6A 1TRIA 1LLOA 4FXRA 2RDTA 1RSCA 3LHVA 1Q6DA 2JEFA 1XD1A 3WLPA 4CQCA 1EGMA 2AGQA 4DM2A 5KFMA 1FCQA 1DYSA 3V6JA 2H6RA 1E15A 1GOIA 5XIMA 2QMJA 2NWSA 2ZTJA 1JCMP 1M7XA 3B03A 3MUY1 5FI8A 3ZYZA 4EE9A 1L8NA 4K2SA 3ARQA 4EEYA 1QNQA 4JEQA 4WGXA 4MUZA 4QDMA 1FWJC 4FNPA 3ITXA 2PS2A 3ZT5A 1EBHA 4IMDA 1C3FA 2WVVB 1KM6A 5G4HC 3GXTA 4O0ZA 3S4TA 1OG6A 2QAFA 2EPLX 3ELFA 3A9BA 2CWNA 4DAFA 3T8LA 4J3WA 3L2MA 1OFDA 3UZZA 4N9CA 4MOZA 3A4AA 3WLJA 4GE8A 2WAGA 3GVRA 1NDZA 2D2HA 3VMOA 2OEMA 3TYDA 3WNMA 2GGJA 8RUCA 1FWAC 3GKAA 1FOBA 3IACA 3RRAA 3DFHA 4DWSD 1E0TA 4GK8A 2Y7FA 3VX0A 4REQB 4AWTA 3PJUA 4HOZA 4GRSA 1CYGA 3ZLFA 5GNXA 5DGAA 4W88A 3T4WA 4AD1A 2G37A 1Q6RA 3MMTA 3ANUA 3PJXA 3RO8A 5DQGA 1LQ2A 2PDJA 3NQMA 3CHVA 1SO5A 5EMKA 1DXIA 4HCDA 3Q8SB 1MUCA 4WJXA 2HBXA 3WQEA 1SQ7A 3VNMA 4AAJA 1CCWB 2V38A 4HOWA 4DJDA 4DXXA 1SJAA 2IKJA 1CECA 1W9BM 3PUEA 5FEPA 3A47A 1F76A 4ZOAA 2DT0A 1RUSA 3M5XA 4I90A 4NZJA 1UR0A 3BW3A 2G3NA 1X8FA 3MO4A 4TVDA 3TXZA 4DZAA 1OC5A 2ABBA 2GDUA 1UBPC 5BRQA 4AWSA 1HFBA 2NUXA 3CH0A 4JIIX 2G41A 5DRCA 3ZR6A 2BNJA 3EB4A 3KRUA 3T5HA 4R88A 3GH5A 1RK6A 4L64A 2OX4A 1S9FA 3NA8A 1OFPA 3SY5A 1V4YA 5DMMA 5M3WA 1R7OA 4WCJA 2YOCA 3EBVA 4YTQA 1FCVA 3QJAA 5KFUA 1NAL1 2DIKA 4NZ3A 4Y9MA 1N8IA 1EYWA 3T78A 1K1QA 3V0TA 1XV8A 1GVFA 1ZNNA 3C0QA 3UETA 3UY7A 4FOUA 3RCMA 4O3OA 3M46A 2OSXA 4WRHA 3CHCA 3PNUA 3QQ0A 5C9UA 3KDNA 4TTGA 1A50A 2HDJA 3LTSA 1YYAA 3GFZA 3WK2A 2ZZ2A 4JICA 3VKJA 2XFWA 4Q8OA 1GVIA 5A3HA 1OGGA 1GORA 1F4HA 1DIKA 1Q6QA 1TUXA 4E0CA 1WDWA 1E0XA 3G0UA 4MPKA 1Q13A 4WDUA 4XZ9A 2IPJA 1L2UA 4X0NA 3L0GA 4S3AA 1MUWA 1Y5VA 3TLLA 3MBFA 1OBAA 4IGHA 2GOUA 1KRMA 3PPGA 1E3XA 3GNXA 2DDXA 1Q3NA 3AS3A 1TVLA 1T0OA 3TONA 1JULA 3P61A 1Q6EA 5XINA 4GVHA 4AXKA 4IG2B 1NELA 4M56A 3TR9A 3W7CA 1H3GA 4ZSUA 4F48A 1GZJA 3IIVA 2WKJA 3O8AA 2PBGA 4RJEA 1PX3A 4ERGA 1XP3A 4G6CA 4X2RA 1UYQA 1QTWA 1QXLA 2YB4A 1EKOA 4DJDD 1OT1A 4Z08A 4GY1A 3KHDA 4O19A 1TR1A 3LBMA 4RNIA 2VQTA 4M1BA 1AQHA 3L68A 4EVZA 4UTWC 4DL2A 2VFDA 4DBEA 3WNNA 3DEQA 3LG3A 5CAHA 1YEYA 5DQHA 5AYXA 3LYEA 3LM7A 2VL4A 1KFWA 5HBFA 4KRUA 5KITA 3CL6A 1P0EA 2FDSA 1AW1A 3OBAA 2NQHA 3WYZA 3H23A 3PNZA 3UJRA 5LKYA 3LERA 2Y61A 4PRWA 4LYPA 1CWYA 3MANA 4LU0A 1UWAA 4P5UA 4CCEA 3CL8A 1DWFM 3EKLA 4LY8A 3TN5A 4CNUA 4FS2A 5IRPA 5KZDA 2ABAA 4IQJA 2ZKMX 2QCDA 4KETA 5DLGA 3Q37A 4I7UA 4C1KA 1KNWA 4LAKA 2D20A 1MYRA 2DH2A 2CITA 3C4UA 2I56A 3RB3A 3B8VA 4C1LA 4JOMA 5CSUA 1DHPA 4GQBA 1L6GA 3TZFA 2BMBA 2Z29A 3ICJA 3KFTA 4MMWA 4JUZA 2VCBA 4TV5A 4GYKA 5KFEA 1R3VA 2F61A 3G2GA 1IHIA 1MI3A 4O10A 4WDTA 2D1ZA 4NNBA 1TVNA 3TV8A 1P1MA 2JQXA 2DH3A 4NZ4A 3V16A 2FVKA 2W27A 3S1WA 1PZ3A 4Z0SA 2VUYA 2X1UA 2OVLA 3SUVA 1RQHA 1K4GA 2YA2A 3FVMA 1O7AA 3WMCA 2WPBA 3DOPA 5G5IA 4AD5A 3WQ4A 1UB3A 5B7ZA 3RF9A 4WOZA 3K1DA 3NCOA 1U1UA 3DHUA 5U7SA 4GG9A 4DI9A 2X7VA 1J8VA 4BKNA 2QW5A 3CZEA 2ZZ6A 1XCFA 5CC7A 3M64A 1J0KA 3GV5B 4IGMA 3GKFA 4RZRA 4ED6A 5KT7A 3GQYA 1CGTA 2WCSA 1W5QA 2C3ZA 4N4PA 2R1LA 4QIUA 1AH0A 4RNNA 4XUGA 1GJUA 4LEFA 4HPJA 3TSDA 5JU6A 5HMSA 3G6LA 3EOOA 1GQLA 4Q4QA 3BJYA 4YNGA 4DUWA 3SW6A 4FNRA 4BF7A 2VEPA 2VEFA 2OYMA 4Y9AA 3HA1A 3CHDA 1EJTC 3ZR5A 4RNHA 4DJED 1MEHA 1SW7A 2ALZA 4MWAB 3BAWA 1TA3B 1CB7B 1GW1A 4ECTA 4LGXA 1UD5A 3UR7A 3IS4A 5FL1A 1DWHM 1JR1A 4IHCA 2V5CA 4G7EA 5A8OA 1M3UA 3M0JA 3OOQA 2J74A 5H8PA 4LJ3A 1JD7A 4NUWA 4U28A 3SRFA 4ZODA 4WHBA 1JDAA 2XSXA 1GHRA 1EFZA 1TMHA 1JIHA 3GUWA 3HGOA 2FH8A 4M7SA 2YJQA 2F2HA 1XKJA 4Q8FA 3CHEA 3DHPA 2P88A 4CD7A 4GFSA 3VNZA 3WFAA 4L9YA 3G6XA 4AHOA 2ZX7A 4Z1CA 1FWCC 3WEMA 3GUGA 3MZNA 2QYGA 4ES4A 2C2DA 3R8HA 4ED7A 4BEQA 4JTJA 1R30A 1JNDA 1TYGA 1K8YA 1UUOA 3GILA 1FWSA 4C65A 2ZE3A 2WNQA 2CU0A 2OWWA 4HA3A 3NPWA 1OGBA 1SU5A 2VNCA 4IFKA 4JTHA 1E6QM 1TFVA 3CZLA 1VFOA 4LCQA 3ITCA 3W74A 1ZAJA 4KRTA 5FD0A 3QGVA 3PJWA 4L5ZA 3B0XA 4ROQA 5KFVA 2VRJA 4K37A 1W9PA 1TTJA 4UQAA 1QPQA 3TFXA 1OF6A 3FKKA 1OQFA 2ZUWA 2WJDA 4AVFA 2Y4SA 1DTUA 4R9XA 1I2NA 4YL2A 2BQ3A 3NTYA 4NZ1A 5KG4A 5IHRA 4MDOA 1R5YA 5KG6A 4RZ4A 1FXQA 3HU7A 3VU2A 2CZFA 1TELA 4ZSTA 2ZOXA 3DBPA 1HP5A 2AQVA 1C8VA 2JKAA 3EKGA 5D03A 5JH2A 1WZAA 1PX4A 4M3PA 2WZEA 1Q5MA 1CDGA 3LV5A 3QPYA 3QR0A 2QIWA 3T5JA 4AQLA 2W6RA 4O0KA 4JTRA 1X97A 3JRKA 1VHNA 2BXVA 1MXGA 3AXIA 2ATLA 4FHAA 1XIEA 3JS3A 