2QT3A

Crystal structure of n-isopropylammelide isopropylaminohydrolase atzc from pseudomonas sp. strain adp complexed with zn
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
401
structure length
401
Chain Sequence
KDFDLIIRNAYLSEKDSVYDIGIVGDRIIKIEAKIEGTVKDEIDAKGNLVSPGFVDAHTHMDKSFTSTGERLPKFWSRPYTRDAAIEDGLKYYKNATHEEIKRHVIEHAHMQVLHGTLYTRTHVDVDSVAKTKAVEAVLEAKEELKDLIDIQVVAFAQSGFFVDLESESLIRKSLDMGCDLVGGVDPATRENNVEGSLDLCFKLAKEYDVDIDYHIHDIGTVGVYSINRLAQKTIENGYKGRVTTSHAWCFADAPSEWLDEAIPLYKDSGMKFVTCFSSTPPTMPVIKLLEAGINLGCASDNIRDFWVPFGNGDMVQGALIETQRLELKTNRDLGLIWKMITSEGARVLGIEKNYGIEVGKKADLVVLNSLSPQWAIIDQAKRLCVIKNGRIIVKDEVIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-isopropylammelide isopropyl amidohydrolase
publication title Crystal structure of N-Isopropylammelide isopropylaminohydrolase AtzC from Pseudomonas sp. strain ADP complexed with Zn.
rcsb
source organism Pseudomonas sp.
molecule tags Hydrolase
total genus 157
structure length 401
sequence length 401
chains with identical sequence B
ec nomenclature ec 3.5.4.42: N-isopropylammelide isopropylaminohydrolase.
pdb deposition date 2007-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2qt3A01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2qt3A02
2OQLA 3OODA 1ONWA 3S2JA 3QY7A 1PSCA 2XIOA 5FSEC 3K4WA 2FVMA 3SO7A 1EJSC 2HQAA 4UBPC 2O4QA 1EJVC 4PBEA 1RA5A 2Q09A 1NDWA 2A3LA 5A6TC 3IACA 3GU2A 4H01A 3LY0A 4KEVA 1O12A 3ISIX 1FWGC 4ZSTA 4LAOA 3GUWA 1K6WA 3UR2A 3AU2A 1RK6A 4C6FA 2EG6A 4ICMA 4GBDA 3GG7A 4IG2B 4DO7A 4C6BA 4C60A 3GTHA 4DYKA 2WJDA 2P53A 4LALA 3WYZA 4ERGA 4GOAA 4ERAA 3UR5A 4EPEC 4F0SA 4IH3A 4PCPA 1EF2A 3MTWA 4BY3A 2P9BA 1A5OC 4IG2A 2WJFA 3AU6A 4XD5A 2PGFA 4GY1A 1ADDA 4IQJA 3GIPA 4B91A 1NDVA 2EG8A 1POJA 4LCQA 3CS2A 1JGMA 1M65A 4PCNA 4CNUA 4IF2A 3URBA 1R9ZA 4RE0A 3LGGA 1S3TC 4QS6A 1UIOA 4Z42C 4KEUA 4H9ZA 1XRTA 3B0YA 3DC8A 4KESA 4C6JA 1E9ZB 3MVIA 1FWDC 4DNMA 4BKNA 2HNHA 3MDWA 3E2VA 3ICJA 2Z29A 2E1WA 4UB9A 4GZ7A 4B3ZA 3QGAC 1NFGA 4LFYA 3MSRA 3N2CA 4NG3A 3GTXA 3GGMA 3SFWA 3K5XA 3S2MA 4WHBA 1ONXA 2EG7A 2G3FA 4I6VA 3LU2A 4C6PA 5HMDA 3MDUA 1EJTC 1EJUC 2PLMA 4R85A 4GY0A 1A4LA 4QROA 2WJEA 3RN6A 3HPAA 3FEQA 3F4CA 2QT3A 3LSBA 4WGXA 4C6OA 4JOMA 4H9UA 4CQCA 1K70A 2VM8A 3D6NA 3IPWA 3QY8A 3EWDA 1V79A 4KERA 3RHGA 1UIPA 2ADAA 1FWAC 4RDYA 4XD6A 4E3TA 1RJQA 1GKRA 4BJHA 3QY6A 1BF6A 3UPMA 3URQA 3A3XA 3B0XA 2AMXA 3ID7A 3GRIA 2PAJA 1HZYA 4EPKA 3WMLA 4PE8A 2UZ9A 1R9XA 4DZHA 4G7EA 3IV8A 1FKXA 1V7AA 4KQNA 4LANA 4CQDA 4ERIA 2D2HA 3O7UA 4C6EA 1R9YA 3C86A 4J35A 4C6NA 1J79A 2YZ5A 2VUNA 4IFRA 2HBXA 3NEHA 3MKVA 1YBQB 2QPXA 2DVUA 4DI9A 3PNZA 4KF1A 4EP8C 3T81A 3OJGA 4R7WA 3A4JA 2YB1A 4AQLA 2D2GA 3TNBA 4GC3A 4RZBA 3DCPA 1V77A 3NURA 4H9XA 3F2CA 3FDGA 1E9YB 1M7JA 3V7PA 1KRMA 3IGHX 3LA4A 4HK6A 2DVTA 1I0BA 1YBQA 4GX9A 4V1YA 4QS5A 2GSEA 1RJRA 3F4DA 2O4MA 3G77A 3IJ6A 3PBMA 4GY7A 1WXYA 4MUPA 2HBVA 3LGDA 2VC5A 4H9MA 1YMYA 2HPIA 1KCXA 1QW7A 3RCMA 1ITQA 4C6KA 3A3WA 4LEFA 3GIQA 1K1DA 1V51A 4CNSA 3IRSA 3JZEA 4TQTA 3KM8A 2ICSA 1A5NC 3CAKA 1QXLA 3B40A 3S4TA 3MVTA 3RYSA 2PGRA 3UBPC 4KIRA 1GKPA 4H9YA 3PANA 3FDKA 1ZZMA 2FTYA 2BGNE 2Z26A 1EJWC 4EPDC 2ANUA 2Z4GA 3QGKC 1O5RA 3HM7A 2I5GA 3AUOA 2Y1HA 3MPGA 4C5ZA 3E38A 4LCRA 1EYWA 1PTAA 4V1XA 3E0FA 2R1KA 4H00A 1A4MA 5CH9A 2YXOA 4XAGA 3GTFA 2OB3A 1XRFA 2R1MA 4RDZA 2OGJA 3MJMA 5AKQA 1KRAC 2DVXA 4H9TA 3BE7A 2E25A 2VC7A 1WXZA 4L9XA 4I6KA 4HA0A 1EZ2A 5E5CA 3K2GA 4CEXC 3URNA 3OVGA 3OU8A 5LXXA 3T1GA 2HPMA 4P5UA 3R0DA 4ZSUA 2GZXA 2Z24A 1FWFC 2FTWA 4J5NA 4INFA 4IGMA 4XAYA 2R1LA 4M51A 4LAKA 4WVXA 2Z28A 4HK5A 3ORWA 2QVNA 4DI8A 1FKWA 2FVKA 2Z27A 4KETA 3OOQA 1EJRC 2W9MA 3OQEA 1NDYA 4B92A 1P6CA 1EJXC 4QRNA 3S2NA 2RAGA 1KRCC 2BB0A 4XD3A 1PO9A 4XAFA 4LH8A 4LCSA 4RDVA 2GOKA 3TN4A 4C6MA 4EPBC 4DZIA 1POKA 1GKQA 3TN3A 2Z00A 2D2JA 2CZVA 3GU1A 3E3HA 2P50A 2GWNA 2QS8A 1J6OA 4XAZA 1XGEA 4DLMA 4F0LA 1J5SA 4DLFA 1RK5A 1P6BA 5HMFA 1FWJC 1M68A 4IGNA 4OFCA 2F6KA 2ZC1A 1A5LC 4C6DA 4PBFA 1FWHC 2AQOA 4J2MA 1FWIC 4DIAA 1RAKA 2KAUC 4NP7A 3IARA 2VR2A 4G2DA 1FWCC 3LS9A 2WM1A 3UF9A 1NDZA 4GK8A 4HK7A 1A5KC 1A5MC 3NQBA 2OOFA 3CJPA 4NI8A 3GU9A 3GTIA 4AC7C 4CEUC 4GX8A 2Q01A 4HJWA 4IFKB 5HMEA 4QTGA 5G4HC 3ITCA 2Z25A 1UBPC 1FWEC 3PAOA 3TN5A 3E0LA 3EGJA 5FSDC 1W1IE 2R1PA 4C6CA 4XD4A 1YIXA 3O0FA 2R1NA 1XWYA 4LAMA 1PB0A 4C65A 3F2BA 3F2DA 3S2LA 2Z2AA 4C6LA 1RJPA 4IFKA 2VHLA 2Z7GA 1ITUA 2YB4A 2UBPC 3TN6A 2GWGA 3E74A 1KRBC 2Z2BA 1I0DA 3URAA 4C6IA 1V4YA 1RA0A 1YNYA 4CNTA 1YRRA 2PUZA 3LNPA 4D8LA 3EWCA 4C5YA 4KEZA 1VFLA 1IE7C 1DPMA 4GXWA 3PNUA 4G7EB 4L6DA 1P1MA 4F0RA 3WZ0E 4RDWA 1UMLA 3T8LA 2AQVA 1FWBC 4H9VA 3LSCA 4YIWA 4B90A 4C6QA 3DUGA 4R88A 2IMRA 4QSFA 2I9UA 2OODA 4IFOA 2FFIA 3HTWA 4GYFA 4CQBA 1J6PA
chains in the Genus database with same CATH superfamily
