1GKQA

D-hydantoinase (dihydropyrimidinase) from thermus sp. in space group p212121
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
458
structure length
457
Chain Sequence
b'PLLIKNGEIITADSRYKADIYAEGETITRIGQNLEAPPGTEVIDATGKYVFPGFIDPHVHIYLPFMATFAKDTHETGSKAALMGGTTTYIEMCCPSRNDDALEGYQLWKSKAEGNSYCDYTFHMAVSKFDEKTEGQLREIVADGISSFIFLSYKNFFGVDDGEMYQTLRLAKELGVIVTAHCENAELVGRLQQKLLSEGKTGPEWHEPSRPEAVEAEGTARFATFLETTGATGYVVHLSCKPALDAAMAAKARGVPIYIESVIPHFLLDKTYAERGGVEAMKYIMSPPLRDKRNQKVLWDALAQGFIDTVGTDHCPFDTEQKLLGKEAFTAIPNGIPAIEDRVNLLYTYGVSRGRLDIHRFVDAASTKAAKLFGLFPRKGTIAVGSDADLVVYDPQYRGTISVKTQHVNNDYNGFEGFEIDGRPSVVTVRGKVAVRDGQFVGEKGWGKLLRREPMYF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HYDANTOINASE
publication title X-Ray Structure of a Dihydropyrimidinase from Thermus Sp. At 1.3 A Resolution
pubmed doi rcsb
source organism Thermus sp.
molecule tags Hydrolase
total genus 185
structure length 457
sequence length 458
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.2: Dihydropyrimidinase.
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1gkqA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1gkqA02
3GIQA 3HM7A 3V7PA 5HMEA 4GC3A 3CAKA 4WVXA 4ICMA 1QW7A 4R88A 1NDWA 4H01A 1K70A 1PO9A 4B92A 4IFRA 4CNUA 4R85A 3RCMA 2AQOA 1NDYA 1RJQA 5FSDC 4IH3A 1PTAA 4AQLA 2PGRA 4IFOA 4EPKA 1A5OC 1EZ2A 3F4CA 1A5KC 2Q09A 2UBPC 4C6KA 2Z28A 1FWCC 1UBPC 2E1WA 3IJ6A 3HTWA 2HBXA 4BKNA 2IMRA 1FWHC 3LU2A 3GIPA 4DYKA 4KF1A 3URBA 4H00A 4DLMA 4E3TA 1ITQA 3UR5A 3LY0A 3F2CA 1YIXA 1YMYA 3FDGA 1J6OA 2PUZA 1M7JA 3PBMA 4EP8C 2D2HA 4V1XA 3NEHA 2Z25A 4IFKA 4WGXA 1FKWA 1J79A 3RYSA 3GTXA 2GWGA 3MVTA 3DCPA 2D2JA 1YBQA 4H9VA 3S2NA 4C6NA 3URAA 4H9XA 4ERIA 3WYZA 2Z2AA 1A5LC 2OB3A 3TNBA 4ERGA 3E0LA 4G2DA 1V51A 2VUNA 4B91A 4H9YA 4IG2B 2YB4A 2KAUC 3D6NA 3OJGA 4CQBA 4J2MA 3LSCA 3TN3A 1FWGC 3GGMA 2VM8A 1KRCC 3UBPC 3ISIX 4B90A 1RK6A 2GOKA 2I5GA 4LAOA 1EJRC 3B0XA 4C6IA 2WJFA 2HPMA 3OODA 3WMLA 1FWIC 3GTFA 4QSFA 1GKQA 3LA4A 3LS9A 4GBDA 4EPBC 4LALA 2E25A 2O4MA 2BB0A 5CH9A 1ZZMA 4C6OA 2EG7A 3E3HA 2DVTA 1XRTA 4L6DA 3G77A 4DZHA 1PB0A 4C65A 4CEUC 2A3LA 3SO7A 3MDWA 2Z29A 3FDKA 3B0YA 4NG3A 4NI8A 2OODA 4C60A 1IE7C 4P5UA 4ZSUA 3QGKC 3RHGA 1V79A 3S2MA 4PCPA 4LFYA 1FWFC 3KM8A 3MTWA 1FWAC 1RAKA 1NDVA 1PSCA 2P50A 3F4DA 4LCQA 2QT3A 4RZBA 4GX9A 1M65A 3K5XA 2FTYA 5A6TC 3CS2A 4DLFA 1P6BA 2BGNE 2VC7A 2EG8A 4GX8A 4H9UA 3QY6A 4C6LA 4KQNA 1RA5A 3LGGA 1NDZA 3GU9A 1POJA 3B40A 3K4WA 4GOAA 3IV8A 2VR2A 2R1NA 4QROA 2WJEA 3S2LA 1I0BA 2HQAA 4M51A 4CQCA 1JGMA 4XD5A 3IGHX 4AC7C 2FVMA 2FFIA 3E38A 4R7WA 3C86A 4C6PA 4IFKB 2Z24A 3RN6A 3PANA 3MKVA 3BE7A 4DO7A 1YBQB 3NQBA 4DZIA 3OQEA 3F2DA 1V77A 3AU6A 4XAYA 3R0DA 4J35A 2ICSA 4LEFA 2GZXA 2FVKA 3DC8A 3T1GA 4CNTA 4XD6A 3A3WA 3LSBA 3DUGA 1XGEA 4NP7A 4C6CA 2DVXA 4GY7A 4CEXC 4GZ7A 4RDYA 2D2GA 1EYWA 1J5SA 1YRRA 3QY8A 2OQLA 2R1PA 3GU2A 4IGNA 4QS5A 2QS8A 5LXXA 4L9XA 4IQJA 2OOFA 2AQVA 1R9XA 4MUPA 4RE0A 1V4YA 3WZ0E 1O5RA 3MDUA 4F0SA 1HZYA 4HJWA 4QS6A 4ERAA 4J5NA 1O12A 3E74A 3URNA 2P9BA 2Z26A 5AKQA 4GY0A 2F6KA 1J6PA 4UB9A 3GTHA 3QGAC 1EJSC 1ITUA 1ADDA 3LGDA 4PE8A 1ONXA 4H9ZA 4DI9A 2PLMA 1KCXA 4HK6A 1VFLA 2Z2BA 1E9YB 4RDZA 1FWEC 4C6EA 1A5MC 4H9MA 3MSRA 3ICJA 4CNSA 2I9UA 4DI8A 4KEVA 4HK7A 3OU8A 4TQTA 1EJTC 3AU2A 3QY7A 1KRBC 4C6QA 2Z00A 3T81A 4KEZA 4LCSA 1RJRA 2O4QA 4JOMA 3UF9A 3A3XA 4RDVA 4HA0A 4IGMA 2VC5A 3HPAA 3EWCA 3N2CA 4ZSTA 2VHLA 4QRNA 1RA0A 4LAMA 1P1MA 4LANA 4G7EA 3IARA 2FTWA 2QPXA 2GSEA 4PBFA 2Z7GA 3TN5A 1UIOA 1R9YA 2HBVA 3GRIA 2WM1A 2Z4GA 1I0DA 4EPEC 2AMXA 3EGJA 2EG6A 1GKPA 1UMLA 4KESA 3GG7A 4C6DA 3S4TA 4GYFA 3OOQA 3AUOA 4KERA 2XIOA 1RK5A 4C6FA 1S3TC 1GKRA 4KIRA 4YIWA 4UBPC 1V7AA 5FSEC 3NURA 4C5YA 4Z42C 1WXYA 3UPMA 4B3ZA 1EJUC 3IRSA 1POKA 3MPGA 4LH8A 2UZ9A 3S2JA 2G3FA 3E2VA 2ANUA 1FWBC 2WJDA 4BJHA 1UIPA 2ADAA 4DIAA 4RDWA 1BF6A 3IACA 4DNMA 4LCRA 1A5NC 1XWYA 4IF2A 1EJWC 2R1LA 1EJXC 3F2BA 2CZVA 4GY1A 4H9TA 1KRAC 4PBEA 2PGFA 3A4JA 2YB1A 4D8LA 2DVUA 1NFGA 4KETA 1WXZA 2Z27A 4LAKA 4XAGA 4XAZA 4C5ZA 2RAGA 2YZ5A 3GUWA 3ID7A 4PCNA 3FEQA 4CQDA 1XRFA 5HMFA 3O0FA 1FWJC 3ORWA 1R9ZA 5E5CA 3PAOA 2R1KA 3MVIA 3GU1A 4F0RA 1DPMA 2HPIA 3O7UA 1K1DA 2W9MA 2PAJA 1EJVC 3OVGA 3EWDA 3PNZA 1A4LA 4XD4A 1EF2A 3IPWA 3TN6A 4C6BA 1FWDC 3SFWA 2Q01A 2ZC1A 2YXOA 4I6VA 3E0FA 1K6WA 3T8LA 1M68A 3LNPA 4I6KA 1ONWA 2HNHA 4C6JA 4IG2A 1QXLA 4G7EB 4GXWA 5G4HC 4GK8A 4EPDC 1A4MA 3TN4A 2Y1HA 4QTGA 4KEUA 3CJPA 3K2GA 3URQA 3PNUA 2QVNA 5HMDA 4C6MA 4BY3A 4INFA 2P53A 4OFCA 4V1YA 1W1IE 1YNYA 1RJPA 1P6CA 4F0LA 3GTIA 3UR2A 3MJMA 2OGJA 1FKXA 3ITCA 3JZEA 4XD3A 1E9ZB 1KRMA 2GWNA 4HK5A 4XAFA 2R1MA 4WHBA
chains in the Genus database with same CATH superfamily
