2QT3A

Crystal structure of n-isopropylammelide isopropylaminohydrolase atzc from pseudomonas sp. strain adp complexed with zn
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
401
structure length
401
Chain Sequence
KDFDLIIRNAYLSEKDSVYDIGIVGDRIIKIEAKIEGTVKDEIDAKGNLVSPGFVDAHTHMDKSFTSTGERLPKFWSRPYTRDAAIEDGLKYYKNATHEEIKRHVIEHAHMQVLHGTLYTRTHVDVDSVAKTKAVEAVLEAKEELKDLIDIQVVAFAQSGFFVDLESESLIRKSLDMGCDLVGGVDPATRENNVEGSLDLCFKLAKEYDVDIDYHIHDIGTVGVYSINRLAQKTIENGYKGRVTTSHAWCFADAPSEWLDEAIPLYKDSGMKFVTCFSSTPPTMPVIKLLEAGINLGCASDNIRDFWVPFGNGDMVQGALIETQRLELKTNRDLGLIWKMITSEGARVLGIEKNYGIEVGKKADLVVLNSLSPQWAIIDQAKRLCVIKNGRIIVKDEVIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-isopropylammelide isopropyl amidohydrolase
publication title Crystal structure of N-Isopropylammelide isopropylaminohydrolase AtzC from Pseudomonas sp. strain ADP complexed with Zn.
rcsb
source organism Pseudomonas sp.
molecule tags Hydrolase
total genus 157
structure length 401
sequence length 401
chains with identical sequence B
ec nomenclature ec 3.5.4.42: N-isopropylammelide isopropylaminohydrolase.
pdb deposition date 2007-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2qt3A01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2qt3A02
3F4CA 3D6NA 4R88A 3MVIA 1GKRA 1EYWA 2HQAA 2OGJA 3FDKA 4AQLA 4PCNA 4HK5A 4H00A 4NI8A 2Z2BA 4E3TA 3E38A 4I6VA 4DI9A 1A5MC 5FSEC 3ISIX 1PTAA 1EZ2A 3K5XA 3QGAC 3LGGA 1FWFC 2RAGA 2IMRA 3GTHA 2QVNA 3LY0A 3R0DA 1UBPC 3MKVA 4QS6A 3LGDA 1V7AA 1VFLA 3GTXA 1FWIC 4IFKB 1P6CA 3NURA 4H9UA 4UBPC 4TQTA 2P53A 2D2GA 4YIWA 3F2CA 3GU9A 4GX8A 1XGEA 4J2MA 3F4DA 4XD4A 1E9YB 3GU1A 2E25A 1RA5A 4L9XA 4ICMA 3S2JA 4GZ7A 4H01A 4LFYA 3UR2A 2VUNA 4RZBA 3ICJA 2VR2A 3G77A 2ANUA 1QW7A 1W1IE 3OQEA 4LANA 1NDWA 1PSCA 4IF2A 4JOMA 2Y1HA 4C6IA 1GKPA 1WXYA 3TN5A 2FFIA 1I0DA 3HTWA 3MVTA 4HK6A 3CS2A 2PUZA 4GX9A 2ADAA 1RA0A 2R1MA 2HBXA 2EG7A 4BY3A 2I5GA 2AMXA 4MUPA 1ONXA 3OJGA 3PNZA 4PBEA 4RDYA 2YB1A 4R85A 4QROA 4BKNA 4DI8A 4GOAA 3B40A 2VHLA 4C6DA 2HBVA 4PCPA 3TN4A 3A4JA 2PLMA 3E2VA 4HA0A 4C5YA 3RYSA 2Z24A 2Q09A 1ONWA 4XD5A 2Z25A 4DYKA 4IFKA 3N2CA 1ITQA 1FWDC 1NDVA 4KEUA 4LEFA 2VC7A 2UZ9A 3RCMA 1YMYA 1YIXA 3PBMA 2QS8A 4I6KA 1EF2A 4CNSA 2A3LA 1YBQA 3OOQA 2Z29A 3E0FA 1QXLA 4EPKA 4EP8C 2Q01A 4C6PA 3A3WA 4DIAA 3AU2A 3QY6A 5FSDC 1KRAC 3E74A 4ERAA 1DPMA 4C6CA 4G7EA 1FWEC 1FKXA 2Z2AA 2WJDA 3IGHX 2R1KA 3URBA 1V51A 4WGXA 4V1YA 3T81A 1A4MA 3OODA 2PGRA 3TNBA 4DO7A 1I0BA 3ITCA 4B92A 4F0RA 2FVKA 3ID7A 3K4WA 3URNA 3JZEA 4CQCA 1R9YA 4HK7A 4DZHA 3PANA 1FWCC 3UPMA 1EJRC 4LAOA 4H9VA 1J6OA 3QY8A 4ERGA 1IE7C 3MTWA 1ZZMA 3MDUA 4RDVA 3NQBA 4KQNA 1PB0A 4UB9A 3AU6A 2XIOA 2OOFA 3LA4A 4GXWA 1EJXC 4ZSUA 3DUGA 4CQBA 4B90A 1ADDA 2Z4GA 2HPIA 4IG2B 4LCSA 2Z28A 2FVMA 4C6NA 3WMLA 4DNMA 1PO9A 2VM8A 4QSFA 3E0LA 2OODA 1M65A 5CH9A 4D8LA 2GOKA 3GIQA 3LSBA 3WZ0E 4LCRA 1POKA 2DVXA 3GU2A 1A5OC 2Z7GA 1R9ZA 2QPXA 3T8LA 3OVGA 1J79A 2I9UA 3GIPA 4M51A 3URQA 1EJTC 1BF6A 3LU2A 3GGMA 4KEZA 3DC8A 3UR5A 4B91A 4C6OA 4IH3A 2O4QA 3QY7A 4XAGA 4HJWA 2AQVA 4H9MA 4Z42C 1KRCC 4LAMA 3UBPC 1R9XA 1V4YA 4GYFA 4LALA 4J5NA 2FTWA 2R1NA 2P9BA 3E3HA 5A6TC 1J5SA 3SFWA 1WXZA 1RJQA 2GWGA 1YRRA 4GK8A 3IARA 3AUOA 4EPDC 2D2JA 5HMDA 2PGFA 4XAZA 3PAOA 4C6FA 3URAA 1UMLA 1XWYA 3BE7A 2Z26A 1K6WA 2WJEA 1M68A 1KRBC 2D2HA 4IG2A 4CNTA 4IQJA 3UF9A 1FWAC 1P1MA 1P6BA 4ZSTA 4C60A 4RDWA 3DCPA 3GRIA 3IACA 3O0FA 1EJVC 3S2MA 5HMFA 4KETA 4L6DA 4C6KA 4C65A 1YNYA 2GSEA 2BGNE 1M7JA 3S2NA 1JGMA 1EJWC 4C6EA 1EJUC 3F2DA 4P5UA 1NDZA 3EGJA 4F0SA 4XD3A 3GTFA 2PAJA 4CNUA 1A4LA 3RN6A 4KERA 1FWJC 1GKQA 4DLMA 1S3TC 4KF1A 4C6QA 3WYZA 1E9ZB 2GZXA 4GY1A 2OQLA 4EPEC 3T1GA 1K1DA 3FDGA 4LCQA 2CZVA 4H9YA 2VC5A 2R1LA 4IGMA 4IGNA 3EWDA 4R7WA 1RK6A 2ZC1A 3A3XA 1RJRA 3GG7A 2ICSA 3MDWA 2DVUA 2AQOA 2W9MA 2BB0A 3GTIA 4QTGA 4KIRA 2QT3A 1KRMA 3IV8A 2YXOA 1NDYA 1NFGA 4H9XA 2E1WA 4F0LA 5E5CA 4EPBC 2HNHA 1FWHC 5HMEA 2YB4A 5AKQA 1UIPA 3C86A 2FTYA 2WJFA 4PE8A 5LXXA 4G2DA 2F6KA 1J6PA 3MSRA 4RDZA 4DZIA 3FEQA 1FWGC 4XAYA 3MPGA 4LH8A 4RE0A 1KCXA 4H9ZA 3GUWA 4V1XA 1POJA 4C6BA 4OFCA 3MJMA 3B0XA 1YBQB 1ITUA 4XAFA 2GWNA 3S4TA 3RHGA 4NP7A 1A5NC 4WHBA 4BJHA 5G4HC 3IPWA 1RK5A 4GY0A 2O4MA 1O5RA 4GBDA 3LSCA 3LS9A 3LNPA 4QS5A 2EG6A 4G7EB 4KEVA 3F2BA 4C6JA 4DLFA 3NEHA 4C6LA 1UIOA 1V79A 3HM7A 1FKWA 4NG3A 3TN6A 4XD6A 1EJSC 3EWCA 2WM1A 3ORWA 1K70A 2HPMA 3CJPA 2Z00A 3SO7A 2UBPC 3S2LA 4C6MA 4INFA 1RJPA 3K2GA 3HPAA 4CQDA 4H9TA 4PBFA 1V77A 3TN3A 4IFRA 4CEUC 1A5KC 4J35A 1XRFA 1XRTA 4AC7C 4CEXC 3QGKC 2P50A 3IRSA 4WVXA 2Z27A 4IFOA 3CAKA 4KESA 2R1PA 3PNUA 3V7PA 4B3ZA 2KAUC 4GC3A 3IJ6A 2YZ5A 2G3FA 3OU8A 4LAKA 1A5LC 2OB3A 3KM8A 4C5ZA 4ERIA 2DVTA 4GY7A 1HZYA 1O12A 4QRNA 2EG8A 3O7UA 1RAKA 1FWBC 3B0YA
chains in the Genus database with same CATH superfamily
