1GKQA

D-hydantoinase (dihydropyrimidinase) from thermus sp. in space group p212121
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
458
structure length
457
Chain Sequence
PLLIKNGEIITADSRYKADIYAEGETITRIGQNLEAPPGTEVIDATGKYVFPGFIDPHVHIYLPFMATFAKDTHETGSKAALMGGTTTYIEMCCPSRNDDALEGYQLWKSKAEGNSYCDYTFHMAVSKFDEKTEGQLREIVADGISSFIFLSYKNFFGVDDGEMYQTLRLAKELGVIVTAHCENAELVGRLQQKLLSEGKTGPEWHEPSRPEAVEAEGTARFATFLETTGATGYVVHLSCKPALDAAMAAKARGVPIYIESVIPHFLLDKTYAERGGVEAMKYIMSPPLRDKRNQKVLWDALAQGFIDTVGTDHCPFDTEQKLLGKEAFTAIPNGIPAIEDRVNLLYTYGVSRGRLDIHRFVDAASTKAAKLFGLFPRKGTIAVGSDADLVVYDPQYRGTISVKTQHVNNDYNGFEGFEIDGRPSVVTVRGKVAVRDGQFVGEKGWGKLLRREPMYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HYDANTOINASE
publication title X-Ray Structure of a Dihydropyrimidinase from Thermus Sp. At 1.3 A Resolution
pubmed doi rcsb
source organism Thermus sp.
molecule tags Hydrolase
total genus 185
structure length 457
sequence length 458
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.2: Dihydropyrimidinase.
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1gkqA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1gkqA02
1EF2A 4QTGA 3HPAA 2Z4GA 3OU8A 4XAGA 4ERIA 1RAKA 4C6NA 2KAUC 3RN6A 2WJEA 2FTWA 3N2CA 2Q01A 3MVTA 4DI9A 1EJSC 3LY0A 4LCSA 3OJGA 5E5CA 1R9YA 1FWBC 2WJDA 1RA0A 3WZ0E 1GKPA 1IE7C 3CJPA 1YRRA 3QGKC 3F2CA 4LEFA 4DNMA 4IG2B 4C60A 4IFKA 1YNYA 1K1DA 4XD6A 4IGMA 3SO7A 4DI8A 4H9YA 3EWCA 4AQLA 3K2GA 1J5SA 3OODA 2Z7GA 1EJRC 3GGMA 2F6KA 3B0XA 3ITCA 2UBPC 1XGEA 1A5NC 4M51A 1POJA 2PGFA 1FWJC 1ITQA 3QY7A 4B92A 4WVXA 1NDYA 4IQJA 3A3WA 4KESA 4HK5A 1GKRA 3F4CA 3D6NA 4J2MA 3LNPA 3GTHA 1P6CA 1HZYA 1P6BA 1W1IE 2PLMA 2R1NA 4LALA 4DZHA 1I0DA 3NEHA 4CEXC 4LAKA 4IF2A 2ICSA 4PCNA 1POKA 1NDVA 4GOAA 3GTFA 1KRCC 1KRMA 2I9UA 4KEUA 3F4DA 3URNA 2DVTA 4GYFA 4RDVA 4HJWA 1XRFA 4XD5A 2AMXA 1RK6A 4LAOA 4CQCA 3A3XA 2Z25A 2Y1HA 5FSDC 2PGRA 3R0DA 3UPMA 1A5OC 1FKWA 4GY1A 4CNUA 4F0SA 3PNZA 4F0LA 2Z27A 4DZIA 2OQLA 3UF9A 2D2JA 4BJHA 4L6DA 1ZZMA 4C5ZA 4B3ZA 4H00A 2A3LA 4GK8A 3G77A 1M65A 3A4JA 4DYKA 4EPDC 2GWNA 4C6KA 1J6PA 3S2LA 1E9ZB 3PANA 3KM8A 5FSEC 4IFRA 3HM7A 3GTIA 4JOMA 2VHLA 2DVXA 2YB1A 4PBEA 2Z29A 4KEZA 2RAGA 3S2JA 1WXYA 2R1MA 2I5GA 1EZ2A 3LGDA 4XAYA 4GX8A 3GU1A 2D2GA 4C6LA 4DO7A 2PAJA 1FWFC 3E0LA 4CQBA 3GIPA 3IV8A 4IFKB 1K70A 4KF1A 1O12A 3LU2A 2WJFA 4ERAA 3BE7A 3B40A 1R9ZA 3K5XA 3TN6A 4CNSA 1BF6A 4C6JA 4KEVA 1KRAC 3B0YA 4C6BA 3F2BA 3E0FA 2AQOA 3MVIA 2ZC1A 4C6QA 1M68A 1UBPC 1J6OA 4DIAA 4HK7A 3MTWA 3IJ6A 4KERA 3WYZA 1UIPA 3LSBA 1EJUC 1YBQA 4V1YA 1EYWA 3E74A 3PNUA 4HK6A 4C6FA 3URQA 4LAMA 4ZSUA 4NP7A 3WMLA 4C6IA 1RK5A 2OB3A 1I0BA 5LXXA 4CQDA 3O7UA 3AU6A 5HMFA 3CS2A 4MUPA 3K4WA 3FDGA 4XD3A 3F2DA 1J79A 1QXLA 1EJVC 3SFWA 3GU9A 1KCXA 3LSCA 2HQAA 4H9TA 1DPMA 1RJQA 4XD4A 3QGAC 3URBA 1EJTC 3O0FA 1A5LC 3V7PA 4RDZA 1NFGA 1UMLA 3URAA 4DLFA 1EJWC 4QROA 4QS5A 4QSFA 2EG6A 4RDWA 1V7AA 3OQEA 1S3TC 4EPKA 1UIOA 2HPMA 4H9ZA 4RDYA 4HA0A 5AKQA 4UBPC 1ADDA 2O4QA 2VR2A 4R88A 3GIQA 3QY6A 3IACA 1NDZA 4LCQA 1FWHC 4R7WA 4G7EA 3MPGA 4V1XA 2Z2BA 2P9BA 1FWDC 2HNHA 2GWGA 1JGMA 2QPXA 2OODA 4XAFA 4ZSTA 3DCPA 1KRBC 3S2NA 1EJXC 4KIRA 2YXOA 1XWYA 3T81A 4C65A 1XRTA 1RA5A 4C6OA 2G3FA 4CEUC 2P53A 1GKQA 1E9YB 3UR2A 4UB9A 4EPEC 5CH9A 2GSEA 1K6WA 2P50A 3AU2A 4GXWA 1FWCC 2PUZA 3QY8A 3HTWA 2VUNA 3GUWA 4NG3A 3ORWA 1FWAC 4H9VA 4GC3A 3IGHX 3TN4A 3EWDA 4R85A 3IRSA 3MDUA 1PO9A 1VFLA 2CZVA 1FWEC 1R9XA 4KETA 2IMRA 1YBQB 5HMEA 3RYSA 4H9MA 2W9MA 4H9XA 3MSRA 4PE8A 4H01A 4LH8A 3EGJA 1RJPA 4YIWA 2EG7A 3E2VA 2R1LA 4GZ7A 4IFOA 4ICMA 1FWGC 3OVGA 2QT3A 4C6CA 4C6PA 3C86A 2ADAA 2BGNE 2E25A 3E38A 2O4MA 4C6EA 2Q09A 3GTXA 3IPWA 3TN5A 4GBDA 3S2MA 3T1GA 4BY3A 5G4HC 2VC5A 3OOQA 3E3HA 1A4MA 3NQBA 4PCPA 2YB4A 1FKXA 2WM1A 1PB0A 1O5RA 3UBPC 4LANA 4C6DA 4B91A 4AC7C 2BB0A 4G2DA 3ISIX 3UR5A 2YZ5A 4OFCA 3MJMA 1ITUA 3ID7A 1QW7A 1A5MC 4GY7A 2OGJA 3PBMA 4J5NA 2R1KA 2HPIA 1YIXA 4B90A 4ERGA 2VC7A 2XIOA 4BKNA 3ICJA 4Z42C 4EPBC 3AUOA 4GX9A 4GY0A 4G7EB 2Z24A 1M7JA 3LS9A 4LFYA 3FDKA 4RZBA 4IG2A 3S4TA 2HBXA 2Z26A 1V77A 1FWIC 4E3TA 4J35A 2EG8A 2Z28A 3RHGA 2UZ9A 2VM8A 1ONXA 4L9XA 2Z00A 3GG7A 3T8LA 2FVKA 3LGGA 4C6MA 3JZEA 1RJRA 3FEQA 1V4YA 2D2HA 4I6VA 4QRNA 4QS6A 2FTYA 3GRIA 4NI8A 4WGXA 4INFA 2FVMA 4IH3A 1A4LA 1WXZA 2QVNA 4F0RA 2GOKA 2GZXA 1NDWA 2Z2AA 4P5UA 1A5KC 1ONWA 1PTAA 3DUGA 3MDWA 3LA4A 2ANUA 3MKVA 5A6TC 4XAZA 4I6KA 3PAOA 4RE0A 4TQTA 3GU2A 1V51A 3TN3A 4PBFA 2QS8A 3RCMA 5HMDA 2R1PA 4WHBA 4DLMA 1YMYA 4CNTA 4H9UA 2FFIA 1P1MA 4C5YA 2OOFA 4LCRA 1V79A 4D8LA 3CAKA 4KQNA 3NURA 2DVUA 3TNBA 3IARA 3DC8A 2AQVA 2HBVA 1PSCA 4EP8C 4IGNA 2E1WA
chains in the Genus database with same CATH superfamily