1C93A 4RPPA 4H7CA 5EGRA 1A5UA 1ZTVA 1X6LA 2XZ7A 1F4AA 4GACA 4R85A 4U3CA 3M43A 3MHGA 4JNZA 6A3HA 4Q4SA 1RP8A 2PP1A 2OWXA 3KTXA 3EMZA 2WMIA 2Q71A 1M7PA 3TA9A 3LOTA 5BXSA 2J78A 1KXHA 3W70A 2Y7FA 3A22A 5REQA 1M7XA 4EF8A 4A6GA 1MXSA 1XD0A 1ZY9A 1FH9A 4GJ1A 5FJPA 4KF1A 4JX6A 1MZHA 2EPOA 4JICA 2D0HA 3LY0A 1UZ1A 4DPPA 1XDJA 1IEVA 3F2CA 3SJ3A 4CN6A 1M7JA 4OKDA 1HP5A 3VNDA 1Q7ZA 4UTUA 3DERA 3FGCA 5KFNA 3VOHA 3CL6A 2DH3A 3ZVHA 3E0LA 1E1FA 1S0MA 4S23A 2CETA 3LSCA 3HG5A 3HG4A 4WSKA 3SM0A 3MU7A 4IQLA 3WBYA 4X60A 1K3UA 4J7RA 2CEQA 1QI2A 4WSHA 1NSJA 1Q63A 4BI7A 2NUYA 1LRTA 2ASLA 4J1OA 3ONCA 3RM4A 4IMEA 4J3TA 3E2RA 4UQEA 4CEUC 2IS7A 1CW2A 4I9MA 4WGHA 2DZXA 3SO7A 5C71A 4B5NA 2E4TA 1ZS2A 2QCGA 1EC7A 1PE1A 1GOIA 1VH7A 4IUGA 2F7FA 4ZQPA 3NZ1A 4RZBA 1TIMA 5IDZA 3K5XA 1UZ4A 1W6TA 4LUSB 4F40A 5A6TC 3CS2A 5A2AA 3VNMA 2I5QA 2ZE0A 1XLJA 4MJ2A 4GI9A 3VD4A 9XIMA 3RM8A 5XIAA 4Z2JA 1D3HA 1XLGA 3C2FA 3K1GA 1ZGDA 2ZUUA 4LTSA 2C2EA 3AYSA 4LVAA 3F5KA 4KMQA 2VR5A 3PUOA 4GNKB 2ZUWA 1L8NA 1Q66A 3GQCA 3STGA 1WAUA 3BE7A 3VKAA 4DO7A 2HV5A 1XXXA 2TMDA 2VZSA 1BKSA 4A3YA 5I24A 3S5ZA 5JUVA 1W9VA 1LTDA 2I5IA 2J75A 4GY7A 4UFKA 1VFUA 1WZLA 4DQWA 1JZ2A 1XIDA 1B3VA 5BRBA 4F66A 5LXXA 1W54A 4J40A 3MHUA 5DLFA 2BASA 4JQ3A 4U5KA 1R3SA 4D72A 2ZZ7A 4WDUA 3SIMA 2J77A 5DQHA 4S38A 4NNBA 5I3FA 3GD6A 3GHTA 4ES4A 3LZ3A 4HNCA 1X1ZA 1DBTA 4A3HA 2V9WA 3OA3A 4B4HA 2X1UA 4P8VA 1VJSA 2HXTA 4ROPA 1JD9A 1E71M 2BWGA 1TG7A 1SW3A 4LYQA 1S5TA 1GVYA 3BSMA 1LZOA 4HMEA 2ZZ6A 3R10A 3M16A 3ARYA 3GHSA 1CEOA 4LW7A 3I4KA 3MV01 2DW7A 3KBWA 2D0FA 4LCSA 1FFRA 3GVRA 3KBMA 4QG8A 1REQA 1Y65A 3BOLA 2R14A 1VCVA 2FVLA 3GUGA 3EWCA 3VDGA 4AVFA 3BG3A 1X6NA 2E77A 2G50A 1YLVA 1UH2A 3KOFA 1QNQA 3H24A 3QV9A 1TUXA 1H5YA 4PL1A 2FTWA 1UIOA 1JPHA 2HBVA 2EKCA 3CLWA 3BOFA 2VDGA 4HGXA 5A8MA 3UQNA 1IXNA 2V5KA 1YDNA 3GG7A 1IIHA 4TO8A 4NZCA 4P61A 2VQUA 1X98A 4HYKA 1A50A 3TXVA 3MFHA 3DG6A 4IMFA 1K8YA 5KZMA 1GVQA 2REQA 1OGGA 4XUGA 2V5LA 1F8MA 4JTAA 1H63A 1UWSA 3U5UA 4AMCA 2XSBA 1OT1A 3GVGA 3AXXA 5HOSA 3FOKA 3IACA 3PJTA 3DFPA 4GRSA 4GWEA 4IF2A 3NQMA 4AWUA 4O0KA 2CZVA 1WDPA 2BP1A 4GY1A 2ACUA 3C2RA 2Y0FA 4QXIA 2PDIA 5KFXA 3T42A 1NIUA 2YSWA 1TA3A 2IQDA 2E6YA 1Q6QA 2C14A 4KWOA 4NJKA 2PD5A 2ZDRA 4ECRA 4FNRA 1UYQA 4H6KA 3PY2A 2VI0A 1FOBA 5I3GA 1R9ZA 2PI6A 1Q4NX 2PTWA 4FLSA 3MVIA 4FIQA 2OZ3A 2W9MA 1UW9A 3MB9A 2PAJA 1KBIA 3EWDA 1A4LA 3NTYA 1GQIA 1XSJA 2INZA 3VZYA 2FQIA 2PU1A 1TV2A 3W2KA 3GIYA 4U2ZA 3H4XA 3DFQA 3V1PA 1XLEA 3LCGA 2NXIA 1T8XA 4NT0A 4DO5A 1IWPA 3KL0A 2Z2UA 2CESA 4QTGA 4KEUA 2X0SA 3EBVA 2O55A 3UZXA 4O3OA 3FYOA 1SR0A 3KVMA 5I7GA 2Z1WA 4PUUA 4CU7A 3DC0A 1C8QA 2EAWA 2F6XA 5HMEA 2TSYA 7TAAA 3W72A 4HA1A 4PCSA 4Q22A 2Y8UA 3FK4A 1XR2A 3ZOAA 2AQOA 5LSMA 4W93A 3RXZA 1W1TA 1GPFA 2B81A 1C3FA 3IWPA 1M41A 4CCZA 2UV8G 2ZQ0A 2CLFA 3KHHA 5DGAA 1UJPA 3II1A 3RPMA 3AS3A 4KPLA 2WSQA 3UWWA 3Q8SB 1OIFA 5F2LA 1XPYA 5CCZA 3WENA 2C2DA 2W7OA 2NUXA 4DLMA 4E3TA 4U28A 3ALGA 1EB3A 2CFFA 1BEUA 1N82A 3G6MA 4RNIA 4W86A 6TIMA 5C9RA 5AHFA 2WMHA 1T6MA 3FW6A 3GTXA 3QLDA 2GK1B 4LF1A 1YBQA 3GDTA 2E6FA 4UOQA 2PCEA 3P62A 4D6HA 1V51A 4QX4A 2R8IA 2DORA 3G1DA 3SUSA 3WDQA 4YTRA 2YBTA 1CB2A 4PRTA 3EEZA 2PDMA 4AHQA 2V4QA 1DQUA 2DEPA 2ZX8A 3H2EA 1QPQA 5F4XA 4MTVA 4C90A 3S9IA 2E25A 2O4MA 3BLOA 4M80A 4YTQA 3SR7A 1GOMA 2QCEA 1US0A 2FGLA 2A1YA 1XP3A 3WH5A 2CXGA 3MDWA 5JQ9A 2J47A 1H1NA 2UVUA 1Y8BA 1OX4A 1NARA 3S2MA 4AWTA 4RCXA 3NZGA 1XGDA 2GOUA 4UTLA 4HU8A 4UNIA 3MO4A 2DGAA 4GX9A 2FLPA 2TPSA 2WWDA 1JD7A 4DELA 3CU2A 1R3TA 2BGNE 3UP8A 4O15A 2CZFA 2J62A 5KT3A 2WHJA 3WUFA 4CN4A 1ZHAA 5FI8A 4P7RA 2XZ9A 3OHBA 3WLSA 3UZWA 3NM3A 5HATA 3L0GA 1D3CA 1PX3A 3S5NA 3BUVA 1I0BA 1S5NA 1YTKA 3L65A 1DVJA 3W7JA 4GZJA 4HD5A 5SWUA 3A9BA 4ED8A 4D9PA 4J9PA 1WQ5A 2QV5A 3GW3A 3W7PA 4P2VA 4CNOA 2KX9A 1HP4A 4QDMA 2ZC8A 1H0IA 4JIHA 1EYWA 3OLGA 3SQMA 3MUAA 3RAQA 2R1PA 1X8CA 4KIEA 3F7JA 4LU0A 2XCAA 4HCLA 1WYIA 5T8GA 2XGQA 3PW0A 1OZQA 1C90A 1W32A 1PCWA 4JQ4A 3BANA 1O5XA 4ZEPA 2A79A 2VOMA 4O1EA 5HANA 2QDHA 3GNOA 1UWTA 2XN2A 3EPNA 1EJSC 2QW5A 4YHEA 4LXFA 5A6JA 4BF5A 1TRDA 2VEMA 2DT2A 3IIXA 1MEWA 2NWRA 3KVKA 2E6DA 3OIXA 2VWTA 3RAXA 4DI8A 1AZ1A 3W37A 3EWZA 3KHRA 1HJUA 2BLEA 3OU8A 2GJXB 3S6TA 3CYJA 1UP2A 2QCDB 2RFGA 1I2NA 3VOGA 4I7WA 4JOMA 2X41A 3PULA 4WJ8A 4MWAD 3AS1A 4FXSA 1GK8A 1S2UA 4X2PA 1YKWA 1CLVA 3VC5A 3LM7A 2WNQA 1R47A 4MKVA 4LAMA 1WUFA 5AFDA 4N9CA 4LANA 1YDOA 3F5JA 3ZVIA 1S5WA 1QPRA 5CKSA 1ME8A 1KR0A 4R7JA 1BWVA 5E1QA 3GG0A 5LNVA 1TR9A 2NVAA 4V15A 1NTHA 1QAPA 1W3TA 4GIYA 3A24A 2Y88A 1IT7A 2F61A 4GYFA 2H9AA 1P7TA 3CHDA 4KFPA 4GIAA 1E43A 3N19B 1U5VA 4YIWA 4KGLA 3ZR4A 5DMLA 3W07A 3T2OA 1TPWA 3B9DA 4B3ZA 3GIJA 3ITXA 4JV2A 1F3WA 5KFJA 3ABXA 3DFNA 3ITVA 4O18A 1UR3M 1VRDA 3TR9A 1E6SM 4Y9PA 1ADOA 1OY0A 3CMFA 3VIGA 4IPPA 5C9XA 4PMZA 3GVWA 4CCCA 4JTHA 4H9TA 1TMHA 1F76A 3PAJA 4OTKA 3KW3A 1ZNNA 1SR9A 1R85A 3LUTA 5I07A 3GDMA 1SO4A 4XAGA 3S42A 2V30A 1W1VA 4P8WA 3ID7A 3NZPA 1FWJC 1ISVA 1OQFA 5JIWA 3RBEA 1J0JA 1JCJA 3GW0A 4ACZA 2GLKA 3GU1A 1SFJA 2VURA 1EJVC 1DJYA 4GYJA 3FHQA 3HMCA 3VIOA 1CGTA 3GH4A 3M0JA 3WLJA 2DUAA 3BJSA 1VCGA 1W9UA 1FH7A 2C71A 1Z6KA 4CD7A 5FJRA 1KBJA 2AGOA 5JMUA 1DTUA 2W66A 2FPYA 2V3DA 3S3GA 1XLDA 4QWCA 1FA2A 1KFCA 2NQHA 1G4EA 1J01A 4AHOA 2V2HA 3UGVA 5CC6A 1YQ2A 3C0JA 3G1XA 2WMKA 2Q8LA 1KC7A 3JRKA 3PG8A 1KBKA 1UKOA 2G5WA 4JDBA 7TIMA 1VBGA 1OFOA 3BZJA 4YCOA 3CZGA 3M64A 1N7KA 3LCIA 4ED7A 3V7PA 3PJWA 4KW2A 5L1IA 3NVTA 3S1VA 4ECYA 2PD9A 2Y7EA 3ARPA 5CZSA 1HFBA 2YDAA 1A80A 3WH7A 5DY2A 2DSUA 4ED1A 1F3EA 4B92A 1H4PA 4CNUA 1H11A 3AICA 1VF8A 5FACA 3AWOA 1UWQA 1P0KA 4QDWA 1U33A 1UR2A 2VZOA 4ZB2A 4DAFA 4LNCA 3SRHA 3VKBA 4FLRA 4WQ6A 4ZODA 2Q8XA 