2OQLA 3SEPA 1TTPA 3LK6A 3WIJA 4JTGA 1ONEA 2VRKA 2DDXA 5AHNA 1G4SA 5E0FA 3M0JA 4LS2A 3WX7A 2V5CA 1QAPA 1RR2A 4JTTA 1FWGC 4DX3A 4LAOA 4WF7A 3CEPA 3VKDA 5JBEA 4Q8EA 1TYGA 2FGZA 1I60A 2EG6A 3PJWA 5AZ1A 4Q44A 5A6KA 1YW1A 3IUHA 3CUGA 3MSDA 2HVMA 1OEPA 4LALA 3TZFA 4KBXA 1TJ1A 1N7KA 5MKGA 3MI2A 3R8RA 3U4AA 1DQWA 3QLDA 1LQ2A 4HOXA 2CLLA 1MQPA 3FVMA 3STGA 3TQVA 5DRCA 4IG2A 1T94A 3TVAA 3LPFA 2VWSA 3UW6A 2RHGA 5C7VA 2I57A 5K4XA 4WCJA 4DUVA 2BOEX 1Q6DA 4IF2A 3LGGA 3PBWA 1CX9A 4LC8A 1VFOA 4GH1A 1ISYA 3Q45A 3DFOA 1WAUA 3B8SA 5I0DA 1OYBA 2ISWA 2Y2WA 2E1WA 4UB9A 3WFZA 5E1QA 1CNVA 1R3SA 1RCXB 1U1HA 5EBAA 3CPGA 1UOZA 4DJFA 3VDBA 2AGTA 1VPXA 1C93A 2FDSA 4RUCA 4WIWA 4JN6A 3CEUA 4W87A 3M5ZA 1MFVA 5XIMA 1TZZA 4Z0JA 2PTXA 5FEPA 1EPVA 3NZRA 5DXXA 1YEYA 3PZNA 3D6NA 3GWQA 1UC4A 1MNSA 1W32A 1FWAC 2OX1A 5LNWA 3W87A 3QY6A 3TFCA 2JK2A 3URQA 4AYGA 1WOBA 3WNPA 4DELA 3EA3A 3GDBA 3HBLA 1ICPA 4DL3A 2H8XA 4D9PA 1QI5A 1GG1A 3ARPA 3WUEA 2X1RA 1PKLA 2D2HA 1EEXA 1S0OA 4DWSA 5J04A 4CD8A 4F2BA 4Z2HA 7PTDA 1IWPA 4IFRA 2HBXA 1LWJA 1MNZA 3M7WA 2WMGA 2XCPA 3KWXA 1SZNA 1OHLA 1CGTA 3BK0A 3GHTA 4Q6JA 3KTCA 3W76A 4WDXA 2YBTA 1Y7VA 3NURA 3PW7A 3F2CA 4UMCA 2A4AA 1E5NA 1XLBA 1VLWA 5EMYA 4UTUA 2XVKA 4V1YA 3BQ0A 2GSEA 2R8IA 3G1SA 2VT0A 4LEQA 1J18A 2PE4A 1KFJA 1RHCA 5CC5A 3N2TA 1WXYA 3LTPA 3NQDA 5D9OA 3UZ5A 3W00A 4H19A 2CLEA 1GORA 1FXPA 2NX9A 2A7NA 1M5WA 3A24A 4GUJA 3WJSA 2P8CA 3MMTA 8XIAA 3R25A 3L21A 4GMEA 3KM8A 1A3XA 5D2VA 3AICA 4Q8MA 3LTSA 2E8ZA 3PANA 3PF3A 2B7OA 3S1WA 3AIWA 2I56A 1MXGA 2ANUA 1TV4A 4O0KA 2Y62A 4CD5A 2I5GA 3MS8A 4ZB5A 4DL6A 1PX8A 4NYUA 5FIPA 5KFMA 4R7JA 3N2MA 6XIAA 1XLGA 2XJ7A 4H00A 3FS2A 1ZJHA 3KCJA 3UFYA 4F2UA 1EIXA 1S5WA 2DGAA 2OGJA 4J9KA 1OFRA 1Q7ZA 1WDWA 1QASA 4F3HA 3C0JA 1VYSX 1TVPA 2V69A 1FBAA 4N9BA 3W2MA 3IS4A 1UZHA 4Z1CA 3ABSA 2J8GA 3L4YA 5A6JA 3VINA 1KR1A 1TJ0A 3B06A 1LLOA 1TZ7A 3NQGA 1VH7A 4O28A 4G3IA 1OIMA 3PBVA 1Z48A 3BV7A 2J13A 3MKKA 2FIQA 1FA2A 1O7AA 1CGWA 1SO5A 5FF7A 5C0QA 3AMGA 4DUWA 4DJDD 1QHOA 3MO7A 4GIYA 3STEA 1TCDA 1BVZA 1A0DA 2XCAA 1Q13A 1SO6A 3CZKA 3M9NB 1XIFA 3ARXA 3GDMA 1H1YA 1KRCC 1K9EA 4XIMA 1VCVA 3BJSA 3UXAA 3HA1A 3H22A 1A0CA 2D2JA 3HO8A 4KRUA 3USZA 2GQ8A 1WDDA 2P50A 4D6JA 1OGSA 1HKVA 3D47A 4UWMA 3K8LA 1AD1A 1CGUA 2VX4A 4N6EA 3WUFA 4O50A 3W4RA 4IXXA 4PBFA 3M9OB 2Z1VA 4MZYA 2BWGA 3IAQA 4XZWA 1OZMA 4NP7A 3S6OA 3NIYA 4URIA 1E0TA 4KCUA 3UZJA 3GK0A 1P4CA 3QHMA 4K36A 3W1NA 8CGTA 2P0IA 1NDZA 3NDZA 2OOFA 3UNDA 5FEWA 2V2HA 2IBKA 3GILA 3GD6A 3EWWA 5HQMA 1DJQA 3G5EA 3S8HA 4ECVA 2A2IA 2NX1A 1E0XA 5A95A 3TE9A 1GPFA 2PF0A 2XZ7A 1GTEA 3MYOA 2QF8A 2XU2A 3E96A 2FMOA 2WCAA 5D9PA 1LTDA 4K6AA 3H2CA 3TN6A 1QI2A 3W25A 2GDQA 2V4QA 3HGSA 4PUWA 1VYRA 3VMNA 1C29A 2GGHA 4I9AA 1DTNA 3KHGA 1TPDA 3AUJA 4DJFC 2KX9A 4X63A 2AAAA 1VFLA 3N6JA 3VKAA 3IVSA 4R27A 3IJ9A 4L6DA 3UCQA 1XKJA 3C52A 3WBXA 1H49A 3GAYA 1W31A 1C8YA 3PN8A 3UXKA 3RIKA 2A21A 5KITA 2VL4A 3LGEA 5KFUA 3LHUA 2B7PA 3H2NA 4M1BA 5CPSA 2I14A 3VGFA 3GU2A 2B7NA 3OVPA 3CV6A 4EE9A 2ZRUA 4ZSTA 1KBKA 3DYMA 4CNOA 4S23A 1VIWA 4ED8A 1CGYA 1JYXA 3DGRA 1JD7A 3AI0A 1ZBCA 1G1YA 4WRHA 4WX2A 1E56A 6ALDA 2GYIA 2OSYA 3VCRA 4DWSC 1HKWA 3TXZA 3W1RA 4CVWA 1TO3A 5D2YA 1C9DA 2VFEA 4I5XA 4EPEC 2FJUB 1JULA 3UESA 4AZCB 3E02A 1SFLA 1Z42A 4GISA 3MTWA 1K3UA 2F61A 3R13A 2PTWA 1K7EA 1ZJAA 1NDVA 4M19A 2X40A 3LG3A 1LOSA 1TWSA 3EPNA 1OX4A 3PHAA 4H8HA 2PU0A 1EA0A 3R5EA 4Z42C 3VIJA 3A9BA 1LRNA 3UVIA 3ATYA 4DNMA 3LV5A 2X2YA 1GHRA 4HKPA 3GHUA 1TPH1 4RZ6A 4HMDA 3LXBA 4X60A 3GGMA 1OVDA 3MSGA 4QNEA 1B54A 1J0YA 3AZSA 1OF6A 5EWFA 3V35A 4FHAA 4O3SA 4GIAA 4QAIA 1AQMA 4UFKA 3EOEA 3U9IA 3IIZA 2H8ZA 4C6OA 1THFD 2WNZA 1R2TA 2CXEA 4CQCA 2R82A 4XZMX 1RJQA 4BJHA 2X7VA 2FH8A 4MYXA 5D32A 1E0VA 2VFHA 5AC8A 5I02A 4XX6A 1ZCOA 1ZUAX 3TAOA 5FF0A 5FEZA 1WZKA 1TMQA 2A0NA 3I4EA 3WDPP 1T8QA 2ZUNA 2J6SA 4MOZA 3PTDA 5HWMA 1VLIA 5LKYA 3GYCA 3C5QA 3V1HA 1M7PA 4GVFA 2GSJA 1I1XA 3MV11 3VIKA 4FLSA 1D9EA 1BG4A 5FJOA 1RV8A 1H41A 2CLKA 4F4XA 2CKRA 5FF2A 3V18A 2OWWA 1UWUA 4PMUA 2FB3A 4BI5A 3LDVA 4KF1A 3T5LA 3AHZA 2X0HA 3MUAA 4BQ5A 4H9XA 3DC0A 1E9YB 3ITVA 4HK6A 4NNAA 4FNSA 4XZHA 1RCOB 4AZIA 2WM0A 1X96A 4FAMA 1YMYA 3TMQA 1CCWB 2CW6A 5C55A 4F4WA 4L6HA 3XIMA 3M0MA 1DIEA 3N9RA 2VELA 2ZX8A 3B4YA 2OU4A 1SSDA 4AUBA 3T0CA 5C9WA 2OPJA 1W3JA 5BOEA 3MHUA 3KOWA 4H6QA 3CIWA 2W7PA 4QITA 3EOUA 3BLKA 1UJQA 3RJXA 1F3TA 3GR4A 3IVUA 2DW7A 3TQPA 4YCPA 4E8CA 4DBUA 1Q7QA 4S3DA 4PCTA 3GDLA 3DYOA 4DEFA 3AHTA 2O7QA 3S1XA 3E38A 5HINA 1H3GA 1GYLA 3OQ8A 2GL5A 4HU3A 2R1KA 5D8ZA 5C5YA 3BQ1A 3PZTA 3Q58A 3UZXA 3KBSA 3SGZA 1DE5A 1JZ3A 5D9MA 3SGUA 1HT6A 1WXZA 2FZNA 2HVOA 4JIHA 4HA0A 3I7RA 4DL4A 4CEXC 2H9AA 3UZWA 2DIEA 4S38A 3WUBA 1TMLA 2EPNA 3BANA 5AVHA 5BYWA 5F1VA 1Q3NA 1TRDA 3TX9A 3UNTA 4DPPA 5FJTA 5KFJA 4PMJA 2QCMA 2XGIA 3DHFA 3WH9A 4J3SA 4LBSA 2KZHA 2Y7FA 1DJGA 3SR7A 1Y0EA 3S2NA 2QUVA 3CUZA 1OYCA 1JZ7A 3TTEA 3NL3A 4I7WA 4LCSA 2GOKA 5CZJA 2XG9A 1WXJA 7TAAA 4IL0A 4ZVJA 1HIZA 2BFGA 2VXNA 3E3HA 3C8NA 4YWSA 5AVNA 3TJ4A 3B9OA 3HPSA 2V6AA 1UJPA 5H2ZA 4NX0A 3H21A 4FK9A 1MYRA 3TWBA 4S1FA 1XYFA 3F1QA 2J79A 3YPIA 1S2TA 2VZVA 2DZSA 1XIDA 4GYPA 3N73A 4R8UA 2QVHA 4AVFA 2OWXA 1DQUA 1W0MA 1Q5MA 3H2OA 3O16A 2WAGA 2ABAA 3UPWA 3KRUA 2ZYFA 3P0XA 1KLYA 1REQB 3AMKA 1J0IA 3RLHA 1GJPA 3MI6A 4GXPA 4LAMA 1BTMA 3SCWA 1S3HA 4MKVA 2F6XA 2P76A 3L0GA 4GJ1A 1RJPA 3FGCA 2R8KA 2Z7GA 5M1TA 1ITUA 1OFEA 4F0HA 5KG1A 1HUVA 1UA3A 3G1HA 5AHEA 1XG3A 1GJUA 1BFNA 3NAVA 1K1SA 3OG2A 4C5YA 1DPMA 4NNCA 2JEQA 2OX4A 1F8MA 1OG0A 4LBUA 2AQVA 2Y6ZA 4Z2KA 4H9VA 4B90A 4AWUA 2VZTA 4C6QA 2IMRA 