4IUOA 1H60A 3N04A 3PPFA 4ML4A 3AYRA 1VRXA 4HPGA 2HVMA 8A3HA 4ECXA 1JXLA 4H9YA 4U10A 2W7OA 1P4CA 3UCDA 5AKQA 5EFDA 4D6GA 2XIJA 1XI3A 4PODA 1M53A 3MUZ1 4QXIA 4JX5A 4O3NA 4MB3A 3KL0A 1GNXA 3HPZA 2QLYA 1ZL1A 4TR9A 1TV4A 4M8UA 2FIQA 2G95A 4ZQCA 4Y7EA 4D6HA 3BGJA 2PTDA 3C5QA 5HJLA 3BMWA 3FGCA 1V6XA 1VBGA 1K4HA 2GK1B 2NVCA 2WHKA 4WSHA 3HM7A 1XLEA 3G3MA 1KV5A 7PTDA 3I6EA 1XH1A 4Q44A 1H51A 3OZOA 2WMIA 1C9WA 4I5RA 1XIIA 5HNRA 3QW3A 3PG8A 3EWXA 1OCJA 2FPTA 2Y0FA 3VIKA 4O54A 3QMSA 7XIMA 1U22A 5KFCA 4MZYA 3AOFA 2BGQA 2B7QA 2VC9A 2VWSA 2Y5EA 2EPNA 4ATLA 1OABA 3AU6A 2R8HA 1QOXA 1F3EA 4F66A 3O15A 3KTCA 1SZFA 1RPKA 1F5ZA 1GVRA 3L5LA 3WF1A 4D1JA 5T14A 1CT5A 3Q8PB 4ED2A 1JCYA 2NQZA 1R3YA 3NAVA 2WQPA 2X8RA 3DU0A 1O12A 1B31A 4F0MA 3GHTA 1MEIA 3TYAA 2DVTA 1P0NA 4C6JA 1KO0A 1KCZA 4R8UB 5C2CA 4INFA 3W6YA 4JTDA 3C0SA 1P6CA 3QV9A 4LBRA 1NWUA 3PULA 5DMLA 5CPTA 3EPOA 2PBOA 5C2XA 1JUKA 3UA3A 3KOFA 2QCDB 1PE1A 2VC5A 3NZRA 4PFHA 4ROPA 3P8IA 1TPFA 4ZB2A 5AYYA 3PBGA 1J0IA 3S42A 1ZCOA 4MGGA 3SCPA 3SRKA 4RV3A 2Q01A 3SQLA 1YBQB 1SW3A 3RLVA 4EAMA 3RXZA 2Q71A 1UKPA 1MZHA 3IV8A 3AXKA 3GIYA 4HJFA 3T9PA 4KWWA 1JZ3A 3THAA 4Q33A 3PZUA 5AZ1A 3VKKA 2J7CA 4IMEA 2PWEA 1OX5A 3KBVA 2V68A 3E6EA 3WDQA 1KRAC 1JG9A 3RIKA 4WK9A 1Y5WA 2XIIA 1DXFA 4YJ5A 5LIKX 2R1KA 3SEPA 1NH6A 4D6IA 1ISYA 4RKAA 1HTIA 1BRLA 1KM4A 3WLTA 1FH7A 3H4GA 1UR3M 3DYMA 3N9KA 3B3DA 2XM2A 3BSHA 5LIWX 5LXEA 3NQVA 3DFQA 3RX4A 1SO3A 1EC7A 2W3ZA 3CQ0A 1O5RA 1UW9A 2WC7A 3OU8A 1W9XA 3RB4A 3D0CA 4NASA 3MFIA 4ICMA 3IVUA 1X38A 5CG7A 4GXMA 1PS9A 1NOWA 2G8ZA 1ITCA 2VC6A 2A3EA 4QNEA 5FJJA 3TAOA 3TA9A 3G8EA 1P7TB 3CQKA 4I5XA 2W9BB 2BOFX 1H7XA 4L56A 4KWVA 3PVFA 4X22A 4Z1AA 1JZ7A 3L0KA 4L9ZA 4DI8A 1C93A 4A8NA 2ZX8A 3AXMA 2H3DA 4LUYA 1OWQA 1XJBA 3TR2A 3SUSA 3RLGA 5KETA 2QCLA 4NU7A 4O57A 1YTEA 3KRSA 4F2TA 1K03A 1ZJBA 2E8ZA 1V0NA 1TJ1A 2GSHA 3T08A 3BW2A 5E09A 1K77A 1CGVA 3UEQA 3GIPA 4UTUA 5I7GA 4HSOA 4S3BA 2D69A 1XRFA 5HK4A 1I60A 3ARXA 3W82A 2BXZA 4UFIA 4CNNA 3G24A 4P61A 3THQA 1DJHA 1ZQ5A 4DX3A 1PWMA 3K5XA 3T09A 4MVAA 2VD9A 3AMDA 3ITLA 1ZPTA 5BROA 1TX2A 3QSRA 3DI1A 5JUVA 3ES8A 1PB0A 3NZ1A 4R7WA 3STGA 3HOJA 5F9LA 4LWWA 1ME7A 2FTPA 1E6SM 4IFKB 1QI3A 3TVAA 2V63A 3UJEA 2J27A 1K1DA 4HNNA 4PB4A 3M5YA 3PZMA 4UTKA 1XLJA 4H6QA 1TJ2A 4UQDA 3L5AA 2ISDA 2TRSA 3TTEA 1LRTA 1GOKA 2RDXA 4AY8A 2A2IA 1V3MA 4CD6A 3LX9A 7CGTA 3T2OA 1NIUA 2XPKA 1KBIA 1TUFA 1Y5XA 1LBMA 1XLMA 5FAJA 4BHYA 2J6TA 3GXFA 4LPCA 5HR6A 4NJGA 3AS2A 1US3A 5EMJA 2ZYFA 4B5SA 4P7LA 3W7JA 1TO3A 1OFEA 3A3XA 5KFYA 4K7VA 1UKOA 1ADSA 1P0DA 1TCMA 4AEFA 1ELSA 3VKAA 2QCHA 3N2CA 3BOLA 1QMLA 3QMRA 2TPSA 1SR0A 4JX6A 3ME3A 2PD5A 4NG3A 1FFQA 3B8SA 5A6TC 2YXGA 2J79A 4QM1A 2VEKA 3GDBA 5JUMA 4IJRA 4GJJA 1A80A 2IPGA 3IJ9A 4MZ1A 3QR3A 1K1SA 2VFEA 3VNJA 2FZNA 5ABHA 3CC1A 1WKYA 3L2LA 4IIGA 3FEQA 3YPIA 2VEGA 4O53A 1KLZA 4QBXA 5C9WA 3U2ZA 4JQ4A 1EJUC 2WWDA 3OVRA 1VYPX 3FVDA 1ZAHA 3GB6A 3LY0A 1Z69A 5JIWA 4LSBA 3ZVIA 3FXYA 1CXKA 1S2AA 4DBDA 5LNWA 3NOYA 3RM4A 4IR9A 4KKXA 2XGIA 3VNLA 1LQAA 3FLUA 3CBWA 3EOLA 1J6PA 3BK0A 5J5DA 2CZVA 2BB0A 3WK1A 1ONWA 4JNYA 4DL3A 2Y63A 3RM8A 3URAA 3MJMA 1HGWA 4YXGA 4XZWA 1TJ0A 2I14A 3IGSA 3LGGA 3IGXA 4QAWA 4BF9A 5AHLA 1W1PA 1W1YA 3BE7A 3UBPC 1JDDA 4JGDA 1EHAA 4S3JA 2QEZA 4WGHA 2PP1A 1S1RA 5DLFA 3E74A 1CZ1A 4DWSC 2QUTA 1UP3A 1B3XA 3NQEA 1DOSA 3LA4A 2HBVA 3GTXA 4R85A 1EJVC 3KHJA 3ATZA 2CETA 1SSGA 2ZA3A 2XFYA 4PMUA 3UP8A 1C29A 1GZGA 2PWGA 3LDVA 5T91A 3QZEA 3VKDA 4Y2WA 1FWIC 1AH3A 5IBXC 1JYVA 1TPEA 3UXLA 5D30A 3NQBA 3ABXA 2OKOA 3LHZA 4C7DA 3MR5A 1SYTA 1B0IA 4GH3A 3ARRA 3EXTA 4Q7BA 4GO9A 1L6WA 3DG3A 3SJNA 1GK8A 1TPDA 4BA0A 1EP2A 2VGIA 2I7GA 3WH9A 3WLIA 3AUOA 2JGYA 3TYCA 1QATA 3WNKA 1QI0A 1CB2A 1OGSA 4AZBA 1P5BA 4N9EA 1BYCA 3POHA 1GKRA 3QZAA 4MHBA 3NO5A 2CZDA 3SRDA 3HO8A 3N9SA 4FK9A 3I3BA 3L2IA 4G8TA 3AIRA 1JYXA 4UOZA 4AVOA 4AIOA 1KBBA 2NQ5A 4QCEA 2NVAA 4FLOA 4O1DA 6A3HA 5EYWA 3WNLA 3C52A 4ECZA 3EPGA 4FNSA 1J18A 3ARTA 3W7KA 2BLEA 3LI0A 4BI7A 4DUXA 1I1XA 2GOKA 1EXBA 4ZE5A 2HS8A 3OTRA 3EDEA 2HSAA 4XX6A 5KFLA 1KTBA 2QAPA 3NSXA 1RK5A 4DLFA 3I6RA 4H41A 4DYKA 1M65A 2UZ9A 4IPNB 3IGHX 2AQWA 3UG5A 3N3MA 2INFA 4HGXA 4L1XA 2FDMA 4B3ZA 5KTLA 3A23A 1XW8A 3OW1A 3WH5A 5IM51 1O6IA 3BLFA 3T0DA 2F2KA 4CU8A 