5A8MA 2FZBA 2BHUA 4U2ZA 1DQXA 1GOMA 1CDGA 1X8FA 3B06A 1RLDA 4J27A 3CT7A 4M3PA 4PTMA 3SIMA 1XLMA 2AAMA 3KL0A 1KM0A 1YTKA 1PTAA 1E40A 4ZQNA 3L23A 4PEKA 3M4HA 1XGZA 3SIZA 2QCHA 1TVNA 4CGTA 2DT1A 5K7JA 1H7WA 2PDLA 1Y5WA 1RCOB 4I8DA 3OGVA 3CLMA 3EEGA 1XRVA 4IFKB 3CU2A 3FKRA 3STGA 5G5IA 1XINA 4JKLA 1XFCA 1AH3A 2GQAA 4HYVA 1OX4A 2J25A 4W86A 5FKYA 2X40A 2H6RA 4DEZA 5KFJA 3KHJA 5FEPA 4Y9PA 4HYWA 2DZSA 3GXTA 1F2JA 2D73A 1T7LA 4AY1A 1XYCA 3H26A 3LPPA 4GO8A 1QOPA 4PL2A 1D3CA 1SPQA 1IEWA 4PTVA 2VA3A 2IKHA 2EHHA 1XH0A 2DY3A 1ONXA 1EA9C 1E3ZA 3PNZA 4PBEA 4O0KA 2WO5A 4QM1A 4C90A 3WNOA 4AX6A 1Q45A 5A8OA 5CLWA 1W1ZA 4LS2A 5JQ9A 1XP3A 1ONWA 3N2CA 1FH9A 1CPUA 2ASLA 1DE5A 4GRSA 4GCXA 1FWSA 3DKLA 1D9EA 1E72M 1WKEA 1JD7A 3UVIA 3NXLA 2PDNA 3P7YA 2ZZ7A 4GUJA 1GEHA 3REQB 3WBWA 4L4MA 2A85A 3LI1A 2XZ9A 3PR5B 4W5ZA 1YXYA 3N1AA 3FXYA 1GGOA 4M82A 4Q7IA 1JDCA 4NAFB 2EPMX 1P0DA 3HGJA 1A4MA 3EOOA 1NIUA 1S2VA 3L4WA 1ESWA 3SCSA 5LKYA 1EUNA 5I78A 4DHGA 1TCMA 1W5MA 3WNNA 1E6NA 1RY0A 4PMUA 2W6RA 4HD5A 3UG8A 1V3HA 5AN7A 3H7VA 5E0FA 1J6OA 3UU0A 3MUXA 1GTHA 1XLEA 2Y63A 4RDVA 5EFFA 1Y5XA 2WJZA 1W1PA 3KBVA 3ONCA 4ZSUA 3MP3A 3WJZA 4CQBA 3KE0A 1VRXA 2J79A 1V8EA 2QJGA 4QIUA 4PMZA 4QSFA 5LZLA 1UR9A 3PR4A 4Q4OA 4QP0A 4CVUA 5D4YA 2VUYA 4WOQA 3HQNA 3WJSA 3TAOA 4D8LA 3MR3A 3WZ0E 2AGPA 2WNNA 2ZX7A 3GU2A 1J2BA 3OHAA 2IKGA 3TEVA 1YDVA 3L4XA 4IP7A 1JUEA 1BF6A 2CZDA 1R38A 4EX4A 2LLEA 1JUBA 4H3DA 3ABSA 1ISWA 1JVNA 2DZWA 5TBOA 2FZDA 3WH8A 5A1AA 3AC0A 2Z1VA 5A69A 1ODUA 1PZ1A 3G0SA 1TE6A 4JFSA 5L6UA 3G1SA 3FYPA 4LT9A 4WSJA 2IPWA 3H4GA 4JDYA 3VE7A 4PCFA 3PTKA 1DJWA 4FAMA 2XH4A 2OMAA 2RGLA 1Y8BA 5FI8A 3W6LA 1K9DA 3A4XA 2EPHA 2A3EA 4HHHA 3VDGA 3PUDA 3IACA 3VZZA 4QX4A 3BURA 1XRSA 3ZJ7A 2BGNE 4GUIA 3S2NA 5LXEA 1O94A 4O1DA 4UWMA 1LUCA 4PL1A 1Q6LA 1MZRA 1ECEA 1JCLA 3T0AA 3LRKA 4G7FA 1M9HA 4XUGA 4GY1A 2EO7A 2H8ZA 1OD8A 1Q63A 2CZVA 4H7CA 5GPRA 5PTDA 3B05A 2RDUA 4ED2A 2VR4A 1TR9A 3GTIA 4HIBA 3EWUA 5LYRA 4XSMA 2NQJA 4L56A 3M16A 1ISZA 4XZIA 1VF8A 5FF3A 2WJFA 2Q3RA 3GQCA 1J0IA 3L2LA 4J3ZA 3KHHA 4PH6A 1J0HA 3NL2A 5CG7A 4V1XA 4PUKA 1H2JA 2W63A 1EBHA 4FALA 1JCYA 1O68A 3CUIA 1GTEA 3EMQA 4Q4PA 4Z2HA 3R79A 3GIYA 1NELA 2UVUA 1D8WA 2GSHA 4U4MA 4RW3A 4E4PA 5KZMA 1NEYA 3AIVA 3WJWA 1XIIA 4HU3A 4NVTA 3OB8A 4DJFD 3UG4A 2P3ZA 3ORWA 5C70A 4HNLA 2AL1A 1OD0A 3NDYA 5E6YA 3QFEA 4LAZA 3N14A 4V2XA 3UETA 2AKMA 3G0XA 3DOPA 1NFBA 1W8SA 2B0MA 3KBWA 5A8GA 4DUOA 1NU5A 3P62A 4HZ8A 1UR4A 1ECQA 2WHJA 5ECVA 2QNEA 4MNMA 5E0KA 4TR9A 4NXKA 2JEGA 5H8MA 2E6AA 3L0GA 1OGSA 3QBUA 2AMGA 3BL3A 5IHSA 5D2YA 1FDZA 1S38A 4DBUA 2XUCA 1NJJA 1R7AA 1L6FA 1H4PA 4XVDA 4EF9A 4N0RA 1SJAA 2YW3A 1EX1A 4R88A 3HGSA 4XZLX 1UOZA 3TE9A 1MW1A 1VR6A 2EAWA 4HU0A 4TU1A 4HNOA 4HTBA 3DFYA 2DZVA 3QHNA 4F48A 4WSKA 1MQQA 4JNZA 4QQUA 4HNNA 3GNPA 1GOOA 1WOBA 4IHCA 4MKVA 1E6QM 3KHRA 3R2GA 4FS1A 1FY6A 3DFHA 5TD4A 3TZNA 1ICQA 4FX6M 3VOHA 5T26A 1UROA 2IMRA 3BC9A 3GTHA 1X98A 2CU0A 3CASA 3W07A 1V0KA 3G24A 4HMEA 3OVRA 1J93A 1WDDA 5LIUX 3SCQA 2CBUA 1OB0A 2J7GA 4MJMA 1GW1A 1KBBA 1WZMA 4NF7A 3A4WA 4XD4A 3P8IA 3TA9A 1XXXA 4FO4A 4CD4A 5KSWA 4GQQA 2E9MA 3ICJA 1QATA 3N29A 1OCNA 3PTDA 2C19A 1LWHA 3K46A 5H6HA 1KTNA 5J5RA 1ZJIA 4O13A 3GC2A 1SR9A 3H24A 4IF2A 3MVTA 3IV3A 1GZGA 2GFTA 3R11A 3IUDA 5BRPA 4PMQA 3W82A 3OTRA 3QHMA 5TF0A 2ZUMA 2WVVA 3ARXA 3NQCA 4B2DA 4DI8A 4BKNA 1PX4A 3VTRA 8XIMA 2J66A 2YSWA 1F9CA 2OLSA 1SR0A 3TYBA 4D6JA 4LVFA 3S42A 3AYRA 2B4GA 3RYSA 3RRAA 5DF0A 2OU4A 4PRWA 1F3XA 4ZGYA 1X6UA 4DYKA 4PYSA 5F9NA 5AVHA 3TQKA 1SZGA 6PTDA 1KFEA 3THDA 1K8CA 1ENUA 2G3NA 3O9NA 1S0OA 5D2XA 1G5AA 2W62A 2ZXAA 1CGUA 4JEJA 1B2YA 4JN6A 4HOWA 1B9ZA 2DSVA 1OIFA 4CN1A 3MC5A 4AIBA 3SN1A 3WLMA 3R12A 1DPMA 4Q8MA 4J7RA 3ZJKA 4K1GA 3C3NA 2P88A 4GYPA 4WGXA 1SVDA 4V1YA 5H8PA 3F7JA 3W24A 2J9ZA 3CXOA 4DO7A 4QQ3A 1QHPA 3IUIA 2Y7FA 2ZFAA 1AMYA 1JI2A 4TTUA 1VHCA 1OSEA 1EPXA 4Y7EA 3PP7A 3PZUA 3AWNA 2W5FA 1A53A 4MY9A 4ZFMA 3QJAA 1FP8A 3FA5A 3VK5A 1DWFM 4JN7A 2OOFA 5H1WA 3N04A 3A13A 4KWVA 4GG9A 3KLKA 3NFUA 4DL7A 1RHCA 4ED3A 1LYXA 4N42A 2CITA 5CPLA 3NQVA 3GIQA 3R8RA 1VCGA 1IEQA 4TX9A 1QNOA 2QPXA 3OQ8A 3DFSA 1SO6A 3WJXA 1R2TA 1W9PA 4MLJA 4HU4A 1UC5A 2QCDA 4NASA 2VFDA 4NYYA 6A3HA 3H12A 5KG7A 3Q8QB 3EPNA 3CQ0A 3RX4A 4J5NA 3SUSA 5L1LA 3ONBA 4JIQA 1V3MA 2GWGA 3ZZ1A 1YXCA 1XBXA 2ZTKA 4GBUA 2KX9A 1BF2A 1MQRA 3VOJA 4YTRA 4MDOA 3R94A 1R3SA 5DQHA 2NUXA 2OTDA 5C9WA 2WYSA 4HA4A 1U1UA 3H4DA 4PMXA 3TJIA 5CC7A 3CIXA 4LUSA 3W71A 3P81A 4Y96A 1XYBA 2FMNA 4HN4A 1FHVA 4L6DA 2ZX8A 4YVPA 4W8AA 1A3WA 3NVTA 3SY5A 3ARTA 3AOFA 1Q2RA 1X39A 1LG1A 3TWAA 4F4RA 3E2RA 3NPWA 3RCYA 4S3JA 2PS2A 4JUZA 4DUXA 4OUEA 1BLIA 2GZXA 1XI3A 4D8ZA 3QZ8A 2Y4SA 1B3WA 4URIA 2FKPA 2O7QA 2VX7A 4ML4A 4MSSA 1K9EA 5A6JA 1UYQA 4DJEA 4E6MA 4F0KA 3IUHA 4D6EA 1YPIA 3MS8A 2GK1A 3LHUA 3KCJA 4XIAA 3W27A 1XYAA 1S1RA 5H2ZA 1WUEA 3BMVA 3IV8A 3RBDA 3PHAA 3SRFA 3UXIA 5E5CA 2WSRA 4PUEA 2OXNA 2DSWA 2WHMA 3CL7A 1YPFA 2Z1SA 2FTYA 4PTDA 2WOQA 1BVZA 1L6GA 3R8HA 1BXBA 4GE8A 1TIWA 4YS1A 4K3ZA 3W7JA 1PX3A 3EZ4A 4RE0A 3NM3A 4AH7A 1EFZA 3RX3A 2JEPA 3PTMA 4ASTA 4OFCA 4OIFA 4ZQRA 5M2FX 1LRQA 2YXGA 4AWSA 2W9BB 1A3HA 4ZOBA 1BRLA 3RHGA 2UY5A 2H9AB 1S46A 4K2SA 2OELA 3W81A 5B7YA 1O5RA 4QDMA 3K8KA 3AO0A 1IHIA 4A2RA 4NKCA 1GOXA 3T7VA 3PZNA 3GXIA 3PTQA 1DWGM 3NEHA 2P0OA 2CC0A 4UTWC 4BWLC 1QASA 1H1ZA 2D69A 4JICA 2QPSA 4JYEA 3HMJG 4LVBA 3K2GA 3HPAA 3KTCA 1KM1A 3LHYA 3N13A 3U5YA 2DPJA 1BQCA 2P50A 3UXAA 4JFWA 5BRQA 1KXVA 1LL4A 1R3TA 5I00A 3NYDA 1JDDA 8RUCA 2R8WA 3NSXA 2BVTA 3EA2A 1XR2A 3PZPA 1JAEA 4O18A 2WZIA 4REQA 3DEQA 2EG8A 