1C91A 5KT4A 4RE3A 2OH2A 3TYCA 1VPYA 4DAIA 1S1PA 1VEPA 1L6GA 4WR3A 1RA5A 5HOSA 1TPFA 4JFWA 5KT7A 5DGBA 1MVYA 1SUXA 3T09A 4E8DA 1BKHA 1V3MA 4P7RA 4GI9A 3KDNA 1AL8A 1GVQA 4XO6A 5KFZA 4ACYA 1HJWA 4GFIA 2P53A 3MWCA 2WTFA 4AHOA 1HQTA 3N18A 1DWHM 3QH2A 1E6XM 2C13A 2P3EA 3GDKA 3VM5A 2PBOA 1VIZA 3K1GA 2WZMA 4Q7BA 4F0SA 1Q2SA 1T6MA 4BY3A 1OGBA 2HXTA 3DAQA 4BK9A 3G6VA 1T0OA 4JY9A 4RCXA 4D8ZA 4WKHA 4BQ3A 3GIPA 3W1LA 4B91A 4X0VA 2XIBA 3NPXA 4FF7A 1SZFA 2HVNA 3S9IA 5M3WA 1EOKA 3QRHA 1VRXA 2V82A 4H9ZA 5LNRA 1JUEA 2OO0A 2UV8G 5DXYA 1QJWA 1NF7A 3K46A 1CGXA 3HMCA 1WBJA 3CIVA 1N56A 4PN2A 4CN4A 4NG3A 5LIWX 3HQOA 4AHPA 4AD0A 4IIDA 3MDUA 1QWKA 1R85A 3DG6A 1IT7A 4OTKA 1DWGM 2WC4A 4PUEA 3W1AA 4RNOA 3FCPA 4XZLX 1IR2A 3W74A 4LW7A 2IMWP 1NELA 1BAGA 1GYNA 2OGYA 4IHCA 4QEHA 3POCA 3W24A 2EPMX 4GQRA 2EEXA 2XINA 2YBUA 5I77A 5IFPA 1DL3A 5I3KA 3WQEA 3GRIA 2A3HA 1OF8A 3BAKA 4Q4QA 1TV5A 2A3BA 3GM8A 4QWDA 1HXJA 3KOZA 4HBKA 3U6WA 3IV8A 2BHYA 4XQ6A 2EF9A 9RUBA 4ERIA 3SCVA 5JQ9A 2E1DA 5KG7A 1MMFA 2G3MA 2V4RA 1F3EA 1UKSA 2YZ5A 1WZMA 3RU8X 3WLMA 2WANA 3N1AA 2EJ1A 3W82A 4R7WA 2B81A 3WMBA 1Z32X 4GFSA 3O2LA 1L6YA 1Y5VA 4ZQOA 3NQFA 4U33A 4H8NA 1SZEA 5I6SA 1VHCA 3IGHX 4LGXA 1QBBA 3OLEA 3KUMA 2EXOA 1S39A 1JG9A 5KFKA 1EUAA 1SW7A 3ZWTA 2W7OA 2OVLA 2DZXA 4WGHA 3SUUA 1KFWA 1VBUA 4LC6A 4J4KA 3QTGA 4Y6GA 1HO4A 3T4WA 4E2VA 1XQLA 3QZ7A 3PPCA 1V51A 1FXQA 3P81A 3TZNA 3U8GA 4O13A 1A49A 1XLDA 3W38A 3GUGA 1BPLB 2NT0A 3FJ4A 4WJEA 3VD9A 3S4TA 3CZJA 1R3YA 2UY5A 4DYJA 3UBPC 3G6YA 4YTUA 1UR2A 3C2OA 1UR0A 2BBFA 3KEHA 2JALA 2Z4GA 2ONEA 3A4AA 3FAWA 3LBCA 2FMNA 2CZFA 4AWEA 5H8UA 4J9PA 4O16A 1OFQA 3GV5B 4GYPC 3B05A 1D3CA 1ZCCA 3HGJA 1ML1A 1PKMA 4IX0A 3L67A 1Q6QA 3NL5A 5AN7A 3BAJA 1H0IA 2F84A 2WLZA 1XLCA 3L4UA 2AGPA 4O19A 1WE5A 1LM1A 4RL3A 2R9RA 3QMRA 4IP5A 1CXEA 3HPFA 1GGOA 1WZAA 2CKSA 5DX7A 1LF1A 4AD1A 4IMGA 3CM4A 4UQBA 3H2MA 3M4HA 4A22A 4OE7A 3CT7A 3KBJA 1W1YA 4ZGYA 3OU8A 4WK9A 2WWCA 4Z2GA 5M5DA 2WV8A 3DXIA 3UU0A 1FWNA 4RE2A 5AHFA 3OVQA 1FWFC 1QT1A 4JIEA 1UD5A 3FK4A 4QG8A 2VRQA 1OD0A 3PR2A 1A47A 4LOCA 1RCQA 3LCXA 4ENLA 5SWUA 4IZGA 1U5VA 2O56A 2I9EA 1UH4A 3ZQ9A 4TXEA 5U7SA 5KG5A 3SN0A 4RUBA 5BRBA 1XH1A 1YPIA 2VCAA 4C1NB 2XVGA 3VC6A 4R33A 1X1NA 1R3WA 5BU9A 1TX2A 2TSYA 1MXSA 1LOQA 2V2DA 3FA5A 1XSIA 3W1XA 1NOWA 1Q7MA 3VZZA 3CAQA 4HOWA 1J5SA 4AYSA 1XYCA 3V0TA 1J96A 2YCKX 4ECUA 2FLPA 2QCNA 1FWIC 1F07A 3TH6A 3WH6A 4IMAA 3LMZA 3GBDA 4IUOA 1O4UA 3HOJA 3TJIA 3KCLA 2J7HA 3PZIA 6PTDA 2HE5A 4W93A 1G67A 3VK5A 4NI8A 3NQ2A 2A7RA 1O6IA 5C70A 4LVDA 4N2YA 5F2IA 3HGOA 4OBRA 2RJHA 3RJYA 1TPVA 4QTGA 2E0PA 1HL9A 4K8GA 3EGJA 4X22A 4XD4A 5E93A 1US2A 4F2TA 1A0EA 1VBGA 2QGYA 3A5VA 2FPYA 2XVLA 3WD0A 4C6LA 4M5PA 3W7JA 4DJFD 1QPKA 1OC5A 1LBMA 3LCWA 1E1FA 2Z2BA 1JL8A 1XLJA 5KFNA 3SIMA 4QBXA 1PVNA 4CNTA 2I1OA 5F2LA 3LNPA 2OCZA 3BUVA 1AMKA 2RDTA 3ARVA 1GZJA 4V28A 3PNUA 4G7EB 2ALDA 2IUZA 3VGEA 3EZ4A 3VZYA 1XV8A 3WJYA 2YA0A 3LUTA 1ZY9A 2WPBA 1XM3A 4OJYA 1SYTA 3DESA 1XLFA 1HJUA 5ABGA 2FLLA 3W6YA 1NDWA 3NSNA 4Q45A 3HFTA 4REQA 1XRSA 2DPEA 3PULA 4E4UA 1E4IA 3LRLA 3REQA 3ALFA 1NF0A 1UYQA 3PTKA 3MW7A 4GBDA 4MB1A 4M6VA 2FLNA 3UXDA 4IJBA 3BSGA 4WY0B 2CYGA 4YS1A 2C1IA 3TDFA 4ED6A 4KWWA 5A6BA 2VQUA 3G24A 5KT3A 5FJUA 4O53A 4GUFA 4XIAA 5A8MA 5A94A 5BRPA 2J8FA 2NQJA 2PODA 4IGHA 3RAOA 1FHDA 1JGMA 2VOTA 4U2YA 3QYQA 1EF3A 1BRLB 3ATZA 4QS6A 2ZE3A 4C90A 1ZENA 2NUXA 5FEXA 5KFPA 3I7SA 1Q8AA 3OTRA 2VUYA 3I4KA 3O0KA 4HJFA 3USBA 3GZ3A 3TR9A 2FDMA 2PZ0A 3MMWA 1K4GA 2PGWA 2G3IA 2G3NA 3P93A 3GVWA 4DL7A 1AZ2A 2EG7A 4MWAE 5B7YA 3AHVA 1IWAA 1W91A 2E6AA 4OHQA 3HZ3A 4HGXA 1SW0A 2BX7A 2ESCA 3DI0A 4PFHA 1UUOA 3OLDA 2WVUA 4WKAA 2IKIA 3FA4A 1IWBA 2ZRYA 2BMBA 3BGAA 4PMXA 4PYSA 2ADAA 4O3OA 4LUSA 1J0HA 2V81A 1UD3A 5CGQA 2ZBTA 4YU1A 4NJJA 3LCFA 2PPGA 4Q43A 5CLTA 2AOSA 1FOBA 1B4KA 4PE8A 1ME9A 3ANYA 3RILA 2J62A 3DDMA 3TOYA 3PZUA 1V7AA 1WNOA 1OX6A 4MMWA 3GKFA 2HSAA 4BZYA 2DT0A 5FA5A 3JU2A 4XSLA 2DSKA 2VUNA 3PTMA 3BLIA 3DHDA 4IRKA 3WLIA 2DVUA 3M43A 4BF7A 4HNVA 2BSLA 2J7CA 2VENA 1S5TA 4AQLA 2CXGA 3UG4A 1DWJM 2XH4A 2JKPA 3VU2A 4QJ3B 2YYTA 2W5FA 3TYBA 3QQ0A 2FQIA 3W27A 4JR5A 1DWIM 3FFSA 3G77A 2OJPA 5AECA 4DL5A 1P6WA 1RZMA 2Y61A 1CXIA 1D7KA 4HPXA 1KCKA 4PCFA 1OCJA 3EX1A 4FNPA 4UQ9A 4KWVA 5HPOA 4BI6A 1UWRA 3OP2A 4TX6A 4ATLA 4I90A 1CIUA 3JZEA 1V7YA 4IUGA 4L4LA 3H54A 4JV2A 4NY2A 3HQNA 1LL6A 1GKPA 2IPFA 3UCCA 4Q4OA 4EYHB 2W4XA 1G5AA 3GIMA 3CZ8A 3H7RA 5G1YA 1JCLA 2VGGA 5C8BB 1DV7A 3HM7A 3WFAA 3LHZA 4R34A 3LD5A 1JDAA 3RDKA 3TTYA 1KFCA 4XUYA 1MQQA 4US6A 3E0FA 1VZWA 3W7NA 2TMDA 5FI8A 2F2HA 1HJQA 3BMXA 1F73A 2B4GA 4HA1A 4YYCA 2CWNA 4H9TA 3BE7A 1J11A 1VFSA 4D6CA 1KM4A 5HPCA 3EX6A 3TC3A 3SCSA 3R8HA 3STFA 5LZLA 2ASDA 4MB4A 3N3MA 1YTDA 3OHAA 3L4WA 3UJ2A 3IJLA 3T5KA 4S39A 4F4YA 1YYAA 4P5UA 3PB2A 4EOUA 4Y2WA 4UTKA 2AQ4A 4MNLA 4XAYA 3HU7A 2NQ5A 4PL2A 5B7ZA 1KFEA 1J0JA 1RYRA 1IQ8A 1SW3A 4WQ6A 2UVWA 1K6AA 5K9DA 2FVKA 4KETA 5H6HA 5DCEA 4ZFMA 2V5JA 3OQEA 4B92A 1KC7A 4ZO7A 4H8VA 3L5AA 2J7BA 5G2HA 2BB0A 1PZ1A 3ARSA 1PO9A 3GNDA 1MZRA 5JBFA 4LH8A 1IEWA 3W7QA 3WLLA 2REQA 3D46A 4CU7A 2XH0A 2J7FA 2RDUA 4ZB2A 3AMCA 3VM7A 5KG2A 3QGVA 3E2RA 1RK5A 2ZZ4A 4FA3A 2IPJA 4DM2A 3DENA 5E0CA 4KIEA 