5AFDA 5I3DA 1XBVA 1HG3A 4M80A 4O4WA 4GZJA 4F40A 1BG9A 1FTXA 4OHQA 5EB8A 2PDYA 2CFFA 3CQHA 4TX9A 3CLMA 1KCKA 3G1VA 4KT2A 3WZ0E 3KHRA 4NT0A 2OWCA 1KCXA 1IXQA 2RJGA 5KMYA 1Z32X 1XSJA 2C16A 1OVDA 2VXNA 4E8DA 4X63A 4GVFA 4IMAA 1R3RA 3G1RA 3ABRA 5F2LA 3VE7A 4P7RA 3W1UA 4AISA 4JKLA 1BGAA 5AC4A 4DJDC 4WDWA 2ADAA 3PBUA 4EK7A 3U7VA 1E4IA 4MJZA 5F9NA 1E51A 1TWDA 1BWVA 1PVNA 2Z25A 3QV6A 3BAKA 1WOAA 3BLPX 5C6MA 2JKEA 4IGNA 5DN1A 2J8TA 3RPMA 3SECA 2IQDA 1BYBA 3VILA 2D73A 1XIDA 1B4KA 3GYCA 3QC3A 4F0KA 1EJWC 3ZVHB 1B2YA 1Z9AA 3TROA 1TRDA 2INZA 3NFUA 1S39A 4WXZA 2W8LA 3A5FA 1A3WA 4TQRA 2BQUA 4B15A 1E9ZB 3SBFA 2DIJA 3QFEA 1EC9A 2XFRA 1DQWA 5L9FA 3TJLA 5FCZA 1H2JA 1KWGA 4S2CA 3OQEA 3RLHA 1YHTA 2GGEA 3IUHA 5HULA 3GG0A 4QJ4B 1JFHA 4KIEA 3XINA 3MS8A 4KESA 4M7TA 4N9BA 1XIFA 4HHMA 1J5SA 1HN1A 3PR2A 5DLCA 4AC7C 4L61A 3VD7A 1IR2A 4FLSA 4HN8A 2QCGA 1BXNA 4PRTA 3RITA 3CLWA 1BGGA 1OFAA 2CIPA 1WPCA 5TNVA 1UZHA 3BPWA 1KTNA 3KBNA 3PK7A 1JAEA 3ARUA 3MYOA 1ISZA 4A3HA 1BEUA 2YCIX 3WJXA 2YKKA 2A6LA 4JV0A 3PZGA 3OVPA 5AYIA 3TTOA 3H2NA 2ATMA 1MRAA 1W37A 4WOQA 1PHQA 4LCSA 3W37A 2V4QA 4RW5A 4XK2A 1JYNA 1SGJA 4PCNA 2E3ZA 4A3UA 3T6CA 4ZENA 1XFCA 2NLYA 2YBVA 3TJXA 5A6LA 5L1LA 3W25A 4E8GA 2WKLA 3DC8A 3PUGA 2X0YA 1KB3A 1FWWA 3UWEA 5AHIA 4EF8A 5HJYA 2EHHA 3GW3A 1HZYA 4JFSA 1C8XA 1RD6A 3T0CA 3ZJ6A 3GIIA 2CW6A 3P0XA 3NGDA 5ECVA 4RU9A 3U2OA 3M6YA 2WHJA 1XDJA 2Z28A 1Q45A 4ADUA 2G97A 3NM1A 4DJEC 1Q66A 3B9NA 2EJ1A 4ZR8A 1HKWA 2A7PA 2CERA 3REQA 5KZ6A 4BJHA 3FAWA 3BW4A 3C2VA 1ZBKA 3LS9A 4M19A 1AG1O 3NQCA 4H9XA 3RCYA 2DZXA 8XIMA 5M5DA 3LBOA 3ZO9A 2V3GA 4WDXA 1OX4A 1REQA 2VX7A 4X2PA 4OBSA 2P8BA 3MKCA 1FA2A 2H8ZA 2VC7A 3QH2A 4XVEA 1UHVA 2FHCA 3IAQA 1XRTA 4NAEB 2DQXA 1JZ2A 2WTFA 1KBJA 1F3WA 3OHMB 4J9SA 3RMJA 2QPSA 4DZ5A 4CN1A 4PMQA 3PN8A 3ORWA 3RU8X 2V67A 2CLMA 2WNZA 2GQAA 1A5MC 3CU2A 2WM1A 1DQUA 3CAKA 4HA1A 1OFOA 3WUFA 3H4WA 3K8MA 3CV1A 3SFKA 1UP2A 1Y65A 2PDHA 3EA2A 1CNVA 2ZA2A 2ZWZA 4ZQOA 1RP9A 2ON3A 4QWAA 2W62A 5CZKA 2CBIA 1LZOA 1BYAA 3TOPA 1XSIA 5LYRA 4W89A 1F2JA 3NDYA 3P2VA 4S3FA 3MV11 1Q85A 2O9PA 3HQPA 5DQIA 4YN5A 4S3CA 3AISA 3VNIA 3O16A 4PMVA 2GFTA 3QF0A 5A94A 3S5ZA 3PZNA 3HTWA 4HK6A 5KZMA 1CLKA 1C91A 1R87A 1FY6A 1LL4A 4GXWA 2HV5A 5BXRA 1LOLA 2GUBA 4RZ6A 4H6KA 1J6OA 3GVGA 4OUIA 3IUDA 2V9DA 2XM1A 3AU2A 5KFSA 1NDWA 1WDPA 4G9PA 4W93A 3UJ2A 4E2OA 1TR9A 2YCLA 1WAUA 4O8RA 3U4FA 3ALFA 4RNMA 4NNCA 3DYOA 3CO8A 4UFHA 3VD3A 1UQYA 3MFHA 1FHDA 1TZZA 2AAMA 2C19A 3WN6A 4PRRA 2GJPA 3SN4A 3LZ3A 4FSAA 1UCWA 3HZ3A 4XB3A 4PSRA 5AC8A 3H2MA 1ONRA 1FUYA 3GR8A 3SZ8A 2VFFA 1HJWA 2VA2A 1JUEA 3MR6A 4AZCB 1IF2A 1A5LC 2P5NA 3OLDA 4S38A 5A2AA 4LF1A 1KWKA 2IPFA 3A5VA 2VM8A 4G2DA 2V3DA 5IOBA 2ACUA 3N2MA 2QVHA 4KBXA 4XD6A 2ZQ0A 5AHNA 5J04A 1O60A 1CXEA 3TUUA 1T8QA 3SCOA 1VPYA 4UMBA 3Q8RB 3MHGA 3GVVA 3QV7A 3WBXA 1IGWA 3WLNA 4ILSA 3TMQA 2AOSA 4QDPA 3GNNA 4PUJA 2BY3A 3DFSA 1RVGA 4LAMA 2D23A 4JTEA 4RDYA 3U3HA 4RV8A 3VDHA 2W92A 3R89A 3W38A 4JX4A 3OLEA 3LU2A 1TPUA 1XH0A 2ZIDA 4AWEA 5J5RA 2ZC1A 3F2DA 2WHLA 3B0PA 3R8RA 4AD2A 2OSYA 1VIWA 1LLZA 3KW3A 2C79A 4JTTA 3AZSA 3WD2A 4IPPA 1GQJA 5CPNA 3Q58A 5BNKA 3NWRA 3K13A 5LIXX 4GI6A 3MI6A 1L6FA 4CEXC 4IMCA 4HU3A 3VOFA 1AW2A 2PB1A 2FZDA 3I3EA 1VJIA 2OLSA 1B3ZA 4WUIA 4DUOA 3DFTA 3GY1A 4AEEA 5I24A 4UR8A 4S23A 2W9CB 5DG9A 1UZDA 3AYVA 4BY3A 2ZFAA 1THFD 3GG7A 2VFIA 3RLUA 2NT0A 1K6WA 4G1KA 4TX8A 2OXNA 2J8GA 1W3NA 3CUHA 4FXJA 2FFIA 2IQTA 2H9AB 2C6QA 5TQLA 3VOCA 4EP8C 1O1HA 1E6RA 1ECQA 5DXYA 3BWWA 3EDKA 2DU2A 6PTDA 4NZ5A 3R8GA 2EPMX 3CB3A 2ZX5A 1A47A 3O05A 1EP1A 1VGAA 1F61A 4I6KA 2BSLA 3EWWA 2DSWA 4LALA 2OOFA 1K8CA 3AIWA 3SN0A 1TIWA 2AL2A 1DTNA 4KCVA 3D3AA 5HINA 3GG1A 2ZZ4A 2V81A 2WJEA 2DY3A 1XPGA 1M7PA 1UPPA 3KS5A 4B92A 2XVLA 3FS2A 1F7BA 5HA7A 3WKZA 1VCFA 3LGDA 1DWJM 4XBJA 4QWDA 3GAKA 4C60A 2QMKA 7ENLA 1XLCA 1Z7AA 3AIQA 4PEKA 1S97A 1QDSA 1FP8A 2CKSA 1F3XA 4LVAA 3H70A 1VFUA 3WJWA 2Z24A 1B5TA 3WG6A 3APYA 1F9CA 1HUVA 1D8WA 1NY1A 1W1B1 1GKQA 4L4OA 2O56A 5AB3A 3W2JA 2OO6A 1YNPA 1OFBA 2A4AA 2E68A 1W1A1 2EF9A 3UPBA 1KR1A 3UA4A 4UNKA 1FWFC 2QHAA 1GWJA 4Q4MA 4Z2JA 5D8WA 3WNPA 1D7FA 2EQDA 4M5PA 1YKWA 1E56A 1M01A 4KEMA 4OOUA 5BCAA 2BOEX 3BG3A 4GWEA 4UC5A 2JBMA 1V08A 2PMQA 3TWAA 2C0HA 1VFSA 5JH1A 