2QT3A

Crystal structure of n-isopropylammelide isopropylaminohydrolase atzc from pseudomonas sp. strain adp complexed with zn
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
401
structure length
401
Chain Sequence
KDFDLIIRNAYLSEKDSVYDIGIVGDRIIKIEAKIEGTVKDEIDAKGNLVSPGFVDAHTHMDKSFTSTGERLPKFWSRPYTRDAAIEDGLKYYKNATHEEIKRHVIEHAHMQVLHGTLYTRTHVDVDSVAKTKAVEAVLEAKEELKDLIDIQVVAFAQSGFFVDLESESLIRKSLDMGCDLVGGVDPATRENNVEGSLDLCFKLAKEYDVDIDYHIHDIGTVGVYSINRLAQKTIENGYKGRVTTSHAWCFADAPSEWLDEAIPLYKDSGMKFVTCFSSTPPTMPVIKLLEAGINLGCASDNIRDFWVPFGNGDMVQGALIETQRLELKTNRDLGLIWKMITSEGARVLGIEKNYGIEVGKKADLVVLNSLSPQWAIIDQAKRLCVIKNGRIIVKDEVIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords N-isopropylammelide isopropyl amidohydrolase
publication title Crystal structure of N-Isopropylammelide isopropylaminohydrolase AtzC from Pseudomonas sp. strain ADP complexed with Zn.
rcsb
source organism Pseudomonas sp.
total genus 157
structure length 401
sequence length 401
chains with identical sequence B
ec nomenclature ec 3.5.4.42: N-isopropylammelide isopropylaminohydrolase.
pdb deposition date 2007-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2qt3A01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2qt3A02
3QGAC 4H01A 3RCMA 1HZYA 4LCQA 2WJDA 4GY0A 1XRFA 4L9XA 2OB3A 3GUWA 2FTYA 4B91A 1A5KC 4KEZA 1E9ZB 1UIPA 3IV8A 1YMYA 4CNTA 3GIQA 3UR2A 2O4QA 2VUNA 4XAZA 2R1PA 3ORWA 4NP7A 4KETA 4PCPA 3PBMA 2CZVA 5AKQA 4JOMA 3FDKA 3CAKA 3T1GA 3B0YA 1UMLA 1P1MA 4TQTA 2GSEA 3EWDA 3OJGA 2P53A 2OGJA 3URQA 3F2CA 4E3TA 1EJTC 4C6EA 3F2DA 4CNUA 4GOAA 1P6CA 1PTAA 3LY0A 1A5OC 1NDYA 1KRMA 1KRAC 4H9ZA 4LFYA 1V51A 3G77A 3S2MA 4C6JA 3WMLA 4WHBA 4LCSA 1K6WA 1RK5A 4C6QA 3E0FA 2I5GA 4Z42C 3MSRA 1A4LA 4C6BA 