4AW7A 4KGLA 3SCNA 4S3JA 1DHPA 4M81A 1HKMA 4J2MA 2VZOA 3S6DA 2VFIA 3R11A 4P2VA 4GGBA 4HPNA 1XF0A 1C8VA 4YTSA 4FEZA 4GE8A 3SY5A 4ALDA 3I65A 1Q2RA 1GVIA 1E0UA 4IFKB 1GHSA 4XBSA 4NZ5A 3BAIA 4AD2A 1UMYA 4MB5A 3BV4A 2R1NA 1LG2A 2NSOA 3THCA 4PBGA 4PSRA 1YXDA 2WC3A 2JQXA 4PB4A 2I7GA 2C6QA 4AY1A 5KFLA 2OOGA 1Q6CA 5HANA 2E68A 1H7RA 2A3CA 1JIHA 3FXGA 1AW5A 3L66A 3VFCA 1R3VA 4LSBA 4IRDA 1ITCA 2ZX5A 5LHFA 1MEWA 1WKEA 3QLLA 5AB3A 3CWOX 3MO4A 4UOJA 3TFXA 2V3EA 1ECQA 1V02E 1JRBA 4KEZA 4PMDA 5CG0A 3SRKA 3HJEA 1CXLA 3RM8A 4LXFA 3P80A 1B5TA 4UQDA 5EMMA 1VCGA 2Q8XA 4C7DA 1W9PA 2DSWA 2ZUMA 1PSCA 4JFVA 3IIPA 3WQ5A 4AZGA 2ACUA 2FPVA 3G1VA 3PBYA 1FWTA 4NZFA 4IT1A 1P1XA 1QDSA 3IJQA 3G0XA 4LTSA 1CEOA 2WMJA 3LY0A 3GHRA 1E0WA 5MKGB 1K6WA 1MUMA 4K37A 4UTTA 1ZPTA 2CIPA 3HJZA 3B8DA 2WZIA 3GG7A 3KHJA 5L1KA 3POHA 4IG2B 2ODOA 3MR5A 1E6RA 3KAOA 1P0BA 3GTHA 4ORMA 4GJIA 2ZVIA 8A3HA 3Q37A 2WO5A 3R6IA 2J9YA 5LYRA 1XLAA 2PC4A 4HPJA 4ASTA 1TCMA 1EF2A 2BQRA 4HMNA 4UIOA 4S3EA 2PWGA 3UJEA 2VI0A 2YJQA 3NM1A 1POJA 2RFGA 3I3EA 4IOTA 1S3TC 1GUVA 4IM4A 5D2TA 2FZ8A 1N55A 3DC8A 1E9IA 2QDGA 9CGTA 4CVUA 4ZEPA 2PGEA 2QJHA 2BQUA 1O68A 3N2CA 2D1ZA 4NJKA 5A6SA 4ED7A 2DUZA 3DU0A 4FOJA 4C6PA 2ZUSA 1H0GA 4HCDA 3WQVA 1QPNA 4UZUA 5AHMA 3V3WA 2NX3A 5CJMA 3PW0A 3M47A 3VOHA 1XG4A 3FYYA 3ZOAA 3LI1A 4ZR8A 5FF4A 4JD4A 1UIPA 2R24A 4MUZA 2CITA 1GKRA 2ZA1A 1DJHA 1ELSA 3KWSA 4D6FA 4DWSB 1SO3A 3QJAA 4FZIA 4IPPA 1HZYA 4Q4SA 4LWWA 2QJIA 5EMKA 1EWDA 3PS7A 1T3NA 1ADSA 1IXQA 1FKXA 2IPWA 2WSRA 2W9CA 7REQA 4C1LA 1IM4A 4HPHA 3ARQA 2ZOXA 1QR7A 1FWSA 1JDFA 3WD2A 4AMAA 3H4WA 2J8TA 3DGBA 2OLSA 3W2JA 1H50A 4EAYA 3GC2A 3C2YA 3I68A 3AQUA 2D22A 2DPIA 3DCPA 4PEEA 3FW6A 3TLLA 3DG3A 3BJTA 1S5MA 2FFCA 1PE1A 4GX9A 2ZUTA 5C5JA 1DQXA 1UQYA 3DG7A 1HL2A 5M2FX 1RY0A 4KWSA 3L2LA 3STCA 2NZLA 1IEXA 5E09A 3OZYA 3ZSSA 2ZXQA 3P62A 1GNXA 2QMJA 4B5NA 1JAEA 1QW7A 3RCMA 3KOXA 3RX4A 3PR5B 4QHRA 3T0BA 3VIPA 3IRSA 3G3DA 1OGGA 2PD5A 3CHVA 1F3WA 2QUMA 3C3UA 3KXQA 1K02A 1W2VA 3W1MA 2GQ3A 1E3XA 3W7OA 3RAQA 1P7TA 2OTDA 5DQPA 5I07A 4GKTA 3BURA 3WLSA 3KL0A 2TAAA 3C3NA 1O1HA 2PS2A 1HL8A 1EJWC 1XBXA 3WD4A 3EPIA 4C7GA 2PEVA 4AVOA 2DT2A 1NAL1 3M0XA 4D1IA 3SECA 3QPEA 2OFJA 3KHRA 3MR3A 2BXVA 2UVRA 3BMWA 1L2UA 1K4HA 4AIEA 3B97A 1S2UA 1V6WA 2E25A 2VC7A 5L1IA 1G4PA 3APYA 4L1XA 3VMOA 4O12A 1EZ2A 2WCGA 3CH9A 3QQWA 3B9NA 5KZ6A 5EU9A 3T1GA 1LLZA 3M0KA 2HPMA 1X6NA 2PDBA 1UKQA 1ALDA 1UR4A 4JTSA 2VVSA 2D20A 4QR6A 4LAKA 3TA9A 3N9KA 3VNDA 4JNMA 1EWEA 4O10A 5AY7A 3ZWSA 3MA8A 4NYYA 5FL0A 5FESA 4P7LA 1YNPA 4AISA 1KM1A 1DIDA 1K7XA 4I8YA 4J3WA 5HWNA 3HMJG 3VNIA 1ZBKA 1A50A 1VFMA 2QCFA 5DQIA 4QW9A 3DBNA 3JVAA 3R2GA 2VX6A 3SM0A 1RYSA 1YKWA 2EKGA 1P43A 2HROA 3UJRA 1J9YA 1UHVA 3ITXA 3SUTA 3GVQA 1P48A 5DLFA 4XTIA 3RPMA 2WHMA 5D33A 1TRIA 4OFCA 4R53A 4ZTYA 3DOPA 1OIFA 2XDFA 4AFYA 4UZSA 4UTHA 5DQHA 3L0KA 3WK3A 2G37A 1VJSA 3F5LA 5KFEA 1NIUA 2VEGA 3SQMA 3V0UA 3ALGA 1MRQA 1VFTA 3PUOA 5C9ZA 2VWTA 1UH3A 3LPOA 4MPQA 5KFYA 1SFTA 4L80A 4PZVA 3PAOA 2FZMA 1IGWA 4RK8A 1WAWA 5HULA 4C6CA 3BQ6A 3KVJA 1W3LA 1CLXA 4C65A 4ACZA 5DLCA 3WUGA 5GJPA 1UZDA 3AZTA 2PDMA 4LRSA 2GGJA 3LXAA 3HG3A 1M1BA 3EAUA 4GPNA 2W61A 2VX5A 5BCAA 2HNEA 1CXKA 2Y5JA 4GUGA 1TX0A 2DZVA 4D8LA 2PSNA 4W8BA 4M80A 1X98A 2XWEA 2R14A 4CCZA 4Z1BA 1W37A 4PB5A 5KSWA 1ICQA 1LP6A 2HWGA 2PURA 3IRDA 3LCHA 4Q8PA 4OBTA 1H51A 4GYFA 4NZJA 3OODA 3NR0A 3ZO9A 3ME3A 3OHBA 5FSEC 3ES8A 4JY8A 3SRDA 2INZA 4QWAA 2RDWA 3VNZA 4M82A 3AISA 4JNYA 3NM3A 2MNRA 3AXXA 5CC3A 3ISIX 4HSNA 4Q4KA 2XH2A 4EBEA 2WVSA 4ICNA 2IQTA 1SJAA 1H7WA 3II1A 1FCVA 1NWTA 1A5SA 1R7AA 2R8HA 4WDUA 2PA6A 4PUKA 4WJ8A 2FB2A 2YLLA 1GK8A 2D0FA 3DKJA 3B3DA 5CSUA 2QQ6A 1XGZA 4DYKA 2JEIA 3ZYZA 3PUEA 1OX4B 4GOAA 7XIMA 4BFAA 4JTDA 4JN8A 3G0UA 2WSYA 2VFGA 1GONA 1FHVA 1RH9A 3VOCA 2J7GA 3SN1A 3ABZA 3UP8A 1R2RA 1M3UA 4J9NA 3DI1A 1A5OC 2Z1XA 1Z9AA 3P8JA 1WDQA 4ZXLA 4S3CA 2PDHA 3W23A 3RBDA 5I78A 1VFFA 2A3EA 1UIOA 2QJJA 2YA2A 1FWDC 3EWYA 3MDWA 3KZSA 4BS0A 3GC5A 4JTKA 2WMFA 3TTSA 2XSXA 1TV3A 5FD0A 4N4PA 3MV01 4QJ1A 1OC7A 5CEWA 1CLKA 4PSPA 4I5UA 1EJTC 3H7VA 1UB3A 4GY0A 1XPYA 5A3HA 3SB0A 1KTBA 4CQ8A 1Q4WA 4GZJA 3DFNA 3AYVA 1V3LA 6CGTA 2QPSA 3E2QA 1S2AA 3PZGA 4JOMA 1K70A 3FOKA 2GSHA 1EX5A 1JPKA 1Y5WA 3UPMA 4G9PA 4A6GA 4W5UA 1EHNA 3R94A 3AMLA 3BAYA 2UVUA 3N13A 2PAJA 1A53A 1IF2A 4IWWA 4QWEA 2P10A 3PM6A 2C2DA 3NQCA 1UQZA 2I5QA 1IXPA 1J2BA 4E2BA 1XDLA 3W37A 4C6EA 3PPHA 1M04A 4J35A 5A8QA 4KEMA 1VPQA 3KW3A 1GVYA 3NEHA 2V9WA 4YNGA 1F4AA 1JXJA 2E8YA 2F8QA 2X2GA 4F4ZA 3UZZA 4UFHA 2YA1A 2HDJA 1GOQA 1XC6A 3ZT6A 4ECLA 1SMAA 2VGIA 5IXEA 3LYEA 3T2QA 4DQWA 1AA1B 4AH7A 2XC9A 3IJ7A 1YBQA 4ZMGA 1PHQA 3AIEA 1DBTA 2O4MA 5AOUA 5BMWA 3TROA 3DFPA 4CKQA 3V75A 2VC5A 4H9MA 1SZGA 2E4TA 5I2UA 2OLHA 1KCXA 3VKKA 1H62A 5B80A 5HR6A 2X41A 1R3QA 4EBCA 5C2CA 3RBEA 2VD9A 2RKXA 4A3YA 4PODA 4O4WA 4TVUA 1I9CB 1TSIA 2ZRVA 2G4FA 2J77A 4TQRA 5EPDA 1SJBA 4YVVA 3VOFA 1NSJA 2JIEA 4Q4PA 4RNFA 3QGKC 4PRRA 2G3JA 5JH1A 1V02A 3ZVIA 3GNXA 1OCNA 3HFYA 1PTAA 4YVPA 4AXKA 4LB3A 3G8RA 4HSHA 2YXOA 5A6MA 1G94A 4CCCA 2QCEA 2PWVA 1TWIA 3HG5A 4QWCA 4KRZA 5HK4A 4JBRA 4UTJA 3CQIA 3L4TA 3ERPA 2JEFA 1DKWA 3K2GA 3SUWA 4Q3MA 3DEQA 1MW1A 1UKPA 