1NELA 5F2GA 2QNEA 4B2DD 3THQA 2VR4A 4WDUA 4PUNA 4O57A 3WLPA 3BICA 3L5AA 4CNNA 3N2CA 1RLCL 4UTLA 3LPPA 1EJSC 1B4EA 4NX0A 3AIUA 1F8MA 2Y70A 5KINA 3IAQA 3WH9A 3CHVA 2GYIA 3OG2A 1UZ4A 4R7OA 1BKHA 3W0KA 4IG2B 3L2LA 4O10A 2JKPA 2G5WA 4DI8A 3WDQA 3PUOA 4KRTA 4G7FA 2ZZ2A 1V02A 1TMQA 4WEVX 4IXHA 2E8YA 5I79A 4H8NA 4HOXA 3O9NA 2B7OA 2PWUA 4JN7A 1H7WA 3LQGA 3VOJA 4O28A 1Z41A 1UR1A 3THDA 4WVXA 3E1F1 1E1EA 2PBOA 3UGVA 5TAOA 1NIUA 3VGHA 4GACA 3AAMA 3CZJA 5ECVA 4MNJA 2O55A 2OWXA 3LOTA 6XIMA 1UUQA 3WENA 4DXXA 3AWOA 3VFLA 2V4RA 1JPKA 3VD5A 1PUDA 2E7FA 2Y63A 3WK3A 1VBJA 1AJ2A 2QF7A 3H7VA 3NQ6A 4NZ1A 2QCDA 1X98A 2VEGA 4PSPA 1K9DA 1SYTA 4NNAA 4CNUA 2OQLA 2EPLX 4CVUA 2J74A 3LENA 3AOFA 2TPSA 5KZMA 2WSPA 3RJYA 1US0A 5AYYA 1N56A 4O19A 2RH9A 2DW6A 1I2PA 1XM3A 1DHPA 1AH4A 5CAHA 2DH3A 1WYIA 3N4FA 4Q32A 2QCLA 1E6RA 1EXPA 4O3QA 3OTRA 1IZKA 4S23A 4FZIA 1MXSA 5M1TA 1EYEA 4PUJA 2DSWA 2UY5A 3WNLA 4AEEA 1AH3A 3UERA 3P5YA 4NAFA 4NZJA 3EOSA 4CU8A 3LLDA 2WCAA 5C5YA 3P62A 1OZQA 2XIQA 3L2MA 5CPTA 1PBGA 3FHQA 7REQA 5A8QA 4ZB2A 4W7WA 4E38A 3KHGA 2BR0A 3RMJA 1OCQA 3N2TA 4DQWA 2R24A 3RPMA 3ARVA 4QE4A 3KWXA 3S5YA 4P7RA 5JIPA 4FA3A 4I8DA 3WMLA 3RLUA 1LBFA 3IUIA 3KCOA 4UTFA 3BQ6A 1L2UA 5F2IA 5I3JA 2YBTA 3O7UA 1FFRA 3NL6A 5HMFA 4MUPA 2HXTA 1QW9A 2UVRA 1QNPA 5K9XA 3IAPA 4IJRA 5IBXC 2C6QA 1RALA 5TD4A 2TMDA 3E6EA 3RK8A 1Y5WA 3W7DA 1ZRQA 1MUWA 3CIWA 3L4YA 1EC8A 1UWIA 4F4XA 4AWUA 5D4YA 1BKSA 4OIFA 3AXIA 3T08A 1XGZA 3FAXA 3O63A 5FEXA 4N0RA 2PDPA 1J11A 3UZYA 3PB0A 1T99A 3TFCA 3TYAA 3RU8X 3UY7A 4LUIA 4QLJA 4LCQA 3VIKA 1NQ6A 1ESWA 3N19B 3MMTA 1KA9F 3TQ1A 1UR2A 1OFEA 2C1HA 1P7TA 1C8XA 1I8JA 1KNWA 3QHMA 1WDDA 2QYGA 2ZX5A 3VGEA 3VNYA 4NLGA 4JYEA 1H0IA 2CHOA 1IWAA 4IQDA 3ZR6A 4AFYA 3WQ5A 3BSGA 2XGZA 3FLUA 2B31A 3K1GA 1BPLB 1OT2A 1AL7A 4GC3A 3VYLA 2GDVA 1PO9A 3PZ9A 1VFLA 4AZ7A 1FWEC 3AALA 2J6UA 1O1ZA 1FXPA 3EDFA 2PCEA 4R5EA 1UKOA 1R3QA 1ISZA 3N4EA 2XH0A 1DYSA 3Q58A 4WUIA 3WLIA 1B5TA 3H2EA 3BCFA 2D69A 1JPMA 3V18A 3D3AA 5G4HC 4WR3A 1E70M 2XISA 3E3HA 1A4MA 4PCPA 2Q8XA 3GV8B 2A5HA 3NL2A 3NYZA 3KBWA 4LYKA 1RZMA 4QJ5B 1NP0A 2ZZ7A 3VZYA 4FXRA 4G3IA 4JZ5A 1ITUA 2GVGA 1QW7A 3U4AA 4JXCA 1XLLA 1P5BA 5L1LA 1YIXA 2G96A 6ENLA 3HGSA 1VBRA 1G1YA 3AZTA 3W7GA 1VFFA 3M16A 1PKNA 1O1HA 2DFAA 4JTTA 3E2SA 1IYXA 3THCA 2GVYA 3MI3A 1J9YA 3BXWA 1N8IA 1JYXA 2PWHA 3L9CA 3WL0A 4TX9A 3PZTA 2ATMA 1EF3A 1G7UA 1RJRA 3FEQA 1ZAIA 2O9TA 5HJLA 4RNOA 3B05A 1V02E 3EOLA 1IQ8A 3C61A 5I3DA 1A4LA 1WXZA 4IP7A 3V75A 1KCZA 1KGUA 1XR2A 4GUIA 5I3GA 2J4GA 4ED6A 1TV2A 3MKKA 5CXPA 4LUTB 1T40A 2F6XA 2R8WA 4JD4A 3JR2A 3ARZA 1Q6GA 4ED0A 3W7QA 2WZHA 3GXDA 4FIRA 3ZJ8A 1J0YA 1A3HA 3LV5A 4EBCA 3PZIA 5FEZA 1LL6A 1K9FA 3VCCA 1K7EA 3K30A 1TJ0A 1GYNA 1RHCA 3OO2A 4S3KA 3ARRA 1A50A 4Q22A 3J7HA 4YTTA 5EWEA 4H3DA 5FEWA 3LTYA 2A4AA 4JIEA 3R0UA 2DSZA 5HDRA 2ZX8A 4RX0A 1ME9A 4US5A 4E4PA 2QZRA 1X7FA 1XIFA 2HCVA 2WJDA 4AU0A 5CSRA 1MW0A 3NQCA 5AC4A 1GKPA 4GQQA 2XGQA 4JQAA 3H70A 2ACSA 3W76A 1CENA 3CQ0A 3BVJA 2VUYA 4AG0A 3K2GA 1C29A 3KX6A 4W5ZA 1TV4A 2Z7GA 3LPFA 3M0MA 3W1TA 4DEFA 1ONRA 1UW9A 5KG2A 1UWSA 3DESA 1YKWA 3THUA 2QDHA 1V6WA 3IIXA 4R9OA 5IXEA 1AH0A 1DQWA 4ZZ9A 4HIBA 3UG4A 3FSUA 1PS9A 1KTCA 1OWQA 1HUVA 3TNOA 3OHMB 3FJLA 3F4CA 1FH7A 3QTPA 1ZFJA 2QW5A 3LNPA 2PDCA 1UP3A 3T2OA 2C22A 1T5AA 8RUCA 4QLKA 1S0MA 3M44A 3SB0A 1W3TA 3L12A 1K3UA 4LV4A 4MWAA 1XV8A 1JDFA 3KHJA 3F4DA 2P5NA 4X3ZA 3U57A 4Q8TA 1TIWA 2C79A 2MANA 1XBVA 2PGRA 2QCNA 3R0DA 2OT1A 1HO1A 1TTPA 3WK1A 3WBWA 4O16A 4DX3A 3PNZA 1SMAA 2PDHA 4IL0A 4F0LA 1M01A 2PDWA 3UVAA 3E5PA 4L80A 4E8CA 4XZWA 3L65A 3EX6A 3G77A 1U1UA 3R89A 2PDNA 1QWKA 1V03A 2JKAA 4UZUA 3BZGA 2CLOA 2J7HA 1LL4A 3MY9A 1I2NA 1UUOA 4LW7A 2CC0A 4RZ6A 3G1XA 3PR5B 5C71A 1KXVA 5AHFA 5A3HA 2FHBA 1H5YA 2JFEX 3R58A 3WUBA 1V7YA 1GVFA 1RVKA 2Y8UA 2VO5A 1F76A 1GQIA 4FR1A 1XH2A 4CNSA 2Y7FA 1UWQA 4PMJA 1C8QA 2J9YA 3MZNA 3SGGA 2BLEA 3PPFA 1AZ1A 1OD8A 1SM9A 3AMGA 3CEPA 2ZC1A 3TK7A 2PDIA 3E5BA 1SO5A 1MW1A 4C6QA 4LJ3A 1KBKA 5G2WA 1PIFA 3M0YA 2OCZA 1YBQA 3B04A 3DOPA 2XFRA 3NUKA 3VGFA 3AISA 1I2QA 2I57A 5A2AA 1PZ1A 1QO2A 3HV9A 3G6MA 3NQEA 3TP4A 1BEUA 4CGTA 1UR4A 1OC5A 1LBMA 3K4WA 2NQ5A 3DFPA 3W84A 1QXLA 4G9PA 2FLNA 4QIUA 4OHQA 1D8WA 2X1SA 2WZMA 3AXXA 1A5LC 5DRIA 5DBUA 4DLFA 3U8GA 1HJXA 1EWDA 3WNNA 3DKJA 3G2GA 4FXFA 1QNSA 4EXBA 4JQ1A 5H91A 5JBEA 4H9ZA 1XH0A 1BRLA 4HA0A 2Z6JA 4XTDA 1GONA 2A6LA 3LHTA 4YN5A 2PMQA 4PMDA 3ATYA 1B90A 3WF3A 4G7EA 1VF8A 2RJHA 4LF2A 3TJ4A 2O0TA 2BY3A 2O9PA 4ZSTA 4UFMA 3S2NA 4GVHA 1W2PA 2YXOA 3CO4A 4LNYA 3GW0A 2G3FA 4WSKA 1TVLA 5D8ZA 4FAMA 1W54A 3ABSA 1I75A 4RNNA 4GJIA 4W4QA 4FOKA 1RVGA 4AUBA 1OFOA 1WDQA 1FHUA 2BHUA 2CFFA 4MNKA 5AHNA 4W93A 7TIMA 4E2VA 3RX2A 2CEQA 2EBNA 1XIMA 2CBIA 4CCZA 4AZHA 3TTQA 3CQHA 3QH2A 3VIHA 3VZXA 5KG7A 4H01A 5F1UA 3EGJA 1XSKA 3VKKA 2GJXA 4G1NA 2E25A 3SCOA 3EDKA 4DPQA 3AJ7A 3SURA 1Q6RA 3HQ1A 4RPPA 2YB4A 3SDOA 1EUNA 5BU6A 2POZA 3WN6A 5KTLA 2YA1A 1B3OA 1BYBA 1JPDX 3IRDA 5KT3A 1EHNA 3NGJA 4NL1A 1E4IA 4WXZA 1W5QA 4Q7IA 3QV7A 3UCCA 3CZKA 3H4BA 4ZCWA 2ATLA 1ZCCA 3NCOA 1QI2A 2OQHA 4PL1A 1W2VA 1KXQA 1KM2A 3P14A 3L4XA 4LT9A 2YCIX 4JX4A 2VCCA 1V3KA 2QJMA 4UFIA 4S2BA 1Q4WA 2EAWA 1LUCA 2J6SA 5JBFA 3GHRA 1JPIA 3D46A 1AQMA 4NHVA 2I5QA 5HINA 4Q8WA 3RAQA 3GAKA 1DV7A 2H3DA 2OKOA 2ZX9A 1PZ0A 3LGGA 1BYCA 2X0SA 2ZUTA 3EB4A 2OPJA 5XIAA 1QOXA 3WNMA 3AXMA 4ALDA 1R3RA 1LL7A 2QUNA 2QJNA 4IMDA 3DECA 4UZSA 3FS2A 2Z2AA 3C8NA 4P5UA 5H6HA 3B0PA 4NJGA 1H7OA 4ECSA 3GDTA 4JTSA 1BG9A 2E40A 1SFSA 2BQ3A 4IMGA 3RO6A 3GFXA 3LCGA 4H04A 3KBJA 2JGYA 1TPUA 3NYDA 1I9CB 4YR2A 4MWAE 1US2A 3HN3A 8XIMA 5LIWX 4MJMA 3LG3A 4F9JA 1CXHA 2X8RA 4AMAA 5EBAA 2XIMA 3PBUA 4B9YA 2P88A 4QWDA 5T9CE 