4JKKA 1B3ZA 4JEQA 4BZYA 4LF2A 4E6MA 5F2MA 1UBPC 3PUEA 4HPGA 4PSPA 3SI9A 4M6UA 4GFSA 3P6LA 4AZ5A 4IL2A 4DYKA 5T14A 2NQJA 4A05A 2AAMA 3EWBX 3L67A 2GGIA 1V7YA 3FDGA 5CJ5A 4JXCA 1PKMA 1RLDA 3OA5A 1HN1A 1TWSA 4EP8C 5ABEA 2ZX6A 1FKWA 1ONRA 4IZGA 2DQWA 4LUIA 3MMWA 2YL8A 4J9KA 3N6JA 2W7PA 2LLEA 2ZTKA 4ECQA 4G2DA 2D24A 3PFMA 5HPCA 4B91A 1SFLA 1H7WA 8A3HA 2VGBA 2CKRA 1GYNA 3B8WA 3LLXA 4UTTA 3ISIX 4C91A 4LAOA 6REQB 4HPNA 3BLLA 3HA1A 1FWIC 3BO9A 1RYRA 1KM2A 1JCTA 1XIEA 5CPNA 4AZ6A 1K9EA 1XYFA 3ZMRA 3G1VA 3AMKA 2D1ZA 4YWIA 1BQGA 1VFSA 2WMFA 4JY8A 2OWCA 1XKYA 3G77A 3QR0A 5EA9A 1O60A 1PB0A 3BLEA 1XW8A 1JQVA 1QU4A 1FUYA 1LWHA 3LPOA 3U2CA 2XWDA 2ZWYA 4QNWA 1V8EA 5AOUA 4CKQA 3GNDA 2CIPA 1V03A 5EPDA 2BVWA 4LFYA 4OWGA 2X05A 4LV9A 4OECA 3B3DA 2P50A 1LUCA 3PJXA 1FP8A 1HF6A 3B9EA 3UT0A 1WUEA 3VOJA 5AN7A 1K8CA 1V6VA 2QHAA 1JX4A 1NDZA 3UR8A 1H0GA 4JTFA 1U83A 3L4YA 3U5YA 1N8IA 4QROA 4ATLA 4GC7A 1WDRA 3KX6A 1YNQA 1D7KA 3IN5A 3GR4A 5A6SA 1HJQA 2X1RA 4ADTA 2GVGA 1RQHA 2YW3A 3RO8A 3RX3A 3FY1A 4REQA 3S6DA 3KVJA 2BY2A 4AZGA 4IISA 3IJ7A 4Z17A 3SQSA 5KFEA 4ML4A 3GIKA 1SFTA 3HGJA 3E2SA 3WBEA 1VLWA 3ECQA 4DVOA 3QW3A 3THCA 2PC4A 5KFUA 2D2GA 2QV4A 1J5SA 1YRRA 4DRSA 4KRTA 4EEYA 3BMXA 4QE5A 2YL6A 3LXCA 2VKZG 1KBBA 3GIIA 5J5DA 5DRIA 4QDPA 3QC0A 3VKDA 4JIEA 1J11A 4MUPA 3IJQA 1DYSA 2ZOXA 4ERAA 1UH4A 3EDDA 3C4UA 1GOKA 5JBFA 3L9CA 2P9BA 2Z26A 4B2DD 4WXYA 1IZJA 3UY7A 1ITUA 1G94A 2YL9A 4RPQA 5LGXA 3CT7A 3KBJA 4QWAA 4GI8A 4C6EA 1CGYA 3MSRA 4UWMA 2I9UA 4KEVA 1VBRA 4LVBA 4QJ4B 2HMCA 2OX1A 3AAMA 4AY8A 3ANYA 4NYUA 2OX4A 3UF9A 3MSGA 1IHIA 2XISA 5CPTA 2VHLA 4P7OA 4MZYA 4LUJA 3TTQA 2YDRA 3MCMA 4ZR8A 4DL7A 4B15A 2PRLA 1JGIA 1ZFJA 4QEHA 4YR0A 2Z4GA 3GX9A 4YU1A 3MMUA 1YE4A 3QKEA 1Z42A 2QF8A 3T2PA 3Q67A 2G3IA 2OSXA 3TTSA 3WQ5A 4ZVJA 1S2AA 3ZR5A 1MSSA 1EKOA 1XBVA 4UBPC 2GJPA 1XCXA 1GYLA 3WK2A 1ZBCA 1AW1A 2W9CA 2VFDA 5DX7A 1KKOA 4PUMA 4CD6A 4LH8A 4DEZA 1YE6A 2JALA 4W7UA 2QCCA 2HSAA 1EFZA 4S2BA 3TP4A 2VRQA 2VEPA 3GR7A 4IJBA 1F74A 5DY3A 1Q6LA 4F8XA 1HKJA 3W9ZA 1A3XA 3EX4A 1CGWA 4PBEA 1PUDA 5KFHA 2E40A 4MWAA 4CUCA 5LA2A 1KCKA 4CQ9A 4Q4QA 3NJ3A 1UMYA 2W27A 2PC8A 1TX2A 4CQ8A 2JBMA 3VNJA 4JZ5A 1D8CA 2JKAA 4UTIA 3CM4A 2XM1A 4HPXA 4FOJA 1C7SA 3CZJA 1F3XA 1FWDC 1XLIA 5U4NA 3BQ6A 3TLQA 4MDPA 3C52A 4FF7A 3RUBL 2HNHA 3OHMB 1XLBA 4QJ3B 4N9BA 3S6OA 1CENA 5KFKA 1TV8A 3OB8A 5U7SA 2VD8A 1P1XA 3L66A 1WB0A 1C92A 3TQVA 2GVYA 4KWVA 1G5AA 4AF0B 4B5SA 2CBUA 3U8GA 4FSAA 2P53A 3VVGA 4NZ3A 5M3WA 3D3AA 4V1YA 3OGVA 1FX6A 2FTPA 4F0LA 2C2RA 2V5DA 4JIQA 3M46A 4G9PA 3V6JA 4WHBA 4KWWA 4IIGA 1E1EA 3M5XA 4I8YA 4RZ5A 4ZA0A 5FF3A 3P82A 1SO3A 4AD4A 4E2DA 3Q37A 4MAVA 2V5BA 4XUYA 1JXLA 2D23A 1QK2A 4QFUA 2PWDA 3VGFA 4FNUA 2B7PA 5AHEA 4PUWA 5LA0A 7REQA 1I1XA 5A2BA 2JEPA 2XJ7A 2ZA3A 1P0DA 4IL0A 1TCMA 3IJ6A 1GYMA 3APYA 4KFNA 5TD4A 1KCZA 1W5NA 3AIWA 3ES8A 1JRCA 1QNOA 3LLFA 4F2BA 1YIXA 1AODA 1Y5VA 4QAWA 5LXEA 4TOQA 3KUMA 3QYSA 3PWIA 1SW7A 1MXDA 5XINA 1ENUA 4RNOA 4US6A 3VNZA 4UQBA 5AYYA 4ATDA 3JVAA 2VUNA 3JUGA 3EDFA 3NA8A 3TLLA 3D6NA 5A1AA 2F2KA 5AC5A 3QKZA 1FWSA 3UBPC 4GQBA 3FJLA 3S0CA 4JFWA 3GXPA 2J9XA 3EB4A 3DXIA 3DYOA 4GE8A 3R0KA 1LLWA 2OFJA 1WDWA 4U33A 1PEZA 3LS9A 3UJEA 2XPKA 3RILA 4N4PA 1AJ2A 1OVDA 3EB2A 1MWOA 3GC4A 3IIOA 2WZEA 3GYCA 4QNEA 4GI6A 3NPUA 1B3WA 4GC6A 1MQQA 3W6LA 1AH0A 2OJPA 2YCLB 1MQPA 4ZFMA 2Z7KA 3HJZA 4H41A 4H6EA 3W2MA 2P0OA 5DQPA 2Y85A 2V3EA 2HCVA 3V4BA 4PCFA 3N2TA 3S1WA 3FIGA 2X40A 3W85A 1OFBA 3WO8A 3F4DA 3AALA 3H21A 5GNXA 4EAYA 1BYBA 2J88A 3BV4A 2EJ1A 2X1SA 3BQ1A 4F4WA 3U7VA 4M24A 5EYWA 1O95A 2CXEA 1V6YA 3IK2A 3AJ7A 4P7NA 3H40A 3GU9A 2BTMA 4LBSA 1POJA 1PCKA 3BTNA 1M9HA 3DAQA 1FWWA 2I16A 1KGUA 4ZOBA 4FHAA 2VOTA 4DXVA 5I3KA 1VYSX 1JI1A 4Q4MA 3GK0A 4Q6XA 4K8HA 3OBEA 1WDDA 3GILA 3PANA 4DZIA 5FESA 3WQDA 3UXAA 4S1FA 1RD5A 4L9YA 5FCZA 1LG1A 4XD6A 2WKGA 3A3WA 2J7BA 5E0FA 1XH0A 5AHIA 3B0VC 1OF8A 5HULA 4Z2LA 3GLCA 1Q6EA 1DJZA 3TW7A 4RU9A 2P88A 2BDQA 4W88A 1JCMP 4R9XA 1KR1A 3SGZA 3L4VA 3P93A 4L9XA 1FWTA 2QMJA 4YTTA 4EOUA 1XUUA 4ED0A 2R8JA 1JPKA 1UZHA 4W89A 1H2JA 2GJRA 3G18A 4A4AA 1I4NA 4YNGA 3DIPA 2HISA 3FFSA 4LYRA 5L6UA 2O56A 5C5YA 1TCDA 1OIMA 4QP0A 1EWEA 2EPNA 4OV4A 3PHAA 1UP0A 5HDRA 4PMDA 1AD4A 3JS3A 1D9EA 4F0HA 3BCFA 2R8KA 4JHZA 2YCJA 1L8PA 1BWLA 1KCXA 4LS0A 2QJMA 1YYAA 4NAFB 1Q5MA 2OSWA 1FWEC 3DG3A 1HL2A 2BOGX 4IMDA 5D37A 5D02A 3UWUA 3ANVA 1QT1A 3BK0A 3TC7A 4MJZA 3AU2A 5JIPA 3BJTA 2VCAA 1J93A 4RDVA 2CLEA 1LROA 2DZVA 1AJZA 2XU2A 4NX5A 1PIGA 7ENLA 4JTJA 2E68A 3W73A 2XDFA 3CTLA 3BQ0A 3W23A 3OGSA 3BW2A 3GDBA 3EX2A 4PBFA 2QNEA 4K68A 1ALDA 2GQAA 4DO4A 4EPEC 2AMXA 1K02A 4PMVA 4L5ZA 2AGPA 2C6QA 3GDLA 4O54A 4TUFA 2ZUNA 3MO7A 3BZGA 2OH2A 3RIKA 1R46A 1HW6A 4B2DA 4K38A 2YLAA 5FSEC 2CHRA 4D6DA 1KA9F 3G1SA 4WSJA 3TOYA 1BRLA 5CLTA 5B80A 4J4KA 4XZ9A 3W6MA 5FF2A 3PUDA 3QM3A 1CXFA 1O5KA 1YDYA 2VP8A 1FH8A 1CECA 4JS3A 1TRIA 1O6IA 1UOZA 4ECVA 3SUTA 4WLCA 4NJGA 4DL4A 4RV8A 1HG3A 4PULA 2ISFA 3DHPA 3O6CA 1XICA 4F9JA 4R7OA 3A4JA 5IFTA 3IJ8A 5FJIA 5H2ZA 2B7QA 2RDXA 4ZB0A 5EWFA 1BXBA 3KZPA 3NEVA 3N9SA 5F9LA 4NVTA 3CAVA 4LS1A 3KCJA 4CQDA 4ECUA 4DEFA 4XB3A 3W0KA 1FRBA 2G41A 1X7IA 4HT3A 3I3BA 3GH5A 4F4RA 3M5YA 5KG3A 