2ZRWA 3ABOA 4NJHA 4AC1X 3RNDA 2GVYA 2NV9A 3WFZA 1XBZA 2BHYA 3GE7A 3IK2A 4P2VA 1TV2A 2Z2BA 2TYSA 3RAQA 1EL3A 4KGLA 5KFAA 3BDKA 1VFUA 2PDPA 1LWIA 3LLXA 3QSTA 4KRTA 1F73A 3KCOA 4JTIA 1NWUA 1CGYA 1NM9A 5FOOA 3VUPA 3S1WA 2JIEA 2BXZA 1RA5A 4AHOA 5KEZA 2JK2A 4RPPA 3OSPA 4HNCA 3W37A 5KFZA 2GGHA 4AU0A 1LP6A 5FESA 3T5KA 4JQ1A 2PTYA 3BGAA 1UZDA 4GC6A 5D2TA 4LWWA 3BXWA 3C0LA 2G3IA 4AUBA 5KZEA 4ATLA 2VEFA 1H7RA 5A5WA 4ADUA 4PMOA 3H2NA 4PMYA 2F61A 4H2HA 3AQUA 3OJGA 3WH7A 5REQB 2QJIA 4PZVA 3WQWA 3B40A 3M47A 3S9YA 3A4JA 5KFOA 4NQ1A 4C7DA 4DRSA 1K9FA 1E9LA 4AIOA 2RFGA 3W72A 4B3KA 3MR5A 5J5DA 1W17A 3IEBA 4KWUA 1BKHA 2PGWA 3VILA 3UA4A 3IJ8A 2IXUA 5C5YA 1OQFA 5F4XA 1QDSA 4QAWA 3UWWA 2G37A 3GHTA 4M80A 4JD4A 2RH9A 5KMYA 4GACA 4EPKA 3ES7A 4M6PA 1JR1A 3QY6A 2VP8A 2OWXA 3H7RA 4ECQA 3TXZA 4ERAA 3K1GA 3OSNA 4H8HA 4JXCA 2D0HA 3OODA 3WLJA 3NQMA 2ODOA 1UQYA 1ZCCA 4D6DA 4RNIA 4J3UA 5CXPA 1AA1B 4NZCA 3WH5A 5FJPA 1R9YA 4IGHA 2WHLA 2POZA 3B8TA 1KKRA 4H9VA 3VFCA 4ECLA 3DERA 1T41A 5CPNA 2PC4A 5CEWA 1HL9A 1YNPA 2DT0A 3GXPA 1G67A 5IM51 1UOKA 3TOYA 1J0ZA 1LTDA 3XINA 1E70M 1AJ0A 3M0LA 4DUVA 3IS4A 1K3UA 5U4NA 3WMLA 3RGTA 3MYOA 2B7NA 2FHBA 3W7EA 4YU1A 1KC7A 3KOZA 4DVOA 4E2OA 2WSYA 1FXQA 3OBKA 2D3LA 2NVDA 3C8NA 3QR0A 3C52A 3RPMA 3A12A 5ABTA 1UKPA 2A3BA 1IEVA 1XCFA 2F84A 6REQB 3O06A 2DZUA 2O4QA 3NDOA 1AD4A 4ZO6A 4Q43A 2O55A 1WUFA 2GGIA 3L2IA 5I7GA 4Z2GA 2XIMA 1V4YA 1EOMA 2XM2A 3SN4A 4KRZA 2PDKA 1YX1A 3PZVA 3AYVA 5DCDA 1Q6DA 3OYXA 2IS7A 1BD0A 2D2JA 1TVPA 1I8JA 4C7GA 4ZVJA 3W87A 3GIJA 3THAA 1XWYA 2WMIB 4DL4A 3H70A 1DJIA 2QCNA 4CNTA 3C0SA 2W92A 2XISA 2QDDA 3UCQA 2INZA 4RL3A 4LB3A 3HZ3A 3B97A 4AD4A 3ZVHA 1XHGA 4C6KA 2BBFA 3S3GA 5KFMA 4LTSA 4JIIX 3AHXA 4GZIA 3BMWA 1XJBA 3DYPA 5K9XA 1MZHA 3G1VA 1O4UA 1EJUC 5CPMA 1E0VA 1G7VA 5E9XA 3GIKA 1E0XA 3BOXA 4LVAA 4UTTC 1T3NA 4UMCA 4KF1A 1FRBA 2G50A 4ECXA 3W7LA 2HMCA 4O1FA 3T09A 2V6AA 3WKZA 1REQB 4XISA 2E9LA 3TTQA 5C0QA 2UY4A 3HGRA 1NWTA 4DL3A 3T55A 3ARVA 3M44A 3OBAA 4NX5A 3UWEA 2X42A 3QLLA 1RK6A 5DFAA 5LGXA 4IX0A 2DVUA 4F4ZA 4C7FA 2WAGA 4L65A 3M41A 3FJNA 4YPJA 2XN0A 1FCVA 3OLDA 5JUMA 1FA2A 1H1YA 1FWHC 5T9CE 2XN2A 5HMEA 3H4BA 1UD5A 2V8ZA 1B4KA 1UPPA 3C86A 3LTYA 1OC7A 2DSKA 1V0MA 3PG9A 1NQ6A 1BYDA 4UOQA 3C0QA 4S3AA 4HTYA 4RUAA 5AC4A 2VWTA 3UZWA 1HJSA 4CD5A 1IZKA 1KCKA 1QPRA 2QVHA 3MUCA 4ILSA 3N2OA 3ALGA 3WUBA 1VPQA 1V03A 2EG6A 4AVFA 2J7EA 3ITGA 1FUYA 1KBKA 4YXGA 2D2OA 2W7OA 3QYSA 4I7UA 1T8XA 1BHGA 1P6WA 1BAGA 3AMLA 5ABEA 3NL3A 3NQ2A 1E4LA 3N2MA 3QOMA 2ZA1A 3GXNA 3KDNA 4IFRA 4CEUC 1A5KC 2DPIA 3WLPA 5CQ1A 2VGFA 3IRSA 1OC5A 1YKWA 1U83A 3FGCA 4WY0B 4PGLA 2EPOA 3LN3A 3C5QA 3MSYA 2ZZ3A 3GAYA 1QO2A 4DJFA 3AIQA 3EWXA 3O7UA 5GVJA 4J3TA 3TR9A 4AAJA 4NAEA 4O54A 4UNIA 5BCAA 1OVDA 3PWAA 3D6NA 1CECA 3CHDA 2V38A 3KBJA 1GKRA 1SSDA 1JNEA 4QE1A 3MMWA 4AF0A 2A6NA 2FYMA 3G6MA 4E3TA 4FLOA 3ISIX 3CZLA 4YYFA 4RCXA 4F4YA 5KFGA 2Y7EA 3LGDA 3A6OA 4OBSA 2G3JA 4DL6A 1YE6A 2CIPA 2O7SA 2WXDM 5CZTA 1G4PA 3HG2A 1H61A 6CGTA 3UY7A 4E4FA 2VR2A 3BV4A 3BGGA 4XZWA 5HJLA 3WK0A 3SCNA 3ZSSA 1LDCA 2QIIA 4IPIA 3S6DA 3EA3A 4C6IA 5JIPA 1GKPA 4ZBCA 3TN5A 3W85A 4HK6A 2E5CA 1HTIA 3TDFA 2HJPA 3B8DA 2C1HA 4N9CA 2ABAA 5I3DA 3N15A 2UY2A 4ZEPA 5LA0A 2CHRA 4C6DA 3TN4A 1W1TA 3RM9A 4ED8A 3GVWA 1ZL1A 3GV7B 2WMFA 1TJ1A 4C5YA 1C29A 2F38A 3UJFA 2Q09A 3VMOA 2VFGA 4ZQCA 2VOMA 4LRTA 2BG5A 1KW1A 1S39A 1X96A 4IL2A 1JZ8A 1ITQA 5BOEA 4WDUA 4S3DA 3KWXA 1GQLA 1TWIA 1R3VA 4JIEA 4TXEA 4A3QA 4BEUA 1UKSA 1OINA 4JTHA 1YBQA 1QOXA 3KEHA 3R58A 1QXLA 4EP8C 3QR1A 3MR2A 1LG2A 4NUWA 2GQ9A 6TAAA 4BFAA 4UMAA 1AL8A 4Z2LA 5FEWA 4HMCA 1FKXA 5IDZA 1S2UA 1JIHA 3TK7A 3OZYA 3O1NA 4B3LA 3TNBA 1VLWA 3C2YA 3WQ5A 3K4WA 2R91A 1S5WA 2V68A 4MGGA 3G5EA 3WF0A 3N17A 2JIWA 3QV9A 2QJMA 4JTCA 4EWJA 3FNDA 1HT6A 1TX0A 4Z1AA 3H4WA 4GVIA 2GOUA 2RJHA 5DY3A 2BXVA 4TVDA 3TOPA 3DECA 3I10A 1X7FA 1B4EA 4KQNA 1L9WA 2Q8XA 2PCEA 4JIRA 3VCCA 1BKSA 3GXMA 2R8IA 4B90A 1FCQA 3NZQA 1K1SA 2A3CA 1CXFA 3WX7A 3ECQA 3MKKA 1JUKA 3VE9A 2E68A 5E6ZA 5AECA 3U0HA 1OFQA 2WNWA 1PTDA 1XX1A 4MB1A 2YA2A 4L1XA 3WFAA 3WENA 4BHYA 2OODA 2EQDA 3TYZA 4O3NA 3P80A 1MVYA 1SZEA 3QKEA 3GIPA 1QMLA 2ASDA 3FX4A 1C91A 2B7OA 3WBAA 1EWEA 1KV5A 3L68A 3AXXA 1S5MA 1XL9A 1SGJA 1XYLA 3EX1A 4HJWA 4J9OA 2J75A 3PW0A 4GYFA 5K3VA 3LHVA 1KGXA 3W3OA 4J3VA 1JZ4A 3CWOX 3C2FA 4ED0A 1WXZA 3FCPA 1YRRA 1Q3NA 5JBDA 3NZPA 3UA3A 3W70A 1EQCA 4U31A 3K1DA 3URAA 3IGUA 1ZAHA 4IICA 2R8GA 2GSJA 4GVGA 4CNPA 1AZ2A 1KM6A 3P3BA 2PURA 4S2CA 1HKMA 1P1MA 3W75A 4BZYA 1QBAA 1Q6QA 1UH4A 4PRRA 1OCJA 5LHFA 3SCWA 4J9RA 1RD5A 1PWLA 3PUGA 3WD4A 4UCGA 5D02A 1KR0A 3CO8A 1LLOA 2VJXA 4O17A 2YBVA 1A0EA 2Y2WA 1H60A 3RUBL 4JS3A 1ZTVA 1SSGA 4N6FA 4JTTA 1X6NA 1FX6A 1E6SM 4PEEA 3THQA 1V7YA 3FJ4A 1DJHA 4F66A 3R25A 2BVWA 3BAWA 1OT1A 4DNHA 3VOCA 1ZBWA 3M0XA 4F2UA 4KIRA 3TCSA 4H8VA 1NVMA 3B04A 5HINA 1T40A 1EF3A 2ACRA 2E4TA 3DFQA 4LBUA 5AYXA 1BYCA 3SCRA 1UIPA 1A49A 3FSUA 4G2DA 4NY2A 4L9ZA 4DZIA 4O57A 2CYGA 4BS0A 2OZTA 3CLWA 4G5DA 4HHMA 3RU6A 2GWNA 3FKKA 2WK2A 5EWFA 5G4HC 4YNGA 3H7UA 4MWAD 2QF7A 3H2MA 4NHVA 2ZUTA 3LS9A 3QZEA 4U28A 5GNZA 4O0QA 4JQAA 2Q02A 3ZYZA 3UWUA 3GDKA 4JTDA 2ZYFA 3E5PA 4E5TA 2XZ7A 1QI0A 5DO8A 1BXCA 5AVNA 3M64A 