4JFWA 1TPWA 2XIOA 2VX6A 5TD4A 4AD3A 2B4GA 1GGOA 2E4TA 2V2DA 4U6PA 1ICPA 4PMXA 3CUJA 3LBCA 1K9FA 3UXKA 5E5CA 3CZGA 1K9EA 3OVGA 3HV9A 4ZE4A 3F4DA 4Q8VA 4H2CA 4PMJA 3E49A 3W83A 4RPPA 4R7JA 1PKLA 3GDLA 3H2AA 1PCKA 3AFBA 3EMQA 1ONEA 4WLCA 1GPFA 1QI2A 2J25A 3QLDA 4K1GA 2A6NA 4F2UA 3F7JA 3RR1A 2CZEA 2FGLA 3VXGA 3HG2A 5G2IA 2BY0A 2E67A 2P0IA 5I6SA 4ICNA 1KM1A 1UD8A 5C9XA 4ALDA 2DPJA 1ZP4A 2BASA 5BMWA 3N2OA 2AKMA 2ZRWA 4K1WA 4DO7A 3SRHA 2C18A 1UMYA 1TPB1 2PCQA 5D04C 4OQVA 3BMXA 2JEJA 4DL7A 4HNTA 2X0SA 1S46A 5EGRA 1BXCA 4ICCX 5EDWA 4PMYA 3WH8A 5I3JA 1NU5A 1I9CB 3QYQA 4MSSA 1QO5A 3TTYA 1A3HA 1IEVA 4BQ5A 4IUGA 1G7VA 1W9DM 4N6FA 1HIZA 1VH7A 2R14A 4X60A 3BL3A 3RCNA 1X39A 2FVMA 4UNIA 3S6OA 3NPUA 4MB5A 5C2GA 2QGHA 3SN1A 3W53A 3VM5A 4NJHA 4RXGA 3WLHA 4XD4A 4ZOBA 3FA4A 3OG3A 3P81A 2EKGA 4BFAA 4D6EA 1ZJIA 3KEHA 3TQ1A 5CLWA 2HRWA 4XTDA 3LXBA 1XYFA 5DCDA 1DJNA 3TNOA 2Z1VA 1MW2A 3GK0A 1H50A 1JCNA 3CTTA 2OH2A 4CQ8A 1ML1A 4D2JA 4ZEPA 4D8AA 1RCQA 3FHAA 3SQSA 2PDWA 3H4BA 1ISVA 4AHPA 5K9CA 3BCDA 3GYEA 1Q6CA 1RHCA 2QV4A 1Q6OA 5HAOA 2QKFA 1H11A 2BVWA 5KT4A 3CMJA 3IJIA 1VEOA 4PTDA 2WVUA 3SCQA 1TWSA 1NFBA 4XVDA 3U6WA 2YCLB 3W85A 1EBGA 3FY1A 3FSTA 1FWRA 2WBGA 1E70M 3IANA 4OTKA 4L4PA 3OYZA 3T07A 4JYFA 3FA3A 1HO4A 3VIJA 1V3JA 1QNOA 1T8XA 4EACA 1MDLA 1MXDA 5CJNA 3WBWA 4I8DA 3HV8A 3GWQA 4I8YA 3NQ7A 4C6DA 3QKZA 3W28A 2W4XA 3A4JA 1XDLA 3C2RA 1LWHA 3W73A 2IXVA 2Y85A 3VDAA 4W5UA 1FWEC 4W84A 3UWVA 2YIHA 2Y5JA 3WY1A 2BVDA 4N42A 3MTWA 3MZ2A 3HJZA 4GUGA 3U8GA 1EOMA 2VURA 3ZIZA 4QTGA 2HTMA 1GJWA 4LNYA 5GPRA 2OODA 2ASHA 1QFEA 4QDWA 3W7LA 3M0MA 3GZAA 1M1BA 5L1JA 1FQ0A 4DEZA 2NX9A 2UVVA 2Q02A 5KFTA 3V5FA 3M9NB 2ASLA 5I3GA 3UF9A 1UD4A 1EWDA 3MCMA 3MVIA 3HGJA 3WEOA 2ODOA 4CN6A 4DPPA 3WDRA 3CUFA 2P9BA 5D8ZA 1IT8A 3ABQA 4RZBA 3AC0A 2JEQA 4OE7A 4P8WA 4U2YA 3I7RA 4FPSA 4J3XA 1EP3A 2GJRA 3BLKA 3PF3A 2BXYA 1DL3A 3F1QA 3UCQA 3NDZA 4B5UA 1SVDA 3UR5A 2OO0A 3BDKA 4XD5A 5BZAA 4HZ8A 4ENLA 3K30A 1BVWA 2A1YA 4W7VA 4XKYA 2C91A 1I2QA 1W3KA 1AJZA 1QU4A 3S5NA 2JEGA 1VYRA 4O3RA 5E93A 1PDZA 1W9VA 1W5NA 1NSJA 4QQUA 4FA3A 3AS1A 2PD9A 3LLXA 5KINA 3N2XA 2EPKX 3RUBL 1GQNA 5CEWA 2HEJA 2YDRA 1W56A 5E1QA 2V6AA 1WKDA 4J9NA 3GXNA 4WD0A 1MMFA 4UB9A 4HZ7A 5A6KA 3NXFA 3VM7A 1CLVA 4GVGA 1MQPA 2Z0IA 4PZVA 2Z2UA 2Z1BA 3COTA 3K8KA 4LTSA 4ZXLA 2CBUA 3Q94A 1SMAA 3OZPA 4LRSA 3KBMA 4X9SA 4U7CA 1EX5A 2BG5A 3M44A 2QF8A 2HXUA 1X96A 1YE4A 1Z8AA 4E8CA 4J3SA 1FDJA 3FFSA 1KGXA 4OWGA 5LA2A 1LLWA 2QPUA 1KGUA 2DPIA 3W1TA 1U5JA 2W8KA 2J47A 3QM3A 4UFLA 1SZEA 1XSKA 1ODUA 4H8UA 2XIQA 1VB9A 3L4VA 1EUNA 2V2CA 4M6PA 1QHPA 1E72M 2DT3A 1FWHC 5I00A 5CGTA 1R0MA 3GXMA 3MUAA 6REQB 4J2PA 4XBKA 4LAOA 5AN7A 2B7NA 4LANA 4ZVJA 2NSXA 5PTDA 2NVDA 4EX4A 2XDFA 1I1WA 1TKKA 2PZ0A 2EEXA 3FDSA 2ACSA 4PTWA 5JBFA 4C90A 1WDRA 1QK0A 1GONA 2B7PA 2C13A 5H8UA 3M41A 4CNOA 4ECUA 5EPDA 3KRBA 1KBLA 3NPVA 4Q43A 1YDYA 3UZWA 1EH9A 4ZO6A 3EDFA 3DHDA 3RAQA 3ABSA 3NQFA 4H9VA 1SUXA 3W7RA 3BCJA 5BXPA 1OG0A 3W75A 1Z42A 3GDMA 3AZTA 3VDGA 2PGFA 4HTYA 3OQ8A 2BHUA 5DMYA 1V7YA 4QRNA 3C61A 3STPA 3VA8A 3QY6A 5MKGA 2NLIA 3QZ7A 1Q4NX 4JN6A 4YHGA 1XX1A 3UWYA 2H3BA 4ML9A 1PZ0A 3VNKA 1UOZA 1H0GA 3PP7A 3DENA 3ZM8A 1GPWA 4MF4A 2ALDA 1FRBA 1ZBVA 3OHAA 2YW3A 5C54A 4J3ZA 1WUFA 3EKZA 5SWUA 1RJRA 2PDKA 2ZX6A 4JHMA 4IWWA 3D46A 4H8HA 4J9PA 1FWTA 3THDA 2J7GA 3H2CA 1YE6A 1O94A 3S2MA 1DV7A 3U2EA 2GJXB 3KP0A 4F4WA 1MWOA 4H3DA 3WF0A 1B54A 1J96A 2Z1KA 4JQ3A 3A64A 4RUCA 3AJ7A 3C56A 2MANA 1IXNA 5G2HA 5F2GA 3R6IA 4JFUA 5I3FA 1JVNA 4ZXOA 2AGOA 4V33A 3O63A 2POTA 1UWUA 3QGKC 4QFUA 4N02A 4JCLA 2W67A 1ITXA 1LCOA 1CX9A 5I3KA 4NRRA 5FEXA 1LT8A 3FA5A 4CEUC 1O95A 3S5YA 5CZTA 3CPRA 2UV8G 4YWSA 2BV9A 3EGJA 2F6UA 3CQJA 2A3BA 2ZDSA 4XIMA 2E0PA 1R6WA 3FAXA 1RJPA 3WFLA 4RE3A 1IV8A 3ES7A 3UVAA 4RNFA 3E9AA 2ASDA 1A0EA 1R3TA 4GIYA 1OSEA 1QI5A 1EO7A 3L12A 5U4NA 3MCNA 5L1KA 3VUSA 2PDNA 4J9OA 2DQWA 4B16A 1WDSA 2DW7A 4E6MA 4RE4A 2PWDA 3A21A 3ARZA 4J4KA 3KOZA 3BJTA 3W1RA 1QW8A 2CHOA 3CZJA 4LBSA 2NT1A 1YTKA 1XYLA 4WKAA 2P76A 3EDDA 3G0XA 5IFPA 3IJLA 5CPSA 1UKTA 4CQAA 1AQFA 2R9RA 3W2NA 1D3CA 2DORA 1UR8A 3CYVA 2VEIA 4BF5A 4C1NA 3PTMA 7ODCA 1XGEA 2E6FA 3RJYA 4I9TA 4AZ5A 1WDQA 1YTDA 3U48A 3CT7A 1F05A 3WH7A 2G3MA 4I9MA 3VDCA 2Y8UA 4GYJA 