1FHDA 2ZADA 4QTGA 4YR3A 1HF6A 3NO1A 3EB2A 1D3GA 4M56A 1RAKA 3LNMA 2CW6A 3BTNA 6REQA 5M03A 4EBEA 3VOFA 1XLIA 2OZ8A 5A6LA 3DDMA 3IJ9A 1ZUAX 3TOYA 4HPHA 2VYOA 1V0KA 5AHEA 2DH2A 4F0HA 3UQNA 4O17A 1IE7C 5JUMA 1X39A 1UKPA 2OT0A 3WDJA 2WQDA 4DNMA 2DZTA 2F9RA 2ISVA 3G1HA 1EP2A 3DGRA 3W88A 3VOIA 3WQ8A 3B4YA 1J5SA 1OJXA 3E96A 5FL1A 3KUMA 3CM4A 4AIOA 3GQYA 1N82A 3RITA 3T5KA 4L1WA 3TTEA 1UZ1A 2CYGA 5E1QA 5A6BA 4AY7A 3U2EA 2EPNA 2BXVA 3I7RA 2HK1A 2J7DA 5M3WA 3V0TA 3LZ3A 1HZYA 1SQ7A 1XLFA 4JHOA 1RV8A 1W1B1 2DZXA 3H2NA 3N3MA 3RG6A 1I0DA 1J2BA 3WJXA 2V8ZA 1E4LA 1CB7B 4HMCA 4RZRA 4HHLA 3N6JA 4FF7A 3PPGA 2ICSA 3UWZA 3MFHA 4AHQA 4F8XA 4WQ6A 3LB0A 3MFIA 3B9NA 4J9PA 1RK6A 2QKFA 4KRZA 4BF7A 3OA5A 2BTMA 5I3HA 3OB8A 4YCOA 3IIVA 1W9DM 3QZ7A 1FFQA 3SM0A 2NUXA 3GX9A 4DUVA 2DJXA 3GNOA 1AMKA 3KW3A 1PDYA 1RP8A 2IKHA 2W62A 4U33A 4GK8A 3ERPA 1HKWA 4HU4A 3VMNA 1XIHA 1M65A 1YNPA 1JIBA 1CGVA 3CC1A 4IFRA 2CITA 3Q8SB 1BWVA 4ECXA 1H11A 3PTQA 1R8LA 1TMHA 4AIUA 1GQNA 3BG5A 2JEIA 4TQSA 1UMYA 3PJWA 4GX8A 1MQQA 5DBTA 4YTUA 2PCQA 2WKJA 2XZ7A 4UTJA 1E15A 1DJNA 1E1CA 2D0GA 1E5JA 3T2PA 2PLJA 4AVOA 3TMLA 1KRAC 3B0YA 5IHRA 4OECA 2TYSA 1M68A 1J6OA 1X7IA 4DIAA 3O15A 4DUOA 4W87A 5C7VA 4XUGA 1TPFA 1EJUC 1JI2A 1U2YA 1JD9A 1CNVA 3F4WA 3E12A 5KZDA 2GUYA 2V5DA 4HMNA 3M5YA 4C6FA 2QJGA 4L1XA 1HKIA 4J2PA 1PWLA 1TV5A 3II1A 4D6FA 3WNKA 3G0XA 4BQ2A 3FDSA 4XV0A 3KTCA 3GU9A 5MF5A 2HQAA 3ARQA 2A3HA 3SUTA 1BYAA 5IOBA 2Q3OA 2OSWA 3GK0A 1P1XA 3OIHA 5CSUA 3REQA 1QNOA 5FI8A 1S3TC 1KQZA 4QWAA 4DUWA 4GWEA 4ZOAA 5CC6A 4JTQA 1FH9A 3DIPA 1AQ0A 2V69A 4FO4A 1GZGA 3QSRA 1TPDA 3R8GA 2J47A 1BF2A 4O1BA 2NWRA 3WG6A 4WSHA 3G8EA 4PN2A 3N17A 4A8IA 4LC6A 4JIQA 3NEVA 1GORA 3O05A 4X63A 2ZX6A 2ZQ0A 4DBDA 1I60A 1A3WA 1W31A 4EF8A 2OYMA 1OM0A 5KFMA 3B8VA 2XSXA 1W9XA 5L9FA 3LGEA 1UKSA 2BASA 3CPUA 1EB3A 1LORA 3GC4A 1OD0A 4NNCA 3FA3A 4W88A 3BJYA 1GK8A 1Z8AA 1QU4A 3M0HA 2GSHA 1LQ2A 4ZTYA 4WKAA 4Y2WA 4MJZA 3GKAA 5MHBA 2G4FA 3RU6A 2V5LA 3PZUA 2VTFA 4UTTC 3LPGA 5C9UA 2VOMA 3AC0A 4MB4A 4NAEB 3RJXA 1RJPA 5C7HA 1WZMA 1ZSXA 2QT3A 3PJTA 3PG9A 2JIWA 4LYQA 2FPVA 2A7NA 3ONBA 4MPQA 2ATSA 4GGHA 3LHZA 1H7RA 3F7JA 1EEPA 4QNEA 2C15A 4MJ2A 1WX0A 4MMWA 1VFMA 4X0VA 3WK0A 4B5WA 3VTRA 1YLVA 1VLWA 3Q67A 4MDOA 4NJKA 5D2YA 2ACRA 3DI1A 3MJMA 5D09A 2P1FA 3ZWSA 3CV7A 3QMRA 5IDZA 3EX1A 3OSNA 3EOOA 3TSMA 1U5HA 3W38A 3LZ5A 2INEA 3CK5A 4EPBC 3QF0A 3ZWTA 1T41A 2R8JA 3O6AA 2EPKX 2O7SA 3MB9A 4I5XA 3W7NA 3ECQA 1HJQA 4DYEA 1TX0A 3R10A 1TA3A 4HNTA 4E3TA 1XQKA 3R79A 2UZ9A 2DSVA 2PF8A 1CXFA 2Y5SA 2YJQA 4JTCA 1JUBA 1B1YA 4HBKA 4O11A 3IJLA 2XCAA 1S2CA 4LTSA 1TVNA 3BANA 4MZ8A 3WQDA 3WQOA 4FLQA 3GXTA 4FNTA 1BHGA 5LIKX 2AOSA 3SRFA 3TFXA 1S10A 4V28A 3VNIA 4DVOA 2DSKA 2XSAA 3MDWA 3R6IA 2ANUA 3AMDA 3P84A 5FAJA 3KE0A 2YCKX 4WK9A 2P3EA 3BGJA 3GYEA 1RBLA 1PCKA 1Q6EA 2VI0A 3W1UA 4Z2GA 3Q45A 2FFIA 3DG7A 4C5YA 2OOFA 3NA8A 3CAKA 4AF0B 3NURA 1LBLA 4TIMA 4XZMX 7CGTA 3W7JA 1XGDA 2CLPA 2E1WA 3G1VA 1M53A 1BYDA 1VEPA 2XGPA 4ERIA 1R30A 3RN6A 2E6YA 3GXIA 3M1ZA 3TR2A 2ZWYA 3ANYA 4J9JA 4MY8A 5HULA 4K7VA 1UH2A 2XWDA 4UFLA 1R9YA 3S5OA 1XIGA 4WSJA 3KVMA 3MR6A 3EMZA 4WIWA 1LOSA 2YBUA 4Q8QA 2DUXA 1YTEA 4HZMA 4LVFA 5IM51 4EE9A 1PIGA 3S83A 3BOLA 3HFYA 3WD0A 4UQDA 1MRAA 3F4VA 2VP8A 4KRUA 5ABHA 3FN9A 4O1DA 2WMIA 1JZ2A 3VNJA 1SVDA 1V6VA 2GFTA 3S47A 4KEMA 1XLMA 2AMGA 3AS2A 4LALA 4PYSA 1RPXA 5AECA 4CEXC 1V08A 3PN8A 1N8WA 3GQCA 3I4EA 4GINA 3IJDA 4WOQA 3PZOA 3R0KA 3VD3A 4E2DA 2DVTA 4GYFA 4MUZA 4TMBA 2AL2B 3MUY1 2E3ZA 1YXDA 4P7LA 2AMXA 3MHFA 4LAOA 4D6IA 1GOKA 1W1TA 2RJGA 4ZENA 2YW3A 1FDJA 2WHMA 5T26A 1TFVA 4FR6A 1UWRA 3S1GA 1MZRA 2PWDA 3Q2DA 5F2MA 5KFJA 5FF3A 2A3LA 2VQTA 4HCHA 2X2YA 4YYCA 1M41A 5KFVA 4A8NA 5F1VA 4PMZA 3N11A 2DVXA 4HU3A 3W1RA 3DFYA 5DG9A 3GVRA 4WJXA 4QJ1A 3BO9A 1YPFA 1YHTA 3WQCA 4AX7A 1A5SA 1VAHA 1NQKA 2HROA 2PDQA 3G24A 1GVIA 4GKTA 4HTBA 2OVLA 3WEZA 3BLLA 4S3CA 4QWBA 5KFZA 3R43A 3VMOA 4JDYA 3F2BA 1S2TA 3AXHA 2XYLA 1GQKA 5KFRA 4M29A 2H9AB 2WB5A 1V6XA 4V1YA 1JAEA 3WQWA 1VKFA 4HK6A 3N2BA 4MYXA 3QMSA 1W1YA 3VKDA 4H4IA 2Y7EA 2TODA 3TQVA 3I3BA 3WBAA 1FP8A 1YXCA 2BOEX 2ABAA 3CMJA 5E0FA 3BGGA 3PZPA 2V4QA 1M3UA 4QLLA 3PW5A 3W37A 3LSCA 3QGAC 5KFYA 4A3UA 3NZ1A 4OKDA 4TU1A 4AD3A 3HBLA 1DQUA 3OBEA 4YWIA 3DAQA 4HU8A 2NXIA 2QUUA 7XIMA 3VUSA 3H23A 2ASLA 5HMSA 5AKQA 4UBPC 1XIIA 4GZEA 2W91A 2VR2A 1AJ0A 1Q6DA 5BYWA 4B4HA 4JQ3A 1XUUA 3MV01 1H1YA 4B3LA 1THFD 3H2FA 4KIEA 3SY8A 4CU7A 4Z08A 2QPXA 2DY3A 3RGTA 3VDCA 3H40A 3VO0A 4AEFA 3NR0A 5KETA 2YZRA 1L6GA 3SCUA 3P61A 4PB4A 2G3NA 5K3VA 3AIQA 1GKQA 2OJPA 3DHPA 4J3UA 3STPA 8CGTA 1OIMA 4KCWA 2PDGA 4YCPA 2JEGA 1H49A 2XINA 2I14A 3NDOA 1Q6CA 5A6KA 2HXUA 3SUVA 1R3SA 1REQA 4X2PA 2PDYA 2YW4A 2ZUUA 1R9XA 4ZQRA 4JFWA 3N29A 3W2LA 5HMEA 5JH2A 3LXAA 2C18A 4BWLC 2XC9A 3H4XA 4H9XA 3NGFA 3WO8A 1X1ZA 5IRPA 4WDTA 2PC8A 1S2WA 3CAQA 1CT5A 3G3DA 2W9BB 3V4BA 2BGNE 1F61A 4GCAA 3EEGA 1F8IA 1IEWA 2WYSA 1Q13A 2VC5A 4IGSA 3NQBA 4AX6A 4JHMA 3GIMA 3DX5A 2WM1A 2V38A 2WJZA 4RZ5A 3KTSA 4NU7A 1XP3A 4PUDA 2PU1A 1EJ7L 1QPRA 6CGTA 2MNRA 2YIHA 4EXAA 2J8GA 4UTHA 1KGXA 2FMNA 2R8HA 1QI5A 2Y8VA 1YX1A 3HB9A 2I1OA 2QAPA 4P8WA 1RY8A 1EBGA 1R2TA 1XISA 4RE3A 2D3LA 4AY1A 2QGHA 1TWSA 