1EYWA 1FWGC 4QTGA 4HK6A 1GKPA 4C6PA 4PCNA 1PSCA 3TN5A 4B90A 3ID7A 4LAKA 1RA0A 1FWFC 2Z26A 4XD5A 4LEFA 4C60A 4C5ZA 1V4YA 4C6KA 4BY3A 3MVIA 4C6OA 4ERIA 4C6NA 1KRCC 4B3ZA 3TN3A 4L6DA 3ICJA 2OQLA 2ICSA 1DPMA 2GWGA 3K2GA 4DIAA 3C86A 3T81A 1O12A 3UF9A 4J35A 3E74A 2DVXA 4R85A 1J5SA 1EJXC 2YZ5A 4CQDA 4ERGA 1ZZMA 5G4HC 2OODA 3EGJA 4IFKA 4AC7C 2VM8A 2GZXA 1RJRA 4V1XA 2HQAA 2AQVA 2Z29A 4LCRA 2VHLA 3URBA 2XIOA 3FEQA 4H9MA 3OODA 2Z7GA 4EPKA 2Q01A 1RAKA 4RZBA 3PAOA 2QVNA 5A6TC 2DVTA 3A4JA 4INFA 4DNMA 1J6PA 2A3LA 1K1DA 3LA4A 3GTXA 2E25A 3DUGA 3GTFA 3LSCA 1POJA 4J5NA 2Z00A 4V1YA 1ONXA 3MTWA 3ITCA 1I0DA 2QT3A 1A5MC 3S2JA 3DC8A 1VFLA 1YBQB 1V79A 4PBEA 4DZHA 4IGNA 3AU6A 1QXLA 3B0XA 1FWCC 3GTHA 1RJQA 4RDYA 3URAA 1FWAC 4IFKB 4DZIA 3F4CA 1GKQA 4PBFA 4H9VA 4HK7A 4G2DA 4UB9A 1O5RA 4R7WA 1YIXA 1XWYA 3AU2A 4XD4A 1ADDA 2YXOA 4KERA 4LH8A 1EJVC 4GY1A 1FWHC 2D2GA 4IFOA 4H9XA 4QRNA 3K5XA 4IQJA 4YIWA 1FWDC 2PGFA 4IH3A 2VC7A 4IF2A 3GU9A 3RHGA 4BKNA 2AMXA 2FVMA 4CEUC 1EJRC 2E1WA 4WVXA 3RYSA 3GGMA 4H9UA 1QW7A 2PGRA 2RAGA 1EJUC 2Q09A 2QPXA 3TN4A 1RK6A 4GYFA 2ZC1A 3LGGA 2I9UA 2HNHA 4DLMA 1A5NC 1NFGA 4B92A 5E5CA 3HM7A 4MUPA 4C5YA 2FFIA 4XAFA 1J6OA 4H9TA 4C6FA 2F6KA 2FTWA 3A3XA 3GIPA 3TN6A 4C65A 4EPDC 4NI8A 4KIRA 4ZSUA 2Y1HA 4RDZA 2ADAA 4C6CA 1FWJC 4F0SA 2YB1A 1J79A 2Z25A 3MPGA 4GZ7A 2VR2A 4C6MA 4G7EA 2KAUC 1R9ZA 3S4TA 1NDWA 4QSFA 1POKA 3F4DA 4XD3A 2R1NA 4EP8C 3MDWA 4IFRA 4KEUA 1EJWC 2P50A 3GG7A 3MDUA 2R1MA 4QS5A 4KF1A 2Z28A 3UR5A 4GXWA 1K70A 2YB4A 1WXYA 3QY8A 3LNPA 3BE7A 3OQEA 2QS8A 1V7AA 3TNBA 1W1IE 2Z2AA 4QS6A 3LS9A 3N2CA 3GTIA 2Z4GA 4HK5A 3K4WA 4RE0A 4KQNA 5CH9A 3HTWA 3KM8A 2WJFA 2PAJA 4ICMA 1PB0A 1FWIC 2Z24A 2AQOA 3O7UA 2HBXA 2EG8A 4DI9A 3WYZA 2OOFA 1M68A 1FWEC 1UBPC 4OFCA 4G7EB 2O4MA 4H9YA 