1L8NA 1SPQA 3V36A 4B5VA 1TIWA 3P84A 4LVFA 5HNRA 4PUUA 4H83A 1FH9A 3B9DA 5IHSA 4NRSA 2QMKA 1T8XA 5CSRA 3NSMA 4AX6A 1F6KA 1K8CA 3OB8A 4F48A 4L1WA 2W9MA 3GY1A 2XISA 4KPLA 1OCQA 3AHYA 1B4EA 2W67A 3CTTA 2PWHA 4B15A 4XAFA 4DN1A 4NZCA 3SCPA 1R5YA 3B8VA 3ZLGA 4GVHA 1W3HA 4HQVA 4W84A 3GW0A 3K4AA 3A47A 5EYWA 1VF8A 3C2EA 5E6ZA 1UWIA 5T9CE 1ADOA 3R0KA 3TV8A 2F2KA 2YDQA 4R8UB 2AKMA 4M3PA 4LVGA 4QDPA 1QPOA 1JPHA 3RAXA 2VX7A 1CXFA 2OWCA 5JXQA 2XIQA 1OFOA 1QOXA 1V0MA 3BSMA 3NQ7A 3S83A 4J9OA 3SRFA 3CJPA 5DMYA 3U5YA 4HVXA 1SU5A 1L6SA 3WL1A 1MZHA 3S1UA 5ABFA 2XFRA 1Y8BA 3S5ZA 1FWEC 1A5AA 3ITTA 5EGRA 3EEZA 4O8AA 5CBIA 1YIXA 3CUIA 3CUHA 3NQMA 1T5AA 1XWYA 1U83A 1O5QA 2DH2A 2YW3A 3W84A 1IT0A 3W2NA 4DNHA 3ZSTA 2ZTKA 2PDYA 2QUTA 3T78A 3U3HA 1AODA 4TO8A 4QNWA 2GWGA 4MNMA 3WJZA 4YJ5A 3WK0A 1YNYA 2ZXAA 1FWRA 1U5JA 4K2SA 4HNOA 5KFDA 4L4PA 2OT1A 3IUIA 4ZBCA 1QI0A 1RBLA 2IXUA 3O6AA 3K8MA 3O9NA 3S5SA 3VDAA 3CQJA 4IQEA 2GLKA 3DUGA 4FR1A 3ZLHA 2DIJA 2C0AA 2VR4A 4ROQA 1J6PA 5E9XA 3QY7A 3QFEA 1JZ6A 3RFAA 5I5RA 5T8GA 5A2CA 1OK4A 3TTQA 4IP4A 1JAKA 2HQAA 2UY3A 2X05A 2HE8A 4UFLA 2QULA 3DFQA 1HTIA 3RB3A 4KEVA 2X09A 3CGTA 4KS0A 4KGJA 4EXAA 1S38A 4MY1A 3TQ1A 1WKFA 3NEVA 1HGWA 3WYZA 3VFLA 3VZXA 2J6UA 1FRBA 4XVDA 3IGXA 3VIGA 1X38A 4K3ZA 5LNVA 2DSZA 3SFKA 5KFOA 1KV8A 2MUCA 3N4AA 4MKNA 1G4EA 2QPUA 1PJ9A 3PBGA 1GOWA 2ISFA 4JX5A 1QUMA 3R58A 1IHIA 1R9ZA 5D2WA 2XFWA 1FWWA 2OQHA 4FIRA 3TEVA 2HNHA 3LB0A 4A3RA 4GACA 4HN8A 2C79A 4P8UA 1SR9A 4TVDA 2HISA 3MSRA 1EQPA 2P8BA 5JH2A 3CASA 5KZEA 4RXGA 4E6MA 1IYXA 2BVYA 5EMLA 4RNNA 1SFSA 1X6UA 3Q67A 4U5KA 1R2SA 4KH2A 3ZJ7A 1D8CA 2ON3A 4FS2A 3FHQA 1PYMA 2AKZA 1IEIA 3LLFA 5CBJA 2E6FA 2QUNA 1NQKA 1YPFA 5JVLA 2ATMA 1RALA 3W7HA 3W7CA 1ZBWA 2ZCGA 2GVYA 4KERA 3RHGA 1AL7A 1G69A 2NSXA 2FPTA 4A4AA 4FI4A 3QZAA 3EB4A 2PDUA 3W83A 1ODZA 4IPLA 5GVJA 2C22A 1E3ZA 5LSMA 4ZOBA 5I24A 4DPQA 4NHVA 1N48A 3AIQA 4DRSA 2ZX6A 2O9OA 4HIBA 2ACSA 3QSRA 5HBFA 4W7VA 3THQA 1XBZA 4WXZA 4IR1A 3WDHA 4J3ZA 4JAWA 5BMXA 4L56A 2GVLA 1ZLPA 3V5OA 3FA3A 1TPWA 4M7SA 3LM3A 2XVPA 4PMYA 2E6YA 4GBUA 4XISA 2F38A 3PNZA 3AXMA 1F9CA 4TIMA 5GJMA 3TNBA 1PV8A 1OABA 2D24A 1Q6OA 3MFIA 3WO8A 3M0YA 4UTIA 3W1TA 1RJRA 4W4QA 2OZ3A 1ZHAA 4XSMA 4L64A 5LA2A 1WDSA 4HMCA 4J9MA 5I09A 2ZXDA 2E9MA 3QXBA 1FFQA 3E0IA 1TJ2A 3C0SA 1E1CB 3A3WA 2V3GA 4NSBA 1KQZA 4QE5A 4HMEA 4JNZA 1R6WA 2OO6A 3BH4A 4AZCA 4MAZA 2VO5A 3UG3A 2HTMA 1RPKA 1K9DA 2PGRA 1RLDA 1W5PA 3WDQA 2PDPA 1HN1A 3L2MA 2X1UA 2VVNA 3CZEA 1JR1A 3MUZ1 1QNRA 4GO8A 3VD5A 1AFSA 4TR9A 1BD0A 1QBAA 3QKZA 4LYQA 3EA2A 1XISA 3H7UA 3LOTA 5KFBA 1S9FA 3CMFA 4FB7A 3N17A 2GJPA 1UP0A 4PTDA 2VP8A 3KP0A 4GHRA 3ZZ1A 3EDDA 5ABTA 1M7OA 3H23A 2OLAA 2ALZA 3ZFHA 2V38A 5CZKA 1S10A 5E6YA 4ES4A 2NVDA 3R8GA 2BXYA 4I6KA 3TNOA 2H3DA 2VZSA 1TR9A 4LUJA 3RCNA 4Y8EA 4O3QA 2C1HA 4D6DA 2BGSA 3QZ8A 4H4IA 2WKLA 1GQKA 1WX0A 2V3DA 2YR1A 2HEJA 5CKSA 3BW4A 3FKKA 4DF2A 1W3NA 4UOQA 1V6TA 2DUAA 4GCAA 5F2GA 3BQ2A 4GABA 3OBAA 3N25A 2EO7A 1JDEA 2FHFA 1UWTA 5F2MA 4B9YA 3QZEA 2CC0A 2GJXB 2W9BA 2MANA 1E9LA 1GW1A 4ECTA 4CCDA 3GB6A 4QWBA 1F5ZA 4HPGA 1QPQA 1BSLA 4CD4A 3LMYA 4NZ4A 3P67A 3RX2A 1X8FA 4DZIA 1POKA 1KA9F 3W2LA 1I45A 3H26A 5DY2A 3UCDA 5C9RA 1VENA 1Q45A 4MTVA 3D0CA 1SSGA 5HDRA 1K1QA 5KFXA 4YR3A 4FNRA 4B2DD 1R87A 4DZ5A 4C6DA 1KM2A 1FWHC 4LY8A 1MUCA 3MB9A 4RV8A 1UPPA 3RRXA 1BGGA 3E12A 3J7HA 1I2OA 3LV6A 4ZODA 4AG0A 4O0ZA 4YR0A 4IGSA 3WNLA 3QVQA 3LM7A 3KVKA 3E0LA 1LL4A 2EJAA 3PJTA 5IOBA 3PJUA 2CZEA 2FGLA 4HHPA 4KFPA 5I00A 3A13A 2AGOA 4RJEA 4V2XA 1YTKA 1N82A 2QJGA 2VNCA 1ESWA 4LV4A 1XYAA 3BG3A 4O1BA 3WLQA 3QMSA 1BWKA 1KGXA 3WNOA 1O5KA 4NU7A 3C2RA 4NUWA 1KRBC 3W29A 3MUIA 1EJ7L 3LRKA 4BA0A 2E9LA 4J28A 2VFDA 5HA7A 2CEQA 3BPWA 2QDHA 1IIGA 4O1FA 3TR2A 5AFDA 3KHLA 1Z8AA 1TE6A 3RK8A 4JIIX 4RDWA 2DZUA 1UD4A 1FWBC 4ED2A 4L4MA 4REQB 4LYPA 1TQXA 2ZQ0A 4HU8A 1H11A 3WDRA 3NNTA 3N12A 3GLCA 3REQB 1CB7B 2OZTA 1GOMA 1VHNA 2Y5SA 3MR6A 4XG1A 2FVMA 3RX3A 4WOZA 2O4QA 2A3AA 3WLJA 2NV2A 2ZWZA 5L6UA 3B9EA 7A3HA 3N4EA 4LNCA 2BP1A 3G6XA 5DT5A 3RITA 1QNPA 1X8CA 1WPCA 4YVXA 3NPVA 4JEJA 3WDJA 3R79A 4ZO9A 4D8AA 2QNEA 4JV1A 1UKTA 4GNVA 5K7JA 3LTYA 5G1MA 4H6EA 2WVVA 3F4VA 5F1UA 2YZRA 4Z1YA 1T99A 2QJNA 4WSKA 4GYJA 3KE0A 1V0NA 2PWDA 1US0A 6REQA 5TNVA 3RB0A 3H4XA 2J78A 2C28A 3BDKA 3OSPA 1EBHA 3QGAC 1BVNP 1JCNA 3SFWA 5CQ1A 4EEYA 1G4TA 1YXYA 3W75A 2WZEA 4L65A 3BJYA 1JNEA 2XTKA 4KWOA 4F9DA 5HMDA 4LUSB 2QDEA 4OGZA 1V3HA 3U5UA 2WJEA 2RDXA 4FNTA 3SY8A 3JS3A 2W79A 2Y7EA 3H70A 1W9UA 1K8ZA 5HNNA 1W1TA 4M6PA 3ABOA 1ZBVA 1CB2A 4RDYA 3T5HA 4J9RA 4EBDA 2PP1A 2WK2A 3R12A 5HMSA 3RR1A 3B0XA 1K03A 4QM1A 3KHDA 2GQ9A 4B5XA 3RG6A 3VX1A 1OFPA 2UY2A 2QZRA 4TVCA 4O3RA 2ACQA 5DT7A 3O05A 3WF2A 3ZT7A 3VUPA 4KQNA 4UOZA 2CBVA 4CQDA 3QHNA 2Q8LA 3EMQA 3EEGA 2CZ5A 4E8GA 3R0UA 1EDTA 1QHPA 2CFFA 3VVGA 1LQAA 1EP2A 2XN0A 4O15A 1LYXA 1R7OA 3O15A 3EWZA 3D3FA 5J5RA 4H6RA 1J12A 1Q65A 1IZKA 1HO1A 1FHLA 4OOZA 1L6FA 2VKZG 3TWAA 3NL2A 1O66A 5KFCA 2VEIA 2VJXA 5BOOA 4R9OA 3WH7A 2DPJA 1QPRA 1V03A 2DEPA 3LCIA 3PW4A 1RUSA 1ITQA 1W5QA 1VYPX 5K2ZA 3EX3A 3NO5A 3VMPA 4BHYA 3NDOA 2OEJA 4X9SA 1TREA 3EWUA 1OFDA 4ECQA 1ZFJA 2X1SA 4LS1A 4MWAD 2ISDA 5BXRA 2Z1KA 3MBDA 2QXWA 5TIMA 