3M7SA 4FI4A 2V3FA 5DGAA 3VPLA 3KLLA 4J35A 1HKVA 3G6XA 1H50A 3RXZA 4UCFA 3KVLA 3SCPA 5I3FA 5JH1A 2BX7A 1O94A 4G56A 4TVDA 2NV2A 4I6VA 2FVMA 5EY5A 3Q4DA 4HPGA 3QV9A 3ZMRA 2W27A 3TU9A 1A5KC 1HW6A 3AYRA 4QQ3A 3KAOA 1LTDA 1QR7A 1GVQA 4NZ5A 1ZBCA 1EA0A 4MVAA 3KEHA 3C0LA 1BGGA 1MW3A 3W71A 1VEOA 1R85A 4LCRA 3BJSA 5KFAA 3GNRA 3HQOA 3RBDA 3L4TA 4L9ZA 1EDGA 3GXPA 1Q6FA 1JD7A 1EF2A 3UZXA 1JXKA 4S3DA 4RXFA 3A21A 1G6CA 5KG5A 1ENUA 2KAUC 5LIUX 4OBSA 4LXFA 2DIKA 4EF9A 1SO6A 1FCUA 3MWAA 5KEZA 4KWOA 5DQIA 4LEQA 4HNLA 4N9BA 4JICA 4QCEA 2EJ1A 1SU5A 3WZ0E 1YXYA 2R82A 4GIAA 2QMJA 1OG6A 2WW5A 3CPRA 3LHVA 3F2CA 2JALA 4HOWA 3GM8A 3AIWA 1R7OA 2QV4A 2JE8A 3GS6A 2BXZA 3LBCA 1KM3A 4YWSA 2Q3RA 2JEFA 4PODA 3NWRA 1XYFA 3BAYA 1A0DA 2XHYA 1IV8A 1A5NC 1T3NA 3W7LA 3OVQA 3RR4A 3ZVHA 2ASJA 5GJMA 1A0EA 4IPNB 4AD1A 3A3WA 1U22A 3B8WA 4IUOA 4KESA 1GKRA 1R2SA 1VS1A 1V5XA 2KX9A 3S0CA 2OTDA 3MHGA 3OQ8A 3T0DA 2J24A 1TMLA 4HQVA 3P8JA 4UQ9A 3VDBA 1W3HA 1YPIA 2DEPA 2FH6A 4P8VA 2FLPA 3BLKA 4JNZA 4HJWA 3BAJA 5CZKA 5J04A 4XD5A 3WLHA 3A3HA 4MB5A 1XW8A 1VJIA 4KW2A 1K8ZA 1E6NA 2CLEA 1OINA 3O16A 5L1IA 3QEZA 4QEEA 5D9MA 4HHHA 4AZCA 4J3ZA 2JKEA 4Q6JA 2Y4SA 4OGZA 4J9RA 2C7FA 1S2VA 2XSBA 1LLOA 2Q6ZA 3SUWA 3NZRA 2C0AA 3OGVA 3HM7A 1U83A 4JPGA 3I65A 1PZ3A 3WD2A 2Z29A 2J6VA 2BGSA 2D2GA 5HJYA 2UY3A 1OEPA 5AN7A 4JV1A 1BQCA 1G94A 4BK9A 3EA2A 4YPJA 3IV8A 2AKMA 1CXKA 3A47A 5BROA 3FKRA 3K5XA 2J66A 4HA3A 4H8UA 3RILA 2J7BA 3LHUA 2A1YA 4O53A 1W3JA 5J5DA 4PTWA 3STCA 3MVIA 1J10A 4X61A 4ILSA 4EYIB 2EEXA 4E5TA 4BI6A 3WJSA 1ODZA 4KERA 1P0BA 5KT6A 4X0NA 3ABRA 4OV4A 3BSMA 2HS8A 2VC9A 2PF0A 2CXEA 1FDZA 1OBAA 4JS3A 3L23A 3KZPA 3MUXA 1Z3NA 4O52A 1W9PA 1FVPA 4OQVA 3VD4A 1G4PA 4WOZA 3RBEA 4LB3A 4KWSA 1VCVA 1J96A 3S8HA 1QHOA 4F4ZA 4QAWA 5AC5A 1GW9A 1B31A 1FWNA 3OZYA 2EKGA 3FJNA 2YR1A 3QHOA 1DL3A 4CVWA 5G5IA 3BGAA 3WMCA 4ED1A 1XLAA 3CL8A 1GPFA 1KLZA 4MSSA 1H7PA 3VGDA 1GCYA 1ADDA 4DF1A 2BWGA 2E0PA 2PD5A 5KFHA 4O1CA 1Y5XA 1VC4A 4J3SA 4RUCA 3C52A 3PW2A 3MCOA 2NX1A 1Q6OA 3FW6A 5AZ1A 3WH8A 4O18A 5BWFA 2W7PA 4HNUA 4QG6A 6XIAA 3ZLFA 2ON3A 3WF1A 2VRQA 4I3GA 4P7QA 2E6FA 5CEWA 1VB9A 3HG3A 1JDAA 3TYZA 3ZFHA 1M04A 2DZBA 4JTGA 3KXQA 3CV1A 4ZQOA 2VFHA 1FY6A 3EXTA 1HKKA 3P82A 2CLMA 2GK1B 2UY4A 2VT0A 5IFTA 4HNVA 3UWEA 3KHHA 3T5LA 1HJVA 2VNCA 1GG0A 3WD3A 3EPNA 2WXDM 2YDAA 1O7AA 1XPGA 3A12A 3P7YA 4W7VA 3AFBA 4HT3A 3OG3A 4YIWA 4GZ7A 3VDAA 1JGIA 1XYCA 4IIDA 3OVGA 1V6YA 5AHLA 2E9MA 1I2RA 5C0QA 4HSOA 3TN5A 4REQA 4XO7A 2ZUSA 3SIMA 2QF8A 4P7OA 4TV5A 5DLGA 1L6FA 4QGCA 4Z2JA 3TA6A 4EYHB 3M9MB 4ML4A 1FA2A 1WCGA 4IPIA 5FAGA 4LGXA 3G1FA 5U4NA 3W1MA 4GUHA 2XIBA 2BB0A 4GQRA 3VE7A 1Q6QA 1TRDA 2IQTA 5CLWA 4JQ2A 3PBMA 3TLLA 3KL3A 1I1WA 3VNMA 4AAJA 5KG0A 3SR7A 1DIKA 3KVJA 3OZPA 4U5IA 1YTKA 3DG6A 3PPCA 1OB0A 3ITLA 3LYEA 2HK0A 4D6DA 2FQIA 1R3TA 1IT8A 5BRQA 5A8NA 1FWIC 4ZQCA 2VCAA 4PEEA 3BLDA 2Z28A 4IMAA 2WKGA 4OOZA 4C6MA 5JVLA 1DE6A 4US5D 4QS6A 2WHLA 4Q4QA 3GRIA 1XRVA 3POCA 4IH3A 1TV3A 1H4PA 4NSBA 2DT1A 5LHFA 5K9CA 5LGXA 2GOKA 3EDJA 4LUSB 2J6XA 3BMWA 4IIHA 1MQRA 4BZYA 1F6PA 3CLMA 3LCHA 4OU1A 3VZZA 3W02A 4N4PA 2W63A 2INFA 5D9OA 1V93A 2PWVA 3KBSA 2FZ8A 1UPMB 3NQ2A 4FX7A 5AC8A 4O8AA 4GBUA 3QKZA 5AVHA 2RGLA 1P1MA 1UH4A 3W74A 4M6QA 3R7MA 3NGDA 3FIGA 1AVAA 2V2HA 1B4KA 1W32A 4TUFA 2VEPA 2OSYA 4XWUA 4XIMA 1DXIA 1PSCA 1SJDA 3H2CA 2V9DA 3EPOA 5ABTA 2WM0A 3LM7A 3EWBX 4MWAD 1ZGDA 5AC6A 3FKKA 5EU9A 1GJWA 2C28A 1ZBWA 3SZ8A 4XBJA 4EWND 1S2AA 2PTZA 3BLPX 1UD4A 4C1NA 1PCWA 4L4MA 3NSXA 2VZVA 3UCQA 4W84A 4J28A 2BOFX 5TF0A 3ME3A 1J01A 5BW6A 3VFCA 4GIRA 2VQUA 4PMOA 2O92A 5BOFA 3SUSA 4JFTA 4KFOA 3UZ5A 3TJIA 1F6KA 1JCTA 1ZJHA 4JTKA 3SSJA 1ZJIA 3BMVA 4U31A 4HB7A 1BWKA 4N4QA 2GQ3A 1UD5A 4NI3A 1JVNA 3EA3A 1FWJC 4HN4A 2HV5A 2FTPA 4UFHA 5CZTA 2EPOA 3GTHA 1UJQA 3WJWA 2REQB 3QZEA 2YFNA 3CAVA 2WK2A 4GABA 3ES8A 1AMYA 1F3EA 3MO7A 4CNOA 1MFUA 5LIXX 4DYJA 2GDUA 5HATA 2BG5A 2FJUB 4XKYB 4XQ6A 3W85A 3SEPA 1KFWA 1ITCA 1W91A 4HPJA 5FSDC 4ZB0A 3H2MA 1SJBA 3AHVA 3AZRA 3CWNA 2O9OA 2E5BA 2A79A 3HU7A 1M6JA 2YL5A 4Q8FA 3CUHA 1XYZA 1MNZA 3TMQA 4S3FA 4ZXLA 4NZCA 3IEBA 5AYXA 2DZAA 3W2KA 3KM8A 1GGOA 4A8LA 3AIBA 5LNUA 1E55A 4KCUA 1S0NA 3C0SA 2HMCA 4XAYA 1S3HA 4E2OA 5EDWA 2XVKA 1DP0A 1XBYA 3RB3A 2GVLA 4ZGYA 3RIKA 5KFQA 4IQEA 4M7SA 3KL5A 4MZYA 4JIIX 2VWSA 1XX1A 5HPCA 2XN1A 3KLKA 2YPIA 4PUEA 2XPKA 4PMUA 3M47A 3E49A 2AQOA 2WKLA 1D7FA 2G3IA 3VK5A 3W07A 3WK2A 4EACA 2H90A 5D38A 3CQIA 5D2XA 3JVAA 2XVLA 3GY1A 3WJZA 1NF0A 1HT6A 3R8HA 1C91A 2HEJA 3E74A 4BF5A 3WMBA 4MLRA 2CXGA 5LXXA 2PDJA 4RZ4A 4GYJA 2VX6A 3CS2A 2NXHA 3ARUA 4EAMA 5CZJA 1J79A 3UNDA 4CU6A 1A47A 4K36A 3VXGA 1NU5A 4URIA 1OK6A 1KTNA 3WQVA 3ZT7A 1NFGA 2EPMX 4M1BA 3W1QA 2IPJA 4QSFA 2V6AA 3IUHA 4B5UA 2BV9A 7ODCA 2X1TA 3GR4A 4H7VA 1R0MA 4XB3A 2PE4A 3LX9A 4PTXA 4R88A 3L0NA 3W1LA 5LSMA 5FA5A 3QY6A 3NJ3A 4MKVA 3R11A 3BL3A 4BQ5A 5GPRA 1XIDA 2GWGA 1XSJA 3BMXA 4LB4A 1RQHA 1O6IA 3DCPA 2D2OA 3SGUA 1Y7VA 4Q8EA 1LWJA 3V16A 4QHRA 4NF7A 1TUXA 4C6OA 5M5DA 4NAFB 4H8HA 4U3CA 1J18A 3ZO9A 1KGWA 3A4XA 1AK5A 1TZZA 3S1WA 1A3XA 4I9TA 7REQB 4UXDA 3ORWA 3V5FA 2E9LA 3QGVA 3MDUA 2X1UA 1R38A 5DCBA 5BZAA 1TTIA 2VENA 1DJGA 1S5WA 2ZVIA 3C4UA 5AHMA 4QJ3B 3PFMA 