5CXPA 1QHOA 1OCQA 4JYEA 4O11A 4UFKA 2PDUA 1QT1A 4UFMA 2VGGA 3VNYA 2OQLA 8CGTA 4U5IA 1TQXA 4O1BA 3W9ZA 3HGSA 3NVTA 5DQPA 3AI0A 2RDIA 5HQEA 3DUGA 2XH7A 2C14A 3E2SA 3TQPA 3BTNA 2HK1A 5KFJA 3R0DA 3BICA 1JJKA 3TW9A 2X2YA 1YIXA 3W00A 1PUDA 4EYHB 3O6YX 1ME9A 3LRKA 2BDQA 2PAJA 3SADA 4OBRA 3CT2A 1DVJA 3BOXA 3BAXA 4YWIA 4AXNA 2FGBA 4E2VA 1ZRQA 3FCPA 3NPXA 1D2KA 4O12A 3BLDA 3C2EA 3L4UA 2WM0A 3WLOA 3QFWA 1FHVA 3TW6A 1BSLA 3RR4A 5K2ZA 1OF8A 2X0HA 1CTNA 4WSJA 2GGHA 3TJIA 1O5KA 3ITVA 1C90A 4YTTA 2BX7A 2VWTA 3P5YA 3CAWA 3ARYA 3L5MA 4LBUA 1VFMA 4YQWA 4DB7A 1EDTA 3M0YA 3N2BA 1W3LA 4ZBCA 3BV7A 3KBJA 4UBPC 3KUMA 3AIUA 4GLEA 2WMFA 1XIMA 1GYLA 1MQRA 2PTZA 4TTUA 3LB0A 4FF7A 2ACQA 1HJXA 4XKYB 3CWHA 2Y6ZA 4O28A 3LCWA 1IEQA 4JV1A 3CASA 4GOAA 4CCZA 1TJRA 4BI6A 4HYKA 1LUCB 4EPKA 1TJPA 4ZFMA 1U5HA 4HCLA 5CPQA 3M0KA 4AIBA 3DCPA 1W54A 5EMLA 1VJZA 1QWGA 4FX7A 4XTIA 4R53A 3ARSA 1W1TA 4NP7A 4DYEA 1HW6A 1J4EA 2TYSA 1EA9C 1GCYA 1G4TA 3F5JA 3GLCA 2INEA 3P14A 3QPZA 2CYGA 3PSWA 2OLHA 1H09A 4FO4A 4L6OA 3FV9A 3BG5A 3PBVA 3H2OA 1CXLA 2ZA1A 3VO0A 1YPXA 2QXWA 4GUFA 1IWBA 4LOCA 4DXKA 3H2EA 2HE5A 3LCXA 4GQRA 1YXYA 3ZSSA 1SM9A 1XBZA 3VZYA 2OPJA 3KCJA 1JNEA 3T0TA 4QJ3B 3V6HA 1UKSA 1KFCA 3DKJA 2GVLA 2WQDA 3PJTA 4YTUA 4WY0A 1AL8A 1M6JA 3VFCA 1A3XA 1EHNA 4M1RA 2OZ0A 5FF0A 3ITGA 4JD4A 5KG0A 4YR3A 3UFYA 4KH2A 1OM0A 3NXLA 1WXJA 4IH3A 3G77A 1XIBA 2ZUTA 3GNRA 3THCA 1DE5A 2R8IA 1A5AA 1HNYA 1RPXA 1DIDA 1B4EA 2JEPA 2ZCGA 3GVWA 1B3YA 3WDIA 1TZ7A 2Z6JA 5C7HA 4AZIA 1WCGA 4GMEA 3WUEA 2OGJA 3PAJA 3RO6A 5ABFA 1JX4A 2J7FA 1XH2A 3W23A 4MNKA 3CPUA 4ZO9A 3R7MA 3V1HA 3E0FA 4GIAA 4KCTA 1TPH1 3NJ3A 4HNUA 4AX6A 2YLLA 3SB0A 1PZ2A 3AMGA 5KZEA 2NQ9A 1KV8A 5BWAA 1E6NA 2XIMA 3O1NA 1F3TA 2HPIA 3ANVA 4XZHA 4DO5A 2BQRA 4K68A 1BTCA 4H7VA 1ZSXA 3W7EA 5DY2A 4EF9A 4HNCA 1B90A 3BANA 4R9OA 2XUCA 4FIRA 3RU6A 1GG0A 4QE5A 1IT7A 1J5TA 3F4CA 2VO5A 4EAYA 2DVUA 3TEVA 1HKIA 2FMNA 2WMJA 4GKLA 4NAFA 3CJPA 4AB4A 1JPDX 3CB8A 1O68A 3WF2A 3OA3A 3IIPA 1R9XA 1V3HA 3MSGA 1BKHA 5HXMA 5HATA 3XISA 1V8EA 2IPWA 3PBYA 4PCPA 2ZBTA 4HPHA 2QS8A 3UNTA 3TC7A 2C1GA 4JIEA 7A3HA 2TODA 3G6MA 2VVNA 3OGRA 4Q45A 4FNTA 1EJ7L 1GG1A 3LMYA 3NO3A 4DEFA 4E2DA 2C0AA 4Q32A 2FQIA 4MIMA 1ZENA 3H24A 5EBAA 1FWBC 1EOKA 3VOGA 1VR6A 4YR0A 2CEQA 4HMDA 4Q6XA 4GJ1A 2CKRA 1Q7MA 5F7UA 4RNJA 1NDVA 4NYUA 3PZQA 3LNMA 4XIAA 4JDYA 3WK0A 2REQB 1ZHAA 3GU9A 3WQDA 3M7WA 5BRBA 3BH4A 3VGEA 3E2VA 4DN1A 4NILA 1HP4A 4OKDA 3E0IA 4AF0B 4ACYA 1BAGA 2CC0A 1GYNA 2Y7EA 4A8LA 1MXSA 4F50A 4FEZA 4MFEA 5LNRA 4B5XA 4BR1A 1VC4A 5D33A 2WXDM 4ZA0A 3CYJA 2RHGA 2G3JA 5A6BA 4YU1A 2BHYA 1RBAA 3ITTA 2WYSA 4IXXA 1UKQA 3KP1A 1C92A 2OT1A 3OHIA 5HNNA 3C2YA 2RDWA 5DGBA 3G3DA 3GU2A 4KFPA 4UQEA 2WNWA 3SR7A 2BTMA 2OMAA 2NW0A 3GE7A 4UXDA 3BARA 1CEOA 1E4LA 3EX3A 3PS7A 3S2NA 1Q7QA 2ZC8A 2WJFA 4JS3A 1XLKA 3GV8B 4XV0A 5HANA 4AFYA 4U31A 3T4CA 2DSKA 2CZ5A 2KX9A 4A3YA 1A5NC 3EYPA 3WQ5A 4ECLA 2XU2A 5HOSA 1H5YA 1S3TC 4HYRA 4QE4A 4O0QA 3KRZA 1V6WA 4H19A 4M6VA 3AYTA 4JHZA 4GPNA 1RR2A 3MKVA 3K2GA 3RDKA 3PW4A 1XD0A 4IP5A 4W7WA 1GEQA 3T2QA 3IRDA 3VZXA 3W27A 4Q4OA 4AIUA 2NUWA 5G4WA 4LQ1A 4EIVA 2V5JA 3R5EA 3I68A 4JTFA 1N8WA 1QHZA 2FZBA 1U83A 3LSBA 1P1XA 3N2TA 1QNPA 4POCA 3B0YA 1KKRA 4HIBA 4TQSA 1S38A 2X42A 2XJ7A 3ZLHA 2J9ZA 4B3KA 4IR1A 4XAPA 4ERIA 3WQ8A 4J9JA 3WQGA 2W61A 5H91A 2PTWA 4C6QA 2XFFA 2J4GA 2PDBA 3L67A 2O9TA 4CVWA 2OYKA 3IWPA 4GA8A 5D9NA 4YLWA 3KL5A 2X30A 3VIMA 3QHOA 1V0MA 4PTVA 2HZGA 4QJ1A 4KGLA 4FALA 1Q8AA 4ADTA 1JXKA 3DG6A 5FJPA 3P67A 4KIRA 4JPGA 2OWXA 1KFJA 4S3EA 3E12A 3KBSA 1P0KA 3RHGA 3UESA 5M1TA 4XSLA 3LD5A 3JZUA 2ISFA 3WENA 4DXVA 2AMGA 2G50A 2CBVA 1XM3A 5LNSA 3MP4A 1HVXA 5FESA 3BGAA 5FOOA 4O1EA 1VENA 3KHLA 3EEZA 2QJJA 5HPCA 1NP2A 1XYBA 3I7QA 4F9JA 1WKFA 1OADA 4ORIA 2XCPA 3FXGA 2IMRA 3W7IA 2WB5A 3HQ1A 4HK7A 4DVOA 5H6HA 5DEZA 3P84A 3WF3A 2XGZA 3B9OA 3FJNA 1NWTA 3U4AA 2QR6A 2FMOA 3EWCA 4GCAA 4IX2A 2X1IA 3URQA 3OLIA 3WQCA 4JQAA 1UOKA 1XINA 3LM3A 4M51A 3BQ1A 2NX1A 2WMKA 3AHVA 1AMKA 3U9IA 3UU0A 4P7OA 3UY8A 2FZMA 3E02A 3JUGA 1L0PA 3WQFA 1MDRA 5HMDA 1GZ1A 4LS0A 3R4IA 3MA8A 5EL1A 1E1CA 3OBKA 3TZNA 5I07A 1XG4A 3MR3A 5DBUA 4KF1A 4MNMA 3NL5A 3UCCA 1AQMA 5FF7A 4JIPA 3H55A 2F9RA 3CGTA 3B0UX 4HPNA 1A5SA 2PP3A 4GC4A 3LCFA 