4G3IA 2PDGA 4S3JA 2PTZA 4LS2A 4ZQNA 3VINA 3LHYA 1JPDX 3IPWA 1JFHA 2YXOA 5BRPA 2O9PA 1YTEA 3B9NA 1GNXA 4G7EB 2W92A 5DO8A 1CB7B 4FR6A 5A8OA 2VZVA 3GG8A 4PMOA 2FDMA 4RKAA 3PNUA 1K9FA 4IGHA 5HK4A 1UD5A 2C79A 5FIPA 3DHDA 4XWUA 1YNYA 5AB3A 2ISWA 1D7FA 3Q2DA 4EWND 3B4YA 3JZEA 4IICA 4E2BA 1ZALA 5I0DA 1ESWA 3WSUA 2FFCA 2DFAA 4TVCA 1XCWA 3HN3A 3UJFA 5BWFA 3WDHA 1U1UA 5L1KA 4M1RA 1V02E 4HTBA 4DL3A 4HTYA 2JEIA 5I06A 3TW9A 1A5OC 1A49A 3DFSA 3UFYA 4B5TA 4NAEA 4A2SA 3B05A 4M5PA 1ZJIA 4EANA 3M5VA 1FWCC 1JPMA 2RGLA 4E0CA 3K4DA 3ZLHA 2PDUA 5TIMA 3G1RA 4QWDA 3A64A 5D4YA 3ZJKA 4UFHA 4CVWA 4UR8A 2XGBA 2XFFA 3QHNA 3K8MA 4H00A 1DL3A 2ISVA 1MW1A 2J6VA 2BG5A 3FV9A 2GSHA 1FQ0A 3BPWA 5KSWA 2OOGA 1IIGA 2G97A 5G1TA 4IFKA 4HOZA 2X16A 2D2JA 2QIWA 1W3IA 3KL3A 1W2VA 2C16A 1W1YA 5F2IA 3P74A 1UUOA 5ECUA 1N2VA 4LAZA 3TN3A 6XIAA 4MNJA 1A5SA 2GOKA 5FL0A 4DUWA 2RDTA 1RPXA 3OODA 4RNJA 1YPFA 4O16A 2WHLA 3WF1A 4F0KA 3Q4DA 3K46A 3UY8A 4HU3A 5D2VA 3UCQA 1OCBA 1FTXA 1IZKA 2Z6IA 4IXHA 5DLCA 4DX3A 2JFEX 1XIFA 2WQPA 2RHGA 2FIQA 3NR0A 1RPKA 1EHNA 1PXGA 3MP5A 2QUTA 4N9EA 2VZUA 1H7PA 1MDLA 4NG3A 2OODA 4H8VA 3E9AA 3AFBA 1F7BA 1TV7A 1PKYA 4AZ7A 1VPQA 1WBHA 3P7YA 1LQAA 4ML9A 2WMIB 3VGDA 4HCDA 2ZWZA 1E6XM 1LG2A 4XTDA 5IOBA 2Y24A 2FLNA 5KG5A 4GX8A 5REQB 1PV8A 3TYDA 1RA5A 3DU0A 3UEQA 1UD2A 2A3BA 4LVDA 4XTIA 2DDXA 1RY8A 1V3JA 4LNYA 4RUCA 2BS9A 4CU6A 2H8XA 3AI0A 5CPMA 2C91A 3W2UA 2HQAA 1JGMA 4OUEA 3KS5A 4HVXA 4R7WA 3ZZ1A 2GJLA 3SGUA 2E28A 1RALA 3A4XA 1W8SA 1XIBA 4LVFA 3FGCB 4XAYA 2L5HA 2ICSA 1AW5A 4B3KA 1LLOA 3AHVA 4CNNA 1S97A 1HUVA 2BY0A 1JJKA 2PDHA 2DVXA 2ZX5A 1TWWA 2YLLA 3BAWA 4WOQA 3HV9A 2MNRA 3CH9A 1GWJA 2DPIA 3CLMA 3LBMA 3W28A 3VUSA 2AQWA 2YYTA 1R9XA 5GNYA 3AXKA 3PBUA 1EOKA 3WNMA 1O5RA 4HJWA 4QS6A 3OVPA 5G2WA 3TMLA 3E74A 1UR0A 3TA6A 3N1AA 3CUZA 1MW0A 2FLIA 1OFQA 1KKRA 3EWYA 1VJIA 3W02A 4GJJA 3AJXA 3HURA 4GQQA 4IIBA 4Q8QA 1PKNA 4PE8A 3R25A 3CMJA 1TQJA 2TRSA 4RDZA 3V36A 2BFGA 2INEA 4LB3A 1Y5WA 1XBXA 4CNSA 3Q65A 1EF3A 3VGBA 4Y7EA 1OK4A 4RUAA 3B8DA 4JY9A 4BEQA 4YYFA 3I65A 1X96A 3FKRA 3T0AA 1LT8A 4JFVA 4HMCA 3D0CA 5DMNA 3VD3A 5KFMA 4D71A 2BOFX 2WSPA 3E6EA 3TJLA 2O0TA 3GFZA 3U0HA 3EGJA 5DGBA 3T5HA 3WQ8A 3W88A 1RVKA 3INPA 3OOQA 3NQFA 3I3EA 1Q3NA 3V0UA 3ZJ7A 1V7AA 1XINA 2ZZ2A 3BSHA 1JCYA 3GNXA 4Z42C 1WXYA 5DRCA 1EJUC 1EO5A 3RF9A 3ZSTA 5LNSA 3NL2A 5FEXA 4UC5A 3N04A 2HVNA 1NWTA 2OT0A 4LCRA 3SN0A 4GA8A 1BGGA 1VFFA 4AD2A 1KRAC 2PGFA 1F5ZA 4JNMA 3B8SA 2XH0A 3T2QA 4UCFA 4MMWA 2OYMA 4JTEA 2DPJA 3GUWA 4QQ3A 4A29A 1Z44A 2UY4A 1M03A 3O0FA 2ZDSA 4Y9MA 2PP0A 4GIEA 3G1FA 2VRKA 5C9UA 2HPIA 3CUXA 2SFPA 2VVSA 4IPIA 3RO6A 4CNPA 2W91A 4HU0A 3TN6A 3WF0A 4A8LA 1REQB 4K2SA 4O12A 3E0FA 1CXLA 3SJNA 2VFFA 3ARXA 3H4GA 4Z0SA 4ZE4A 4ALDA 4J9OA 4B4FA 3SFKA 2PDQA 1XYBA 4AD3A 4DJDD 4INFA 4CU8A 2QJGA 4JTQA 1OZMA 1FKXA 1QWKA 3B4UA 2Y6ZA 2REQB 3AROA 3HM7A 1HX0A 1J0YA 3H23A 4FEZA 1W3HA 1JRBA 5E9AA 4PA8A 3SADA 1W3KA 1IQ8A 2CWNA 2YJQA 4UFJA 4IFRA 1VPXA 1I2QA 2YA0A 1RJQA 5K9XA 3EOEA 2QLYA 7CGTA 5CPOA 1LWJA 2X7VA 4JTTA 2VCCA 3DFYA 4DB7A 1ZBKA 1DWJM 1PIIA 3VCRA 1G4SA 2MUCA 2RDUA 2A2IA 3ABQA 4IP5A 2QXWA 3A9IA 3KEHA 4S3AA 1TA3B 2DH2A 3M6DA 3POHA 2OSYA 2IMRA 2QQ6A 3T4CA 3EOOA 2WMGA 2E9LA 1RV8A 2GVEA 4LV4A 4GXMA 1JDDA 1TE1A 3VOIA 3A4WA 2X0HA 2Y5SA 1DWGM 1BXCA 1XKJA 3Q94A 3GR8A 4IGSA 1XD1A 1DE6A 2WC7A 4H9VA 3HBLA 2OKOA 1EDTA 4NX0A 1TELA 1VFMA 4QWEA 2JEGA 2J8TA 5EMLA 5EDWA 3W7EA 3UCDA 4F4YA 3OHIA 3GC5A 5KZDA 2ISDA 6CGTA 3AMLA 1OCQA 4UIOA 1JNDA 1E6ZA 2WKJA 4YLWA 2E5BA 5BU6A 2V63A 3CV7A 2F38A 4OE7A 1KTCA 1ZZMA 3LCWA 4KBXA 1LL7A 3KE0A 5E0CA 4AC1X 3VE7A 2YZRA 1M01A 4KKXA 5CC7A 4AHPA 1MZRA 2GGGA 4HA3A 3TQKA 4DJEC 1ISWA 2XVGA 3B8UA 2VELA 3T09A 4WF7A 3WLOA 3S9YA 1FWFC 3MTWA 4RE3A 5DCEA 3MBFA 3GHRA 3RLVA 1G01A 1UC4A 2JIEA 3SECA 3RAOA 1A0DA 1CLKA 3OBAA 1LOLA 3VILA 2CZDA 2VC7A 2EG8A 3BJFA 3B0UX 4TQRA 3IVTA 3WN6A 5K9DA 2R1NA 2WJEA 3MKCA 4ZMGA 3ZLFA 4XD5A 3CWHA 4RE2A 4FXJA 4NUWA 4IRKA 2DQXA 3UZJA 1MW3A 1YBQB 1DJIA 3FA4A 4Z1CA 1K1SA 2UVRA 1TQXA 4JIRA 5GJNA 3AU6A 3AS0A 2YKKA 3AIUA 1DJXA 5A95A 3WLLA 1C91A 3QY8A 1QNSA 4L4OA 4A8NA 3STFA 3UPBA 4IRCA 5CC5A 3RCNA 4R33A 3WMSA 4U2YA 3WH9A 1YHTA 3TH6A 3WZ0E 4DHGA 1CYGA 3U3HA 5I03A 4UTHA 3LMZA 1ICSA 2AL1A 1TPVA 1O68A 4JQ2A 1GT8A 1TJRA 1LP6A 3W71A 1QPOA 1GW9A 2VGGA 3H22A 3KOZA 1XS2A 2D3LA 2VD9A 4Z2KA 3IV3A 4AD1A 1E3ZA 2QUNA 3PVFA 3LM3A 4YJ5A 1WNOA 4LBUA 4LVGA 4H6QA 1PVNA 3T5KA 3XISA 5A6MA 2ZXBA 3VE9A 2J9ZA 4O0ZA 4Q4OA 3T81A 1IWBA 2J27A 4YWSA 5AC8A 4J27A 2FLLA 4XZIA 3GDKA 3VGHA 4X2RA 3SCPA 1OJXA 3HO8A 3B04A 1DIDA 4ZXOA 4Y96A 2YCEA 4D1IA 4GUJA 1EDGA 3G1AA 3QV8A 3CAQA 4YTSA 1R9YA 4F9DA 4ZXLA 3OPSA 4GABA 1E40A 4IIHA 2VA2A 1NVMA 5DEZA 3WF3A 4KESA 3PZGA 2YCLA 4EYIB 3S4TA 1PYFA 1K8XA 4ECSA 4H8NA 1EHAA 3CEPA 2JEJA 3WNKA 2ZE3A 1PBGA 1JUBA 3S2JA 4YN5A 2P3ZA 1FFQA 2HXUA 3SBFA 2W8KA 4HN8A 1ZRQA 1PWMA 3OYZA 1R0MA 1T41A 4HNLA 1H7XA 3FXGA 5KG0A 4A22A 4RW5A 1XYMA 5KFWA 3AYRA 1W2PA 4XVDA 5MKGA 3A3HA 3FAWA 3R6IA 2EXOA 4MHBA 1XBZA 3IJ9A 1MNSA 2ZRVA 4ED3A 3LG3A 1THFD 1W1ZA 2XH7A 3W75A 4J9NA 1AQMA 1H1ZA 2QJJA 3NAVA 1G9HA 4AY7A 5CPQA 1RBLA 1TZZA 5CC3A 1CIUA 1MFVA 2HS6A 1UP3A 2ALZA 4W9TA 8XIAA 1IM4A 3WCZA 