4NG3A 3TN6A 4IJCA 1F6PA 3CIWA 1AK5A 1TMLA 2IQ0A 1DIOA 2FZ8A 3CJPA 3TTSA 1P7TB 3UJ2A 3W1UA 3M43A 3N4EA 1KR1A 2XSXA 3S2LA 4C6MA 3E2QA 3WL1A 5KFCA 4KT2A 4AVNA 3AYTA 1TA3B 4XBKA 2YL9A 4P8XA 3TTEA 3UNTA 3SUWA 1JYNA 5AYYA 1NY1A 4RNJA 3AIWA 1PTGA 4GUHA 3WH9A 4M19A 1L0PA 2VVNA 3PNUA 2ZXDA 3UCCA 4ZENA 2VCCA 4KMQA 5EA9A 1EBGA 4LB4A 4D1JA 1A5LC 2W9CA 4GY7A 4EVZA 3RILA 4WLCA 2EKGA 3RK8A 4K37A 3V0TA 3WLQA 1O7AA 3MO7A 2OYMA 4AQLA 2DIEA 2JBMA 1WPCA 4HBKA 4N7QA 4RUCA 3ZO9A 5CGTA 1SZNA 1ZALA 2PF0A 4PBGA 5KG3A 1PBGA 1SFSA 3PZ9A 3IIVA 1OFBA 1TWDA 5HANA 3VNMA 1GZ1A 2VX4A 4UR7A 5EMLA 4UBPC 1TRIA 1OFDA 5A6LA 4Q3MA 3IANA 1VLIA 2ZXBA 5FJJA 3WQCA 2ZWYA 2IBKA 4LBSA 3XISA 3WCZA 3S9ZA 1XUUA 3NA8A 2AKZA 3AS1A 3W2JA 2WBGA 2ZTJA 2W8KA 4O19A 1S97A 2Z1XA 5D04C 1XQKA 3P8JA 4GX9A 1TJPA 1YEYA 4FSAA 3AXIA 5U7SA 2HXUA 4UXDA 3UT0A 4GOAA 3KXQA 3EWYA 1HJUA 1WYIA 3ARRA 4XD5A 5BYWA 2BGSA 1S9FA 1FWDC 3BSMA 5C6MA 1YMYA 3PBMA 2BV9A 2QS8A 4LRSA 2YCLA 4I9MA 3M9NB 1R3RA 3F5JA 2P8CA 3IJLA 4RW5A 4WKFA 3GZ3A 1B54A 2ZXQA 3VNJA 4XSLA 3UWZA 2DZTA 5CBIA 1XLCA 1XBVA 5BZAA 1TPEA 2PRHA 3R43A 4U5IA 5EMYA 4XTDA 7A3HA 2E6YA 4KH2A 4G7EA 2PWDA 4GFIA 2J8GA 3T81A 4Q22A 4CCZA 4FOUA 1B90A 3B9DA 2NVCA 4LY4A 5I77A 4QISA 4A05A 4XK2A 5I03A 4UQAA 3URNA 3LCLA 1W9DM 1HJWA 3A47A 3W74A 3WF2A 2PZNA 3AIEA 4H7ZA 2X09A 3BOLA 4G1KA 1B0IA 1N48A 2C1IA 1B31A 1ZP3A 5IHRA 4U33A 4EOUA 3ABXA 4M24A 1UKOA 2PZ0A 3BJYA 3NQBA 1IWPA 3O6CA 3KBMA 4UB9A 5BXPA 4W7UA 3NUKA 1U5HA 2UVVA 4RK8A 4IRCA 1NOFA 3P2VA 4AVOA 3KWSA 4PUUA 1O1ZA 1VHNA 3AALA 1Q5MA 3SRKA 5D38A 1XIHA 1C9WA 1I2NA 3E12A 3VMPA 2PWHA 3ZJ8A 2FQIA 3LLFA 3OVGA 2DFAA 1GOQA 5LIWX 4OU1A 3URQA 1EJTC 4RR4A 3VYLA 3VABA 4M1BA 4NSBA 3UR5A 4YTQA 4IH3A 3RB3A 2V3FA 3TYAA 5EWGA 3MBFA 4AWTA 4DXVA 5J8LA 1V6VA 3EB4A 1KGUA 2X1TA 1N56A 3E0VA 3WEOA 2F9RA 1HXJA 3KOXA 1SO5A 3I3EA 4E0CA 1HNYA 5DMMA 2GK1B 3ARWA 4XVEA 7TAAA 2O9PA 4HNUA 3WDPP 3FVMA 3N4FA 1M1BA 4BI6A 1XUZA 1GVYA 1UMLA 1BQGA 3OVPA 4J1OA 5DANA 3TMLA 3GDLA 1KRBC 4MZYA 2VFFA 8A3HA 2VDHA 3R1ZA 1K8ZA 3CYJA 4IWWA 3DGBA 3R10A 3LB0A 4JTQA 3S9IA 1TV3A 2MUCA 2XIBA 1JCJA 4EE9A 4IGSA 5KFWA 1D3GA 3LCWA 3VZXA 1JL8A 1RVKA 3KLLA 4KETA 1LBLA 2IW0A 3F4NA 4R27A 4W4QA 1WKDA 2AGOA 3PWGA 3KVLA 5HNNA 2RDWA 3NOYA 4QWBA 3B4UA 5LHEA 1AW1A 1QI3A 1TZZA 2QUTA 4NRSA 5L9XA 5EY5A 5AC8A 2CWNA 2OQLA 4OECA 2QF8A 3S5NA 1JYWA 1DE6A 5AHLA 1O6IA 2D0GA 3HB9A 2GGEA 4MJ2A 3WLSA 3EWDA 1K8YA 1VJSA 4F9JA 3GG7A 3MR6A 3FJ6A 3W28A 3TW6A 3U7VA 1ZJAA 1B5TA 4FK9A 5DT7A 1ZLPA 3INPA 2E1WA 2C2EA 4RNFA 4GABA 3CZKA 2CLKA 1BGAA 2NQHA 3OLGA 3KVKA 3NQ6A 1WOAA 1A0CA 3W1XA 2CWXA 1FWGC 4AZGA 4LH8A 1LQ0A 4YWIA 2A1YA 1GVEA 1R30A 3WQOA 3KHLA 2ESCA 3RLGA 1VBJA 3OGRA 4DL5A 2EJ1A 5EB8A 3PVFA 2G8ZA 4ONVA 1BSIA 1JPMA 5D37A 3RLUA 4NZ4A 2ZA2A 4KEVA 1XLDA 2CKRA 4IPJA 1S5NA 2FB3A 4OT7A 3AJ7A 1VCVA 4LUTA 3MUAA 2FDSA 2HPMA 3HQOA 1E0TA 1QVBA 2PP1A 4O1BA 2NX9A 3CUFA 1SW0A 3LLDA 3E0IA 2ZZ5A 1W0MA 4CQDA 4A8LA 1Z3NA 1P0KA 5KFTA 4BF9A 4HHLA 4L80A 1HN1A 3EDEA 2ZQ0A 3OHIA 3E6EA 4DO5A 3RXZA 1FOBA 2GVGA 5D03A 1O5KA 4JDBA 2QHAA 3EA1A 2G3FA 3LMZA 3EPIA 1JCXA 4PFHA 1PE1A 2IXVA 3CBWA 4BK9A 3VNYA 1XIFA 2SFPA 4MJ4A 3PPCA 5CSYA 1MW2A 2B7QA 1IF2A 3VOFA 2OVLA 4GJIA 1TR1A 1XLBA 2X1UA 4O16A 2Z6JA 3RMEA 3U7BA 3VDBA 2HS8A 4PC8A 2YL5A 3PVXA 1KFBA 4RPQA 3UPWA 3KDOA 1EZ2A 2FGLA 3LGGA 3R0DA 4IUOA 2ZE0A 3T07A 3HQPA 3UZ5A 4Z1YA 3B8UA 4X9SA 1E56A 1S1PA 3K13A 3TNOA 3T2PA 4FIQA 1UZHA 2OO0A 1SJCA 2E25A 4L9XA 3S2JA 3VGFA 3LG3A 3UR2A 3GK0A 3A23A 4P8UA 3VIIA 1W1IE 3L65A 1GYLA 1Q66A 1UR8A 1J0JA 1GW9A 2E1DA 2ISVA 4X0VA 3EX2A 3MP4A 3W83A 1A5AA 1NH6A 1S5VA 3YPIA 3PY2A 1IGWA 2VQUA 2J6XA 2GDUA 2XGZA 1I1XA 2J27A 2IUZA 1XF0A 1ZGDA 2YB1A 4QR6A 4G6CA 2I1OA 3AJXA 3DX5A 4RJEA 3QEZA 5LIYX 5E93A 2YA0A 5C7HA 4Q8EA 3W7CA 2EPLX 5FL1A 3UESA 5C9UA 5IOBA 4HA0A 2XSAA 4PODA 4V15A 4QJ1A 3AZSA 3SADA 5D09A 4CN6A 4L64A 4L1WA 3EOEA 2BY2A 4S39A 2IA6A 2JF7A 3W7PA 2BDQA 2NUYA 4D9PA 1HIZA 3U4FA 2NQ5A 5KFYA 3C2VA 3VKBA 1WKFA 3E0FA 4LV4A 3BV7A 4H41A 2FDMA 2PTWA 1H11A 4FLSA 2OPJA 3VIHA 4A6GA 1OZQA 1H41A 4KCVA 2XG9A 3C56A 1SW7A 3EXRA 3BVJA 2Z2AA 3UXKA 2ZC8A 1C8XA 1CENA 4ZQOA 4IL0A 1JZ7A 3BQ6A 1ZBVA 3WDQA 3JZEA 3ITXA 3W26A 4DWSC 4GH3A 4DZHA 1UD8A 1FWCC 3UPMA 1EJRC 4Y9MA 5L1KA 3H6OA 3L7RA 1KXHA 2J62A 2GJXA 3LGEA 2PDUA 5LIKX 3DIPA 3L5AA 3LTPA 3RM8A 3PZTA 1IXQA 1A50A 1V6UA 3L66A 3DUGA 4LVGA 3AIBA 3UGVA 3N12A 3ZVIA 4DQWA 2HWGA 1F3EA 1FHLA 4PTWA 2OR2A 4HPHA 3NQGA 4KPLA 4PMVA 2ZCGA 1WBJA 3VIKA 2G0WA 2HK0A 2BTMA 3ZT5A 3EXTA 2VR5A 4N9EA 3C6CA 3QY7A 1OFEA 3EDDA 1SZFA 1PHWA 4NRRA 1W91A 4LALA 1RCXB 2PGEA 2NWSA 3WY1A 1VAHA 2RDTA 1XLGA 3E2SA 5F1UA 3WLRA 9RUBA 3MW7A 3H23A 2PGFA 3FHQA 1Z89A 1JCNA 3CMFA 3WF4A 4JQ4A 4K6AA 1VBUA 3WDRA 2ZX9A 4IIFA 2E8YA 4WR3A 5HJXA 3DCPA 3O0FA 3TJ4A 1L8NA 4XZMX 4TV6A 1VFFA 4Z1DA 4QW8A 4Z17A 4JV0A 3TX9A 5IDIA 4CNUA 4KERA 1O1HA 3AFBA 2Y0FA 1UR1A 3EDFA 4F2BA 4AEEA 3NTYA 4NJGA 3MZ2A 1K1DA 5DMNA 1QPKA 1Q4WA 2GGGA 3KP0A 4LEQA 3LM7A 2QV4A 4R5EA 4AZ6A 3OZOA 1PKLA 2PF8A 3K4AA 4R7WA 2ZC1A 3A3XA 2OJPA 3MDWA 1OFPA 1QAPA 3WBEA 2PODA 1NWRA 5HQEA 3O6DA 2PDQA 4AEOA 2PBGA 4Q32A 5CJ5A 2IMWP 3MMTA 1G6CA 3QV6A 5LXXA 1W2PA 2OEKA 1KBIA 4GVFA 2ZUVA 4K8EA 