3KCOA 4AD3A 2J6VA 2QAFA 3CXOA 3LI0A 2CZDA 2CHOA 5KG3A 1OT1A 4Z1AA 1B57A 3FHAA 2YCLA 5A5WA 3W7LA 4S3BA 3W26A 1IZCA 1W3KA 3OBKA 5KT5A 2XH7A 2O7SA 4O3PA 3QHOA 1CTNA 5T14A 1JXKA 3EMZA 4C1KA 3F7JA 5CXPA 2I16A 3WF4A 3H53A 3U57A 4GQGA 5CH9A 1W54A 5DN1A 3PWIA 4ML4A 2WHJA 3INPA 4QQUA 3SURA 3LPGA 1GYMA 2ZRZA 2Y4SA 4QLJA 1DEDA 1DJXA 1WDPA 1R0MA 1XLEA 3ZM8A 2GGGA 2XSBA 3H24A 5E5CA 3W7RA 3GFXA 3VX0A 3R1ZA 5D38A 4ATWA 3B8TA 3G8EA 3PVXA 3QOMA 3NZ1A 3A9IA 1EZWA 1MW0A 4JPGA 4UUIA 3JRKA 4RU9A 4NIRA 4M7TA 5LGXA 4HZMA 4M51A 1UCWA 1ZL1A 4BQ2A 2Z28A 2GDVA 4YHGA 4HK5A 2CLFA 5H8PA 2QVNA 3GSMA 2ZUWA 1H63A 1LWIA 2REQB 4X9YA 4JIPA 3FEMA 3BC9A 3SI9A 4PC8A 1JEZA 1JI2A 3L0NA 5KFAA 3AJXA 2FKPA 2P0OA 3V16A 2RAGA 2BVWA 4ZB0A 3PVFA 3PZVA 5EFDA 1BYCA 4ADUA 3GO2A 3OO2A 5I23A 3A12A 2NV9A 1HP5A 4DLMA 2DZWA 5DMMA 4DLFA 3BO9A 4NNBA 5HMFA 5F7UA 3IVTA 2Q71A 5DCBA 1X1ZA 3IWPA 5BXTA 1FTXA 1VQTA 2W27A 4N9EA 4DB7A 2Y7DA 2EPHA 4JKMA 5HAOA 3V5FA 2QF7A 5LIKX 4NASA 2NW0A 3BCDA 1TUFA 2DORA 3PZQA 1PZ2A 5K4ZA 3DFTA 1XDJA 2WLYA 4GC6A 3QOKA 5M17A 1KGWA 1H2JA 3AFBA 2XHYA 1QO5A 2FLIA 1FCBA 2G0WA 3FXYA 1BYBA 3C56A 3W73A 5C71A 3F2DA 4DZAA 4LRTA 3MFHA 1LT7A 4JN7A 4N0RA 3WQ4A 2Z1BA 3S3GA 2VHLA 1JF5A 1UROA 1XLKA 3AIUA 4RW5A 3JW7A 2ZA2A 3NA8A 4ZQPA 5A6LA 5BROA 4JKKA 1G0CA 2AMGA 3FJNA 3EWCA 1UP2A 1TPB1 1WUFA 5HXMA 1ZRQA 5BXPA 3NZGA 3RLGA 1AUSL 2J24A 3WZ0E 1UR8A 3HN3A 1OBAA 2BVDA 4JX4A 1FDJA 2Y24A 3HV8A 4A8RA 5A2BA 3RM4A 2FFIA 3RUBL 3LQGA 2PRHA 3T08A 4OZOA 5L9XA 1J93A 1LG1A 4A05A 2VD8A 3N14A 1NH6A 3O3RA 1O12A 4D72A 3UG8A 1EP3A 1JFHA 3WQOA 1RK6A 4TTUA 1F05A 3QW3A 1GVOA 1AVAA 1MUWA 3RB4A 2I17A 4GRSA 2WJDA 4DF1A 3HURA 4ZA0A 4CD7A 4C1NA 4UCGA 3G18A 3TONA 3N19B 3UA4A 2J74A 4AF0A 2WQDA 4BF9A 5HATA 2GK1A 3VDGA 4J9QA 1OYAA 3NO3A 1TTJA 1S2WA 2C3ZA 1JVNA 4TUFA 3TSBA 4RE0A 1W3IA 4J9LA 1B3WA 1KGUA 4IQDA 3KBNA 3FKRA 2XGQA 3NYZA 1XRTA 4AEEA 3OBEA 4PA8A 3T0TA 1IXOA 4JYFA 4HHHA 1H1NA 3GW3A 1TJRA 1GVEA 1PDYA 3SCTA 1NFGA 4LFYA 3GDRA 3QF0A 1LCOA 3QW4B 3ZJKA 2WXDM 4MHBA 1M7XA 4W88A 4WHBA 1ONXA 3O63A 1QO2A 4M6QA 1KO0A 2PLMA 3WF1A 3EKLA 1CDGA 4HYWA 4A3QA 2PDFA 1X39A 3G1RA 1H1ZA 3FEQA 4NZ3A 3VYLA 5ABEA 3IGUA 5HQEA 3ES7A 2QAPA 2WKJA 3HV9A 3P6LA 1V0LA 7REQB 4W86A 1J0KA 2RDJA 3K4DA 2FHBA 4MZ8A 1RBOB 3WBAA 3GKAA 3OZPA 2FH6A 1MXDA 1W5MA 1KTNA 3WMLA 4IRCA 3BAWA 4GQ0A 2UZ9A 3WSUA 1EOMA 5CCZA 1I4NA 4G7EA 1NU5A 2DZBA 4YWIA 5DFAA 2HRWA 4PH6A 4NRRA 1CI1A 1OWQA 2CLIA 3CUXA 3VA8A 2O9TA 3I7QA 4K8EA 4HNNA 3OSNA 4RX0A 3W28A 3NGFA 4KW2A 1V08A 4MJ4A 5KFGA 2YB1A 3MZ2A 5CZSA 4ZTXA 1O95A 1ZAIA 4HNTA 4DF0A 4IPJA 5AYZA 1DWFM 2QHAA 3TYAA 1Q6RA 3M6DA 2NWRA 3FX4A 5TF0A 3SN4A 4ZXOA 1DOSA 2Q02A 2QCDA 1VBHA 1GCYA 3P0WA 3PBMA 2QKFA 4HB7A 4GY7A 3E1F1 4RNJA 1A80A 3SGGA 4FLRA 3CZLA 2HXUA 4BWLA 3VIFA 1P7TB 1UW9A 1GW9A 5KG4A 1ME7A 4I3GA 4NZ1A 2NVCA 3WKZA 3BW3A 2W6RA 3LBOA 1K1DA 1E1EA 1PZ3A 2AQWA 4ED0A 3NQEA 1R3TA 1HJXA 2D0HA 1HX0A 3CHDA 4XK2A 4PCSA 4GD0A 2PDLA 3TMLA 2BHZA 2ALRA 3MVTA 3QMTA 4LY4A 3LERA 4JTCA 3RU6A 1E55A 4M1RA 1ZU8A 2OSWA 2PLCA 2Z6JA 3EX2A 1PS9A 2PDNA 4JHMA 3MPGA 2NT1A 4C5ZA 3H2EA 1EHAA 4DJED 1LL7A 1EX1A 3RO6A 1UA7A 3PUGA 4V1XA 8XIMA 3EPMA 2ZX9A 5CJNA 1BKSA 2NVAA 4A3UA 2VR5A 3PWGA 1XRFA 3GS6A 3E6EA 2R1MA 1B9ZA 4K7VA 4YN5A 3WFLA 4IMDA 4DUOA 1YNQA 4Z0SA 1Y65A 2BLEA 1Q6EA 3WK2A 3BCFA 1VEOA 3M9YA 5TD4A 1QK0A 4RW3A 1HG3A 2Z0IA 5DGAA 1GWJA 4EWJA 4FO4A 1HKIA 4JKLA 4DM1A 4F4RA 3SRHA 2A7PA 5DLGA 4DI8A 1LQ0A 1RQHA 3MHFA 2E09A 1NDYA 3DERA 5BZAA 4WKFA 2HCVA 4W8LA 2VGFA 1DJZA 1XYLA 1LBFA 1YDVA 1LJYA 4O14A 1QOQA 2Y89A 3G0SA 4I9MA 2IKJA 4LUTA 3TW9A 2CZVA 3UR8A 2GWNA 1XGEA 1FUYA 3COTA 5C2XA 1XIEA 1TB3A 4PMQA 4A2RA 1XIBA 3H2FA 1R47A 1DJWA 4LYRA 4IGNA 2Y0FA 2AGQA 1R46A 2XVNA 1QU4A 1RAKA 3IARA 2QCHA 3UY7A 1KM0A 4GK8A 4LVBA 1S0MA 3CUFA 1PIIA 4O17A 3C2FA 3GTIA 4HJWA 3RLUA 4M0XA 4DBDA 4F0MA 4RXFA 3KBWA 3QEZA 1QI3A 2NXIA 3KTSA 4JL1A 1Z89A 3TC6A 3TN5A 1PXGA 1V0KA 1E70M 2P5NA 3KLLA 1YADA 4TX9A 7ODCA 4UFMA 4NF7A 3K13A 2AL2A 3SCRA 3S2LA 3ABXA 3VD3A 3LPPA 1K8YA 4A21A 2PTDA 2NQHA 2AGKA 1I2PA 2ATLA 2YL5A 1I0DA 4FXJA 2IS7A 3CQKA 1ZGDA 4U4MA 3LRMA 2PUZA 3S0CA 2RGMA 3RMEA 1EYEA 4LAUA 1UC5A 3OGSA 1P1MA 3KL5A 3LZ5A 4ICCX 2VCCA 4B16A 3FSTA 4OQVA 1Q6GA 2EPLX 3L23A 3ZIZA 3U48A 3W7PA 3ZJ6A 4LJ3A 1HKJA 1ONWA 4L6OA 4OVXA 2BZNA 4PBEA 3I6TA 3R7MA 1E6PA 3IK2A 2X42A 1KR0A 3ELFA 3PBUA 2XN2A 3H55A 5KFIA 2PCEA 3TAKA 4XZBA 3WCZA 4NAEA 4JTAA 3AU2A 2YL6A 1PDZA 2WSKA 1MEIA 2YDAA 1N8FA 4W89A 4QISA 2G50A 3WLPA 3KDOA 4IMFA 4C60A 3TUUA 3F4WA 4WDTA 3CQ0A 2DP3A 3G1YA 1KKOA 4ERGA 1YTEA 3SDOA 2YIHA 3UR5A 1MWOA 3WD1A 4KKXA 4PMRA 3AROA 1W9DM 3CT2A 1MFUA 3CMGA 1KM5A 2ZUUA 2PCQA 1FDZA 3CL8A 1U22A 3CWHA 3SY1A 4LBRA 5DMNA 4MZ1A 3VXGA 3CH0A 1TR1A 4UTWA 4HZ8A 4DBWA 1P0DA 4BWLC 2GGIA 3KOFA 1VC4A 3GXIA 2NV1A 1YE6A 1GEQA 3WLRA 4S2CA 1WUEA 4J27A 1W9VA 2Y8UA 1C8XA 1T96A 2ACRA 4QROA 1I8JA 4JQAA 3HG4A 1RD5A 1TWDA 3G1FA 5BWAA 4BR1A 1GOKA 3KVMA 4HP5A 4Q6XA 4WXYA 2QT3A 3LSBA 5D03A 3O06A 2ZICA 1PIGA 2XYLA 2PP3A 3TXVA 2E3ZA 5DO8A 4W8AA 6TAAA 2AU0A 4MFDA 5JIPA 1CWYA 2ZTJA 3WENA 1EUNA 1YE4A 2F9RA 2WNWA 3G1DA 2DUXA 1K77A 3LX9A 2PF8A 4LANA 4H6KA 1XXXA 2VTFA 3LQLA 4JEQA 3H2AA 2NUYA 1T41A 4HOZA 1YBQB 