1EL3A 4AYGA 4DBDA 4QHRA 4PUJA 3LX9A 4HQVA 3ALFA 4Q8PA 2ZC1A 1J2WA 3N25A 4PUNA 4UCGA 3M41A 4QAIA 3MYPA 3FJNA 4C6JA 3TSBA 4TTGA 3CUIA 1EXPA 4U3AA 3CQKA 3CV1A 4BA0A 5E6ZA 4K37A 2JEQA 3DG7A 4MNLA 1B57A 3STCA 1XC4A 1CXKA 3PZUA 3CZEA 5LGZA 2H9AB 4LC8A 1P7TB 3CL8A 1JYVA 1RJPA 2RJHA 1LF1A 4PMQA 2AMGA 4KEMA 5T91A 1RHCA 2J24A 4DUXA 1IF2A 3VIHA 3W1XA 4FPSA 3L4WA 1FCUA 4BHYA 1QW7A 4H04A 3O9NA 3QBUA 3WQPA 5MF5A 3QZ6A 1HXJA 2X09A 1GOOA 1IEIA 1CXHA 3V5FA 1JAEA 2CYGA 3L4ZA 4RXGA 5M5DA 1NELA 3RLGA 3F4VA 4GC4A 1X1NA 3U57A 4G6CA 3VGEA 4AIEA 1E6QM 2DSVA 4XIAA 2VRJA 2NX3A 2PSNA 3HFYA 2ZFAA 3H4WA 2PE4A 2XTKA 4FS2A 5F4SA 3L4UA 3VGGA 4AEEA 4ACZB 1JF5A 2BOEX 1QHPA 2XYLA 3APTA 2DZAA 4MYXA 1FWNA 4M3PA 5HUPA 3USZA 4DJDA 3WJZA 2YDSA 8RUCA 3DCPA 4WX2A 1ITCA 4F4XA 3W4RA 1ZBWA 1QWGA 2ALRA 2EKGA 3ES7A 1SSDA 2V8ZA 2P3EA 1W9DM 2EPLX 4CQBA 3WQWA 1FWGC 3RB4A 3KBNA 4Q7BA 3CL7A 3C61A 4M0XA 3UXKA 2XVLA 3R43A 4QSFA 3PPHA 7A3HA 1YDVA 4FS9A 4XZLX 1IV8A 1L2UA 3PC0A 3WQGA 3CTTA 1FXQA 4QCFA 2FDSA 3UWZA 4QR6A 2VX7A 4GZIA 4DBUA 1UR9A 3AXHA 1R7AA 3AMDA 2RDIA 5ECVA 3WG6A 2BHYA 4AX7A 4JKLA 3WJXA 2VR4A 1Q8AA 3GXNA 1B90A 2DP3A 3TDFA 3T8QA 5C2CA 1K6AA 4LGXA 2JKPA 3TZFA 1F73A 2VEGA 3GZ3A 2PDBA 4H7VA 5D2WA 4AZIA 1GHRA 1UOKA 4N2YA 4WD0A 3L5MA 1AJ0A 3O6YX 3BSGA 3MZ2A 4C6LA 1F61A 3SAZA 3YPIA 3GQYA 3PPFA 2ZXDA 3S9ZA 5F1UA 1W17A 2VR2A 2VX4A 5EB8A 3VAVA 4O52A 3RJXA 4MG4A 1E0WA 3CWOX 1X39A 1MUWA 5I02A 4HSHA 4JFSA 3GXDA 4IMGA 1TZ7A 4LT9A 2ZXQA 2EPMX 1E1CA 4QJ1A 1GJPA 3PSWA 1IR1A 2VC6A 1EX5A 4HNUA 1NP2A 3GXMA 2PP3A 4EX4A 2E8ZA 3AZRA 3VI2A 3TOPA 2FJUB 4B3LA 1G7UA 4IQJA 3M0MA 5LIWX 2QAPA 3MI6A 3N2MA 5FAGA 5B7YA 4B5XA 1DOSA 3VCCA 3HPSA 3WBAA 5CBJA 3ANUA 4AAJA 4AU0A 1ADSA 2IW0A 4O3SA 3PW4A 1RUSA 1A3HA 4Q8MA 1BSIA 4UQCA 4GY0A 2E9BA 1KFBA 2QYGA 3MWCA 1W1B1 3M0LA 3QPEA 1BLIA 4GJIA 5RUBA 4W4QA 2WXDM 3HPZA 1YPXA 3QHOA 3AYTA 3B06A 3WK1A 1AL8A 4O19A 3R12A 2WCSA 1B30A 4LEQA 1LUCB 3BURA 3FSTA 3V75A 3SCVA 3QZ8A 4PMRA 1IT0A 1GQLA 2I9EA 4POCA 3DN5A 3WJSA 4G1KA 5HPOA 5IRPA 1NM9A 2XN1A 1CGXA 1UZDA 2CPUA 2H90A 1PAMA 3C8FA 3W74A 4FA3A 4NF7A 1BHGA 1RA0A 1NOFA 3AIQA 3CHVA 2A3AA 5CAKA 2NSOA 3WQCA 3HQNA 3KXQA 2GSEA 4DBWA 3VUPA 3EPGA 3HGSA 4S3KA 1R3QA 3QEZA 4WDXA 1F6PA 3SDOA 4AG0A 4K8EA 4FLOA 1XG4A 4OQVA 3DYMA 3T5LA 2GUBA 1J96A 4L56A 3W24A 4WEVX 3DFHA 3HOJA 3A4AA 2H6RA 4XAPA 1EP1A 2WPGA 1CLXA 1NF0A 3UPMA 1ODZA 3N18A 2Q02A 4P8UA 4RNHA 3L4XA 3LI1A 1FWBC 2WJDA 4M19A 3FX4A 4NL1A 5EMYA 4OT7A 1HKIA 3W7KA 2BQRA 3G0UA 4JN6A 1J0IA 2Y5EA 1U2YA 4O4VA 1N56A 4UR7A 2V82A 1NOUA 1LM1A 2O7SA 1IGSA 1BAGA 4H8UA 5EMUA 6ALDA 3I7SA 2GQ8A 3RLUA 4JFUA 1QDSA 3I6RA 2Z27A 3GNNA 2VQTA 2FGBA 2AQ4A 2YZ5A 4W7VA 5ABGA 3EKGA 4L6HA 4R27A 4ZOEA 3L12A 2B4GA 1DKWA 4ZL1A 4MY9A 3PZTA 4G56A 2YIHA 3O7UA 1VQTA 2HDJA 4MB1A 2G4JA 5KFIA 3G0SA 3MKKA 1RH9A 4JQ1A 3ZM8A 1NEYA 4JIPA 2GGHA 1UQZA 4IG2A 4MZ8A 4PMNA 4JTRA 2BBFA 2HK0A 2Y8KA 4Q43A 5DG9A 2FZBA 4QISA 5AYXA 3E5PA 4XZNX 3IANA 2XSXA 4BI6A 2QVNA 2CZEA 1JZ7A 3EDEA 4N6FA 3HZ3A 4DJED 1SU5A 2GDUA 2VVNA 1GOXA 3UR2A 4NXSA 3OTRA 3DX5A 1UG6A 2W9CB 1WOBA 2EEXA 2YDQA 3P5ZA 3W1RA 3VYLA 4H8HA 4GINA 3N17A 2G37A 1HKVA 5CZTA 3W81A 3CAKA 4RZ6A 3PZOA 4PRRA 1M04A 3QOKA 2VA3A 1ZAJA 2AKZA 1W3JA 1V3HA 3IUHA 3LRKA 3MANA 3W22A 1VD6A 3LB0A 3VD7A 4IFOA 4EPKA 2DW6A 3MFIA 4RL3A 1RCQA 1UWUA 1QHZA 2C22A 4MWAB 5HJXA 4GVIA 2UBPC 5KFSA 4W87A 1K7XA 4JL2A 3TE9A 2QJNA 4UOJA 5KG1A 5FAJA 3PB2A 3VPLA 3HTWA 1K4HA 1KGWA 2OZTA 4AVNA 4L80A 5FEZA 4YYCA 4XKYA 5CQ1A 3CZLA 4GISA 3N9KA 1ITXA 1SJAA 2AGTA 5EBAA 3LTPA 3T9PA 3UCCA 2NT1A 1MFUA 4PL2A 1J79A 2A5HA 3T40A 2GJNA 4FX7A 3WYZA 3EAUA 2ZRUA 3UA4A 3LHWA 3ZT7A 4J3UA 1A5AA 2I14A 1MVYA 4A35A 2H3DA 3SRFA 2YB4A 3T5JA 2VFGA 3C0SA 3LHUA 4A8RA 2WZHA 2W62A 2PLKA 2VM8A 3T78A 2D73A 1HJSA 1RK6A 4S3DA 4O1AA 1TV5A 5CSUA 3R0UA 3NGJA 3WLPA 3PPCA 2HTMA 1K1QA 3ITLA 4ACYA 1GKQA 1EUNA 4UNLA 4EPBC 1IZCA 1JF6A 1K7EA 3SCOA 3AIRA 1TPDA 2D3NA 4GH3A 3WF2A 5AC7A 1MYRA 2HWGA 3AQUA 3H2NA 5E0KA 4M7TA 2IPFA 4K36A 4P7QA 4MIMA 4TMBA 1L6GA 4DUOA 1B2YA 1WZKA 4NJIA 1KNWA 4J9RA 5A69A 2XIBA 4O1CA 1R3YA 5DBUA 4TIMA 1S0OA 3RHGA 3F5LA 1VFOA 3KM8A 3SI8A 2RDJA 3VXGA 1HJWA 1NDVA 2D20A 1PSCA 4DXXA 5C7VA 3WMBA 4MM1A 5FF4A 1UKQA 4FX8A 3M4HA 2PZNA 4LWWA 2F84A 4P8XA 7REQB 1PKLA 2JQXA 2QCFA 3CEUA 2UY5A 2F8QA 4IM4A 3K4AA 3S1XA 4M8UA 5PTDA 4PTMA 1KFWA 1UQYA 4Q7NA 4AXNA 5CSRA 2D0GA 3MMTA 4HN4A 1C9DA 1GOQA 2NXGA 5DG7A 3M1ZA 2CWXA 4GUGA 4R9OA 4AC7C 1XC6A 2Y62A 4LYKA 1UWIA 1ZP4A 3E38A 2ODOA 4YP3A 5F2GA 2VEIA 2VFIA 1JCLA 4K7YA 4IQEA 3T4WA 3COTA 1BTCA 3BMVA 1QW9A 3W7MA 4AY1A 4Q3MA 3T1GA 3WQ4A 3LEPA 1ELSA 3DUGA 1XGEA 4NP7A 1KM1A 2PURA 2ZZ5A 4JYFA 3NO1A 1HO4A 3BC9A 3DI0A 5I23A 4D8AA 3UD6A 3JZUA 3SCWA 1FHVA 1OB0A 1OYAA 3N2OA 4PSRA 3MR6A 2AKMA 4LB4A 4WKAA 2VGIA 4QS5A 2W8LA 4GCXA 4N0RA 1UA7A 4HOXA 3L2LA 2CERA 1E73M 3P8IA 1SO5A 3UJRA 3QFWA 4HIBA 1MUMA 1QO2A 5KFZA 4U5IA 2NXHA 3DFTA 2PWVA 4I7VA 2P10A 2NQZA 1D8WA 4BFAA 4E4UA 2OQHA 1QI5A 3LXBA 4Q8UA 3OZMA 4IT1A 3FLUA 1LRQA 3BAIA 4GI4A 1V0MA 2CNCA 3NQ2A 2G0WA 5BW6A 2DIEA 3BLFA 1V3MA 1G67A 2UWFA 4JGDA 4MY8A 1Q2SA 1CI1A 3PN8A 2E0PA 3H54A 2HROA 3RX2A 4CCDA 1QNRA 3PZ9A 4YS1A 1L2QA 3EXTA 4J3VA 3RB6A 2HS8A 