3IACA 5LXXA 3FDGA 4HJWA 3O0FA 4AQLA 4F0RA 3MVTA 2WJEA 4I6VA 2IMRA 3NQBA 3SFWA 4LAOA 4GC3A 4ZSTA 4CQCA 1M65A 2P9BA 3S2NA 4DO7A 3A3WA 4ERAA 4HA0A 4QROA 2PUZA 4DI8A 3V7PA 4P5UA 3E38A 3UBPC 1YRRA 5HMEA 1S3TC 4NG3A 4GX8A 1FWBC 4D8LA 1EF2A 3EWCA 3IARA 1A4MA 4EPBC 4BJHA 2DVUA 2UBPC 1RJPA 4GX9A 3HPAA 3OVGA 1FKWA 4C6DA 3UPMA 3MJMA 3CJPA 2HPIA 1BF6A 3URNA 3QY6A 2EG7A 4IG2A 3E0LA 4IGMA 1EJSC 1ITUA 4I6KA 1A5LC 1PO9A 3PANA 2GOKA 3R0DA 2FVKA 3MKVA 4GBDA 1EZ2A 3SO7A 4EPEC 3LSBA 4RDVA 3OU8A 1WXZA 3WZ0E 2G3FA 4XAYA 3E2VA 2HPMA 1XGEA 2HBVA 1E9YB 2BGNE 4DYKA 4CNSA 3IJ6A 3CS2A 5FSDC 4PE8A 3OOQA 2D2HA 3NURA 2BB0A 4KESA 4C6IA 1NDVA 3DCPA 2ANUA 4J2MA 3RN6A 3IRSA 4C6LA 4RDWA 1I0BA 1FKXA 4M51A 2EG6A 3PNZA 2WM1A 4WGXA 2Z2BA 3LGDA 3S2LA 3E3HA 1JGMA 4IG2B 4LALA 3GU1A 4H00A 1KRBC 3QGKC 2D2JA 3T8LA 3ISIX 1V77A 2GWNA 1R9YA 2PLMA 3AUOA 1KCXA 4KEVA 1YBQA 4GY7A 4LANA 2VC5A 1R9XA 5HMDA 2W9MA 3IGHX 3GRIA 2UZ9A 2R1KA 4R88A 1GKRA 4CEXC 1YNYA 3GU2A 4DLFA 4XAGA 4XD6A 4UBPC 4F0LA 1ITQA 3PNUA 4GK8A 3NEHA 3QY7A 3JZEA 3LU2A 2R1LA 1NDZA 1XRTA 5HMFA 1RA5A 1ONWA 1P6BA 4LAMA 4CQBA 3IPWA 3F2BA 1UIOA 1M7JA 3D6NA 3B40A 5FSEC 2Z27A 1IE7C
chains in the Genus database with same CATH superfamily
4LXFA 5EPDA 3QFEA 1XR2A 3W1UA 4JKLA 1HW6A 4GY0A 5K3VA 4UFHA 3WNMA 1N55A 3B9DA 1KFEA 3GIQA 1WUEA 1R3SA 3W76A 1TA3A 5KFXA 3VE7A 1VR6A 5M3WA 1P5BA 3EWXA 3LV5A 4J2PA 1Q6EA 4FS9A 5IFTA 1PX4A 4M0XA 2Y8UA 3LV6A 2ALRA 4O8AA 4WEVX 4Z0JA 3EYPA 3IUDA 3OHAA 1ZQ5A 2J47A 1SZEA 4UMCA 1S5NA 4L1GA 2V3DA 3PAJA 3W82A 1AZ1A 1X39A 3W75A 2GGGA 1ALDA 1EHAA 2G50A 3DFHA 3H7VA 3VZXA 4F9DA 1XC4A 1A4LA 3W81A 3W4RA 4HMDA 1EYWA 2WNQA 1FWGC 3W7LA 4MJ2A 4PTVA 4LUIA 3PC0A 3FIGA 3SZ8A 4JQAA 1JULA 3H4DA 4TQRA 1W1VA 4NAEB 3MVIA 4C6OA 5AVNA 4ERIA 1CPUA 