5F2GA 1XIGA 2BOFX 3SURA 2HRWA 3I4KA 3ZR4A 2XVPA 3CGTA 3WN6A 4GPNA 3KOFA 5BXTA 4G56A 4GZEA 3ZSTA 3SJNA 1PDYA 3TH6A 1RK5A 1OY0A 2J8FA 2OSXA 3W1MA 3CYVA 3CHFA 1HVQA 2PB1A 5HUPA 2ZWZA 2PCQA 3Q94A 4W7VA 2QUUA 4DBSA 2PWEA 5MKGB 2NXIA 5E9AA 2GJNA 5EBAA 2RDXA 2XFFA 4AD1A 1SO4A 3WG6A 2YL6A 2QEZA 3WMSA 1IR2A 2MNRA 3UQNA 4W9TA 3PFRA 3NJ3A 1YPXA 4R9XA 1NF7A 1US0A 2HXTA 2QCMA 4H9TA 2GVEA 5ENLA 3KRSA 4QG6A 1XLLA 5LNSA 3EX3A 1CGWA 4MADA 4MWAA 4EIVA 1VFSA 2E40A 4RZRA 2I17A 4B4HA 1KD0A 1EX5A 1OFAA 3CT2A 2V5CA 2QCFA 2H90A 4JX6A 3O2LA 4BF5A 3OU8A 5CPOA 1GVOA 3M0JA 1KFLA 1YW1A 3SDOA 3G8RA 5J04A 3P5YA 1SQ7A 3WUGA 5EBUA 2XVGA 3UGRA 2Z1KA 3T08A 3KZSA 3TYEA 3KVMA 4MY8A 4PCSA 3UG3A 1A5MC 4NZ5A 1PL9A 4RV3A 3ATYA 2VZTA 1UB3A 1PKNA 2XWEA 2RAGA 3LY0A 2QGHA 1CZ1A 4R33A 3K8LA 4ORIA 4AHPA 3WMBA 2DW6A 4WRHA 4ZQMA 4U3CA 4WDTA 3P0XA 5AYZA 1GPFA 1M03A 5LA1A 4I5XA 4ZR8A 2DV0A 5M1TA 1RXOB 1O5XA 5DMLA 3VNLA 3TSDA 2VT0A 4R7OA 2BQUA 2I9EA 1N8WA 1EGVA 1EXPA 1TMQA 1I60A 3G77A 2NXHA 4YHGA 1QW7A 4PUMA 1KFWA 3GH4A 4LANA 4J28A 3KOWA 3AROA 4HPJA 1DJYA 4GO9A 2YFNA 2QAPA 1UBSA 3QQWA 2VYOA 2ADAA 5D33A 3VMNA 4AB4A 1GHRA 2FH8A 2X7WA 1VQTA 1Q4NX 1V08A 1UW9A 4CQ9A 3Q4DA 3LCFA 4Y6GA 3H2AA 4MPKA 2ZICA 3G1FA 3VGEA 2GLKA 1QBBA 2IQTA 1E4IA 4EBEA 1JPHA 1MSSA 2R6OA 4JY8A 2QV5A 1W3NA 3IJQA 1HVXA 3UFYA 4ECYA 4FOJA 4IPPA 3Q8PB 4QCEA 3WF1A 3OEXA 1E4NA 5BRBA 1LJYA 3LCGA 3BW2A 3D47A 4XIMA 1Z41A 4W88A 3S46A 3P5ZA 2V9DA 1B57A 1EO7A 1LWJA 1HJVA 1OFOA 2C1GA 3K8MA 2XSBA 4LX4A 1LRNA 3WNPA 4G8TA 1ZQ5A 4DYJA 4DX3A 5DX7A 3URBA 3ITOA 4UTMA 4MG4A 5JMUA 3CWHA 1UD3A 3OO2A 1W3TA 4ZCWA 1PEZA 3CMGA 5AHFA 1NWSA 1GHSA 1TPUA 3BLIA 1U5VA 2XHYA 4HK7A 4QJ4B 4L1GA 1GYNA 4ERGA 3VDAA 1CI1A 1QWKA 4MF4A 3WNLA 1UA7A 2Y6ZA 3PZIA 3TROA 2OZ3A 3BW4A 3P0WA 3KTXA 1H50A 1NSJA 3MJYA 2IQDA 9XIAA 5AFDA 1E71M 3Q45A 1E3XA 4WEVX 2OH2A 2R8KA 2H8XA 2D1ZA 2YFOA 4RNHA 2GOKA 1ZY9A 4Y8FA 4OZOA 1R9ZA 1C92A 4DEFA 1B9BA 4Q8QA 3TYCA 2Y5SA 3VUSA 3E49A 2OWCA 3II1A 5JIWA 4AISA 3DG7A 4L61A 4C6OA 5I07A 4UR8A 3QKZA 4R53A 3GV5B 1UG6A 3CUZA 2OX1A 3N3TA 3B9AA 3M5VA 3M9MB 4L4LA 4UFMA 2FTWA 3M9YA 4QWAA 4PN2A 2VRQA 1WKYA 3W84A 1HGWA 3A64A 2WC3A 1CLKA 5JH2A 4GHRA 3VIPA 4YTUA 2B81A 1E5NA 4N4QA 2WJEA 3O05A 1JD9A 1GWJA 4OJYA 4DM1A 4XBSA 3BZJA 3L0NA 4UTLA 1QNRA 5HQLA 3TP4A 1E4MM 2AU0A 2DZPA 1DJGA 1FWAC 1J96A 4G3IA 1H5VA 4JYDA 1YHTA 1YNYA 3PJTA 4D72A 4JTEA 2BY0A 5A6MA 4BI7A 1VKFA 2POTA 3T0CA 1IIHA 1PZ0A 4JTLA 4WUIA 1DIEA 1RZMA 4B5TA 1TV5A 5DQGA 4DLMA 4O14A 2G41A 2ZDRA 1QU4A 4XKYB 1AJZA 3AZRA 3N9SA 2V5KA 3HV8A 2FZMA 1Z7AA 4LSBA 4IP4A 1EEXA 2BQ3A 2WZEA 3V6KA 5I09A 2XCPA 4WCJA 1OYCA 3CZGA 3U48A 4XUYA 4Q8WA 2PFHA 2W9MA 2TODA 1KTBA 4H9XA 3M7WA 1N2VA 3P93A 4NZFA 4QXIA 4B9ZA 1JJKA 5KFDA 8CGTA 3PS7A 4QNEA 1JCMP 1OWQA 3V3WA 5A94A 3B8IA 4WY0F 1J6PA 1PDZA 1W3LA 4KFOA 2A7PA 4H9ZA 4OBRA 3GG8A 4TX6A 4FBUA 1WNOA 1ZU8A 4BJHA 1PIIA 1T5AA 3HPZA 4RV8A 3L67A 2VC6A 4GBDA 1GVIA 1N8IA 4QBXA 4QS5A 2A7RA 2ASHA 3S1UA 4GISA 2V30A 2DORA 1OYAA 3LOTA 4NNBA 1KBLA 1UD2A 1W32A 3HM7A 1E1CB 3PPFA 3USBA 3T40A 4HKPA 4OV4A 3AS0A 4UZSA 2NSXA 4GMEA 1K70A 1DWHM 4RNNA 3TA6A 2VZOA 1TREA 3W7DA 3W2LA 4H8UA 4INFA 3SCUA 1GQJA 2WANA 4AD5A 4FBTA 3W1PA 1ZNNA 3E9AA 4IQLA 3FVDA 4RNOA 2DPEA 4H04A 1X8CA 1ZB5A 4JQ2A 1F3TA 5E70A 2XH7A 2RUSA 4Y9NA 3WUEA 3FLUA 2ZRYA 4FNUA 1G94A 1X1ZA 3DYOA 4K7YA 1XLFA 4CU7A 1PCWA 3G3DA 2OQYA 3UWQA 1V93A 1XLJA 3T5LA 2V2DA 1L6SA 5G4WA 1WAWA 4LXFA 3Q8SB 4MKSA 1RAKA 4QEHA 2D23A 2GQ3A 4PA8A 3T2OA 1YADA 3OYZA 5AY7A 2V5LA 3S5YA 3FDKA 2R8HA 4ES4A 2R24A 2O56A 4HNVA 1H5YA 1M7OA 1I45A 2WCGA 3OA5A 5FSEC 4LAUA 3GW0A 2CERA 3N2XA 4HZMA 3HA1A 1OC6A 1WB0A 1KFJA 5DELA 6XIAA 1V7AA 4QWEA 2J6TA 3GTXA 3A4AA 3WSUA 4AYGA 1H1NA 3GU9A 3SECA 4CVWA 5C5JA 5BOOA 5I0DA 4IISA 1JRBA 5EMMA 4FNTA 3UD6A 4OHQA 2ZX5A 1J01A 1PZ2A 2YCLB 1JZ6A 5A6KA 4X2RA 2RHGA 3M9OB 4RZBA 2R9RA 1UR0A 4UIOA 4UNLA 2FJKA 1L2QA 5CPQA 4YR2A 5KT2A 2Z2UA 2OOGA 4KCUA 3JUGA 1WXYA 2FFIA 4TVUA 4C91A 4LYRA 3TJXA 1CIUA 1SFTA 2WCSA 1KM4A 4FEZA 1RA0A 2VWSA 1C93A 3VD9A 2EG7A 3FAWA 2XIQA 4MLRA 1W56A 2DH3A 4J9JA 3VI2A 1W5OA 5HXMA 5KFHA 2JGQA 2NT1A 4D6IA 2EXOA 2JEIA 3GY1A 3DU0A 6ALDA 2CLMA 4PUJA 4GYPC 5EDWA 5CG0A 5CLTA 5G4EA 1F07A 3EOLA 1XYZA 1KWGA 4BF7A 3CHVA 1GQIA 3DHUA 5LGZA 1JYVA 1M7XA 3UPBA 4HT3A 1YDNA 4IXHA 4DIAA 4ATWA 3W7NA 4GC7A 1FH8A 3V5FA 4YVVA 4LU0A 3E74A 3PBGA 3T9PA 5KT4A 3TFXA 1U1JA 3NGFA 4W8BA 2J9YA 2P5NA 1UZ4A 3ITTA 4DZ5A 1MWOA 1B30A 1Q85A 1DJQA 1EHAA 1PWMA 3GDBA 1O60A 1RLCL 1L6YA 2ZRUA 4O11A 3S6OA 3CPGA 2X16A 5A2AA 1QI2A 2JKPA 3ANYA 4E2BA 5D30A 1XDLA 3RR4A 1R3QA 1IIGA 1HKIA 1HL8A 1A5BA 4O50A 1F76A 3CEUA 4IP5A 1NFPA 3MDUA 1T0OA 3UERA 1SJDA 1CXLA 2YDRA 5CGQA 3ZOAA 1TPWA 1DORA 4LCSA 1F61A 3MBDA 1I4NA 3OVQA 2Z28A 1KKOA 4HYRA 4U3AA 3CPRA 5DMYA 1PO9A 2FLLA 2JEQA 2VEPA 4P7LA 3UG5A 3KRBA 1T99A 5CH9A 1OEPA 3KBNA 4XWUA 1BPLB 4EAYA 3GYCA 4ZB2A 4GQ0A 3EB3A 4R9OA 1IT8A 1LT8A 2BFGA 3LU2A 4IQDA 3H2FA 2PWUA 4RKAA 2XGPA 4I9TA 3O63A 3W7MA 4JBRA 3N2BA 3TLQA 3UBPC 2V2CA 2R1NA 4NXSA 3VAVA 4LOCA 2WSKA 5HA7A 4FI4A 3DC0A 3SCVA 1SFLA 2TRSA 1F3WA 1SU5A 5FJRA 4GINA 4A3YA 3GH7A 2Z26A 1K6WA 4KEMA 1JYXA 4CD6A 2O9TA 4FMVA 2YKKA 5AOUA 2XVKA 3VC5A 5CZJA 2D2HA 