3ZR6A 3B9OA 1RJRA 2Y5JA 2BHUA 4BK9A 4JCLA 2XIIA 4DY1A 5D04C 5BNKA 1XRSA 2XCPA 1XPGA 5AVNA 2E5CA 5DELA 5HUOA 3WQVA 5H91A 3WNOA 2ONEA 3I4EA 1WBJA 4OZOA 3HQ1A 2Z1KA 3UESA 3KHLA 4JYDA 5HAOA 1C9WA 1HQTA 2B31A 3G6LA 4A3RA 4ADSA 4QJ5B 2IPGA 1F4HA 3HQOA 3VKKA 3QOMA 1R30A 1GGOA 2C0HA 4O8AA 3EX3A 1XM3A 2BVDA 4WKFA 3IRSA 1POKA 3QZEA 5HWJA 4MJMA 4ZQCA 4NJJA 3Q45A 1B54A 3E0VA 1SZRA 2NLIA 3HV8A 4J3ZA 2BY3A 2WPBA 3VX1A 3RU8X 5H8MA 5G2HA 1O1ZA 2PB1A 3W1TA 3QMTA 4NYYA 4DWSC 4W84A 1EJXC 3LENA 3RFAA 3P2VA 3MV11 3VIMA 4S3GA 5A8GA 1E70M 2AL2A 4QE4A 3E2QA 3U2EA 3KZSA 3SY5A 3M5ZA 4PCNA 1K9TA 3KBSA 4UZUA 4A8IA 1XCFA 5HMFA 3G1YA 3QTPA 4MB4A 4IR9A 4AX6A 3BLPX 1HO1A 3TSMA 1EA9C 1F9CA 2FPVA 4WY0F 3L5LA 3WD4A 4IMAA 3M6YA 5D9NA 2OPJA 1F3TA 4C6BA 5HNRA 4Q8NA 2V3GA 5FL1A 4ED2A 5HNUA 2J4GA 1QO5A 1VB9A 5A6LA 3THDA 3L2MA 1DWAM 2DU2A 4WIWA 5G4HC 5CXPA 3SUUA 2IA6A 1VBJA 1ICPA 2J9YA 1YEYA 3BW4A 2NW0A 4FNTA 4EPDC 1WXJA 3LTYA 5DANA 4PUDA 2Y1HA 2YPIA 3OZYA 1L9WA 2XVKA 1OC5A 4LRSA 1K77A 4LRTA 4AEOA 2WSYA 4OFCA 5HWMA 3ZFHA 1DWHM 1V08A 2FZNA 3CASA 3GSMA 3J7HA 1FVPA 1I1WA 4S39A 3SZ8A 4WY0A 2ESCA 3H70A 4JIIX 1GG1A 2YBUA 3AC0A 3W7NA 1PDYA 1J12A 5KZEA 3UW6A 1BRLB 1KM6A 2J13A 3CB3A 3R1ZA 1GJUA 4HZ7A 1WV2A 1OG6A 5C9WA 4I5UA 1JVNA 1V0NA 3PZQA 4BQ4A 4IX0A 1S3HA 3SN1A 1OK6A 4MB5A 2Y7GA 1I2RA 1KO0A 2PGRA 3MBDA 2XUCA 3I3DA 4I9TA 2INFA 5DQGA 1XYCA 3NDZA 2QKFA 4XO7A 1FHUA 3BGAA 3PBGA 1P0BA 4ZE5A 4FX6M 1E4LA 3VTRA 3KOYA 2W4XA 2NLYA 4PN2A 1ITQA 1MDRA 2ZYFA 3GH7A 1XYAA 2XC9A 2OMAA 1HT6A 1V3IA 4DJEA 4O8RA 3CB8A 3MW7A 1E0XA 4DAIA 2GFTA 3S2NA 3URAA 5DCBA 1XISA 2Z2AA 1TJ2A 1XH2A 5KTLA 2KAUC 1UR8A 1G1YA 1SZFA 1KLYA 4J2MA 1Q6GA 3IJLA 1KRCC 3HB9A 1KM4A 4FF5A 4NZ5A 2YOCA 1A47A 1Q6OA 4WDWA 1JDEA 3WQFA 5K4XA 2O92A 3GYEA 2H3BA 4S3BA 1OFEA 3LYEA 2VTFA 4GQRA 3SY8A 3WUBA 1H50A 3VNLA 2J79A 1Q6FA 5BU9A 2QGHA 3WFLA 1EBHA 5E6YA 3ZT5A 1BPLB 1XLLA 1IE7C 4P5UA 4ZSUA 2ZVRA 4QG9A 5IFPA 2CLIA 4O0QA 3WD2A 4IWWA 6TAAA 5A6BD 4UUIA 1OD0A 4UFIA 4DJFC 5BOFA 1JZ4A 4NAEB 3V5CA 3MJYA 4O57A 3QH2A 1UJQA 2GPTA 4DZ5A 1D2KA 3QY6A 3W2LA 1KFKA 1AG1O 3I10A 3ZWSA 5AC6A 1TFVA 1BWKA 1TIWA 3NQDA 1OFPA 3NIYA 2W9BA 5D2TA 5CSYA 1T8QA 3KRSA 2E6AA 3B8IA 4X9SA 4NHVA 4M56A 1RP9A 3HFTA 5LNRA 3C86A 3LRLA 4IFKB 2B0MA 1AQFA 2WHKA 2OKTA 1KD0A 3DZ1A 3W38A 3NQBA 3OQEA 3F2DA 2BSLA 1V77A 5CSSA 4BQ5A 4OOUA 2IBKA 3W83A 2EBNA 1ZCOA 2IQ0A 4BF9A 3LSBA 1BKHA 4ONVA 4U10A 3CC1A 3THAA 1SUXA 3OLDA 5FF0A 1TPEA 1XSKA 3H2AA 2QUMA 4ZQMA 4TMCA 1FCQA 2R8WA 3E02A 3O06A 4LBRA 1ZETA 1SM9A 1UB3A 4RE0A 3M9MB 3GBEA 4L64A 2BXZA 3EEGA 1JDCA 4NZ4A 3OBKA 4GYPC 5DBTA 1ISYA 1GHSA 1Z41A 5C70A 2XFYA 5AKQA 3O6DA 4UFLA 3GTHA 4N7QA 1EXBA 4EXAA 3D5HA 1TTPA 2XINA 1KXVA 3REQA 4HSOA 3PTMA 1OT2A 1J18A 3RRAA 5G2IA 4EACA 2J8GA 1BYDA 1K03A 1J4EA 4HCHA 4HU4A 4ECXA 4LAUA 4U4MA 3H26A 3QY7A 4ZFCA 5EMKA 2PLCA 4H7ZA 1GVRA 3QHMA 4GVGA 3EWUA 1LOQA 4IIEA 4C1NA 1UWAA 2VC5A 3VIJA 1PYMA 3WLRA 3H2OA 1H49A 2WWCA 2R9RA 3VIKA 1O5QA 3IARA 2QPXA 1B3YA 3RU6A 1CCWB 3GFXA 3WNNA 5KFTA 9XIAA 1S46A 2P8BA 5I77A 4R8UA 2V9DA 4IHCA 4J28A 3WFAA 1GVFA 3EOLA 4KCUA 5AY7A 5LYRA 1KFLA 5EBUA 1J8VA 4ZTYA 3W1MA 3BCJA 1W9PA 2GVLA 3EXSA 2FMOA 4DYJA 3RMEA 2QJIA 5KZ6A 1NAL1 3O15A 1S5MA 3BG5A 4Q8EA 2ZA2A 3G6YA 3AHYA 3KHDA 1DTNA 2P1FA 4DIAA 1UKSA 2ZXAA 5HNTA 1DXEA 5C9ZA 4K3ZA 4UMBA 1I9CB 3TYBA 2R1LA 1DIKA 1XYZA 3VNKA 3TUUA 2CHNA 3E0IA 3BV7A 4I9AA 1PPIA 4J9LA 4YHGA 4X0NA 2BHZA 1E3XA 1OCNA 2QUUA 2X2YA 3CHCA 4EBCA 1ZLPA 3CNYA 5TQLA 4XVEA 3TC3A 1EP3A 3WKZA 1US2A 2Q3RA 2J74A 3O3RA 2EQDA 1H51A 3AYVA 4XSMA 2FYMA 1R8LA 2ZUMA 1TREA 4XD4A 1ZUAX 2VUYA 2BY1A 3M7SA 2G8ZA 3RCYA 2J7HA 4AZCB 4OIFA 2FHCA 2WZMA 1TO3A 4I6KA 4WRHA 5KETA 1EC8A 4GK8A 5DFAA 3TJXA 3U6WA 1J0HA 1B31A 3TR2A 5CG0A 3K2GA 4KFOA 2X42A 4HNVA 1R2SA 4KCTA 4C6MA 4BY3A 2XIJA 3M0VA 2Q3OA 3KLLA 2JKEA 2P8CA 9RUBA 3VDHA 3MCNA 1BXNA 3VDBA 2V0TA 2B7OA 1I75A 5FJJA 1AQ0A 3RK8A 3VDAA 1QI0A 1MNZA 2B7NA 2OCZA 5CAHA 4WVXA 2NX1A 4BS0A 3ATZA 3K8LA 5LIUX 1PO9A 4FNPA 2FZ8A 2XVNA 3V5OA 3RCMA 4Z2IA 2GQ3A 4GBUA 3GTNA 4M82A 2RDWA 5IXEA 1DIOA 5I3DA 5IHSA 1WCGA 1ZL1A 2KZHA 2WC4A 4NNAA 3PW2A 2Z28A 3S5SA 1OD8A 2IPWA 3H2FA 1DXFA 1E72M 3M0YA 1CBGA 1U5HA 3GIPA 1Y7VA 4MSSA 4MZ1A 2Y70A 4V27A 2CBJA 3R7MA 3XIMA 6ENLA 1GEQA 1J6OA 3WH8A 1BQCA 3A21A 3P0XA 3LDVA 1I2PA 1VYRA 2Z25A 1B3XA 5CZ0A 4YR3A 4ZO7A 1DJHA 2QVHA 1QHOA 2NV1A 3HMJG 1SW0A 3W7CA 2ZKMX 1EWDA 2ON3A 3MR3A 3WLHA 3ARVA 4NILA 4FP1A 1LBLA 2VX5A 3EMCA 2VC9A 3QGVA 4C7FA 4D1JA 1O94A 3KBVA 3CO4A 3PZMA 2A21A 4QQUA 3QMRA 1QOPA 1VS1A 1CT5A 3NQCA 5ABFB 3GTFA 3H4BA 3CYVA 5BOOA 1C8VA 1OINA 2XN0A 4DXKA 1Q6RA 1OGBA 5HJYA 4RZRA 1LL4A 5DMMA 4JD4A 4ECLA 1DWFM 4JR5A 1V6XA 3IRDA 3G22A 2DVTA 3TTYA 1O4UA 3EPIA 3PWAA 2E8YA 1C8XA 4UXDA 2A3LA 3W1AA 1LT7A 1CPUA 3QJAA 4PMJA 5BXRA 5DG8A 4JUZA 4RXFA 1R5YA 3ARRA 1W1A1 1ZP3A 3H53A 3LN3A 3N4FA 4NRRA 4J3WA 2J25A 4RUBA 3LQGA 4XK2A 3SCUA 4AIOA 1TMQA 3M47A 1CGVA 2CZ5A 3RPTA 1M65A 3PP7A 3S5OA 4UTWC 4WK9A 5BROA 3UWEA 4IIDA 3H6OA 3MWAA 1ICQA 4DLFA 3NVDA 4DBEA 4RE4A 2W63A 3HQPA 4AMAA 3LI0A 1ZQ5A 4ZCWA 3IVSA 5KFDA 3MUY1 4K8GA 1VFTA 3OSNA 4LUTA 3QMSA 2PBGA 3GFYA 1H3GA 4O3QA 3GY1A 1WX0A 2PGWA 2UY3A 1JPIA 5DT5A 3H4DA 5KFOA 