3AO0A 1PXGA 1FHLA 4KERA 1RAKA 3LQLA 2OB3A 3A22A 5CGMA 2P0OA 2Z2AA 5EWGA 4ED3A 1XICA 4WY0B 4EPBC 3E0WA 5CC3A 4ED0A 3EAUA 3GHSA 2CLKA 1KXQA 3TC6A 5JIPA 1KFBA 4FX8A 1Q65A 2J7DA 2WOQA 3MP3A 4Z1DA 4O3QA 1XS2A 4GHRA 4MJ2A 4UQ9A 1V5XA 3SCVA 4C7GA 3CUGA 4L1WA 3C2OA 3OGSA 4DWSB 3VDBA 4LUSA 3THUA 3LXCA 1VFLA 4M24A 3EX4A 3UZYA 4I9JA 2FFCA 3L23A 3W1AA 3KVKA 3FOKA 4OFCA 5CPMA 3E5BA 4IMFA 3W1XA 2V3EA 1EQCA 3W2UA 3RNDA 3E0VA 4M81A 2OELA 4ADSA 2QUMA 3S6TA 1NFPA 2CLEA 4ZQMA 4JKKA 4Z2KA 5EBUA 1P0BA 2QUUA 2G3IA 4QEHA 4J9LA 4J9QA 1GT8A 3AJXA 3WCZA 5B80A 4HZMA 4DJFA 3VD4A 1IZJA 1VZWA 2HROA 1L2QA 3MPGA 3RYSA 2GQ3A 1W8SA 2ZUMA 3AHZA 4ZQNA 4U5KA 4QQ3A 4N0RA 2RJHA 3NQDA 5A6SA 2QDGA 3W71A 4P7QA 2YBTA 4NX0A 3WF4A 3GO2A 4WVXA 4F4ZA 3VIIA 4Q8MA 1GHSA 2AKZA 1DWGM 3GRIA 1T40A 3AHYA 3D47A 2VX4A 3KDOA 1FH8A 3UNDA 2HS6A 3CWOX 1KM3A 4TIMA 3W7QA 2IKIA 2J9XA 4G3IA 3W22A 4E38A 3CV6A 5DRIA 3DERA 1KRCC 2ZRUA 3L4YA 4E3TA 3H40A 1KBKA 4GKTA 5D9OA 3T05A 3GSMA 2G4FA 4AU0A 3UVIA 1HQTA 3PFMA 1TE1A 5HUPA 3ZWTA 1PIIA 4C6CA 5CJMA 5REQA 5LHFA 1HX0A 4D1IA 1M04A 4CGTA 2ZTKA 2TSYA 1JPMA 3ZR4A 4OUEA 4I6VA 3H21A 1ITQA 4UWMA 4LT9A 2XGPA 4GZEA 5AC6A 1BF2A 3PSVA 2KAUC 3W6LA 4L4MA 3BG9A 1LG2A 2PF8A 4LUTA 4O1CA 4CCDA 1PKNA 4PBFA 4A3RA 2FH6A 4IJCA 1X98A 4RDVA 2PA6A 2QUNA 3S0CA 1A5CA 9XIAA 4PN2A 3TNBA 1XIHA 3K4DA 2JEIA 1XL9A 2DSZA 2QVNA 1D7KA 1B3VA 4HYVA 1MFVA 4ATDA 4Q6JA 1WKEA 1TREA 2HNHA 3GZ3A 1SZGA 1W9UA 6TIMA 2OKTA 1HJSA 3LPOA 1VBJA 2QDHA 5EMMA 3L9CA 3SI9A 3FDGA 4QS6A 1I4NA 3WMSA 2VUNA 1Z48A 4B91A 1G9HA 3TN6A 4A29A 3IAPA 4GUHA 4MAVA 4O16A 1WAWA 4P2VA 3W1MA 4LV9A 4IRKA 1PJ9A 1T6MA 1GOXA 2R91A 3OJGA 3WDJA 5LNUA 2J7EA 4UMAA 4E4UA 5DF0A 4F4XA 3WLMA 2E1DA 4UTHA 1F8MA 4LFYA 1J0YA 2YCKX 3M43A 1XGZA 3CV2A 2GPTA 5T9CE 5XIAA 5KEZA 1UC4A 3MB9A 5I5RA 1W91A 2XSBA 4B5NA 1G0CA 2VDIA 2ZUSA 2NX3A 5AHMA 3M0ZA 4ZFCA 4GC7A 4H7CA 2FLNA 4C6FA 3TN4A 4PCFA 2Q8XA 3UG3A 4IRDA 1R3QA 2UY3A 4R33A 3UXDA 1J10A 1IZKA 2WPGA 3G1SA 3W02A 1A49A 3IJQA 5D05A 2GDQA 2FPVA 4E4PA 2WCGA 5CBBA 1UR4A 2OFJA 4MLJA 4PR4A 3SY8A 5IXEA 3E5PA 1EX1A 1I8JA 2DUXA 4HSNA 2WSQA 1KTCA 5BOFA 3N34A 4LB3A 4ACZA 4D6JA 3W87A 1C8QA 1C9DA 3G1FA 1TTIA 4D8LA 1Q6FA 4NF7A 1QBAA 3V0SA 4DF1A 4CQDA 2Z7GA 3EWBX 3NQGA 3AS0A 4KMQA 3M47A 3GAYA 3BJSA 3D3FA 4PTXA 2E09A 1ZFJA 2PLKA 1QOQA 2DW6A 4TMBA 7REQA 1M7JA 4NX5A 1S5VA 2XGBA 1O4UA 1H4PA 2MUCA 3BLEA 2Z1XA 3FKRA 3UJFA 4GZ7A 3ZOAA 4KFNA 3HBLA 3ABZA 1P43A 4H9ZA 4CQBA 3EPIA 1V6UA 2VFHA 3ZZ1A 4UTMA 6TAAA 1UIPA 1U2YA 1Z6KA 7TAAA 1ISWA 3BLIA 2OQYA 3ZXWA 2GQ9A 4DHGA 2PWFA 3I4KA 2WVVA 3V36A 1ZY9A 4Q4KA 1HJVA 4H9MA 1QNSA 4Y9NA 4W8LA 4WF7A 1GOQA 5CZJA 1E6XM 2VI0A 1HKKA 4D6CA 3IIZA 1MNZA 1IEXA 3H4XA 1IQ8A 1M7OA 4J3VA 2C15A 2WCAA 3PPHA 1UASA 2XC9A 1DJWA 5CBJA 1YX1A 2FLPA 3NOEA 4RXFA 3SIMA 2WC3A 4KS0A 3LPPA 2FGZA 3A24A 4K6AA 1JGIA 2J13A 4MNLA 4YPJA 1HKJA 1A5BA 5DY3A 3NEHA 2Z6IA 4ZZ9A 1N48A 1QNVA 2AL1A 3LGEA 3N11A 4XZNX 3NL2A 4H9TA 4C6BA 5GQBA 4AZ6A 1K3UA 2CBJA 3LSCA 4H8NA 1WUEA 4K36A 4NYYA 2OLAA 4XBSA 4HK5A 1X6NA 2ALRA 1EZWA 1F8IA 4TVCA 1R9ZA 4Y8FA 4WIWA 1VAHA 4H00A 3IJ7A 4MJMA 2FPYA 1O5XA 4S39A 4LUJA 4ECYA 3QYSA 4IQLA 4Q7NA 2JKPA 5E0KA 1LRNA 2PI6A 2QZRA 3R1ZA 1US2A 5BRPA 5IFTA 4PTMA 3B8IA 3B0VC 1J0JA 2WHMA 2IQ0A 1AD4A 5I2UA 4LUSB 1B9BA 3S9IA 1YMYA 4RDWA 5KFKA 1ADDA 3R12A 3VD5A 3IEBA 4Z2LA 3QHMA 3BMVA 5CLTA 3ZSTA 2JIWA 5L1IA 1SJCA 4FOKA 4GYPC 3RBDA 1KCLA 3T8QA 4XAYA 3HURA 1JPIA 3Q67A 2J24A 3PB0A 4IOTA 3GH4A 3B97A 2WLYA 3H6OA 3C8FA 1J01A 2ACRA 4N2YA 3UERA 2B81A 1E4NA 2QUVA 1T7LA 4PUUA 1CLXA 2BY2A 3PW2A 1RYSA 2YW4A 2P8CA 1YLVA 3LCHA 3KOXA 2QCNA 2VMFA 2X7WA 3W0KA 3MUCA 1FFRA 4BQ3A 2QCMA 2C22A 4M0XA 4JTLA 3ZT6A 3VCNA 3DYPA 4GZIA 1U5VA 3QEZA 3DXIA 2QPXA 3LRMA 4F0LA 1X7IA 4H7ZA 2BBFA 1AZ2A 5IDZA 4RLIA 5A6AA 5M17A 1LYXA 4W8BA 2Z00A 4AG0A 3QZ8A 4FNUA 2CLOA 4D6FA 1HF6A 4Z2GA 3LEPA 5HNTA 4ZL1A 3BZGA 3KVMA 3O06A 5F4XA 1D9EA 2NQJA 1UMLA 2D0HA 2FKPA 5E0FA 2NXHA 3JVAA 1SSDA 2SFPA 1JDFA 1J11A 4IG2A 4N4QA 3DFOA 3ISIX 4G7EB 2NV2A 4IICA 3O0FA 3EWYA 1NARA 2I9UA 1NOUA 2FZ9A 4GINA 4J3UA 4XAZA 2ZVIA 4J5NA 4EANA 4JKMA 5A2BA 3VMNA 2XHYA 3QW4B 3A13A 3LN3A 2XSAA 5CG0A 5GJNA 3QGAC 2WZHA 1RY8A 1ZZMA 1JQXA 3RG6A 3GC4A 3CMFA 4W87A 4Q8NA 4RL3A 1F6YA 3LQGA 4GGHA 