2YDRA 4XZBA 3E2VA 4CN1A 4D6EA 4A3QA 3FJ4A 5G2IA 2DQXA 2DDXA 4RW3A 2WBKA 5HA7A 4EOUA 1UZDA 2E68A 3ATZA 1GJPA 4FOUA 1EXBA 4J4KA 3RRXA 2XN2A 2I5IA 4F2UA 3V6JA 1K8YA 2F6UA 1E0VA 3UBPC 2J6TA 1MQPA 1TWDA 3UT0A 4IPLA 2OOGA 1QT1A 5DCDA 4M1RA 4JTFA 1RUSA 3RFAA 3CV2A 5KFLA 3F5JA 1G69A 3LMZA 4MIMA 1WZAA 1X1OA 4Z2LA 3BLFA 1KBLA 3S9IA 1F3WA 1JYWA 1NARA 5EGRA 1RD5A 1L8NA 1V0MA 1TPWA 3W29A 5DT7A 1WDSA 2QJIA 2QPSA 5KFCA 3U7VA 5I3KA 4ZOBA 3GTNA 1UD2A 2PWEA 4AYGA 3CUIA 1C90A 3USZA 1P7TB 5AY7A 2Y89A 4AD0A 5EB8A 3MP3A 1UR0A 3TW6A 3RHGA 4UNKA 2VM8A 3UNTA 4IMFA 2A7RA 3VINA 3W2JA 3PVFA 3JZEA 4YTQA 1R3WA 1GVYA 2D73A 1M03A 3E2RA 3P67A 2Y8KA 4ZO7A 2OMAA 2VFIA 4J9NA 2PDXA 2EF9A 3AROA 2IPFA 2XIJA 2NSOA 1VYRA 1WAUA 4H8VA 4AWTA 1NEYA 1KB3A 5C2XA 1DJQA 4GUFA 3TN3A 2I7GA 4FF5A 3WNPA 2FH8A 3GH7A 1P0NA 5HMDA 5EMLA 3EPMA 3W73A 3L4ZA 3SN0A 4J9LA 3FY1A 2AAMA 4GCXA 4UMAA 3I7SA 3HGOA 5A6BD 3HMJG 4ADSA 3EA1A 4NUWA 3LPOA 4PMRA 1K4GA 4IXXA 4BEQA 4IGNA 1DWIM 2AGPA 4FHAA 4OOUA 4ATWA 4KBXA 3HPZA 5EMYA 4EIVA 4C6NA 1GOMA 1KFCA 4L4LA 1ZP4A 5DF0A 1KV5A 3KDOA 3H53A 3QMTA 4X2RA 4EEYA 2F7FA 3VI2A 4DI9A 2ZA2A 1TX2A 1U5JA 2V2DA 3OHBA 1P0KA 2FJKA 1TO3A 3GVVA 3LMYA 4JDBA 3CO8A 4QDMA 5KFIA 4RW5A 3HURA 4B3KA 4IFKA 1ZL1A 3MW7A 1R87A 1HL2A 1H1NA 5FJJA 3SO7A 4H9YA 4Z1BA 2CKSA 2VEIA 3EEZA 1GYMA 3I6EA 4GYPA 1Z44A 2WSKA 1TCDA 4DHGA 2IBKA 1BXCA 1W0MA 4J9OA 3A4AA 3THAA 3ANUA 4HK5A 3UG3A 2YCLA 5BXRA 5KFWA 1TJPA 3P0WA 1W1IE 3KP1A 2G0WA 3MV11 1KFEA 2BVDA 5CSSA 4OV9A 1QAPA 1US3A 1SZGA 5I02A 1RY0A 2PS2A 1XG3A 3HMCA 4AXKA 2VFEA 1GTHA 5GNYA 1PDZA 4F3HA 4BQ3A 3DFOA 5C9RA 3PW0A 1E73M 5CC5A 3BH4A 4MNMA 3W7CA 2YL6A 2WPBA 1TPC1 3QPYA 5FCZA 4DZIA 4CD4A 2ISWA 2B0MA 4ZE5A 4ZA0A 4B5VA 2XU2A 5D2TA 4WF7A 3KWSA 2J13A 1JZ5A 3PBGA 2NV1A 3S1VA 2GVJA 1SR0A 4WJEA 4O3NA 1WXYA 2I5GA 3GR8A 2ZXQA 5FJUA 1CDGA 1R47A 4LBSA 4KFPA 4IUGA 2E4TA 2VDHA 4U3AA 1PTGA 1BXNA 4RL3A 1K70A 4KF1A 2GOUA 4ROPA 1AUSL 3N13A 4NT0A 1MSSA 3OBAA 3VILA 4QDWA 2PDUA 2AGOA 1F74A 1VCFA 3M41A 3QTGA 3PWAA 4CQ8A 2ZRUA 1G67A 1MMFA 1UR8A 4QITA 2FHFA 3G3MA 1XYLA 1M7XA 4I5UA 4L9YA 2RDWA 4G1KA 2WSRA 3ENLA 4QFUA 2ZRWA 3VM5A 3GDBA 4DO6A 3B9EA 3E0WA 2G3MA 2DZUA 3O2LA 3QJAA 1MEWA 4LSBA 2YBVA 4WX2A 1RXOB 5LA2A 4JCLA 4NYUA 3SFWA 1U5VA 4P2VA 3HPFA 3MI6A 4V2XA 4X60A 2QLYA 5EFFA 4A2SA 1AQHA 3AYTA 2VXNA 3L5MA 4QS5A 4RDWA 3WL1A 4K6AA 3M46A 3QZ8A 4YXGA 4LWWA 3SCNA 4UFKA 5C9WA 2YYUA 4EPKA 1PX3A 4MG4A 3M0XA 5E09A 2Y2WA 3HPSA 4CCCA 1RPKA 1VPYA 1WBHA 4B5TA 3PZQA 5HQMA 2PTYA 1FWHC 1XQLA 3B03A 4LBRA 2PA6A 1DWAM 2J8FA 3GC2A 1RR2A 4PCSA 5RUBA 3S42A 2VVSA 4AZIA 3EDDA 2FB3A 1AW2A 3UR2A 4XSLA 4UB9A 1LF1A 4BCEA 1G4EA 2ISFA 2PDBA 2XM1A 1WKYA 3P6LA 5A94A 4MZ1A 1BGAA 3QY8A 1XXXA 4NG3A 1D8CA 2WTFA 3W7RA 1GNXA 3EWDA 3TTOA 3IRSA 1FWSA 4KETA 1YBQB 1FP9A 1W3KA 3BOXA 2CHRA 3TC6A 4DWSC 1J0IA 1EOMA 1ME7A 3AHYA 1JRBA 4IM4A 1VYSX 3GBEA 3B8TA 3CB3A 1JYVA 3N2MA 3SCRA 1B3YA 3A9BA 3FNDA 3GTXA 3IPWA 5C9XA 1H5VA 3QPEA 3BWWA 1Q6LA 5H8MA 3B8DA 5C55A 3UA4A 1OQFA 4UC5A 1JFHA 2A3EA 4R9XA 1IWPA 1X97A 1H1ZA 2JEPA 3OLEA 4KMQA 3NOEA 4JN8A 4FNUA 1RQEA 1OF6A 3APTA 4D6CA 1A5MC 3K13A 2Y7GA 1G4SA 5FIPA 3HQNA 1EGMA 1J4EA 1RYRA 1BRLB 3AMKA 5CCZA 2DT0A 1SW3A 4GE8A 4F2BA 3BUVA 3MT1A 3O06A 3GWQA 3OLIA 1PVNA 2GQ8A 3W53A 1GTEA 2XWEA 1N8FA 1CGYA 4G7EB 2E8ZA 4HPXA 4TX8A 3U2OA 4GISA 2UY2A 3U5YA 4DM1A 5BWAA 4UMCA 5BU9A 1L2QA 4RZBA 1DTNA 4YLWA 3CEUA 3CQJA 2XTKA 3M0KA 5D05A 1VEMA 1B9ZA 4ECQA 3SRHA 3NQAA 4LNCA 3QFEA 3EKGA 3N12A 3NNTA 2ZUWA 2JK2A 1UG6A 3T07A 2FPTA 4ZL1A 1KM4A 1HNYA 3GKFA 3I10A 3P93A 3SCTA 1B0IA 3HV8A 5CZ0A 2DZVA 4IHCA 2WVVA 1NFPA 3QV6A 4TQTA 3CL6A 3OPSA 2PGEA 3A5VA 3W2NA 2X1IA 2HVNA 2CLHA 4GI6A 3AHXA 2GJXB 3W01A 5KFNA 5CJ5A 2PI6A 1O68A 1AG1O 2V5JA 1WPCA 2CLLA 5DX7A 3WQPA 4KQNA 1J5TA 4QE5A 3V5CA 3MR5A 2PTXA 2FFCA 5G1YA 5B7ZA 1TIMA 4NRSA 4RCXA 5H2ZA 4M6UA 2Q71A 2BVYA 3B9DA 2DIEA 3QFWA 5E0CA 4QAIA 1C9DA 2G41A 1GUVA 4C7FA 3SN4A 4O3RA 1E6XM 3S5SA 2NWSA 1V6UA 1OX4A 1GOQA 1RA0A 1DWHM 1WBJA 3GHUA 5IFPA 3T05A 3VKBA 1E1FA 3W83A 2C71A 1LUCB 3CJPA 4Q8PA 3VC5A 2JF7A 4Y6GA 3ZXWA 4E4FA 3SCVA 5I07A 4IL2A 4F4YA 2J8TA 2ESCA 3WQFA 2ALRA 2QUMA 3GIIA 4PRWA 3BLEA 3I3DA 1PZ2A 2PODA 3AS1A 4F79A 3TKFA 1EJRC 1K1QA 3B0XA 3ITCA 1XGEA 5DEZA 1XBXA 4M51A 2FZBA 2QVHA 5A6SA 1CLXA 3Q8RB 1HTIA 3PHAA 3W1AA 4WCJA 5HK4A 4DF2A 3AMCA 3K8KA 1OZMA 4JR5A 1QI0A 1V3HA 2CWXA 2OYLA 1GQJA 2E9BA 1WKDA 4YVPA 3VCNA 2VGGA 3MMWA 4R27A 3CBWA 2PLMA 3UWUA 3D3FA 2QCFA 4DWSB 2HRWA 4QSHA 2YA0A 4YYFA 1JIHA 4AZ6A 3NSNA 5BRPA 2J75A 5FOOA 4ECZA 3GTFA 4HPNA 1T0OA 4XX6A 3RB4A 3S6OA 1QWGA 4LVBA 3EB3A 2PZNA 3S46A 4DJFA 4FK9A 2E77A 2Z25A 3H6OA 1BVWA 2NUWA 1BVZA 5FACA 4F0SA 3SBFA 1ODUA 3W1NA 1J0HA 1JX4A 2Z27A 3PVXA 1ZZMA 3ZQ9A 1VPXA 1VFOA 3ITOA 4B5NA 1PJ9A 3H55A 1QK2A 1HP5A 4J3XA 2H8XA 2YSWA 3A4JA 2GWNA 2BVTA 1DTUA 4CD8A 1GVOA 4PCFA 6REQB 5B80A 3NQVA 3TXZA 3UWYA 3ABQA 1YQ2A 3HPXA 4Q4OA 3GTIA 1IF2A 6TAAA 2YB1A 5F9LA 3VUPA 3PJXA 3NXLA 2YLAA 4Q43A 3N1AA 3NXFA 3VDGA 4L65A 1ZLPA 4ED3A 3ZR4A 1UKTA 4A3YA 1HVXA 4C6LA 2BDQA 1LRNA 4IPPA 1JAKA 1L6YA 2GPTA 4CQBA 3BQ5A 3LERA 4H7ZA 1G01A 1UCWA 2WJFA 2X30A 1B3XA 3B40A 5KFFA 3NIYA 3COTA 4LOCA 3QC0A 1FCBA 3VD7A 1R46A 