3G6YA 3NQDA 5L1IA 3IIXA 3W1RA 4U5IA 1C7SA 3KUMA 3TTEA 1K8XA 2Y8KA 1QPOA 3P82A 1UQYA 1JNEA 1TV2A 1ZAHA 1EJXC 1QK2A 1W3JA 2YZ5A 2ZWZA 5G4HC 3ANYA 4IP4A 2BHUA 3W7DA 3V3WA 1FWSA 3BSHA 2A4AA 3WNPA 3BG3A 4V1XA 3H2EA 4D6GA 3AIEA 4Y96A 1J18A 2WPBA 4YWIA 3OODA 2R8JA 1SW3A 4ZO6A 5CSUA 2ODOA 1D7KA 1OD8A 4JFWA 1XBYA 2PDYA 1B3WA 5M5DA 1T5AA 3LA4A 1TELA 1OFOA 1AL7A 3TTQA 1V08A 1W9BM 3W7GA 3DG6A 3EWUA 3A3HA 1B9BA 1YDYA 4LBSA 1WDDA 1YBQB 3NVTA 5AC8A 4H6QA 1F6YA 1FFRA 1U5JA 3GTHA 3UCDA 4RZ5A 2NVCA 4H9VA 5MKGA 3V5OA 1IWPA 3E2RA 4R7WA 3HQOA 1XGDA 1YIXA 3IGXA 2DSUA 4ECLA 1AVAA 3P8IA 1HFBA 1EJVC 1XH1A 5KFYA 4P7NA 4AZIA 2GVYA 3KZPA 4CUCA 3RRAA 4ZFMA 3SR7A 4ZE4A 3M16A 2OEKA 4IH3A 4AD1A 2AMXA 2QV4A 4UQCA 5DMYA 4QWBA 1EJRC 2XGBA 1X7FA 3LLFA 2PDFA 4RXFA 2P3ZA 3WF1A 4FLRA 1TPDA 1ZJBA 3AALA 1CB2A 1CXIA 3CZJA 5A2CA 1N7KA 3DFQA 2FFIA 4WLCA 3UZWA 1H09A 2WJZA 3QQ1A 2QCEA 2BQ3A 3UXAA 4DUWA 1GWJA 3R89A 2OX1A 1GOOA 4E0CA 2ZUNA 3FN9A 4O14A 4ROQA 1CLXA 3I6RA 5HR7A 2W3ZA 3UGRA 1I1XA 3LZ3A 4KF1A 5EFFA 5JIPA 5GVJA 1IIGA 1ITXA 5D38A 5GJMA 2NQZA 5IHRA 2ACQA 1W5MA 3NQ6A 4YHEA 1CEOA 4A35A 4HA1A 1GW1A 1Q7MA 4QLLA 1TMHA 3QZ7A 3NXLA 2UY5A 3ARUA 2EG8A 2DIJA 4MNJA 2X1RA 1M68A 5EKYA 2QQ6A 4GPNA 3WBWA 4G7EB 1Q65A 3IJIA 3L9CA 4LSBA 5EGRA 4W7UA 1M01A 1YE6A 1ICQA 1EYEA 3QVQA 3QMTA 3MVTA 4JXCA 1R2RA 3DI1A 4ZSTA 4IHCA 4J9OA 4V2XA 4L4MA 4DI8A 1E0VA 2J88A 3CAWA 3EMCA 1R38A 2VRJA 3B8UA 3AAMA 5BW6A 3M0HA 4FX6M 3POCA 4O3RA 3PM6A 4BF5A 2ISWA 4MF4A 1W91A 4GQ0A 2CLOA 4GJJA 4F4YA 3H55A 3BDKA 5FI8A 2ISVA 5AYXA 3O9NA 3D3FA 2EJ1A 2GVJA 1GQKA 4MNKA 1VC4A 3V75A 4PL2A 4HU3A 5LZLA 3VK5A 4ZXOA 4M19A 2Y63A 3T5JA 3WF4A 5D8WA 4ZR8A 4HYKA 1A3HA 2VZSA 3C0JA 1UH4A 4D6EA 3XISA 5C2CA 1XLLA 1GTEA 5G2IA 4G3IA 3LCLA 2C8NA 4I8DA 3QTGA 5D05A 