2GYIA 2J7CA 4IT1A 4DJEC 2I5IA 3STCA 1TZ9A 4JNMA 3C2RA 1XIEA 4XBJA 4LGXA 3BCJA 4JTAA 3N11A 4CU6A 5FCZA 3HF3A 3CH9A 4CD7A 4EXAA 3WLNA 3R89A 3I7SA 4BQ3A 3KS5A 1A4LA 4CCEA 1RQBA 1EUAA 3QTPA 2WPGA 3R8GA 7ENLA 1E9ZB 4MYXA 4HP5A 1I2RA 5M17A 3VD5A 3W01A 2CLPA 3SN0A 3L12A 2YJQA 3PBYA 4C1NB 4ORMA 2VFIA 3SGZA 3ZR5A 1ODZA 4A29A 3G6YA 4DJDD 4TMBA 2GJPA 4N9DA 4IX2A 4GQGA 1JRCA 1NQKA 4DAIA 5FJIA 2YXOA 1FP9A 4F0LA 1R8LA 4WIWA 3VDCA 3FJLA 5F7UA 3O6AA 4DF0A 2YDAA 1HKKA 2E3ZA 1B3ZA 1K7FA 3FEQA 2DSZA 2PA6A 5L1JA 1U1HA 2WMHA 2D0FA 9XIMA 4UTKA 4CQAA 3SQMA 4A8IA 4AZIA 5M03A 3P74A 4LNYA 1Z6KA 3P82A 3ZWTA 2QCCA 1SYTA 3W7IA 3WIJA 4RNMA 4J9MA 1F6YA 3N18A 2PDFA 3WDHA 1PKMA 3N6QA 2J6SA 3WQ4A 4TQSA 1UASA 4DL2A 2WNQA 1OGBA 2P1FA 4GI6A 5D9NA 2Z00A 5DGBA 3JRKA 1GQKA 4Y8EA 1KFKA 5HUOA 3FIGA 3K4DA 5GQBA 1DBTA 4QEEA 3UYIA 1RBAA 1F7BA 1V77A 4L6HA 2VA2A 4GFSA 4AC7C 4ECSA 2JF6A 1DP0A 2FLNA 1GG1A 4JFUA 5D05A 3M6DA 4I8YA 1ICSA 1IGSA 2NVAA 4HN8A 4P7RA 4GD0A 3CTTA 1G4TA 2ZZ6A 2YZ5A 4X60A 3O15A 3W1LA 1THFD 3MHFA 2DZXA 4B5SA 4O15A 4K38A 3B3DA 3MVIA 5DQIA 2VELA 3VNZA 1QT1A 1QPQA 1AQ0A 3V5CA 3SQSA 4HMNA 3U6WA 4DXXA 4AZ7A 2ZZ4A 1LT7A 2PBOA 4LUIA 2CESA 2Q6ZA 4MNKA 3W7KA 5JBEA 2UV8G 1UP2A 1UWQA 2A4AA 3A5FA 4GC4A 1FBAA 5LNRA 3VGBA 4JYFA 3V16A 4U6PA 1XC6A 5TQLA 3N6HA 4EEYA 1R2SA 3FSTA 4WD0A 2NZLA 5CJMA 2W27A 3MSGA 1FWIC 1TRDA 2FH6A 1LOQA 2VQTA 3PSWA 4KBXA 2FFCA 3VKCA 1HO1A 4GX8A 5F4SA 3NDZA 3F4DA 3QW4B 5I02A 1I2OA 4EXBA 1RR2A 2CXEA 4UTJA 1HKWA 3A9IA 1F8MA 1ZHAA 4YMZA 2ANUA 3MZNA 2J13A 5BMWA 2OLHA 3TV8A 1PSCA 3GNNA 2QMKA 4XO6A 2I5QA 3ES8A 3WQVA 3LEPA 3G18A 3COTA 3TONA 3KS6A 3L21A 4RDYA 1FH7A 2W3ZA 3BZGA 2FTPA 4ZL1A 2AGKA 3CC1A 3B8SA 2P8BA 3M6YA 2CLLA 2E5BA 3QZ6A 3GVRA 4S3CA 1QPOA 1TV7A 1G1YA 3NGJA 2Z24A 2GJXB 1EWDA 1IWAA 1NDVA 5K9CA 4PMJA 3PZQA 1J11A 3EKZA 3MWAA 5AHMA 2C79A 4Q7BA 1QCWA 1UWIA 1NARA 4JTGA 3FEMA 1WP6A 4U5KA 5FF0A 2W9BA 3OOQA 2H9AA 1W9VA 3WLTA 3AU2A 4LUJA 4PUNA 4QLKA 4FPSA 2C71A 1VD6A 3WBYA 2PD9A 2WQPA 2OKTA 3S2CA 5BXSA 5FL0A 1S2CA 1EGZA 4WDWA 1AW5A 1J4EA 2R1KA 4I5UA 2PDCA 1SM9A 1XC4A 1I9CB 4F2TA 2UVWA 4DN1A 2D24A 3KTSA 2PDMA 4CN4A 4FLQA 4ZO7A 3KUMA 2C16A 1TX2A 1Q2SA 1GJPA 2Y8KA 4IMEA 4GIAA 2QW5A 1WDQA 1LBMA 1X97A 3PANA 5EMJA 8TIMA 4IPNB 4QE5A 3GAKA 4XB3A 1IXNA 5K4ZA 4QLLA 2ZVRA 4JNYA 5DG7A 2ZKMX 4YL2A 2FGBA 3GFZA 3BQ0A 3PUEA 1N55A 3WBXA 4GLEA 3MQTA 5L9FA 2HPIA 1JPKA 3CV2A 2FB2A 3LRMA 2YR1A 3MMDA 2QAFA 3WK3A 3VX0A 1KCLA 2XCAA 3TC3A 1M5WA 3W7GA 3T44A 2J78A 3V0UA 4JTJA 3MCOA 1AW2A 3HGOA 3DC8A 2NLIA 4GJ1A 1TZ7A 4OKDA 1QFEA 3G22A 2H3DA 4MB5A 3TYDA 3STEA 3E3HA 4IMCA 1T8QA 2V0TA 3N3MA 3BQ1A 1BGGA 2J7FA 4UFJA 4HCDA 2ASJA 1EC7A 3OG2A 3UXLA 5F9LA 5G1TA 3H54A 2CLHA 3CEPA 4NZ3A 2ISFA 2FZNA 1K7XA 3MUIA 4QAIA 4YQWA 1OF8A 1VP5A 3UF9A 2J74A 4ZODA 1AUSL 1Q7QA 3PF3A 1BYAA 2CLOA 5I5RA 2BR0A 5T8GA 1EJWC 1M01A 3F2DA 3CUGA 3GTFA 2PAJA 1HJQA 2E77A 3EDKA 5D9PA 5F2LA 5REQA 1GQNA 3EOUA 2X2GA 3ZLGA 4BQ4A 4AX7A 5AC7A 4O1CA 5AZ1A 1V02E 1F74A 5IBXA 4JX4A 3T5HA 1KXQA 3BO9A 3VM5A 3F5LA 2VC5A 2R1LA 4IGNA 1CW2A 1AJ2A 2VKZG 4J3SA 3ZQ9A 4B5UA 4NZ1A 2E8ZA 1WDWA 2BB0A 3MUZ1 1YDOA 1GONA 1XH1A 4Q8OA 1NFGA 2J24A 3BGJA 2YGYA 3W7OA 1ONEA 3GHUA 3NEVA 4MWAB 5ABHA 3BH4A 1MUCA 3GS6A 2CW6A 4HJFA 2V5BA 3ERPA 3H2OA 4D6CA 3UVAA 1W3KA 2OX4A 5I2UA 4M6QA 4C1KA 5HWNA 4NJIA 1H7XA 1J9YA 3B0XA 4X61A 1ZFJA 3S4TA 5D2WA 3B9OA 3DXIA 3MYPA 5HWJA 3VINA 3VX1A 4KKXA 1P48A 3R0KA 4FXRA 2PLJA 1S0MA 2V82A 3VOIA 1EDTA 4R3UA 3MU7A 3OG3A 3HJEA 2UY3A 2ZE3A 5EMUA 3QZ7A 3S1XA 1XG4A 4IIEA 4F40A 1UIOA 1EGMA 1H0IA 2FVLA 1DWAM 3VDHA 4DJFC 1ZENA 2FLIA 1ITXA 3GFYA 4FHAA 4IQEA 4ADSA 4A4AA 1K4HA 5D8ZA 3A3HA 1T6MA 1ELSA 2WWCA 3TYUA 2UWFA 1XRFA 3PPGA 4L6OA 1LM1A 3ELFA 4I7WA 4OTKA 3QQ0A 4FNPA 2DDXA 2OSYA 3RB0A 2C91A 1TTQA 2VTFA 1RVGA 3H53A 5TNVA 2WLZA 4N4PA 3B0UX 6REQA 3EDJA 2XINA 4DWSB 1XSJA 3B0YA 4HCLA 2ABBA 1EYWA 3TR2A 3SJ3A 5ABGA 4W85A 4ED1A 2BNJA 3RAOA 3T8QA 1R6WA 4YYCA 2DJXA 3EMZA 4IJRA 5TAOA 3KHGA 2PD5A 3LYEA 5DN1A 4M5PA 1S0NA 1ITCA 5KTLA 3UYCA 3DN5A 3IIPA 3RO8A 3DHFA 3LDVA 3PBUA 4AZ5A 5HR6A 2NQZA 1W8GA 2QVNA 1UBPC 3IAPA 3SRDA 1P6CA 3FW6A 4F9DA 4FR1A 4L7ZA 4ZTXA 2Y85A 3QF0A 3TQ1A 1CEOA 4H01A 2PRLA 3KW3A 2BASA 3WEMA 1J10A 4QJ5B 3BG9A 3OZMA 3U2ZA 1NDWA 2XH0A 3FK4A 1UKQA 5CC5A 1LLWA 3SSZA 3BLLA 1GK8A 1REQA 3FYYA 2WSPA 1J0YA 3VIOA 4CLMA 4MUPA 1ZJHA 5KFQA 3GLCA 5A6SA 2Z1WA 2XFRA 4ZB5A 4GKTA 3GR8A 2Y7DA 4YCPA 2OWWA 5LA2A 1IXOA 3CUXA 2WC7A 7REQB 2DT2A 2GJRA 1DWIM 2Z25A 1A80A 2ZUNA 5HDRA 4Q8NA 5EL1A 4KEUA 4YLWA 1XQLA 1C3FA 1IV8A 4R34A 2C3ZA 4ZTYA 4IPLA 2A3LA 3NR0A 4AXKA 1QUMA 1TPH1 1F6KA 2Q01A 2XTKA 3C2OA 3W86A 4JIHA 3BJSA 2JE8A 3W6MA 4GXPA 3LBCA 4S1FA 5AYBA 1TMHA 4UFLA 1Y65A 4WZHA 3SGUA 3VCRA 5MF5A 1RYRA 3PB2A 1GZJA 3IGHX 1V51A 4E8CA 1DTUA 1V0LA 3V18A 2A7NA 2CCRA 2PDYA 3WQFA 4D8AA 2OEJA 3BSHA 4W89A 1O5QA 3NSNA 1D3HA 4HSHA 4WKAA 1QNSA 1CXKA 1I6NA 5FAJA 3MTWA 2W8LA 4B15A 4JCLA 1EEPA 3UW6A 1FWTA 3UJSA 2NV2A 1MI3A 4WY0A 4CQ8A 3VGGA 3W9ZA 5MHBA 3VKDA 3THUA 5F1VA 3V4BA 3GSMA 3WH6A 3G0UA 2F2KA 1M65A 1TELA 5D8WA 1B3OA 3RITA 4EYHB 3W00A 4R8UB 3RLVA 3FYOA 1W3JA 3VVGA 4TTGA 3CWNA 4AZBA 4Q8VA 4LNCA 1UUQA 2PI6A 3PZMA 3AMGA 2AQVA 1EA0A 3AIUA 3M0MA 