5A6KA 3N29A 1N8FA 3ARTA 3DOPA 2NVCA 2FFIA 3BAXA 1X97A 2J7EA 5A3HA 3GXIA 3GAKA 3MMDA 4AIUA 1EQCA 4RJEA 1KXTA 1TSIA 2ABBA 2Z1SA 4LSBA 4C1KA 5CGQA 4Q8TA 2UY2A 3CO8A 2OT1A 1HJVA 3ARSA 3R0DA 2A85A 3FA3A 3OHAA 4UR9A 4NY2A 2X8RA 3KS6A 5L9FA 1QVBA 3GHUA 3RNDA 4GH1A 1V6TA 1EQPA 3QN3A 4DWSD 4Q6JA 3WJYA 2YXGA 4ZBCA 3WK0A 3CHFA 3N2XA 4LY4A 2XSAA 2C0AA 5KFGA 3WQEA 5A6BA 3RJYA 3V0SA 3M9YA 2BMBA 4BR1A 5BOEA 4L1WA 5TF0A 1XG3A 1TUFA 1R2TA 2G96A 5E09A 1E15A 3UG3A 3WK3A 1YXDA 3KLKA 4IQDA 3MDUA 4F0SA 5CLWA 1VIZA 1EX1A 1SZEA 1J0ZA 3EKZA 3UG4A 5KFBA 3P84A 2VWSA 1OBAA 3I6EA 4XQ6A 3QQ0A 3WFZA 3NOYA 1DE5A 4CQAA 1UA3A 4FOKA 3LGDA 4TV5A 2PF0A 1ONXA 4H9ZA 3DDMA 4DNHA 1NQKA 1JIHA 5LNUA 5CBBA 1UD6A 3VZZA 4H9MA 3E0WA 4HK7A 4XKMA 1EJTC 1VGAA 4W7WA 4A21A 4C6QA 4DM2A 2G3NA 3EPOA 3HIJA 3TCSA 3CAWA 5KT6A 3DI1A 3DBPA 1OFAA 3HPAA 4HYWA 3AZSA 3ZIZA 2I57A 2PF8A 4QRNA 1Q45A 2PCQA 3MUCA 4J3SA 1W0MA 4BI5A 4PTVA 3GIMA 1WP6A 3NPVA 4J3XA 1P1MA 1KCLA 2DJXA 2DZSA 4ZO9A 3O05A 2HE8A 4FB7A 2Z7GA 4AXKA 5AECA 3O07A 3NQGA 4XBSA 4C7DA 1IXQA 2UVVA 2EG6A 3CUJA 3QVQA 3V35A 1GQKA 1JDAA 5EL1A 4R3UA 4F50A 1R86A 4C6FA 1S3TC 1J0KA 4IX2A 1S0NA 4PB5A 2J8FA 3GNRA 2NZLA 4HYRA 4F48A 3QQ1A 2OO0A 4O28A 1MW2A 1VEMA 3ZT6A 3NL6A 4I5RA 1SZGA 3B97A 5EMMA 5DXXA 3S5YA 2ADAA 5K7JA 4E3VA 4KS0A 3R8RA 1LDCA 1P43A 1FBAA 2F9RA 4Z2HA 1F6YA 3KTCA 3F2BA 1V02A 3F4WA 3NYZA 5A5WA 4D8LA 3RITA 4LAKA 4C5ZA 3CPRA 2A4AA 4NKCA 3KTSA 2XWEA 3CH0A 1KTNA 1VBUA 1OWQA 3FAXA 3U4FA 4IRDA 4D6CA 2P76A 1X1OA 2X2GA 5E5CA 4GIRA 2OU4A 4L4MA 2WV8A 1L6YA 3W7LA 2J66A 4GVFA 5BMXA 2XM2A 2PRHA 3OO2A 2BQ3A 2VENA 3NSMA 4MNKA 4DM1A 1W3NA 3IVUA 4OOZA 3W1PA 1FWRA 3PFRA 3CBWA 3MP3A 3QFEA 4N4QA 3T8LA 4HNTA 1E0UA 1NP0A 3G24A 3K8KA 1UPPA 3FVDA 2PTYA 4WR3A 3IGXA 3R11A 1ZBVA 1AZ2A 3CJPA 2V67A 3QPYA 2G3MA 3AUJA 3V3WA 3VKCA 4RR4A 4DJDC 1W1IE 3UU0A 3H55A 3VMPA 3W7HA 4XZBA 2VDIA 3MJMA 2VXNA 1S1RA 2NQLA 5BXTA 1XRVA 4AISA 5EWEA 4DJFD 1WKYA 4Q33A 1XI3A 4DL2A 1G0CA 1IEXA 3R79A 1V5XA 5D30A 5K2ZA 3MUZ1 4NSBA 4WXZA 1WKDA 4HBKA 3G8EA 1T40A 2CKSA 3OEXA 4UQ9A 3USBA 2V6AA 4WJEA 2QDDA 1QI4A 3G1HA 1XQLA 2PDKA 2QAFA 3UNTA 5MKGB 1B1YA 2BV9A 3NO3A 4O11A 3BLKA 1KM0A 3AIEA 3GNPA 5DXYA 3OZPA 3CV2A 3NUKA 4Z1BA 4L4PA 4U31A 3L0KA 4KRUA 3FDSA 3A13A 4XX6A 3VABA 4JX5A 2Y63A 1GPWA 4Y90A 1DEDA 2FJKA 2QR6A 5C7HA 4ROQA 1SMAA 1UBSA 1TVNA 5D9MA 2Z6JA 3N2BA 3SCRA 3C2EA 5CJMA 3WL1A 3U2ZA 1VENA 3ATYA 1SGJA 1TJ0A 3TQ1A 1QTWA 1NWUA 1AQHA 2OB3A 3PUGA 2OEKA 1H7RA 1S39A 3G2GA 3BQ2A 1C8YA 1GVIA 2PDFA 1XLHA 4UNKA 4GKLA 3KDNA 4O3NA 5FA5A 3BQ5A 1QCWA 3GWQA 1WE5A 3TWAA 3AXMA 5MHBA 5KT7A 4H2HA 4FK9A 2WJFA 5AZ1A 3W2JA 2C19A 4PTXA 1GCYA 5IBXC 1OG0A 4HZ8A 3P0WA 4EK7A 5T9CE 4WKHA 3GZAA 5C2XA 2V38A 1H7OA 3IIPA 1UKTA 3PZNA 5LNWA 4PC8A 2EG7A 1GOWA 1XRTA 5DMYA 1ODUA 3TYEA 3WJWA 1OX5A 5KINA 1W9XA 2Z29A 2YA1A 3XINA 5KFVA 3CWNA 1ONEA 1RR2A 2DZUA 1XV8A 1AA1B 1KFJA 2ASHA 2OTDA 2QT3A 1ZJBA 1XSIA 5BCAA 1GTHA 3QV6A 1G4TA 4ENLA 3TYUA 2NWSA 1XGZA 4JX4A 3NWRA 1VP5A 3M7WA 4MLJA 4PMUA 3W2NA 4H9UA 2F2HA 4RNFA 3P14A 1LJYA 4MJ4A 2VDHA 3L21A 1NWRA 3FXYA 3TONA 1A5CA 3TJ4A 2WSRA 4UMCA 3W53A 4XZWA 3HF3A 4KCVA 4ADUA 2NQ5A 3IGHX 3WQOA 1GUVA 5FEWA 5A94A 4J9QA 1EEXA 3W3OA 1TB3A 3ENLA 4ZQOA 3N6QA 3NNTA 1H61A 5H8UA 4EKJA 1EIXA 4UMAA 1CXIA 1ZPTA 1HVQA 2AGQA 1V6WA 4Z08A 3IJIA 4CNTA 1TTJA 4Z1YA 3N4AA 1KV8A 2V5JA 1DQXA 1J5TA 1E9IA 1XLFA 1E56A 1KM3A 3OG3A 5JUMA 3EB3A 5D2YA 2QGYA 2PGEA 5M03A 3GU2A 3ZLGA 1LBFA 1F6KA 1PHWA 4D6JA 4DYEA 2YW4A 1J9YA 4DL6A 1TV3A 4NZ1A 1FY6A 4EXQA 5KT4A 1ZCCA 1EGZA 1BVWA 1YPIA 1GVOA 1LBMA 1J6PA 4Y2WA 1KW1A 1TPB1 1I2OA 4F2TA 2WAGA 1GORA 2PDYA 5AHLA 1ECQA 2PLMA 4HK6A 4HYVA 3F4NA 1KWGA 3T08A 3ICJA 2ZVIA 1DORA 1WA3A 2E67A 1KFEA 4S3FA 3S1UA 4XIMA 1XF0A 1UHVA 3S8HA 3W7GA 4CGTA 5HR7A 3M0XA 3T07A 4HA0A 1EP2A 5EKYA 3C56A 2GGEA 4I5XA 1RYSA 1SJBA 3ITOA 3HG2A 2FPTA 4DWSA 2I56A 1LQ2A 3FEMA 3BWWA 2ZRZA 1MEIA 4UTKA 3UG8A 3TN5A 5HXMA 1PX8A 3U9IA 4PRWA 2WM1A 4PTNA 3GVVA 4LJ3A 5DT7A 3WEZA 2AOSA 3OG2A 1E1CB 2XIOA 1US3A 1GKRA 3WLNA 4OBSA 2WBGA 1RD6A 4C5YA 4PYSA 5EFFA 1C7TA 4ORIA 3UXDA 5HINA 2CCRA 3W27A 3H7UA 1W9BM 1VBHA 4OV9A 3NPXA 1P4CA 4ECTA 2G3FA 2E7FA 2XG9A 3QZAA 3ZO9A 3AMGA 3UXLA 3SSZA 4NQ1A 3ZJ6A 4DNMA 3QR3A 4NI3A 5JH1A 3RRXA 2W5FA 4FIRA 4LOCA 1XWYA 1RSCA 5M17A 3W7QA 5LKYA 2G3JA 1EZWA 3SRKA 2F6UA 3THQA 2VNCA 1KBLA 1QPKA 3FJ6A 1WZAA 1JUEA 1WXZA 5EFDA 4I8DA 5CG7A 2DIJA 2PPGA 2W0UA 3EWXA 5JBEA 1XRFA 3TROA 3PR4A 1JDFA 5KFRA 4HSNA 2V5CA 2Y8VA 3BICA 5I79A 4RLIA 1KWKA 3SFWA 3PG9A 1CZ1A 4CD8A 2A3CA 1K6WA 1QI3A 1W37A 1XDMA 2W9AA 1DIEA 4GLEA 1T94A 3AXIA 3RGTA 2YL5A 3WNLA 2XIQA 2X1IA 4E8DA 4ICCX 4AZBA 1A4MA 2R91A 2ALDA 3URQA 1TKKA 1GZJA 5D8ZA 4MADA 3PPGA 5KG4A 4Z0JA 1JZ3A 1VIWA 5I09A 2POZA 4OBTA 3UVIA 2IXVA 1S5VA 1U1JA 3ITCA 5KFPA 2C8NA 4Q8FA 3C2VA 2W3ZA 3H8AA 1GQNA 1EIBA 1H1YA 4XG1A 1H7NA 3PBYA 3L0NA 3CHEA 1V0LA 4K39A 3H7VA 1I45A 1ZU8A 4FMVA 5GJMA 1UPMB 4HHHA 4IH3A 2PEVA 2ZRWA 3PW7A 4NXKA 4JHOA 3F4CA 1EZ2A 5AHNA 1JULA 4DWDA 1A3WA 1M6JA 3SCQA 4K6AA 4C6KA 4ZQRA 3LCLA 5F4WA 3QYQA 3TNOA 2C3ZA 4GO9A 2E1WA 3ELFA 4E4PA 4MKSA 5G4EA 4G5DA 2A6NA 4HJFA 2ATSA 2VT0A 3VNIA 3R94A 2AAAA 3RM9A 3URBA 3UR7A 2R94A 3WBWA 2PDCA 4DO6A 