4AU0A 2HPMA 1WDPA 1D8CA 1GZJA 3T5HA 3TW9A 2BWGA 4WXYA 2QCFA 2ZUMA 1ML1A 3GFXA 1O1ZA 3W7MA 3HB9A 2J62A 3LXBA 1QFEA 2I5IA 5DY3A 4LYRA 2PDLA 3S5NA 3W2NA 2QNEA 1ZHAA 3BH4A 3T8LA 4FXJA 4S2BA 3BAXA 1AODA 2WANA 3HG4A 5FF3A 2SFPA 1R9XA 2WMIA 1SPQA 3DIPA 1H4PA 1LRQA 2YLAA 2UZ9A 4N9CA 2J75A 3STCA 2CERA 5KTLA 1TJPA 3PNUA 4O4WA 2WLZA 4WKFA 5IDZA 3II1A 1CWYA 2YCIX 4LV4A 3M9MB 1FY6A 3G3DA 2XVKA 3TFCA 3NZGA 5CZSA 4ZBCA 1VFHA 4X63A 5B80A 1Y7VA 4Q8WA 1M7JA 3QR1A 3O06A 3VMPA 3VKAA 4CCDA 4ED1A 2ONEA 3C61A 1XRFA 1BD0A 3LHZA 5I23A 1UIPA 4YL2A 4E2VA 3ABQA 2VUNA 2TRSA 4Z2KA 3NDOA 2X41A 4M3PA 4S3AA 2CZVA 4IMGA 3AYSA 1OFEA 3T1GA 7ENLA 3KX6A 3WLHA 3ARXA 3NWRA 5KFOA 5ABTA 1EJTC 4QJ3B 3F2DA 4PZVA 1B9ZA 1AJ2A 1UUQA 2VR4A 4MZ1A 3OBKA 5D2YA 1W54A 3LRKA 4PSPA 4WHBA 4UZUA 4QQUA 2DZPA 1ZBVA 5FL0A 2ALZA 2QMJA 4I9JA 2ABAA 1VEOA 1BG4A 1KFKA 2F9RA 4EBEA 2D3NA 4EACA 4QTGA 2ZCGA 1OGBA 4TO8A 4UXDA 1CIUA 5F9LA 3MFIA 4I9MA 4JY8A 1W17A 3UG4A 1S5TA 3ZR5A 4HPJA 4UFKA 1Q5MA 3CWOX 1RY0A 2G4JA 4LUSA 3BW4A 3LDVA 3UZZA 1J8VA 3AIBA 3GBEA 4J9LA 1UD8A 2HVOA 4QE5A 4K68A 2EQDA 2GZXA 2CPUA 1FUYA 5KT6A 1EEXA 3TTSA 5E1QA 1T41A 3UXDA 1SZNA 2VDHA 3T7VA 1MXGA 3H40A 1KFJA 1R30A 2YCEA 2ZZ2A 1CGYA 4XX6A 4P8VA 5TAOA 4QDMA 3HF3A 1K1DA 3VCCA 4A2RA 5FJOA 1XPYA 4XSMA 2BS9A 3VOHA 5JMUA 1NH6A 2PU0A 2Z00A 1EB3A 3NL2A 2XGQA 2O9RA 2FJUB 8XIMA 3TXZA 2V3FA 1XFBA 1OHLA 3NNTA 1V79A 3ONBA 3SQMA 3W7OA 1V8EA 2CLFA 1FWCC 4NF7A 2XISA 3URAA 4DJDA 5REQB 2J4GA 2R8GA 1XISA 4KWUA 2VP8A 3L4UA 2ZUUA 2VRKA 1O5RA 1DEDA 4KCUA 4QIUA 2J27A 4KERA 2J9ZA 1UC5A 1O68A 2FTPA 1VLWA 3PPGA 2CZDA 5CC5A 3DYPA 4O3NA 2CHNA 3MY9A 2GQ9A 1CDGA 3B06A 4ECRA 1XIJA 1E70M 3LNMA 4GIAA 1PKNA 2B31A 1TWWA 4BEQA 3O15A 1QMLA 1RK6A 3N1AA 4ECXA 4MPKA 3BW2A 4DXVA 5FJUA 4HPGA 9XIMA 