3BCDA 2ISSA 3DN5A 4Y96A 4GO9A 1ZS2A 2Z1KA 1DJWA 5LNWA 3L66A 1XBZA 3EYPA 3MANA 3WF2A 1S46A 2Q02A 3STEA 5DQGA 4Y9NA 3W9ZA 4J9QA 3S9ZA 3FX4A 3ZJKA 3U2CA 1I0BA 4CQDA 3DHUA 3AU6A 1KO0A 4R8UA 5D8WA 3C3NA 5CAKA 4XD3A 1IZCA 2J27A 1KCXA 2P10A 3PY2A 1BFNA 4XZ9A 3GBDA 3URBA 3T5HA 4C1KA 3CGTA 1UUMA 3V7PA 9CGTA 4HVXA 4H41A 3H7RA 3URAA 1DOSA 3UG8A 2EG6A 3GC5A 3POHA 1JCLA 2R94A 5KFUA 1K9TA 5GNXA 2NUYA 3LCFA 3VDHA 1NOFA 3TSBA 1IGSA 4OE7A 5DQPA 1RP9A 4RDYA 2Z1WA 4ONVA 1VFHA 4O3OA 5F4XA 2XH2A 1AFSA 3RCYA 3QYQA 4JNMA 4ML9A 3MPGA 2ZZ5A 4QW9A 3PZGA 1JZ7A 1FWDC 3AMLA 4XAFA 2NV9A 1KRBC 3LRMA 3WEOA 4B15A 2FIQA 1SSDA 2ZICA 3W25A 2YDSA 4UFJA 1E1CB 5ECUA 1ZNNA 4F40A 3KRZA 4Q4PA 1W5NA 5FD0A 4IMCA 4RE2A 1E51A 4K7YA 1K6WA 3UETA 4OT7A 4GI9A 3E0IA 1K7FA 1W9BM 1I1XA 4HKPA 4MF4A 2W8LA 2X2GA 1XL9A 2I16A 3PC0A 4LY4A 4U7CA 4J3VA 1X1NA 3EOEA 2PPGA 2RDTA 3NG3A 2WHJA 1NWTA 3BW2A 2GUUA 3MSRA 3DYOA 1MWOA 4JV0A 1JXJA 1C93A 4Q8NA 2RDXA 1UPPA 4KPLA 1L8PA 4C6PA 1G0CA 2C1IA 5CGQA 2VWTA 3EPGA 4ECUA 1XLGA 3N14A 3T1GA 3QLDA 2X40A 5U7SA 1XC6A 4M8UA 5F9NA 1QI4A 3LHWA 1VLIA 5K7JA 2D1ZA 1XLCA 4H1ZA 4G5DA 3D0CA 4UIOA 4AC7C 1NOUA 2W67A 4HHMA 2HTMA 3TROA 1Q2SA 1SZEA 3REQB 4OFCA 4QQUA 5CPNA 3NTYA 1OC6A 4FNSA 5HXMA 4PUKA 3IGUA 2J7GA 2XVPA 3OW1A 4J9SA 5HWMA 2HPIA 1DORA 1R3YA 3N6QA 3CUZA 8TIMA 4AH7A 4K2SA 3FFSA 1RYSA 4OUEA 3GNXA 3LS9A 2F61A 2ZDSA 4BA0A 1XCFA 4NY2A 3T4WA 1TTQA 3OYZA 3GXNA 3ITGA 1EEXA 3GXMA 1R5YA 4HHPA 5LA1A 4O8RA 1UBSA 4O12A 3SY5A 1UWAA 4WY0F 2VC6A 2QHAA 4FEZA 4DNHA 4F0RA 3CUXA 3DFSA 2CHNA 2DUZA 4XAZA 4RNFA 3PAOA 3UXDA 3GU2A 1H0GA 1Q45A 2V5CA 1KFKA 3MP4A 3W86A 1QASA 3T2QA 1FCQA 2EQDA 1OX5A 4PB3A 1R2RA 1YMYA 3RM4A 1G7VA 2OWCA 3AHTA 3T44A 1F4HA 3S9YA 2QIIA 3M5ZA 3IARA 4DL6A 2Z0IA 5A8MA 3A5FA 4E0CA 1UR9A 3U5UA 1ELSA 3CNYA 4KWVA 1U30A 2FHCA 3GNNA 2GJNA 5E6ZA 3WDPP 3BQ1A 3V0SA 3WUFA 2XVGA 4NXKA 3HOJA 1DJHA 1QRQA 1TR1A 2XN0A 1MW2A 3IS4A 2Y5EA 1OABA 2BY2A 3U0HA 4XG1A 4H2CA 3UCDA 2IKJA 3YPIA 4C60A 1EZWA 1TA3B 1XLEA 3W72A 1H51A 2J79A 4LAZA 2OGYA 1K7XA 3BOFA 3KOXA 1PKMA 3GG8A 3UA3A 1YADA 4CQAA 3GGMA 1QW8A 2F6KA 1PAMA 3VU2A 4AHPA 2FLIA 2FKPA 1F3XA 2PGFA 1P43A 3M9YA 2VX5A 1JCXA 1LT8A 4I5RA 3D6NA 4HNCA 3S5NA 7PTDA 1V0NA 1B9BA 2Z1VA 4US6A 4JY8A 1VRDA 3HIJA 4ATDA 2W61A 1TZ9A 3SI9A 1DIDA 2R6OA 1POKA 4FX8A 3S5ZA 4O1FA 3N18A 2PLCA 1KRCC 4TTGA 1ISVA 3LXBA 3W22A 3QQWA 2YFOA 3GW3A 3VCRA 4M19A 2Y1HA 5BNKA 3IIPA 4MTVA 4GY1A 4DELA 4IX2A 3MSYA 3W70A 5BCAA 3UF9A 3CTTA 1XPYA 4Y9PA 1GOOA 1OFBA 3LDVA 4AVNA 4W7UA 2ZIDA 4LY8A 3M0LA 2XG9A 3GSMA 3PW7A 2P3ZA 3UZZA 2FZNA 1XYAA 1RCQA 1WDRA 3HFTA 3UJ2A 9RUBA 1Q4NX 1ISYA 4TVCA 4CD7A 1MXGA 5DXYA 4ACZA 1XDJA 3G1DA 2KZHA 2X0YA 1O95A 4Z0SA 2WMKA 4FBTA 5I6SA 4C90A 4GI8A 1BSIA 3IGXA 3OSPA 3UYIA 1DIEA 3GIPA 2V5KA 3SUUA 3VX0A 3W87A 3GHTA 2PWFA 2WNWA 3PJUA 2J7FA 3BE7A 1R7AA 4PL2A 8A3HA 3I4KA 1HP4A 3TYUA 2HISA 3TV8A 1JRCA 1Q5MA 4EANA 1QPNA 1Z6KA 2BQRA 2ZKMX 3EWXA 2HDJA 2VOTA 1SPQA 3OYXA 4RU9A 2ZWZA 1UBPC 2JEJA 4Z1YA 3MTWA 2WMIB 3W26A 1NSJA 1QDSA 2PBGA 2OKTA 1SFLA 3LBOA 2DORA 3TYEA 3C2VA 5FF4A 3IJIA 5EMUA 1SFJA 4I9AA 4ZSUA 2XIIA 4L6OA 3FGCA 1AA1B 2OEKA 3UFYA 1A5UA 4BR1A 1W6TA 1TELA 2VGBA 2YXXA 4LBUA 1CGXA 5C9ZA 2RKXA 2GGJA 1VFUA 3KRBA 5T91A 4B16A 2FDMA 4JYDA 3LEPA 3G18A 4H9TA 1XCWA 4QP0A 3Q8PB 1HJSA 4R53A 3GYCA 3T0BA 4HZ7A 1EJWC 4JYFA 4C7DA 4HCDA 1FUYA 1XIEA 1QBAA 3TX9A 5FJPA 1VBGA 3OQEA 3ZLGA 3VKAA 5CJMA 2XGIA 1U1JA 3I3EA 3NFUA 1VBHA 4LQ1A 2HPMA 1UQZA 4H6QA 1WA3A 1CW2A 3TYCA 2BP1A 1FHLA 5HPOA 3IACA 4Q8OA 1ICQA 1ZBVA 3TLQA 3T55A 3TWAA 4LX4A 1H63A 1J0ZA 1E6QM 3DERA 3BJFA 5H1WA 2OODA 5EYWA 3ELFA 2HNEA 2YL9A 4DO4A 4JKKA 2Q8ZA 4QCFA 1EC9A 1I6NA 2NX9A 3PR4A 3I68A 4MJ4A 4GJJA 5TIMA 2Z1XA 1OIFA 3UWQA 5ABFA 5K2ZA 2P53A 1A80A 3B3DA 2OO6A 2PZ0A 1K6AA 2PRMA 2WAGA 2P50A 4GXWA 4FLSA 3ZR5A 3EKZA 3HTWA 2VX4A 3GUGA 2BFGA 2I17A 4GG9A 3TN4A 3MUIA 3HG2A 4RK8A 1FCVA 3KHDA 3NAVA 4O4VA 2QMKA 4HMDA 2PTDA 2WHKA 4Q44A 4NZFA 1JCNA 1LP6A 4C6CA 3BLOA 3ALGA 3E38A 1A5BA 4GBDA 1H60A 4F66A 1IGWA 1Q65A 3NM3A 1E5NA 1VFSA 4RNHA 4NASA 1EWEA 2BODX 1Z69A 3CL7A 2DZWA 1Q7ZA 3NL3A 2E28A 2AGTA 4YQWA 2ZRVA 1GOWA 3G22A 5HANA 4PMQA 2P8CA 3BAIA 4UR8A 2UVUA 3H22A 3ZS4A 1Q85A 2W7OA 4MM1A 4PUUA 2V5BA 4F4RA 2ZE0A 7TAAA 1QOPA 5E70A 3G6LA 2PSNA 3C0JA 4Y90A 1DWJM 2JIEA 4GVFA 4DJEA 3G6YA 1OT1A 2V2CA 1VGAA 3MUZ1 1ZJAA 1E6PA 9XIAA 1UD3A 3U6WA 1XS2A 4TQRA 1TE6A 1EIXA 1ZAJA 4GFIA 4Q7NA 4LYPA 2HBXA 4GGBA 3IN5A 3NQFA 2B7QA 3VVGA 1X6LA 4HNNA 3LK6A 1TR9A 1N48A 3Q94A 1TE1A 3V6KA 2ZTKA 1V4YA 1HO4A 5I3IA 1GT8A 2ALZA 4JFUA 2V0TA 1TJRA 2PRLA 4W89A 4NILA 1GYLA 1NDWA 3EWZA 1PTAA 1XJBA 3LA4A 3C2EA 1Y0EA 3GIKA 4CD6A 4Z17A 2AKZA 2GVEA 3ZM8A 4ZTXA 2HVMA 3ZT6A 3QSTA 3RCMA 3SCQA 1UH3A 2L5HA 1FWTA 5F2LA 5G1MA 2E5CA 2R1PA 1CIUA 1Z89A 1A49A 3OVRA 4JN6A 4WHBA 5J5RA 3R25A 2V63A 3UJEA 3LD5A 4D8ZA 2VCBA 3LBMA 4NQ1A 1BAGA 4UUIA 4N2YA 1QO5A 5HNRA 1P48A 1CLKA 4BS0A 4DXVA 2B81A 4ZO8A 1OX6A 5REQA 4L1GA 1U1HA 4MLJA 3STGA 5DMMA 2ZUMA 3TDFA 3N3TA 4LCSA 3A64A 1GW1A 3UESA 1H61A 4RUBA 3H2OA 3T0TA 1C3FA 1DBTA 3GV5B 3LRLA 2QCMA 3TR9A 4QE1A 3R8RA 4Q4RA 1L6SA 3U4FA 3GFYA 3UG5A 3TA9A 2WC3A 1YNYA 1HJUA 5KFKA 1OGBA 1TV8A 2CKRA 1W5MA 4AEOA 3Q65A 