5F2MA 4D6FA 1V6TA 4C1LA 3M0YA 3NQ8A 3E0WA 2QMJA 1Z32X 4ED7A 3BANA 3RO6A 4TVCA 3IARA 3ME3A 3QLDA 4JHMA 2YYTA 2GDQA 3Q37A 1UKTA 1BWLA 2A6LA 2PWGA 1LF1A 2W4XA 2G95A 4U10A 3LPFA 4PB3A 4XZBA 4IG2A 4MOZA 3UCDA 3QN3A 1F5ZA 2VI0A 3JU2A 3VC6A 2ALDA 2NV1A 4LS0A 1EJVC 3GZAA 3S2MA 4I90A 3SW6A 2A79A 3UZZA 3ALFA 4C6EA 4O4VA 3MI3A 1OX4B 1TPVA 4J2PA 3VD3A 1SMAA 4IR1A 4PMRA 3KAOA 2J7BA 1VIWA 4K36A 1UCWA 2WPBA 3WYZA 5F4WA 1Z69A 4PRTA 3RG6A 3DI0A 1KA9F 1W5PA 2CPUA 3A22A 5FAGA 4AY7A 5K2ZA 2XYLA 2XM1A 1ADOA 1QNVA 1PCKA 3RFAA 2DUZA 1NAL1 1S5TA 3MANA 1KRMA 1J5TA 3DH7A 2EGZA 3T6CA 3QYQA 4YP3A 2AL2A 1RY8A 5AHEA 4MM1A 3RPDA 5AKQA 1BWKA 1R47A 3DGRA 3LENA 4RZ4A 3QQ1A 3S5OA 4TX8A 4RDZA 1OZMA 1JG9A 4HU8A 2ZDSA 1I75A 4JFTA 4J9PA 3LM3A 1POJA 2W66A 2YYUA 3MJMA 5BROA 3W0KA 2BP1A 1H63A 1W1VA 3B8VA 3F4VA 1FQ0A 3TZFA 1WDRA 4FLRA 3P6LA 3WMCA 4DJDA 3EPOA 1XKYA 1EDGA 2GVLA 1G9HA 2O0TA 3E1F1 1D2KA 3BG5A 4YR3A 3GKFA 3NPUA 4FX8A 4K1WA 3F2BA 1TJ0A 2A21A 4GH1A 1Q6FA 4QGCA 3TCEA 1OG6A 2XC9A 4L9YA 1BEUA 2VFEA 4AYSA 1E55A 2VRJA 3RJXA 2X8RA 4HMDA 2Q3OA 3W29A 3JW7A 4PMNA 1P5BA 3ARSA 1OG0A 1DXIA 5FACA 3ARZA 4EF8A 1NOWA 3Q8RB 5HPCA 4HZ7A 1HGYA 2YBUA 2F2HA 4J35A 4AD3A 4A3HA 2AGTA 1RP9A 2PP0A 1XPGA 3GW3A 4LPCA 3VO0A 5DCBA 4P7OA 3QGVA 5HNUA 5GJPA 1XM3A 1ADSA 3WO8A 3LCXA 1OHLA 1LQ2A 4LBRA 1M53A 1OK6A 3PC0A 3TC7A 4M6VA 4C5ZA 4M7SA 2HZGA 4JV1A 3OLEA 3PB0A 5I3FA 5HNTA 4M29A 2WZMA 3F4CA 5CCZA 3PW2A 1PXGA 1N82A 5FA5A 1VEPA 2PC8A 3IIZA 1CLVA 4RZ5A 1G0CA 4JL2A 2PRMA 4QDPA 1JI1A 1Q6EA 4H6RA 5KFPA 3GVVA 2REQA 2XU2A 3QGAC 3PUOA 2DQXA 3MKVA 3I7QA 2X05A 2ZUSA 4DELA 3E02A 3W7QA 5HR7A 2V4RA 3M0VA 3HOJA 4YIWA 2CLIA 1UWRA 5FEXA 3R4IA 5GNXA 3LNMA 3CZJA 3FFSA 4LS1A 1P4CA 2GQ8A 5JVLA 1VH7A 4AIUA 2OT0A 5BNKA 1L2UA 3TSBA 1W6TA 3D46A 5EU9A 4P61A 1BG9A 3RM4A 5HATA 4E4UA 3UR7A 1IQ8A 5BMXA 4JOMA 2Y1HA 1I0DA 3HTWA 2XGIA 3MY9A 5CZKA 3ZJ6A 5FEZA 2PUZA 2BY3A 5IFTA 3LX9A 3WQGA 1EOKA 1LUCB 2HBXA 4FF5A 4CNNA 4BEQA 3T0TA 1FCUA 1UWSA 1TJRA 2YDQA 1EC9A 3ABRA 1ZPTA 1NP0A 2CEQA 2YCIX 4QSHA 3CAWA 2BGQA 4RE4A 3ABZA 2FHFA 4TQRA 2VC9A 5I3IA 4LYKA 3SZ8A 1C8YA 2CZ5A 5M3WA 2NUWA 1XISA 3ENLA 2PE4A 4Q8UA 3L4ZA 1ME9A 2UZ9A 4ED6A 4Q4MA 1X7IA 1DJZA 2INEA 3L5MA 3W02A 5ECUA 1EF2A 1EC8A 2WBKA 5KINA 3UWYA 3LD5A 1VS1A 4LF1A 4UCFA 1ZUAX 3BAYA 1RPXA 3WUFA 4CCCA 2E0PA 3PBVA 3W6YA 4KGJA 3MO4A 3DZ1A 3P84A 3WL0A 1PPIA 4PSRA 4FXJA 3GV8B 3QHOA 1GVSA 2IPFA 3DG6A 3ITLA 4EXQA 4IMAA 3BLEA 4GIEA 3VIJA 1KXTA 3ZS4A 1P7TA 2NLYA 2RKXA 2EKCA 3SQLA 4CQCA 4JCMA 2VCBA 2QQ6A 3KVJA 2BQRA 4LAOA 3N25A 1TA3A 4QDWA 4UOJA 4Q4SA 2OYKA 3VCNA 4A3RA 4Y2WA 1TE1A 1E0WA 3N4AA 3NWRA 3GNOA 2C0HA 3NL5A 4PR4A 3GBEA 5DT5A 1XD1A 3W25A 8XIAA 4DNMA 3FOKA 3Q58A 1ISXA 1EYEA 3L2MA 3AS2A 4PFMA 2BODX 1ML1A 2XPKA 2O9RA 3IJDA 1POKA 3BAJA 2WCAA 3WQPA 1LOLA 3GB6A 7PTDA 3I6RA 4FR6A 4TOQA 3AMDA 2GUUA 5A6BD 1XDMA 2QUNA 4B91A 2CFFA 1NP2A 5GJNA 2JGYA 4GIYA 2C7FA 1I2PA 1Q65A 4WF7A 3H2EA 5A6TC 2NWRA 5DLCA 3DYMA 4YJ5A 3G6VA 3PZGA 1KLYA 5LIXX 4EPDC 3C2EA 4S3BA 3HG4A 4OWGA 7ODCA 4ACZA 2XGBA 1EP1A 2NQLA 3UR8A 3NCOA 1C7TA 1IT7A 1US2A 5KZDA 3GBDA 1IM4A 6ENLA 4B16A 1PV8A 3UNDA 1OCBA 5CSSA 1XS2A 1TQXA 5XIMA 2X1IA 1RSCA 3S5ZA 2Y61A 2VX5A 4K8HA 4QLJA 4YVXA 2OLAA 3QMRA 1NDZA 3MI2A 5HOSA 3STPA 4NJKA 3LZ5A 3WK2A 1GKQA 1F4HA 4C6QA 1D7FA 3R5EA 1CWYA 1KNWA 1OT2A 3WLLA 3W1TA 1B3XA 4CKQA 1ALDA 2WVVB 4LCQA 2QZRA 1AQMA 4NJJA 1DL3A 3OPSA 4QG9A 5XIAA 2BZNA 3CZ8A 3EMCA 1XGDA 4XZNX 2QT3A 4IXXA 4Z2JA 3GWQA 3LXBA 1B3VA 2PSNA 3GXFA 1QI4A 2WVSA 4PE8A 4F4WA 3BICA 1XFBA 3MSRA 3I7RA 1GEQA 3MPGA 3H55A 4Z2KA 5TIMA 4QW9A 4C6BA 2W91A 4NZJA 1XLKA 4MZ1A 1RBLA 5EWEA 4LYQA 3OIXA 3NOEA 5I24A 3B0VC 4Z2IA 1A5NC 1XDJA 5EKYA 5M5DA 2ZRZA 4M7TA 4DF1A 1K02A 2PEVA 4R7JA 3AYSA 2WC4A 4GWEA 2JQXA 2G96A 4MB4A 2FMOA 2RJGA 1LRTA 4LF2A 1H09A 1FCBA 3PBWA 3H22A 2JEJA 4AXNA 3SO7A 2UBPC 5I79A 2VURA 3EPGA 3WD3A 2ATLA 3S6TA 4XKMA 3UZYA 3LPOA 1U30A 3LTSA 1RJPA 4LW7A 4ZQPA 1HX0A 3VD7A 2V9WA 5DBUA 1XYMA 4UOZA 4AG0A 3HG5A 3FXGA 4K7VA 5A95A 1QHOA 5DBTA 3QGKC 3R13A 4B5VA 4M1RA 4GXMA 4N02A 3AS3A 4N2YA 4IFOA 5CZSA 2CHNA 1VGAA 3U9IA 3U2EA 1VFMA 1ZAIA 3V7PA 1FTXA 2WKLA 3CTLA 1W37A 2WMGA 4S3EA 2XGQA 1WE5A 4AIEA 5KFUA 2PDWA 2OB3A 4MUZA 3CL8A 3FS2A 3FAXA 1JZ5A 4A22A 4HVXA 1S2AA 3BPWA 3DESA 4N9BA 3USZA 3EX6A 1W5QA 3GDTA 3I3BA 4LVDA 4MDPA 2DJLA 1KM5A 3SI8A 1MXSA 1JQVA 4HK5A 3MI6A 3QPEA 3KHDA 2BHZA 2QCDB 2YCJA 4UQEA 1BSLA 1MDRA 5FF4A 2VZUA 2YW4A 2QCLA 3ARQA 3K30A 1JPIA 4I6VA 2BVDA 4GYJA 1GNXA 1F8IA 2NT0A 3L4VA 2B31A 1OADA 1FXPA 4O28A 2GDVA 3VU2A 2QDHA 1JPDX 2OFJA 2DZBA 1FWWA 4Q4QA 3GH5A 5I3GA 1A5CA 2H3BA 4J40A 3NURA 4UNKA 3LHTA 3W76A 4EK7A 3QC3A 3F2CA 3V35A 3R6IA 2ZX6A 1HQTA 1TUFA 2XFYA 1DIDA 4GI8A 1UHVA 2BS9A 2X41A 2PMQA 4LFYA 4ZOEA 3PPHA 2ACQA 2BSLA 4IM4A 4Z0JA 2HE5A 3GDMA 3IGSA 4FF7A 4LUSB 3S5SA 1ZJBA 4H4IA 3WNMA 4YHEA 1TB3A 2PLKA 2QULA 1E6XM 3CQHA 2ISSA 1RQEA 2QXWA 5KFNA 1GT8A 3TTOA 2I5GA 3IK4A 4GIRA 2AMXA 3HPFA 3W38A 1YXDA 3SCPA 3CQJA 4MZ8A 4PULA 3U5UA 3LCIA 3ZLFA 1KQYA 2XH2A 2ZUUA 4CD8A 2HBVA 3TKFA 1A5SA 5CC6A 3W88A 5CAHA 1DVJA 3F4WA 1AVAA 1TVLA 3E2VA 4JX5A 2C8NA 4GNKB 2DGAA 4W87A 2DSUA 3G2GA 1HJXA 2ISDA 3WLIA 1DWJM 3W1QA 3MV01 2X0HA 1LROA 