4K8HA 1Z44A 4QWCA 1IM4A 4FR6A 1JDEA 4G56A 4LVGA 1QNRA 4Q8PA 1E43A 2YLAA 5A8QA 4TOQA 3M7SA 4JL1A 4MY9A 4UR9A 3MR2A 5I78A 2PGRA 1EPXA 2PDQA 4ZOCA 3HPAA 5FJTA 3V75A 1W0MA 3PZ9A 4DLMA 1GQKA 1OIMA 2DZSA 4PB3A 3MWAA 1WBHA 3KWSA 4AD4A 1SZNA 1E1FA 6XIMA 2OYLA 4BQ4A 1Q4WA 1IWPA 3MI3A 4GX8A 1Z3NA 4GNVA 1S5MA 4QE1A 4GJIA 1MW0A 1EWEA 2V2HA 4A2RA 3GU1A 4DBSA 1AUSL 3RX3A 3LK6A 3PW5A 1B30A 1BHGA 2ZRXA 4LVDA 4PFMA 3UYIA 3CM4A 4HOXA 2GGIA 2A79A 4IPIA 2ZUVA 4PMZA 1AD1A 3N6HA 3T2PA 4XKMA 2O4QA 4O15A 2ZRYA 5A6MA 3TIMA 4DPQA 4C6IA 4JY8A 3N4FA 1TVPA 4MTVA 4HNOA 5FJUA 1K7EA 3W1NA 3G22A 3IVSA 5I23A 2J75A 1GKPA 3R79A 4S3GA 3GS6A 1RBOB 2J66A 3RPTA 1LBFA 1K70A 3KZPA 1DJGA 9XIMA 4L80A 1KM2A 4LC8A 5D2TA 2E1WA 2J7BA 2Z1SA 1EJRC 2JFEX 4U33A 1BWKA 3PPCA 2HMCA 5CC6A 5G1YA 3I6TA 1OEPA 4O8AA 4XWUA 4GIRA 2A5HA 1A5OC 3G0SA 2V5DA 4PUDA 4S3DA 3P0WA 4M82A 3BLLA 5KFZA 2NQLA 3M0IA 5BMXA 3FX4A 1FHUA 2PUZA 1CGWA 1K9TA 1XLDA 2VR5A 3FGCB 1GUVA 4J7RA 2ANUA 3IJ8A 3MUXA 4IFRA 2PC4A 3CZKA 2WO5A 1MNSA 3A4XA 1YQ2A 1XKYA 1LTDA 4V27A 3VOHA 1BQGA 2WLZA 3W2LA 1S10A 5C9ZA 2G3FA 1HO1A 3MKKA 2YL5A 3VTRA 2R8KA 2WMIB 1FDYA 3MW7A 3OBEA 1WXYA 4H8VA 4MWAA 5A1AA 1TA3A 3N18A 1ADOA 3FJ6A 3ATYA 5HMFA 2W0UA 3S5OA 3TA6A 4HA0A 1YNQA 2XCAA 4DWDA 4LUIA 3V6KA 6ALDA 4XAFA 1K7FA 2Y8KA 5CH9A 3TSBA 1G94A 3CPGA 1TSIA 4AYGA 1KFKA 5EMUA 1WA3A 1G6CA 4WJ8A 4LYKA 1PBGA 5KFGA 1Q6LA 4EBEA 4WX2A 4NJJA 1PL9A 4B9YA 3ZS4A 4P8UA 2DZVA 4NY2A 3AROA 2CXGA 3HIJA 4IL2A 1V03A 2DV0A 3T40A 2HE8A 3EMCA 3GX9A 1UQZA 1W5OA 2YZRA 2YSWA 4Y96A 3KL3A 5FL0A 4QLKA 4Z2IA 4YS1A 2VRQA 3DI0A 3APGA 3H8AA 2P50A 3II1A 1KW1A 2XVKA 4OV4A 1I75A 2ISWA 3S2LA 1N55A 3STEA 2YL9A 3P60A 3CL7A 4JTQA 4N6EA 4XZIA 2X1RA 3IVTA 1QO2A 5E0CA 1K02A 1UD3A 3AIVA 3RAOA 1POJA 1AJ0A 3LLFA 5KG2A 1R3WA 3TJ4A 2PCEA 4HSHA 3B8UA 3V5OA 1OZQA 4HKPA 2OZTA 3NZQA 3VE9A 4NRSA 4LW7A 2V5LA 3NO1A 2NWRA 1XLFA 6CGTA 3N1AA 4RZ5A 2UY2A 1T3NA 5EKYA 1EA0A 4H83A 3SSZA 1W3TA 3ARPA 1UUQA 1HJQA 3BAYA 3AWNA 3NNTA 3M16A 3NQ6A 4GC6A 5D2XA 1JI2A 2R1MA 3HB9A 5C0QA 3KX6A 3LENA 1K8ZA 3ZLGA 4Z17A 3EXRA 1R8LA 2WANA 1LJYA 5KG7A 5C5YA 3B05A 3KZSA 2OZ3A 4MWAD 5HWJA 5GNYA 4V1YA 3N29A 4B5TA 3SIZA 4AEOA 1FKXA 1BRLB 1YXCA 4KEZA 2HNEA 3AYSA 3KBWA 2WZTA 2WZIA 3OPSA 4MUPA 4WQ6A 1V3IA 5HR7A 4B9ZA 2ICSA 2V3FA 2YA0A 4GQGA 1OJXA 5DT5A 2A3CA 3PZTA 3AXHA 5D2WA 3SSJA 5CPLA 1H7NA 2VCCA 1K8XA 3GIKA 1UR2A 5KSWA 3E1F1 1O5QA 4JL2A 5AC5A 5AYZA 1KD0A 3LHUA 4DBUA 5KT3A 3WQPA 2GK1A 1ME8A 3AQUA 4YP3A 1GVQA 1BYDA 3MP5A 4ZQRA 1XF0A 5KFDA 3EWDA 4U2ZA 1KKOA 4YYFA 3GXIA 3TYZA 1ZJAA 4A6GA 2Z1WA 2YBUA 2VEMA 4EBCA 4PH6A 3H4DA 1AH4A 3SGZA 1PKYA 2AU0A 4JFTA 3MDWA 5E9XA 4K8GA 3PR5B 2VZTA 4JTAA 3EX1A 4YCOA 1U30A 4AD0A 1W32A 3VGHA 3N12A 2WSKA 3A12A 3AMCA 4FB7A 4HU8A 5G2WA 3CNYA 1XISA 2OU4A 2Y8VA 1ZETA 1UZ4A 5D4YA 4KQNA 3KLLA 3DECA 4QAIA 1W5PA 1V7AA 1VCGA 2WW5A 1RLCL 1JZ6A 2X1SA 2BOGX 3CIXA 1XLLA 4I7WA 4PMNA 3VIFA 1VJSA 4PCTA 2ZZ7A 2A21A 4RUAA 2PODA 3R58A 1KC7A 2FTYA 1V0KA 3CHFA 1XFBA 4B4FA 2DJLA 4J35A 3O2LA 1FWDC 4DJEA 4QSHA 3OO2A 2OCZA 3V1PA 3OODA 2QF7A 1KLYA 2E28A 3WD4A 4NL1A 4DZIA 4R8UA 4XAGA 3S1VA 1V79A 1VPQA 5F1UA 1UWIA 2GUUA 3NG3A 1I2PA 3SGGA 1QW7A 3IK2A 4DAIA 3U5YA 4ZTYA 5D9MA 1EUAA 3HG4A 1JRCA 4L1GA 3DN5A 3OHBA 1QPKA 4JEJA 1DEDA 2CLLA 5F2IA 2Y88A 1Q8JA 1KM5A 3ZJ8A 3FNDA 5M2FX 4Z2HA 3WD3A 3CIWA 3L0NA 1I2OA 3WLRA 1UA3A 2J77A 2Y5SA 3SO7A 1YBQA 2FLLA 3G1DA 1VYSX 3SM0A 1XR2A 3ZMRA 1DPMA 3WQOA 4ED1A 4GGBA 4HQVA 3KTSA 5F4SA 5I06A 1QWKA 1DJQA 2XYLA 4OGZA 5AVHA 4GCXA 3C2FA 5KFFA 1KM0A 2W91A 2V8ZA 3P80A 4BEUA 2PSNA 4JCMA 4DY1A 1OIFA 1I6NA 2I5IA 2WBKA 3LLDA 3W7NA 1TV8A 3IRSA 1DQXA 3FK4A 5A2CA 4UTLA 1NQKA 1TPVA 1UJPA 3TMLA 4JV2A 4PL2A 4MKVA 3Q4DA 1AW5A 4HD5A 3CH9A 2QDDA 3PWGA 2WJZA 2NXIA 3UXIA 4O3PA 3WLSA 1NTHA 1OT2A 2BHZA 1PCWA 2PRHA 3SCNA 3HPFA 1TWWA 1ONXA 2GDVA 1CXFA 3QQ1A 3EB3A 3PY2A 2PRMA 3ITYA 3CXOA 3TC3A 4MNJA 4IXHA 4XO6A 1TX0A 3D5HA 3RILA 1FWGC 2R24A 1XUZA 1WB0A 1J9YA 2P3EA 3TX9A 3OP2A 3VGFA 4TQTA 4GQ0A 3W01A 1F73A 1KQZA 4GBDA 3NYZA 2ZZ3A 1P7TA 5D37A 3S9ZA 3TW7A 1ICQA 2W9BA 4JIQA 5JBEA 1DIOA 2BR0A 1J93A 1VIZA 2NSOA 1R85A 3K4WA 4G7FA 3SGUA 1SO6A 3TP4A 1KQYA 4U3AA 1TV5A 2JE8A 3HGRA 4UMCA 2HQAA 4Q8UA 4GH1A 2GL5A 4GYFA 3EZ4A 2YDQA 5HMEA 