3M41A 4DO6A 1D2KA 2CPUA 3PJXA 1UR1A 3CHEA 4DI9A 1CBGA 3QV7A 1U1JA 1GQLA 4JTHA 3MCMA 3GQYA 3R89A 1HVQA 1XKYA 4GC3A 1JYVA 3WLKX 2W62A 4XZ9A 2DQWA 2WHLA 4Z2JA 1XCXA 3QPYA 2DVTA 5G4EA 3A23A 1TWZA 4X3ZA 1K9TA 2XGPA 1E40A 1JQXA 4A2SA 4ZQNA 2JGQA 3G22A 1C9WA 2DFAA 4MF4A 3NGJA 1IEQA 2QEZA 3Q8PB 2Z1WA 5LNUA 4XV0A 2Y88A 3A6OA 1XICA 1EXBA 3EKGA 1W17A 5CLWA 3UPBA 1WCGA 1CGVA 4QQ3A 1RP9A 1KWKA 4DAFA 3AXKA 3ENLA 2NXHA 1R30A 3H4BA 5ENLA 4O54A 3U2EA 1QXLA 1TUXA 3B40A 1HNYA 5EMUA 4HSOA 4YHEA 4CNNA 1MSSA 2XIMA 4LPCA 1SR0A 2ZZ5A 2JGYA 1AJZA 3W6LA 3AUOA 2IPGA 4ED3A 1V6VA 1AQHA 4AD4A 5CAKA 3T6CA 1U5HA 1JZ2A 3RRAA 1GPWA 4J3XA 3W9ZA 4OUEA 4F0KA 1U30A 1C7TA 4FNUA 3S1GA 1KRAC 3M46A 4WOQA 2INFA 3V4BA 1QW8A 1PUDA 1RVKA 3UGVA 3MP4A 4U7CA 2Y63A 3DN5A 3NPWA 3TKFA 3T0AA 4JQ1A 1GEHA 1H5YA 2GZXA 4H7CA 5KT2A 3SAZA 5TAOA 4WD0A 3UD6A 2F6UA 2R1LA 2XSAA 1ODUA 2GUBA 2YL8A 3L2IA 3T7VA 5T26A 3V0SA 1FKWA 1QATA 1EIBA 2FVLA 1DVJA 2ISVA 4XKYA 1JIBA 1FCQA 4QW8A 4GO9A 1X6LA 1OB0A 2QYGA 5KG0A 2ZZ2A 3THUA 5BOFA 4RR4A 2Z00A 1SO4A 1YQ2A 3LN3A 1P0KA 2DZAA 3W71A 3CK5A 1TELA 1W5NA 1M68A 4MDPA 4XVEA 3CL7A 4X2RA 3GR7A 2R6OA 3MANA 3UWVA 5KMYA 1A3WA 3RXZA 3BCJA 3IAPA 1XFCA 5ABFB 3KRZA 2QUUA 4EACA 2GJLA 2VR2A 1JDDA 3WD3A 3OHMB 4KCVA 1XP3A 1LORA 1LT8A 4CU6A 4ECRA 4O1EA 3VIOA 4QLLA 3FJLA 4GG9A 2YXXA 1WDRA 2BVTA 1O1ZA 3U0HA 2D73A 2Z25A 3TU9A 4UTLA 4A8LA 1UBPC 4C91A 1Q6LA 1Q4NX 3QSTA 5A2AA 4LB4A 2C18A 1PB0A 3F2BA 1MW3A 2C2RA 3Q4DA 3THDA 5G2IA 4N02A 2YBVA 3DHPA 1DP0A 1UZ1A 1OT2A 2PDKA 2QLYA 4UTWC 4GINA 1KW1A 3G1AA 3ABQA 2UBPC 2ZDRA 3V6HA 4UXDA 4ZO6A 4L9YA 1BWLA 1EC9A 2FZBA 3URAA 1TIMA 3FNDA 3NFUA 1BF2A 3TQ0A 2CETA 3IIOA 4GI4A 3FSUA 3NXLA 1OFBA 5TBOA 4GXWA 3A3HA 4MNJA 1IXNA 3UA3A 1N8IA 2CERA 5DRIA 4LVAA 3GNOA 3LCLA 1O60A 2W8KA 3CPRA 3WNMA 1KXQA 2ABBA 2QCLA 4YR2A 3S2JA 2JF7A 1YPXA 1WOAA 4HCLA 3VOJA 1OCBA 7TIMA 1KBJA 3RGTA 3WQWA 3M0HA 4FR6A 3GIYA 1XX1A 1JJKA 3GH7A 5KFFA 4ICMA 2VDIA 3N2OA 1UUMA 1LWHA 5G2WA 3T2PA 5DG8A 3KTXA 2HS8A 4JDYA 4Q8TA 1A3HA 5CPLA 3IIVA 3NWRA 2J47A 2OKOA 4IH3A 3FV9A 5ECUA 4ZENA 1L6WA 1TJPA 2IKHA 3U7VA 4GY1A 3MCOA 4ONVA 5E70A 3VCCA 3RF9A 3ARZA 3BMVA 2EG8A 4PCNA 4FBTA 1GVRA 3SSZA 3AJ7A 4GH3A 2L5HA 3LEPA 1J4EA 5FACA 3IJDA 3QR1A 3B0YA 1E9ZB 3TJLA 4EWND 3E0WA 4HTYA 5FJPA 4YP3A 4U2ZA 5C2GA 3SSJA 4K8HA 2X0SA 3WJWA 4JUZA 4TU1A 3BZGA 3NJ3A 4O0QA 4F79A 5AYIA 3L4ZA 2VRJA 3E0VA 4EKJA 6A3HA 1UBSA 1SVDA 1AMYA 3CAVA 5T9BG 1EJUC 2BY2A 3UWUA 4D6IA 1ZAJA 3C6CA 3RN6A 1MDRA 1OQFA 2XM2A 2NQLA 5K9CA 2H3BA 2QW5A 2WMHA 2CCRA 1H60A 2RJGA 4L7ZA 2WOQA 1L2QA 3Q2DA 2Q3RA 3CHFA 3GFYA 3UWZA 3ID7A 4A8NA 1TPUA 4JTFA 3WBEA 3S5NA 3QYSA 4DZHA 3U2CA 4Z2IA 1SFJA 3Q8SB 2WBKA 4AIOA 3PZMA 1R9YA 3C86A 1U33A 2P88A 4ADTA 4C7FA 3ZVHA 3IV3A 5F4SA 1ZQ5A 1IIHA 2V30A 1GQJA 3UGRA 1S2CA 2BHUA 3T81A 4Q8OA 2V5LA 5CJ5A 2OT0A 3OJGA 1WYIA 1RQEA 4GQBA 3TCEA 3QQ1A 3FDGA 4ZQCA 5C9UA 1EQCA 2Z6IA 1EGMA 3GQCA 1TV8A 1YDOA 1L0PA 3E9AA 3NDYA 3IJ6A 4F50A 4R3UA 2VC6A 4DO5A 1E43A 3AALA 1Q6FA 3MCNA 2OYMA 3HG2A 4XUGA 2WHKA 3ANVA 4LEFA 1BEUA 1NM9A 1G6CA 4XBJA 3S2CA 3H4DA 3F03K 2CBIA 4AIUA 2BQ3A 1RSCA 1L8PA 4H3DA 2NQ9A 2JKEA 4US5D 1WBHA 1V5XA 1DXFA 4KIRA 4S3KA 2XIIA 4P61A 1ZZMA 3WF3A 4ADSA 5AC5A 1JPDX 2Z26A 4JIRA 3CV2A 4EPDC 3STPA 1XH2A 1QNVA 2Q6ZA 2GDUA 1UWSA 3V1PA 2GFTA 4OBSA 1TV7A 4IPNB 4NX5A 4NL1A 4YL2A 3S9ZA 4RNMA 1A4MA 1IT8A 2OB3A 4AY8A 4F66A 4EYIB 5CSSA 1GG0A 1RY8A 4JS3A 2TRSA 5KFVA 4NLGA 4L9XA 4HU4A 1PTDA 4Q4MA 3A64A 2BXZA 2J66A 4UR7A 3QV6A 5LXXA 4GNJA 2EBNA 4GLEA 3HPZA 4LV9A 4L9ZA 1TTQA 1AW1A 2W9BB 2ISSA 3U7BA 1ZB5A 6XIMA 3CL6A 2ASLA 4WVXA 3IN5A 3BICA 5KTLA 1YX1A 5CPOA 2BOGX 1DORA 3OOQA 1QI4A 3U4FA 4Z1DA 2CU0A 1AK5A 8TIMA 1VBJA 2ZUVA 3R43A 4I8DA 3W81A 3C0QA 5I3DA 1H4PA 4OIFA 1PZ0A 1E6NA 1ZS2A 4EPBC 2F7FA 4H41A 2GVEA 3WG6A 3W07A 2CBUA 3MC5A 2CHRA 3GH5A 4AX7A 4B2DA 4MY8A 3T4CA 2GVJA 3ARRA 1NARA 2W0UA 4KMQA 3VDHA 1TA3A 1SMDA 3KOYA 4DIAA 4I9TA 4PMZA 2WZTA 3AXIA 2E40A 1G7UA 3GXMA 1FWCC 1XJBA 2DJLA 4MAVA 1J0ZA 1R8LA 3MUY1 1A5KC 1CYGA 4B3LA 2XWDA 1ONRA 4GX8A 5D2XA 3NG3A 3MJYA 5AYBA 4B4HA 5MHBA 4J9JA 2H90A 5G4HC 1F74A 2X1IA 1GQNA 4NAFA 1W9XA 5F9NA 3GG8A 1W1IE 1E72M 3TP4A 2WSPA 4G7FA 4W9TA 2VA3A 1GOOA 1S2VA 5HNTA 4BF5A 3I6EA 4Q33A 2E67A 3VDCA 2YB4A 3BG5A 6TIMA 2Z2UA 4QE1A 4FPSA 4JYDA 2INEA 1F61A 2V5BA 2J75A 4JCLA 1BYDA 5GNZA 4AMCA 1QVBA 3MP5A 1EGVA 1E6SM 4OUIA 3PC0A 3I6RA 3UYIA 2ZWYA 3W1UA 4YIWA 4JTEA 3TQKA 5KT6A 4JIQA 3RPTA 3W7KA 5HWJA 4JTRA 4CQBA 3QKEA 2W8LA 4O18A 4UFJA 1PHWA 4ZFCA 3HIJA 1RPXA 2GUUA 1N8WA 3SO7A 1EJSC 3OLGA 1P0NA 1NFPA 1B1YA 3GNNA 2Q09A 1VRDA 1BG9A 2Y70A 3W7MA 3E5PA 3M44A 3GVGA 1UH2A 3AIBA 2OMAA 3DIPA 3G2GA 2OG9A 4H01A 4V33A 4Y9OA 3S5OA 4MADA 3B0VC 4BCEA 2A85A 2QV5A 1C8QA 2WVVB 4UQEA 2WMIA 3KL3A 1DHKA 3BGGA 4DO7A 5IBXA 4H7ZA 5U4NA 1W2PA 1CW2A 2CWXA 3CPUA 2NWSA 2V68A 1YXCA 2QR6A 3HPXA 2CHNA 4Q8QA 4N42A 3M7SA 6REQB 3LENA 2PDGA 3BLFA 1G7VA 4K7YA 3B0UX 4LX4A 3F5KA 5I79A 1SJDA 5KEZA 5KETA 3N04A 1EP1A 4ZOEA 2P1FA 1EA9C 2ZFAA 2V5KA 4CNUA 3B4UA 4B9ZA 1B0IA 5EMJA 5C6MA 3JUGA 5DBUA 2PFHA 2AL1A 3MVIA 4QG6A 4CNPA 3CTLA 4RLIA 4H2HA 5LXEA 3SCOA 3UWYA 4GZ7A 4GVIA 2W9AA 1K8XA 4CD6A 3PB0A 4GJJA 4D6HA 4HYKA 2ZIDA 3PZ9A 