3APTA 4LEFA 2VC7A 1ISYA 1EJ7L 1YIXA 1RV8A 3GM8A 3MA8A 4P7NA 4I6KA 5DGAA 2ALRA 4GUGA 4V27A 3NXFA 4S23A 2OGYA 4FIRA 1MEIA 5B7ZA 3A3WA 1DXEA 2WVUA 2DP3A 4WKHA 4ZOAA 2CXGA 1EDQA 4C6CA 3QTGA 2HNEA 1BRLB 2WJDA 3EYPA 5HPOA 1A5UA 2BY1A 4UFKA 3FA3A 3C8FA 3W2MA 4B92A 2QJHA 1CB2A 1QWGA 4ZMGA 3DI1A 2DIJA 3GR7A 1D7KA 4S3FA 4LUYA 1RQHA 3AHYA 5KT6A 1R86A 3G1AA 2V81A 3O07A 1TSIA 1VJIA 4GI4A 1XIMA 2JEFA 4MMWA 1C7SA 3AU6A 3O3RA 5AC5A 3T2QA 2GJLA 1KM2A 2Z4GA 1R2RA 2J9XA 2P10A 1VPYA 2TSYA 3HBLA 1B1YA 2QLYA 5GJMA 2IKIA 2VENA 2JFEX 3I6TA 4L4PA 4O52A 3WELA 1QR7A 4BA0A 1Q6OA 4ECWA 3KFTA 3LSBA 5JBFA 3GHRA 1GJUA 1A5OC 2Z7GA 1XLHA 3GIMA 2E9BA 3VNDA 3AMCA 3M07A 4REQB 1MO0A 5HULA 1VEMA 4XO7A 2EEXA 3RB4A 1JXJA 1TWSA 3F5KA 2WQDA 1JDFA 4H9MA 1KV8A 3A9BA 4XX6A 1RD6A 4JKMA 4LAMA 3SB0A 3JR2A 2BXYA 3ARYA 1E6PA 3EKLA 3MKCA 3RMJA 4NX0A 2P0IA 4F0HA 4M8UA 1BYBA 2D3NA 3OGSA 3AI0A 3OW1A 1G4SA 3HV9A 3MUY1 2VFHA 2W9AA 3QPZA 5KFIA 3STFA 3LZ3A 2FPVA 2DQWA 1JCTA 3MHGA 4RXFA 4XAPA 3Q65A 5KT5A 3I3DA 4DYEA 1XICA 1KWKA 4U7CA 1H7OA 3GFXA 3NQAA 2V3EA 3G1YA 3BCFA 4WOZA 2OO6A 2C0AA 2GSEA 1M7JA 4HOXA 4J4KA 3LERA 3KOYA 4HZ6A 4ZE4A 3EGJA 4F0SA 4P7QA 5LNUA 1U5JA 4HSOA 4BCEA 4OE7A 3MWCA 3CO4A 3T4CA 1TUXA 2CBJA 4KCTA 2YIHA 4Z1CA 2OZ0A 3GVQA 5KG6A 3GYEA 2WKGA 4QCFA 4EYIB 1C90A 4FA3A 1UUOA 4WGHA 2XWDA 3Q67A 2WLYA 1AODA 2DW7A 3W1NA 3LBMA 2JALA 3L9CA 4KRUA 5G1YA 4NNAA 2OSWA 4DPQA 3VD4A 3T0DA 3KCLA 4DM2A 1MDLA 1XIJA 4OUIA 1V6WA 2F6UA 2VZVA 3GNDA 4PUDA 2W67A 3UP8A 2F6KA 4RX0A 4W84A 2QPUA 1ISVA 3HFTA 2I14A 2ZA3A 4GI9A 4AD2A 5ABFA 2VX6A 3U4AA 4Z1BA 1UD4A 1TKKA 3KRUA 2VO5A 1WQ5A 3NQEA 2BOGX 4NNCA 3VIGA 2VRKA 3DFTA 1PYMA 4ECTA 4X9YA 3IJ9A 1ZSXA 3PAJA 4MWAC 3CH0A 2V3DA 3QRHA 2HE8A 1UWAA 3RDKA 3RR1A 1MEHA 5K9DA 4HNTA 4FS2A 3FHAA 2WNZA 3LUTA 4WJEA 2P3EA 4UQDA 1RPKA 4UUIA 2Y5EA 5I3KA 1GOIA 1TQJA 3NZGA 1Z8AA 3VKAA 5DY2A 4K39A 3A24A 3VZYA 1CXIA 3BK0A 4H8NA 2CHOA 5BWFA 3VNIA 4O10A 3NO1A 4O3SA 3QPYA 2I57A 1ZAJA 2VDIA 3LBOA 3D0CA 4CEXC 3DFOA 5HWMA 2C14A 3NQDA 2TMDA 1XSIA 3OA3A 4KFNA 1ME8A 4UMBA 3RU8X 1KB3A 4KESA 1FHDA 3B0PA 4JFVA 2C13A 5I06A 3HG3A 3R0UA 4US6A 2O92A 1S2WA 1JFHA 4UTWA 3CV6A 4BWLA 4ZFCA 1Q7MA 5CBBA 3I68A 4NYUA 4GA8A 1HZYA 4MFDA 2VEMA 4ROPA 2WTFA 1MXDA 2QDGA 3BSGA 1ZCOA 2C2RA 2C15A 3CNYA 5DG9A 2DZAA 3GDRA 1TG7A 4BQ5A 1YTEA 5G2HA 2HSAA 2FPTA 4PCNA 4H00A 4EKJA 4NI8A 4AZCA 2I16A 3EPMA 4LC8A 4DI9A 1TTPA 3IVUA 3WQ8A 1XYFA 1HP4A 2YPIA 1FWFC 4G9PA 2VVSA 3CK5A 4Y9AA 1K1QA 4KW2A 4QS6A 3AXKA 3LHZA 4LYPA 2J6UA 1IWBA 5BWAA 4YCOA 2IPJA 2D2GA 3HJZA 1JULA 2R14A 1XGEA 4J2MA 4WQ6A 1SZRA 3T78A 1ME7A 4ATDA 2PDIA 1H7NA 2VUNA 4RU9A 1H62A 3O0KA 4O0ZA 2JKAA 4JTRA 3OQEA 4OOUA 2XFWA 3TXVA 1ZETA 1IZCA 3ZVHB 2X1RA 3GO2A 5LNVA 1U2YA 3BQ2A 4GQBA 4UFHA 5D9MA 4XZ9A 3LRLA 5FF7A 4BY3A 1HL2A 2B7PA 1G69A 2VD9A 4UQBA 1AFSA 2Q71A 4AWUA 1ZBCA 3QXBA 3SRHA 3PW4A 1CNVA 1UWTA 2CZEA 1LLZA 3WF3A 4Q6XA 1JZ2A 1X1OA 1EIBA 2HK1A 3SFKA 3WJYA 2OQHA 3SCTA 6TIMA 4TUFA 4ECVA 4JKKA 2YLLA 5H8UA 3G1XA 4WXYA 5FIPA 4B5NA 4HA3A 1TO3A 3SI9A 1WX0A 1E1EA 1DQUA 3GHSA 6XIMA 2Z29A 3LV6A 3UJEA 4K68A 3IVTA 2BVYA 2XDFA 3EBVA 4FS9A 1QRQA 3BMXA 2X2YA 1P0BA 2W0UA 3KL3A 5HQMA 1DYSA 5C8BB 3RLHA 5MKGA 5C71A 2Y89A 1J18A 1RBOB 3GKAA 1TPFA 1K9TA 1WA3A 1Y5VA 4KS0A 1SW3A 4W93A 4UQCA 3U57A 2C6QA 3ABQA 3DAQA 5IFPA 3BJFA 2HEJA 1DJNA 4IIGA 4W5UA 3P61A 5KFEA 1IT0A 1CCWB 2V5JA 4A35A 3EAUA 4CUCA 4DZAA 1UJPA 2OG9A 3NO3A 5E1QA 4L5ZA 3LA4A 1EJXC 1XSKA 2QYGA 4KWOA 5KG4A 1Z9AA 1QTWA 1TCDA 3C0JA 3T5JA 2YCKX 2HS6A 1ADDA 1OGGA 4IG2B 1HG3A 2WZHA 3TQVA 5C9ZA 3S0CA 1I2QA 3B9NA 3W2KA 2FIQA 3E0LA 1S10A 1X38A 3AAMA 5EYWA 3FGCB 2W7PA 3I6EA 4QFUA 3SSJA 5JH1A 1TYGA 2DVXA 1JGIA 1VEOA 3WD0A 4J9QA 1WXJA 2I9UA 4M51A 4QNWA 1RYSA 1BTMA 2A2IA 2OEMA 4NAEB 4NLGA 3QH2A 4H83A 4Z42C 2EBNA 1BVWA 1R9XA 1ICPA 3AUJA 1VJZA 4AF0B 3EX4A 3TMQA 1XLIA 3VIFA 5IRPA 3N19B 1V3LA 4F50A 1FWNA 2AGQA 2X30A 2AL2B 3SUTA 3NG3A 4PCTA 3AXMA 1HKJA 3GC5A 3DG3A 5A6BA 1K7EA 3DBNA 1JAKA 4AD0A 4HCHA 1P6BA 4FNQA 4FOKA 4RDWA 4F3HA 1F05A 4XZHA 1GORA 4E8DA 3TUUA 4F8XA 4X2PA 3BAXA 2Y62A 1JGMA 3T42A 2FZ9A 4M56A 2PDXA 4HPXA 1GOKA 3OHBA 3BTNA 3BW3A 3P67A 2WSQA 3PM6A 2X0SA 1H3GA 2PTDA 2F8QA 3KL5A 2CLFA 1VYPX 1MXGA 3U3HA 5C2XA 3DHDA 4BR1A 4XG1A 1G7UA 3MMUA 1UP0A 5L1IA 1DJXA 4LY8A 3V6JA 5E0CA 3DHPA 2HVOA 4DBDA 3AWOA 4F4XA 2ZIDA 2J47A 5CZ0A 4QTGA 3GQYA 4M6UA 4B9YA 3B03A 2HNHA 3IRDA 4HHPA 3CL6A 3UJRA 2DUXA 2V69A 4UTTA 2WWDA 5KFFA 5GNYA 3IWPA 5A2CA 2QCGA 2J4GA 2E6DA 3QOKA 2NSOA 2NW0A 4UTUA 1R3WA 3VKKA 3VKJA 4DPPA 4PMDA 1YBQB 1KFCA 4XAFA 4H2CA 3QV7A 4GNJA 5LNWA 4CCDA 3LQLA 1YQ2A 4IIBA 1M7PA 2QJNA 3QR3A 5DRIA 3MP5A 5XINA 5DLFA 3DFPA 4F79A 3PJUA 2GGJA 2WVTA 1PS9A 1KLZA 2Y8UA 4C6LA 5A8QA 1FKWA 3AMKA 2PLCA 4ALDA 1S2TA 2VEIA 4XD6A 2PU0A 3EWCA 1PKYA 3I65A 2VOTA 1PUDA 1E9IA 2REQB 4KIEA 1O95A 4EAMA 3WD2A 3NNTA 4LQ1A 3ZWSA 3ZLHA 1LQAA 5C2GA 1QO5A 1EPVA 4ZO8A 1XKJA 9CGTA 3HPXA 3N9KA 3EWWA 4UTFA 1DHPA 4GZJA 1HO4A 4JEQA 2HDJA 2BWGA 4PB4A 5KFXA 5KFBA 1E6ZA 3SR7A 2F6XA 2WW5A 1FWRA 4B3ZA 4EBCA 3IJ6A 4TV5A 3UZXA 1H49A 3TFCA 1RP8A 3ITYA 4I7VA 1JFXA 1GVFA 3AICA 4G1NA 1FWBC 1XIDA 3P60A 1YTDA 4OGZA 2E09A 1E0UA 7TIMA 1OJXA 1Z44A 3OLIA 3LV5A 4D2JA 5HBFA