1XYMA 2Q3OA 1SPQA 4GI8A 3NVDA 2CHRA 4Q8TA 4AVNA 1EF3A 3LXAA 2O9OA 4M29A 4CUCA 2PC8A 4K8EA 4EPEC 4DELA 3CK5A 4ZOEA 3O7UA 5I02A 1OFRA 3HFYA 4DF0A 2PDIA 1YW1A 3T5KA 2ZUUA 3DDMA 4LVFA 4L4LA 1T99A 2UVWA 4Z0JA 3WO8A 4HMEA 1V02E 4EXBA 4RPQA 3QQWA 4MKSA 3H12A 4EBDA 3N4AA 2HXTA 5LIYX 5E6ZA 4YTRA 1A0CA 1LWIA 5K7JA 2J9YA 5EMYA 1S5NA 1LROA 3EWZA 1F07A 2PDPA 3WJYA 1C8YA 3WDHA 1ESWA 1D8CA 4R34A 4DJFC 3H53A 4XZBA 1JZ8A 4HMCA 2O4MA 2J62A 3LCIA 4DYJA 4FP1A 1S2UA 2XVPA 3PTDA 2XVGA 1EQPA 1R2SA 1RA0A 4PBGA 3AHTA 2EGZA 3B9DA 2CCRA 1PYMA 2J6VA 4UQCA 2YXOA 3IARA 3HPXA 3N15A 2PF0A 3TYBA 1JCTA 2BGNE 3S1UA 4GXPA 5CZ0A 3MSRA 4E2BA 3CQIA 3U5UA 5HWNA 3SCUA 4ASTA 1E5JA 1BPLB 3O3RA 4KWUA 4JTSA 3LNPA 4NVTA 4C6NA 5G1MA 4PCSA 2Y70A 3NURA 1EYEA 1CBGA 2V82A 3ONCA 1E6ZA 2UY5A 3N4EA 3KVLA 2ZUNA 3WQWA 9CGTA 4I9AA 3W72A 3QVQA 2UBPC 2A3HA 5DO8A 4YIWA 3T1GA 1QAPA 3WJSA 3KHGA 3STFA 1ZU8A 1EC8A 4GD0A 2GUYA 3TYEA 4LS1A 2QULA 2Q8LA 1DJZA 1XCWA 5FACA 4ECVA 2VZSA 3DFPA 4UNLA 1HKVA 4FBTA 1W1IE 2DSUA 4IMGA 4A05A 4H1ZA 2YR1A 4AZGA 4CU6A 5LZLA 1HL9A 4GI9A 1UUMA 1OYCA 4Q8WA 1KFLA 4GNJA 1A5KC 5KFRA 3S2CA 4PEEA 3IGUA 5MF5A 4GY0A 3W1QA 1UD2A 3SCTA 3VC6A 5A8NA 1FDZA 4LXFA 3DHFA 3I4EA 3TH6A 4ERAA 5CSSA 1J0HA 3QXBA 5AHFA 3N6JA 1SFTA 1HL2A 3EX2A 3VK5A 4UR7A 1EIBA 1RP8A 2ISSA 1BD0A 4UCGA 5BXTA 1WDDA 4UFJA 3TQ0A 1T5AA 1B9ZA 1D3HA 2P1FA 3FDKA 5DG7A 2IMWP 3W3OA 5K4ZA 3M6DA 4K3ZA 3T55A 3L4TA 4CKQA 3W7PA 3VGGA 3HFTA 3PW7A 1MZRA 3AXXA 8TIMA 2WSPA 1G7UA 3QBUA 3ONBA 3CUXA 3MI2A 3R43A 5LIUX 4UTTA 4CLMA 2FJKA 2VGBA 4P7NA 3Q65A 3RM9A 1TV2A 4PUWA 1EDGA 3H7UA 4V15A 2RKXA 3PWIA 4J2MA 4PMDA 3G6YA 1E71M 1IWAA 4H01A 4TUFA 4JIHA 3NSMA 2C1HA 2QJHA 1OB0A 2Z2BA 1R3SA 1BFNA 3P93A 4MY8A 4AIEA 3U0HA 3S2JA 5TIMA 2WK2A 4L6DA 2I9EA 2QV5A 1X1OA 2PDCA 3WUGA 1A53A 1ZB5A 4JTGA 3E3HA 4J9KA 4JQ2A 3AALA 1GVYA 5RUBA 4IFOA 3N73A 3ZJKA 4FS9A 3WUBA 3W24A 4CCCA 1YRRA 4LAZA 4U3CA 4IIDA 4F4YA 2FHFA 2VX5A 2DSVA 4MWAE 4H6EA 1R47A 1W6TA 2IA6A 2VELA 4DUVA 3QTGA 4IGSA 5D09A 1TB3A 2W79A 4L65A 2XWEA 2OEKA 5AVNA 2OR2A 2DZTA 2XTKA 1UROA 1ZTVA 1DXEA 3VD9A 1S0MA 4QSFA 2GWGA 1E0WA 2ZXBA 1VRDA 1H7OA 2PTXA 1EGZA 3W76A 3G1HA 1PYFA 2NUYA 3PZOA 1QCWA 3BQ2A 3E38A 1LDCA 2ZDRA 1L6SA 3B40A 4FF5A 1TCDA 1US0A 5TAOA 1GVEA 3PHAA 1PKMA 1IT0A 3BLOA 1J12A 4ECWA 4YHEA 1ZLPA 3LCLA 3Q8QB 3TAKA 3DFNA 8XIAA 1R38A 4A4AA 4HMNA 2VOMA 2W9MA 1LG1A 1PTDA 4Q8QA 4D9PA 1BKSA 3AWOA 4QS5A 1E9IA 2ZWYA 5I77A 3O6AA 1IZCA 2VZVA 2GWNA 2Y1HA 2YGYA 4C5ZA 3E0LA 1EXPA 3REQB 3T81A 3R0UA 4LYRA 3USZA 2QCFA 2QJMA 1MW1A 2H90A 3MHUA 1H5VA 4QP0A 1OX4B 1REQB 5LGZA 2XH2A 1DHKA 1WOBA 5BW6A 4H2HA 5E6YA 1IEIA 1OYAA 4BWLA 2Y24A 5KFXA 4YTSA 2V9WA 2VHLA 4PC8A 4KRZA 3HF3A 3ZJ7A 3F4WA 4DO6A 5T26A 2GQ8A 5C70A 5BOEA 1SO4A 3S6DA 4P8XA 4JN8A 1PAMA 4ECQA 4HNLA 1AFSA 4JBRA 7TIMA 2WKGA 1JCLA 3UXAA 3UG4A 1DJXA 2OJPA 4UTFA 4L9XA 3CZ8A 3SQMA 2W9AA 3R13A 2EG8A 5I03A 5T9BG 4KW2A 3NGFA 3GNOA 2O92A 3BQ5A 3ZVHA 3UWWA 4JN7A 1NF7A 5EWFA 4PBEA 1E0UA 2HK0A 3M5ZA 3S9YA 5K3VA 5KFHA 3BAIA 3WEZA 2EG7A 1HL8A 3WIJA 3I65A 2DZWA 3GQCA 3A4WA 4ZQPA 1S2TA 2DZBA 2OG9A 3W88A 5GJMA 5EFFA 4QWBA 1GOOA 1V3LA 1O66A 5KG3A 1K9DA 3IN5A 1RYRA 1WP6A 3WNOA 4BQ2A 2XN1A 3EWUA 2F84A 2F6KA 1J79A 3TYUA 3DFYA 5HPOA 1H62A 3KCLA 5CCZA 2RGMA 2VZUA 1VFTA 2VQUA 3GBEA 3W07A 1UIOA 4O50A 1IEWA 4HCHA 4MZ8A 4LX4A 1CGYA 2G4JA 3MV01 3HQOA 4I5UA 3BV4A 3SUTA 3WLKX 3V35A 4PUEA 2F8QA 1UG6A 3O6CA 4Z1YA 4TX6A 5I3IA 2ZZ1A 2PDMA 4H4IA 2PPGA 3N13A 4EXQA 2V4RA 3AICA 5A8MA 3KAOA 4MB1A 2YXXA 4PUNA 3EOSA 4HU0A 3LZ5A 3W29A 4Z42C 1ZGDA 1WZMA 4EYIB 4KEUA 3R2GA 2A3AA 1CW2A 4L6HA 3MSYA 1CXHA 4Z1BA 4Q22A 2D2OA 4J1OA 4MB4A 4GNKB 3IIOA 4DL5A 3NEVA 4W5ZA 1PIFA 2CLPA 3WSUA 2PDLA 3F5KA 1OFQA 2PU0A 3HPSA 4O13A 1V93A 4ZTXA 1CXIA 3QN3A 3VZZA 1TG7A 2CLIA 5EA9A 2Y7DA 1P6WA 1VPXA 2H8XA 4ZB0A 1WX0A 4IP4A 4MKNA 3B4UA 1MRQA 1MFUA 1YDOA 1QUMA 2JK2A 3CEPA 1XIJA 1QPNA 3I3DA 3S3GA 1MVYA 1Y8BA 4OECA 3VIPA 2VJXA 5LNVA 4B4HA 4US5A 3VI2A 4M6UA 2JALA 2CHNA 4KEVA 2RDUA 3M4HA 3T5LA 3W1LA 1XUUA 1VFFA 3M9OB 2WVTA 1EEPA 1XG3A 4A2SA 4DZHA 1NQ6A 4NKCA 3UZ5A 4HZ6A 1L8PA 3ZWSA 5KT2A 1QRQA 1IXPA 1GYMA 4NAEA 4NLGA 1C7TA 4XD3A 1R9YA 1S2CA 2Q09A 5EWEA 2E25A 3CAVA 1W1VA 1R46A 3P3BA 4S1FA 3O6DA 1IE7C 5FSEC 3KXQA 1CI1A