1LYXA 2WSYA 1F5ZA 1VD6A 3TONA 3UXLA 4BFAA 5I23A 1EIBA 2BOGX 3WNOA 2CLFA 4O0QA 4A3HA 4M7TA 1O5XA 1K03A 4GVGA 1W9UA 1AD4A 3DU0A 4GC4A 2NT1A 3NZGA 4JUZA 1F73A 3T0CA 3AWNA 2ZXDA 1XCXA 4Z1AA 1DVJA 1OHLA 4JIHA 1XIBA 2BQUA 4S3GA 3TYBA 4MAVA 3PBYA 1XRFA 3SJ3A 1FWRA 2GQAA 5LA0A 2YXGA 3DGBA 5LHEA 1V8EA 4GIYA 4PEKA 4PFMA 3W2MA 3WLLA 4J40A 3ARTA 1K8XA 5CKSA 3MKCA 3K1DA 4BJHA 1TUFA 3MYPA 3W3OA 3FHAA 3LI1A 1KLYA 3V36A 4KCVA 4S3BA 3QQ0A 3FYPA 1FHVA 3GV7B 3PANA 3E9AA 1FWWA 5G2HA 3MSGA 3AI0A 4DAIA 2VD8A 2OO0A 4EKJA 2VZOA 3N73A 3NQDA 4GI4A 3UP8A 4PBEA 3IWPA 3UWWA 5AYBA 2RAGA 1L0PA 3WKZA 3LGDA 2OQYA 4EX4A 1IR2A 1QOQA 2PD9A 3O07A 1JUKA 2ZC8A 3UW6A 2ASDA 3GIJA 1WZKA 1XG4A 2OG9A 4J1OA 4MY9A 3LTSA 5CLTA 3TN6A 1SR9A 3WD1A 4XVEA 2BMBA 1J93A 4UTUA 1HJWA 3ZJ7A 3VGGA 3KTXA 3KP0A 3CUFA 3ZVHB 5CBBA 3OLDA 3UJSA 1TTJA 2VA2A 3UXAA 1K4HA 4OWGA 4UTWA 3TVAA 3FYOA 2PTWA 4U6PA 5BXTA 6A3HA 3UYCA 2W9AA 1EYWA 1OGGA 1W56A 4LAMA 5D9NA 3W7OA 1A5CA 1C7TA 4GXPA 5FL0A 5KFXA 4W8LA 4PRTA 1G4TA 3DI0A 1XYMA 3A22A 3ZYZA 2QV5A 5I00A 3B8IA 3WLOA 2FYMA 1EJTC 3CUJA 4PMYA 4AZGA 1LLZA 5AHIA 3C5QA 1ZTVA 3NO3A 2ZZ3A 3CT7A 3WH7A 4AZCB 1DJIA 3A9IA 3B0VC 1WDWA 3MCNA 3OZOA 5FJRA 2LLEA 1CB2A 2YCEA 3M6DA 2O4QA 1XKJA 2VVNA 3H21A 4GXMA 4D1JA 2HNHA 3DFQA 3S6DA 3PUEA 2W6RA 4P7NA 5BMXA 5EMJA 4UOJA 3F4NA 1XWYA 3LTPA 1HN1A 3WLSA 4Z1CA 1H3GA 5FJTA 3WLRA 2VZSA 2XM2A 1PTDA 3MZ2A 5CH9A 1XKYA 2DIJA 1VHCA 2HSAA 3PS7A 1T8XA 1YDNA 3OHAA 1GEHA 4LVDA 1C7SA 1F6YA 1Y65A 3GE7A 3SCSA 2CZVA 3DXIA 5KG4A 3RYSA 1D2KA 4YVVA 1TPVA 3T42A 1E9IA 4PE8A 4WY0A 1TV7A 1IXOA 1RBOB 1WO2A 3VD9A 1HGWA 3KOZA 1UD6A 3L4WA 1HKMA 4MY1A 4JTDA 4O54A 2QEZA 3QPZA 3O6DA 3WQ4A 1UD8A 3JZUA 3ZSTA 3WQ6A 4K1WA 4QG9A 1VJSA 5BOOA 5E6YA 2QULA 2OWWA 1D9EA 1OF8A 4ECVA 5E9AA 3WUEA 4G2DA 1YDVA 3UR5A 2D0HA 5L9XA 3GVWA 5D03A 1S5MA 4ZODA 1LG1A 4JTAA 4LV9A 2XIOA 3AUOA 1VJZA 1WB0A 3VIMA 2D24A 3OP2A 1S2UA 2Z24A 4FS9A 1M7JA 4NYYA 1L9WA 3QR0A 4E4UA 4A4AA 1JQVA 3AJXA 5FF0A 1RLDA 1WUFA 4ENLA 4F9DA 4DJDA 3G6VA 1B3ZA 3GZ3A 2Z2UA 2C8NA 3T8LA 2FGZA 4HD5A 2WWCA 2BY0A 4Z0JA 3NQMA 1QPQA 1LWIA 4DBWA 2FTYA 1VIZA 4NI8A 3WLNA 4INFA 5CBIA 1S1RA 2W9CA 2G4JA 4YU1A 1BTCA 5I5RA 5ENLA 3VM7A 1JNDA 4EBDA 4GPNA 4MGGA 1DJZA 4CNPA 3P74A 4KH2A 3FOKA 4DEZA 4L56A 4PBFA 3N34A 3WELA 5M2FX 5HR7A 4JIRA 3L67A 3BW4A 5KG6A 4B5SA 2Y85A 4MPKA 5A2CA 4REQB 1T6MA 4ZB5A 5LYRA 1OFRA 1NH6A 1WKEA 5TNVA 1KFBA 2QDDA 5DY3A 1BLIA 4IRDA 3DC8A 4HMEA 1RSCA 5AB3A 4YNGA 3RM9A 3M64A 4H6EA 3WH6A 3IK2A 2WNQA 1B3VA 2OX1A 3Q37A 1E6ZA 4ZQPA 2FTWA 4XVDA 1JJKA 1ZHAA 2VDIA 1WP6A 1WKFA 1EX5A 1EUAA 1N2VA 3L4VA 1SMDA 4FP1A 4Q6XA 4LVGA 2VMFA 5T9BG 3PBWA 4E8GA 3T7VA 4WGHA 2QJHA 3BAKA 3R13A 4Z1DA 3N6HA 3QKEA 3N9KA 3OODA 4TX6A 3TW9A 1J8VA 3BSHA 1SUXA 3W2UA 3VX1A 2IKGA 3BV4A 3UD6A 1UYQA 1QUMA 3M43A 3UU0A 4UQEA 2YX0A 4J2MA 3UVIA 2GSJA 3MU7A 3DHFA 1SJCA 5JBDA 4DY1A 3AIRA 4AXNA 3IJ8A 2PP3A 4QNWA 3HZ3A 4XZLX 5JMUA 1TSIA 1BQGA 3RAOA 2FB2A 3QV8A 3URNA 1LOLA 1LM1A 3UWVA 3CHDA 3A3XA 1ISWA 4YP3A 3ALFA 1X6UA 3VOCA 4I7VA 2OEMA 2PP1A 1AL8A 4IICA 1KBIA 3FVDA 3ES7A 3NPWA 4JTUA 2HJPA 3LLXA 3QR3A 2IA6A 5DLFA 4XKMA 2PWGA 4MOZA 1P4CA 4R34A 4DYKA 4C6KA 3BARA 1E9ZB 2XVNA 5A5WA 2RGMA 4V33A 3GDRA 1GJUA 1KM0A 4JGDA 2UVVA 1Q8JA 1DXFA 1TQXA 3BG3A 3HJZA 2VELA 2OEJA 4KEZA 3NDYA 1Z32X 1E40A 4C1NB 3TAKA 5HQLA 1UA3A 2YYTA 2ZXAA 2VFGA 3O1NA 1JCMP 2C1GA 1JEZA 5CSYA 2JEQA 1CZ1A 3DFHA 3FA5A 2D23A 3LI0A 3RLHA 4KEVA 4LYRA 4J9KA 1SFTA 3LQLA 3PK7A 4DL4A 1CEOA 4JHZA 4MKNA 3IJ6A 3GD6A 3CU2A 3HO8A 2GLKA 4YVXA 5CGMA 1SZNA 5F7UA 4RV8A 1O5KA 4GH1A 4JTLA 3TIMA 5AYIA 2POTA 3RUBL 3MCMA 2OB3A 4Q33A 4QJ4B 7ENLA 2XFYA 2W66A 2X09A 3NDZA 3ONCA 4GVIA 3CHCA 4PSRA 1TJ2A 2WV8A 4UWMA 3RRAA 2BY1A 1UWTA 3RDKA 5AYZA 2VURA 2J7CA 2GGEA 1YW1A 4MB3A 1PHQA 4KS0A 1VENA 2ZFAA 3TJLA 3HQPA 1WE5A 3KCLA 1M7OA 4K1GA 5I09A 3GVGA 1YE4A 5A6MA 2ZX7A 3WIJA 4E3VA 3N2OA 3AICA 3PWIA 4QISA 3SI8A 4PTNA 2Z2BA 3NPVA 3M9OB 1EP3A 1HX0A 1JGMA 5DY2A 3Q8QB 3PB2A 3G1SA 4FLOA 1W8GA 3KHRA 5HWJA 5A8GA 2C0HA 3H8AA 5F4SA 4LC8A 4OTKA 3RLVA 4U4MA 2V30A 1I2OA 4H83A 2NT0A 4UR9A 3AU2A 2A6NA 1FWCC 2TRSA 1UJPA 4N7QA 3WFLA 2OZ3A 3QOMA 4DBUA 1FWAC 3TSDA 1OYBA 2J88A 3NOYA 2C14A 3BW3A 2IUZA 1EP1A 5MKGA 2IMRA 4TR9A 3OZMA 2ZZ4A 4F0MA 2W9MA 3ANVA 4YTRA 3IVTA 3GNDA 4YL2A 1FWGC 4GYKA 4E8DA 3K8MA 2WMFA 4IIBA 4W5UA 3CTLA 1W1VA 1FKXA 3TQ0A 2EXOA 4X9SA 1TRIA 3UR7A 1V3MA 4Z2IA 3EX4A 4GUJA 5FF2A 4W85A 3GZAA 1ECEA 1KFJA 3CIVA 3ID7A 3TOPA 1S5TA 1E43A 3TTYA 4ZVJA 3H24A 3VNDA 4R7JA 4ERGA 4IWWA 5DXXA 2OLHA 2X1RA 4GY0A 4ATLA 4LFYA 1VHNA 4ED8A 3XISA 4H19A 4V27A 3TCSA 4GA8A 5D32A 3U7BA 2AL1A 5L6UA 4IG2A 3QZAA 1ADSA 4PULA 4GUGA 1V77A 1QATA 5CC7A 2YOCA 3EWYA 3VKCA 2J9XA 2QUVA 3HGRA 2PB1A 4K38A 4L9XA 1F2JA 3BC9A 2Z00A 3GG7A 4UQBA 4GYPC 1VRXA 5GNZA 4OBTA 5A95A 1SZRA 4N6EA 1PV8A 3MHUA 4K8HA 4QX4A 3WF4A 1JR1A 4GNKB 2ZZ1A 4K37A 3GG1A 4AWEA 4FS2A 1QVBA 3FXYA 5L1KA 2PDLA 4NRRA 5E93A 3WY1A 4HA4A 5A8OA 3MR3A 4ZO6A 4GHRA 4GRSA 1JI1A 4ZQMA 3ABZA 3VA8A 2D22A 4LUJA 4RJEA 3SY1A 2XH4A 4H9UA 5HJXA 3OGRA 3WCZA 1PX8A 1V79A 1JULA 3LXCA 3AZSA 1QMLA 4MAZA 4Q4MA 5KZ6A 3C0QA 1JDEA 2PGWA 3OA3A 1QNQA 4EP8C 5EA9A 2RHGA 3OU8A 1ALDA 4JQ4A 4R3UA 3QM3A 3HG5A 