3MY9A 2QUVA 3VD5A 3GV8B 2DZBA 3VIFA 3OGRA 3GDRA 1YX1A 2POTA 5I3HA 3UETA 5A8NA 1E5JA 3LNMA 3PTQA 1EGVA 4O4WA 1W8GA 2RKXA 4OUIA 3Q58A 1VYPX 2GWGA 3MVTA 4C6NA 2EPKX 1SFSA 4PGLA 1S2WA 1A5LC 3TNBA 2ZZ3A 4DJFA 4DBSA 3C5QA 1XIMA 4IG2B 3TYZA 5GQBA 2DV0A 3TCEA 5A8QA 2TYSA 3WELA 3P80A 5E93A 3NPWA 1RQBA 3CZKA 3QXBA 4N6EA 3SY1A 3LA4A 1KTBA 1SJCA 1TPUA 4Z2GA 2BB0A 4B9ZA 1TWIA 3ABOA 3VOCA 4OU1A 2Q6ZA 4J9MA 1DHPA 3K1DA 3LV5A 2OZ8A 3AZTA 4GZEA 1LRNA 2ACRA 4AEFA 1OC7A 2CC0A 3NO5A 2OEMA 1AMYA 1XHGA 3VO0A 1AH4A 3DESA 3EDKA 4ECWA 3MP4A 1XLCA 1RAKA 4H1ZA 4JAWA 3OSPA 4AZCA 1AVAA 3W1UA 2XFWA 4YVXA 4AD5A 2OLAA 3C0QA 1F2JA 3BXWA 3A23A 3CUGA 4EAMA 4Q8WA 3PK7A 2EJAA 3ME3A 3ZSSA 4ORMA 1RZMA 1JZ5A 4JTGA 3B40A 4US5D 1UROA 4GMEA 4XKYB 3A12A 4MYAA 1XLAA 3S2LA 2XHYA 1S9FA 3CIXA 3ARZA 4IIFA 5C54A 4GYPA 4C1LA 3RBDA 1B9BA 3M9OB 4HHMA 2VX6A 2FVMA 3OVQA 3TJIA 4TU1A 2Z24A 5E70A 8XIMA 3LRMA 4QLKA 4HZMA 5HWNA 3BJYA 4PUKA 2GZXA 1BTMA 1FCBA 3W76A 1MMFA 4HP5A 4Q45A 1IWAA 4RDYA 2ZCGA 1HIZA 3L2IA 3AO0A 4Q4RA 3LQLA 1BYAA 2QEZA 1DJWA 4MPQA 3CQJA 3O6AA 3LPGA 4ZO6A 3BL3A 2OO6A 4U6PA 4J9JA 4W5ZA 2NT0A 4EIVA 2QZRA 3VCNA 5JU6A 1OABA 3URNA 3PR2A 2PDJA 1JYXA 1HKMA 4UB9A 5M2FX 1P0NA 5EWGA 2PWFA 1ADDA 3LERA 3M0IA 1GQJA 4DI9A 3IAQA 1DP0A 4DN1A 4Y9AA 5EY5A 1E9YB 3F03K 3DHUA 3NL3A 5C0QA 5DQIA 3NDYA 3ITGA 4UTJA 5G1MA 3TZNA 1QFEA 2Z1BA 1QASA 4M81A 4D2JA 1AH3A 5D8WA 4AW7A 4KGJA 4EYHB 1KRBC 2C28A 2C15A 3AHZA 2OQYA 2WVVA 2HZGA 4TTUA 4IGMA 1ISXA 1O66A 5F9NA 2BODX 5ABFA 1X7FA 1TPFA 2YXXA 5EMJA 1U1HA 3AHXA 1GONA 5HA7A 2HEJA 4MFEA 1T99A 3LBCA 4K1GA 5HMSA 2GGJA 4L1XA 1TPH1 1GVEA 4MB3A 4A3QA 5JXQA 3DBNA 1PIFA 4ZTXA 3V6HA 3APGA 3BMWA 1JNEA 3FVMA 1E9LA 2WCGA 1V3LA 1UASA 2QF7A 4AH7A 3QTGA 2PWGA 3DH7A 4QWBA 3JW7A 3DGBA 5K3VA 2PTDA 3W1QA 1E0TA 1OX6A 4UQDA 2ANUA 5D05A 2WZIA 1UIPA 2I7GA 2OVLA 4FNQA 3ARUA 5J8LA 4L1GA 4DL5A 1V3KA 1VKFA 3PR5B 4MAZA 3E96A 4GGBA 4XV0A 1PWLA 4PB4A 4O1DA 3KHGA 1HL9A 1UUQA 2GSJA 3R8HA 3SURA 3VM7A 5KFYA 3FEQA 1X6UA 4O1BA 2WNWA 5AVHA 4K1WA 1VHNA 3IEBA 4L9ZA 1XLMA 3C3NA 4FR1A 3HGRA 1M53A 1OSEA 4TX9A 2W79A 7PTDA 2Z0IA 4MUZA 3SUWA 5FJOA 3E1F1 4GXPA 1L0PA 3GC2A 5LHEA 1BVNP 3W7OA 3JU2A 4XBKA 4PEEA 3FS2A 3NGDA 3LPPA 1V93A 1GZGA 4AWEA 3TC6A 5HQMA 1QPNA 3M07A 4JFTA 1EA0A 1OFRA 1E4NA 3GKAA 4KRZA 3THUA 1QNPA 4UZSA 3AMCA 4UTMA 4H6RA 4KH2A 4GC3A 4NRSA 4ICMA 4R88A 5L1JA 1TMLA 2FB2A 4R5EA 3D47A 3IIZA 4X22A 1T7LA 2R8HA 5FSDC 3CPUA 4Q4PA 4K7VA 4LUSA 5KG7A 2XGPA 3ONBA 2BR0A 3RDKA 4FOUA 3I68A 3A5VA 4JV1A 3P8JA 2AL2B 5DCDA 3T44A 3IUDA 3N14A 1RBAA 5LZLA 2WLZA 4BKNA 1FWHC 4EXBA 3LU2A 1W5QA 4L65A 3D3FA 5IDIA 1Z89A 5A2CA 3T0TA 4HZ6A 4EVZA 5ABHA 1NOWA 4ZO8A 4R53A 1XIJA 6XIMA 4Q8OA 4WGXA 4ZOCA 3BLIA 3ZWTA 3AIBA 1WO2A 1GW1A 3LD5A 1CWYA 2HNEA 3QZ7A 5G1YA 3EA1A 2VEFA 4H9YA 4UTWA 1QR7A 1XBYA 5KFQA 3PWGA 5BRQA 2XH2A 1GZ1A 4F0MA 4FS1A 2QIIA 3LHTA 1IT8A 2HPMA 1B5TA 3R13A 1NJJA 4JTIA 4YL2A 4ZOAA 3WNPA 4WY0B 2A6LA 2DT1A 3B03A 3NQ7A 3PB0A 3O2LA 3TFCA 5KT2A 3NG3A 4PFHA 1K4GA 4JTUA 1YXYA 3W26A 3UZYA 1XIGA 2C13A 1PS9A 3UJ2A 1M3UA 3EA3A 4YCPA 1A53A 4LC6A 5GVJA 2QCNA 3A5FA 4ILSA 1OYCA 1EO7A 4Q8VA 4BWLC 4L61A 4PMYA 2VFHA 3UWQA 4OGZA 3S1GA 2CU0A 3MSDA 2XH4A 2YBVA 1U5JA 4OJYA 2ZADA 4E8GA 1LOSA 4LUYA 4GOAA 4DZAA 2ZX7A 5IM51 3NGFA 2XVPA 2PLJA 4CQCA 4KT2A 4H19A 2FKPA 3UJSA 4V33A 3I6TA 1EPVA 4IP7A 1V6UA 2W67A 1XLKA 3OW1A 4G7FA 4LEFA 2FVKA 3T55A 2I1OA 1K7FA 3SSJA 1IXPA 1W5MA 3RR1A 4C6CA 4F79A 1QOXA 4CEXC 3AWNA 3L68A 3G0XA 1W56A 3N6HA 4Y8EA 1QK0A 2QCHA 5TAOA 4LPCA 3R89A 1R87A 4KWSA 3CMGA 4JL1A 4LY8A 2AQVA 3IJDA 4N02A 3R5EA 4B9YA 2FZMA 2YR1A 3NFUA 1DWIM 1LL6A 2QDGA 5CPSA 5AC4A 1O12A 1VAHA 3LTSA 2WYSA 2OG9A 4S3EA 5CZKA 3GBDA 2A3HA 2IMWP 5TNVA 1IXOA 1EUAA 3PTKA 5IHRA 4US5A 4I90A 3NQVA 4ECZA 4IPJA 1VFLA 3F1QA 3LBOA 2D22A 2XGIA 4Q7IA 3MHFA 4TQTA 3SCSA 5LIYX 1VPYA 3QSTA 4YVVA 5C8BB 2A7PA 3DKJA 3TQPA 4D6EA 1R3VA 4MKNA 2W9BB 3SIZA 1TX0A 3HJEA 3N2CA 2AU0A 3NDOA 2PWEA 3G5EA 5JVLA 1AW2A 5K9CA 1QW8A 1X38A 1EDQA 4NLGA 4O10A 1VC4A 3T0DA 2OYLA 1F05A 4CD4A 1CGUA 1EPXA 4XBJA 1AK5A 5KMYA 1AL7A 1VEOA 3KWSA 2E5DA 3UXIA 4B5VA 4HNOA 2G4FA 2E9MA 3TVAA 1TTQA 5FKYA 4KERA 4MNMA 3TU9A 4ED6A 2A7RA 4QE1A 3BCDA 2Z1XA 1RQEA 2EGZA 3KHJA 1TJPA 4GYKA 4HNNA 4OHQA 1D3GA 2BXVA 1RY0A 2BGSA 5CBIA 4EF9A 1BF6A 4WCJA 3MQTA 3TV8A 3WLMA 2OWWA 3MI2A 1KQYA 3ITYA 1Q65A 4JHMA 2WZTA 1J10A 1TWDA 4HHPA 3KP1A 1NFGA 5D9PA 4L6OA 2GDVA 4TX6A 4XAZA 3REQB 2RAGA 3LV6A 1VHCA 2MANA 3OYXA 5D38A 4M29A 3DECA 2VCBA 3ORWA 4QCEA 2V69A 3PAOA 4GNJA 4PMXA 3WY1A 1A0EA 4O1FA 5KFLA 1S2VA 3V1HA 2V2DA 3WDJA 2GUUA 3PSVA 3TKFA 3P81A 1LLZA 3SRDA 4Q32A 5HNNA 3PNZA 1NQ6A 3GKFA 3CUFA 3TFXA 3WDPP 3LZ5A 1R2RA 2GK1A 3EOSA 4C1NB 1AMKA 2WOQA 4GQGA 4PZVA 2DJLA 2PDLA 2CHOA 4FALA 1XIHA 1ECEA 3MR2A 3LNPA 3U7BA 5KFCA 1PX4A 4XO6A 3UZ5A 3WD1A 2Y89A 5D2XA 4YVPA 1TVPA 5JH2A 1H09A 3LK6A 1HTIA 4OVXA 1W1PA 3CIWA 4G8TA 1YTDA 2AGKA 4R8UB 1LORA 1U22A 2CBIA 4GQ0A 2WVUA 2D69A 3TW6A 3BW3A 4IPLA 4TR9A 1P6CA 1B0IA 3M44A 2OGJA 1CXEA 4XD3A 5BMWA 3CQIA 4JTKA 4JBRA 3AOFA 3H2CA 4RV3A 2NVDA 2V68A 4YR2A 4LQ1A 1EGMA 1Z3NA 4MWAE 4XISA 1EOMA 1GVSA 1JZ8A 3W84A 1FDJA 1NDYA 4N42A 2IKJA 1LQ0A 4I9JA 5L9XA 3LGEA 4O3PA 4FAMA