2D3LA 3CAWA 3O8AA 1JYNA 2V5DA 4B5TA 1W3TA 4ECWA 2EQDA 4PMNA 5EWGA 1KQYA 4GZIA 2E9BA 4FSAA 1JCJA 2WPGA 4HZ6A 3F4CA 2WC7A 2Q3OA 2YSWA 4AEFA 5M03A 1XIHA 2E7FA 5REQA 2J6XA 1VGAA 3APTA 3BGJA 1OM0A 3A3XA 4E4FA 2D69A 3QZ6A 4HHMA 2X7WA 1QHZA 2ZZ6A 4WUIA 2D0GA 3L4XA 5LA0A 1KM6A 3CUJA 2OKTA 3UT0A 3BLPX 4EIVA 3MR2A 5A8GA 3W1QA 3WQFA 4CCEA 1KM3A 1KWGA 4GGHA 3UWQA 5BNKA 3PW2A 3PPGA 3WLOA 4LUIA 2J9ZA 1KCZA 2QPXA 3UERA 4ZOAA 4TTGA 2TYSA 3QC0A 2BY1A 3TK7A 4EP8C 3VO0A 3A4JA 5FKYA 1SM9A 2D2GA 1US3A 2D3NA 1FVPA 5K9XA 1XC4A 3MHGA 3O1NA 1TVNA 1AJ0A 2NLYA 3W7EA 2BTMA 4FOUA 4PULA 1L9WA 1XUUA 4M24A 4MUPA 4K1GA 2CESA 1XIMA 4ZO8A 7ENLA 1E71M 2I5IA 4S3AA 1JQVA 1EC7A 1PIFA 3GIQA 3ZJ8A 4CNSA 4UTTC 4B5SA 3N34A 3NZPA 3N4FA 4MWAA 2YCLB 1UP3A 1X1OA 3S42A 3PK7A 4Q8NA 1MRAA 1ZJIA 1NP0A 2PDIA 4IMEA 2CLMA 2GJRA 4NJHA 2XGZA 1M6JA 3G3MA 3N2BA 5XIAA 5C7HA 4WLCA 5LNSA 4K39A 4LNYA 4ZQMA 2C8NA 3BOXA 4HU0A 4XAPA 1OY0A 1EB3A 2RUSA 5FAGA 4GUIA 4DY1A 4PUNA 2XFFA 4LCRA 4XBKA 2PC8A 4UR8A 4CGTA 3WL0A 4MG4A 3GTFA 2VCBA 3GDTA 4RDZA 4NILA 1JRCA 4AZ7A 4W7UA 3Q65A 3G6LA 3D5HA 5D8WA 3EWBX 1UOKA 4E38A 4UFIA 2EAWA 1KV5A 2QGHA 3LZ3A 4XTDA 3URNA 3OVGA 2POTA 1S97A 3OVRA 2DZTA 2QIWA 4N4QA 1MEHA 3SQLA 1AD4A 1VCFA 3B04A 4WSJA 1XCFA 4ZSUA 1OJXA 4Q8FA 4DXKA 2Z24A 1XIIA 1JPIA 3TC7A 3IGSA 4IGMA 4L1GA 9XIMA 1QNSA 2TODA 3ORWA 5DG9A 3MSYA 4ZCWA 5D02A 3WK1A 4AZHA 4YLWA 4CQ9A 3M5YA 2X0YA 1YDNA 1WB0A 3BJFA 2DIKA 2PI6A 3T5JA 1Z3NA 5FJRA 2ASHA 3NCOA 1AW2A 3SQSA 1JI1A 2WBGA 4KFOA 5BW6A 1KXVA 4J9SA 2C0HA 3U2OA 3VGHA 2ATSA 5CZ0A 3FDSA 2QS8A 1BHGA 2PDXA 1BYAA 3VNKA 1LROA 4JTUA 3FIGA 5HJXA 4J1OA 5C9XA 2PMQA 1S1RA 4KWUA 3WNNA 2DJXA 3UXLA 1WV2A 1E51A 5IBXC 1GVFA 2WM1A 3KP1A 1EKOA 1TE1A 1E1CA 3UQNA 3BLDA 1R86A 4G1KA 1A5MC 1XIJA 4FNQA 5KFTA 1UD2A 1JD9A 1TTIA 2YCJA 1WKDA 4OECA 4XKMA 2OYKA 3PWAA 4Q7NA 3RLVA 2A79A 2PTYA 3O0FA 2VYOA 1I6NA 1WA3A 1NFBA 4N9CA 1YLVA 1XPGA 2ZDSA 2HK0A 4QDWA 2HS6A 1HP4A 4ZL1A 3CB8A 3GG0A 3W7DA 3F5JA 3EPGA 1RA0A 1Z7AA 4EXQA 4FX8A 4GIRA 4DXVA 1TZ9A 3W88A 4O11A 2OZ0A 1RQBA 4TV6A 4IQLA 5AHLA 4H7VA 1EPXA 1ZJBA 4RV3A 3SZ8A 3TCSA 2OELA 1LRQA 4HYRA 4U5IA 1RLCL 1U2YA 2OODA 1CECA 3HTWA 2E5DA 5A8OA 1PAMA 2J27A 1C92A 5I3GA 3PG9A 4GQQA 2WWDA 3QFWA 4UBPC 1M41A 1LLWA 2A3LA 3L7RA 3IACA 1B9BA 3ZXWA 3BZJA 4RNIA 1LUCA 5DELA 4FMVA 3M6YA 3P5YA 1JCMP 2VDGA 2V67A 4AF0B 4C6FA 1QCWA 2GJNA 4PUMA 1C3FA 2G97A 2GK1B 4C6BA 2ZZ7A 4IISA 4JZ5A 3C61A 2GJXA 2IXVA 2C15A 3RPDA 4KCWA 3PSWA 1A5CA 4JFTA 4B5UA 1VAHA 5CPMA 2PDWA 3W72A 2IQDA 4MNKA 1M53A 1M65A 4B5WA 2OEMA 3H8AA 2QCCA 3P74A 4E2DA 4LUYA 3JR2A 3CLWA 4IP7A 5IDIA 4FXSA 3VABA 3OYXA 4KEUA 5G4WA 1QFEA 3M0LA 2YFNA 3PPFA 1RP8A 3S1VA 4AWSA 3FVDA 3E2VA 4K68A 5AC6A 4IX2A 4DHGA 3CZGA 3VE9A 2Y5EA 4AY7A 3AAMA 1W8SA 3ANUA 4AZ6A 2QJMA 2ZX7A 4I6VA 4MWAC 3IJ8A 4FP1A 4A3HA 2VFFA 4DO4A 1W1PA 3RMJA 3HPAA 4X0NA 1EBGA 3AIRA 3DFYA 5L1LA 5HJYA 4DUXA 3IPWA 3UJFA 2H9AB 5DY3A 4RPPA 4E3TA 3W2UA 5ABHA 2AMXA 2A5HA 1BVWA 4V15A 3GC4A 4EPKA 4O4VA 3VE7A 1J5TA 4D6EA 4AAJA 4IJRA 5D37A 2FZ9A 4AD5A 4RNHA 4BEQA 4P8VA 3O7UA 2O55A 4ZE4A 1XD0A 1VEMA 1CPUA 3MKVA 3HF3A 3IUDA 4PRTA 4DWSD 4E2OA 1BQGA 3L9CA 1ECEA 2QCDB 3AS1A 3WH5A 1GJWA 4UNLA 5GNYA 3FN9A 3TYEA 4JICA 4DEZA 4RZBA 1ZP4A 3QTPA 3BG9A 2EHHA 3MYPA 4JCMA 2R8JA 2PBGA 5DCDA 5JMUA 2CLOA 4S3GA 3SW6A 4K1WA 2HK1A 4GNKB 3IJIA 3LGDA 3OGRA 4IL2A 5CGMA 3TJXA 1UASA 4NVTA 4C6KA 4DXXA 4QJ4B 2D23A 3M5VA 4HA4A 4AXNA 2FHCA 4AZ5A 1LZOA 4MJ2A 4GCXA 1A5NC 2DU2A 3CAKA 3GXDA 5I03A 3SUVA 1G01A 3RYSA 3ZT5A 3MMUA 1CZ1A 3JZUA 2BY0A 1E6ZA 2FTYA 1QNOA 1TG7A 3AWOA 4P7OA 5I3FA 3FGCB 1IR1A 3TW6A 4Y9AA 1SQ7A 4DJEA 3UG5A 4PL1A 1NEYA 4J3VA 1UR9A 1FH7A 1LOLA 1E73M 5HR7A 1J2WA 2E77A 4Q22A 1EYWA 1P0EA 2R91A 3UYCA 2GOUA 1H7PA 3MQTA 5D30A 3LNMA 3SIZA 1HF6A 3OG3A 4RZ5A 3DKLA 4O3NA 1TV2A 5AKQA 2V63A 3KX6A 3M5XA 1W8GA 4HA3A 4HT3A 3WQ6A 2YGYA 4J3TA 1B3YA 3WLNA 1AH4A 1W1ZA 2IKGA 3PFRA 2Y85A 2JEJA 2PDQA 1QTWA 2DT3A 2VGBA 1MQRA 3C4UA 4S3FA 4DL2A 1BXCA 4FLQA 2YXGA 4TMBA 3WEMA 2FYMA 1XUZA 1FFRA 4J5NA 4INFA 3NL6A 3TOPA 3AS0A 2CNCA 2E5BA 3GG1A 4MY9A 5EFFA 4Y9NA 4LUTB 4AC1X 4LT9A 2Z27A 2Y8KA 3VKCA 3CO8A 3CNYA 1MW2A 1XS2A 4A8IA 1I2RA 1EC8A 1TKKA 4ZE5A 4G1NA 3CLMA 2X16A 3V5CA 5KFRA 1VFUA 3UY8A 4AIBA 2LLEA 3OW1A 3ITLA 2O9RA 4C6MA 3TYZA 3ZS4A 2EGZA 3TN3A 4GKLA 4YYFA 3CBWA 4U31A 1KFKA 3WDIA 5H1WA 1J6OA 4JQ3A 3M64A 3N2XA 1WKYA 3AO0A 3BARA 4JXCA 3PG8A 3CWNA 4I5RA 2H6RA 3WQDA 2EKCA 3TTOA 4B3KA 3HQPA 1B3ZA 5JUMA 1DJYA 1R3RA 4AB4A 3PR4A 3UZYA 5IM51 3GU9A 2AL2B 4PEKA 4AC7C 2C16A 2DSVA 5A8PA 1DIOA 1JZ5A 1FCUA 2AAMA 1E6QM 2UWFA 4Q8WA 3SCUA 3ITCA 2EPKX 3P8IA 4JQ4A 5FSDC 1KFLA 1FY6A 3G6MA 2ZRWA 3OZMA 3VOGA 4RKAA 4NI3A 4UNIA 2W92A 3NQAA 4Q8UA 3K30A 5AYXA 1PX4A 6ENLA 2HZGA 2PD9A 2C71A 2NQZA 4N9DA 1NJJA 3CQHA 2ZC8A 1YRRA 1JGIA 4M6UA 1TPEA 1IEVA 2YPIA 1IE7C 1FP9A 2CLPA 4AVNA 3H40A 2JEPA 4G5DA 4F0RA 4X61A 1UMLA 3NVDA 4ROPA 4ECZA 1W1A1 4R88A 2G41A 1KB3A 2G95A 3T44A 4L61A 3OZOA 4GYKA 3CV7A 4NAEB 1XGDA 3V6KA 2JE8A 4FX6M 3KRSA 1D3HA 3K4WA 4QE4A 1F4HA 3GR8A 3MUCA 3AS2A 2HMCA 2YDSA 2P3ZA 5A6TC 1XYZA 5A6AA 4WSHA 1P5BA 3PUDA 4LF2A 3AZRA 1ZTVA 5LGZA 1OINA 1XCWA 4LF1A 1FP8A 2BG5A 1BLIA 3GBEA 3MUXA 3W3OA 2Q8ZA 1D8WA