4F50A 1CWYA 1IXPA 3VABA 2Q01A 2CIPA 1EFZA 4O15A 2WZTA 1OFAA 3FEMA 3O8AA 2OLSA 1XINA 4DJFD 2VR5A 1FWBC 3SQLA 3MBFA 3CPGA 1JFXA 5DG8A 5KT4A 2CWNA 3WUGA 4XTIA 3QGKC 1GVEA 1QI3A 3EWCA 3W7IA 1IT0A 1W1A1 1H62A 3DENA 1QNRA 1QJWA 4MFEA 1VCGA 4DL2A 3H4WA 4I7WA 1UQYA 2VRKA 4Y9AA 2CERA 1TZ7A 3R1ZA 5I2UA 4FOJA 1UP2A 1HXJA 4IQJA 4D9PA 4P8UA 1LG2A 1F4AA 2H6RA 5SWUA 4W9TA 1OFDA 1TB3A 1UHVA 3P3BA 1SW0A 1OFQA 1XLBA 1YDYA 4CN6A 3M7WA 2CBJA 2C13A 3M0VA 2G97A 3NL5A 3CASA 1EO5A 3AQUA 2W3ZA 1B2YA 1NDVA 3IK4A 4GOAA 2OH2A 2GQ9A 4WDWA 2NQZA 2V67A 2A3BA 2WLZA 2XFWA 1QCWA 4AY8A 1BG4A 4G6CA 5K9DA 5LZLA 4O50A 5KFOA 3L2IA 2BS9A 1W9VA 4AVFA 2VL4A 4WDXA 1GOXA 4JFVA 3CUGA 4DWSA 3ZSSA 1JXLA 4LU0A 5KITA 1Z9AA 4GKLA 4QDPA 2TAAA 2ACUA 3EZ4A 3C8FA 1ZETA 1FXQA 3GILA 2XUCA 2IQ0A 4Y8EA 1J6PA 3BDKA 3LLFA 4QXIA 5A6JA 4GFSA 2WO5A 3IJQA 2ZDRA 3KFTA 1OFPA 3TW7A 3NZQA 2EGZA 3C2OA 5G4EA 4JOMA 4HSHA 4JKLA 3DH7A 2NVAA 5CBJA 2HWGA 4XIAA 1EZ2A 2WOQA 1WV2A 1H7XA 2R14A 4L4OA 2X7WA 2VX7A 4ECTA 4YHEA 2V3DA 1RH9A 3GDMA 2IPWA 4HJFA 5I77A 4IFKB 2B7NA 1IXQA 3CWOX 2OZTA 4ECWA 1JPHA 2DZPA 2CU0A 4Q8MA 2X7VA 4DUXA 5CPQA 2IMWP 3DYMA 1PE1A 3MBDA 4LS0A 4TVUA 1XUZA 3DYPA 4WZHA 2X0HA 1TWIA 1E0TA 3VGBA 2YKKA 3LN3A 2YCLB 4YJ5A 5C6MA 1E0XA 3CYVA 2YCJA 3PNUA 1CGWA 4RE4A 5C2GA 5CPMA 1F9CA 3LRKA 3V0UA 3TZNA 4AC1X 4RNJA 2BVWA 2VJXA 3AYSA 1E3ZA 3FDGA 1XLJA 2DV0A 2E6DA 2FZMA 2QCHA 5JIWA 2XGBA 3IJ7A 1KXHA 3VIIA 3VIFA 5DN1A 1IEQA 2AQ4A 4XD4A 3TQKA 4RDZA 1UMLA 4E2BA 4JFSA 4DPPA 4QROA 2VGFA 3O6YX 4A8RA 1NTHA 1OCJA 1TYGA 1PYMA 2D3NA 3T40A 1MZHA 3GFZA 2H8ZA 4PCTA 3LCLA 2DT3A 2JBMA 2EO7A 5J8LA 3CV6A 1W3IA 3ARWA 3DEQA 2ASHA 3FJ6A 2P9BA 3MO4A 4J7RA 4GC7A 5CZSA 3WLMA 4Y8FA 4KIRA 4Q8UA 4AMCA 2V82A 2NW0A 3C2RA 4MHBA 3C3UA 1KR1A 4JL2A 1ZAHA 1FQ0A 4CKQA 1PYFA 4Q3MA 3PWGA 2VD9A 3G0UA 2OZ0A 3OBKA 3R94A 3T6CA 4N9CA 3P81A 3EX3A 2PUZA 1LOQA 1P0EA 2OLAA 2VUNA 2NQJA 3T4CA 3N25A 4A29A 4LF1A 1S1PA 4LUTA 2A0NA 3P2VA 1MVYA 2NLIA 3NZPA 3MMDA 1S38A 3MUCA 5CJNA 2IPGA 5KFSA 4LH8A 2NLYA 4QWCA 2FGBA 1CGUA 1X8FA 1CXLA 3NPXA 2EPHA 3CYJA 4C6EA 2Q09A 5XINA 2GGHA 2ODOA 3LCIA 3T78A 1KM5A 3LUTA 1ZP3A 2ZA3A 4LRTA 1UWUA 1TPH1 5IBXA 1XC4A 4K8EA 1T7LA 3BV7A 4AD4A 5L1JA 1V3IA 3N04A 3R12A 1HIZA 2VDGA 3DKLA 2AQWA 2PFHA 3MC5A 3ISIX 4IPJA 1KCKA 3NQ7A 1OGSA 3HGJA 2BHZA 3IVSA 1PHWA 4ORMA 4H6KA 4QEHA 3BLIA 4DL7A 2C3ZA 1TWZA 3AIEA 4L7ZA 3RM8A 1IXNA 5DMYA 5HNUA 4HTYA 4U5KA 3SIZA 1ONXA 3H4GA 4NX5A 3E02A 4DM2A 3VMPA 2D2HA 2EHHA 1ZBKA 3BJTA 1S39A 2CBVA 3PULA 1E4NA 1HVQA 4HU0A 4RNIA 3ZJ6A 3MWCA 2GZXA 3DHDA 3DUGA 1EL3A 4S3AA 4C1LA 5A6TC 3P8IA 2WSQA 3L68A 3S3GA 3OVPA 5EMMA 1ICSA 1AODA 1GQLA 4QW8A 5LXEA 4J3TA 3QXBA 4IQLA 5DGBA 4TXEA 4CNTA 3W7EA 1EPXA 4DJFC 3H7UA 1KXTA 1HGYA 1YPXA 2ISDA 4RNMA 4UNIA 3C2YA 2AQVA 3SGZA 5BOEA 1MYRA 1XSIA 5FF7A 1B30A 5GVJA 1S0OA 5IHSA 4J3WA 1B54A 5C5JA 1VYPX 1VZWA 4WKHA 2DJLA 1OG0A 1XRSA 5HQEA 2UVWA 3SFKA 3GB6A 1NWUA 1OC7A 3W6MA 1AZ2A 3EMQA 5GJNA 2YLLA 4ZR8A 1X6NA 3I6TA 2ZUNA 4TTUA 5G4WA 2AAAA 3JUGA 1Q7QA 1M7PA 1UA7A 1CLVA 2ZRXA 3QW4B 2FMOA 5AVNA 3ABXA 1FX6A 1DHKA 5DELA 2UBPC 1EGVA 3SADA 4IGHA 1ITQA 2OXNA 2SFPA 4B92A 4RR4A 4YHGA 1P6CA 2QCDB 2XJ7A 3U2ZA 1DWGM 2F8QA 4WXYA 2R1NA 3IVUA 1KC7A 3RPDA 1EO7A 4B2DA 2WVVB 3VKJA 2C2RA 1LLWA 2Q8LA 4PMNA 4AIEA 4DB7A 4RUAA 5HR6A 1KRMA 2I9UA 3VIOA 5LGZA 1VPQA 3W7HA 3KBNA 2Y61A 3GHSA 5KMYA 1KM6A 1WUEA 3JU2A 1J12A 2W92A 4UOZA 1GHRA 1H2JA 2CCRA 3B8SA 5CPSA 5KFEA 4HZ6A 1E6SM 2QJJA 4EPDC 2QCGA 5FSEC 4DZ5A 1K02A 4PB5A 2G50A 4M6PA 1OX4B 5EMKA 1XHGA 2WVTA 4PH6A 3PUDA 4ADTA 4DO7A 3P60A 1FWFC 1T96A 4EVZA 4B5XA 2O56A 3FA4A 4ROQA 1KBBA 5D2WA 2GL5A 5KFGA 4ERAA 2ABBA 1XI3A 5LNSA 3ZVIA 1HL9A 1XICA 3WFAA 4JCMA 4XSMA 6PTDA 5JUVA 1CXIA 3ZLHA 1EC7A 2V3GA 4KGLA 4NVTA 4XZNX 3CIXA 3W28A 3H4DA 3NQ8A 3H54A 3KCJA 1EDTA 3WYZA 5K4XA 4JKMA 1UIPA 3LSBA 1X38A 1A53A 4N9DA 4JTJA 1KR0A 2C91A 1OK4A 4FS1A 5KT5A 2CLIA 4H7CA 2PDKA 2C2EA 2J62A 5LKYA 3ARYA 1RD6A 3EXSA 1A5AA 1O4UA 1Q7MA 4S3JA 5EPDA 4A05A 3OGSA 3KZSA 4X9YA 2B4GA 2J77A 2G8ZA 4PGLA 4PRRA 5ABEA 4JEQA 2JQXA 1DPMA 3DFTA 4XO6A 3WFZA 3K4DA 1UOKA 3L21A 3KDNA 3DBPA 5D33A 1HG3A 3WSUA 1QTWA 4JV2A 3CHEA 1V7AA 4WJ8A 2EJAA 2VEFA 5C8BB 1BD0A 2F2KA 3BG9A 4PUWA 2WPGA 4DN1A 3W27A 3H2AA 1FRBA 2DT2A 3QZ6A 2FDSA 3W81A 4GQBA 3N9RA 1MUCA 1UC4A 2DU2A 2PP0A 1KCLA 4TMCA 4CD5A 4F4WA 2R8GA 3B9OA 5CC3A 1MI3A 4MB1A 2NXGA 1J0JA 3JRKA 4C65A 3B9AA 4HZ8A 2YL8A 4CEUC 3D47A 3K8LA 3CMGA 1FTXA 1WOBA 1R86A 4EPEC 1YTDA 3TEVA 4MWAC 3TZFA 4DJED 4NZ3A 5H8UA 4H9VA 3B4UA 3PW4A 5D30A 4GZJA 4IISA 4U10A 2IQDA 3AS0A 1JZ3A 2A85A 4Y9MA 4O1AA 4L5ZA 3FXGA 4PTMA 4S39A 4F2TA 4R8UB 3WBEA 3S2MA 2PRHA 3L5LA 2OR2A 4ZOEA 4C7GA 2ONEA 4I8YA 1SJAA 1Z42A 1JG9A 5LNRA 4B9ZA 3B06A 3S2CA 2Y24A 2AGKA 4O3SA 1EGZA 2YZ5A 1MXDA 5JQ9A 1UKQA 1BXBA 4L4PA 4GIEA 5FKYA 2IKIA 4NKCA 3MR2A 4LRSA 3GDLA 4B90A 1KM1A 1BTMA 4FB7A 4Z2HA 2ZA1A 3K46A 1PXGA 1DEDA 3W00A 3FDKA 3EOUA 3IANA 1PWMA 5D9PA 2A2IA 1M5WA 1F07A 4UQCA 3SRDA 1GZJA 4M0XA 4N6FA 1ML1A 3GIYA 3ITYA 1W5OA 2PDMA 1MRQA 5KT2A 2BZNA 3UZJA 4WGXA 3PBVA 2BSLA 4Q45A 2QVNA 2OFJA 1KQYA 3T0AA 3WLTA 1D7KA 3M5VA 4AW7A 3LHYA 1EH9A 3PZVA 1Q2RA 1GWJA 4MNLA 4JEJA 4RE0A 4I7UA 1V51A 4D1IA 2QS8A