4EAMA 1UWSA 3WH8A 2OH2A 1DL3A 1UASA 4KWVA 4D1JA 3HQ1A 4YTUA 3IRDA 3WLIA 1TMQA 5JQ9A 1AMKA 1QOXA 1MSSA 5E09A 1YQ2A 3O1NA 1LF1A 1GYNA 1VD6A 3MP4A 2HISA 1TUFA 1PIGA 4QX4A 4C6MA 4F4ZA 5H2ZA 1PUDA 1T8QA 1PX3A 4AG0A 1I6NA 3LRLA 3NQMA 3VKJA 2V2HA 3UWYA 2XSXA 3BK0A 4GNKB 3PWIA 1L6WA 1DJQA 2Z28A 3UR5A 2GLKA 3N9SA 5CGTA 4IIFA 3WKZA 2ZXQA 4AEEA 5BOFA 3NSMA 2PDJA 3HURA 3MR3A 1C8XA 5G2WA 3GG8A 2EPMX 4R3UA 1DWIM 2YA1A 3G1AA 1H51A 3I7SA 3VGGA 5FCZA 1PXGA 3PW4A 2OKTA 3QKZA 2HBXA 2PRMA 4J27A 4MTVA 2OOFA 3H4BA 1JUKA 5XIAA 1OFQA 1XDJA 1GQLA 3IAQA 3L4WA 4CNNA 5HJXA 3G6XA 1LLZA 1P43A 3R58A 3P67A 4XV0A 3NQBA 3I7RA 3BAJA 4JIPA 2DDXA 2PFHA 4EEYA 4RE3A 4DO6A 1TUXA 3PP7A 4LQ1A 4ED6A 4MJZA 3V0UA 4BR1A 3OZPA 1S5WA 5DCDA 3EXRA 1DWFM 1JCLA 4H7ZA 4CD6A 1LBFA 4W9TA 5A95A 2DUXA 2A6LA 5AHFA 3EPNA 1VCGA 1LYXA 4RNJA 1MFVA 3G1HA 4QEHA 2JEFA 4JV0A 1GJUA 3UG5A 3H2FA 2CW6A 4IIHA 4Q6JA 4NILA 3L68A 3KLLA 1VCVA 1Q2SA 2XU2A 1VB9A 6A3HA 3WLKX 1XCWA 1IWBA 3STEA 3FOKA 3ZQ9A 4XAYA 2UVUA 5BWAA 1SQ7A 1XGEA 2D22A 4P7RA 4WUIA 4IPPA 2CLMA 1EIXA 3QR3A 3F1QA 1EP3A 3BAWA 3H21A 4H7CA 1E3ZA 3CXOA 1G67A 1Y65A 2WKGA 2A85A 3E0WA 3KBSA 5C9ZA 4JBRA 2E28A 4QG9A 1ZAIA 3BGGA 4H00A 3M64A 3QGKC 4YR3A 5A8NA 4O1DA 2DT0A 4ZEPA 4JTJA 3RITA 1V6UA 1G94A 1A5SA 2V6AA 3T55A 4QDPA 1TR9A 3DYMA 4FF5A 3W23A 3WDJA 4PMXA 1LL7A 4WQ6A 2C6QA 3G22A 2ZXDA 3KVKA 5DX7A 3GH7A 4PSRA 2ZFAA 3GV5B 2GK1A 3HFTA 4ZQNA 1TJ2A 4WSJA 4S1FA 4TTUA 2J8GA 1YKWA 4AD0A 3GYEA 3E5PA 3W02A 1JG9A 4K1WA 1YTKA 4IX2A 1NTHA 3TQ0A 1FCBA 1DHPA 4Q45A 2OB3A 4GI8A 1WYIA 1LCOA 2YZRA 1E9ZB 1GZGA 3L65A 3VVGA 3NQEA 4LV9A 4WX2A 3L21A 3VIHA 3AHYA 1AFSA 3B05A 4RNIA 2CYGA 3RX4A 1X96A 1EEPA 1NFPA 5C70A 1OYBA 4ZA0A 4NVTA 1MQQA 1HP5A 1UD5A 1OEPA 3F2CA 3DU0A 3W73A 2XGZA 2PDWA 1VFSA 1H5YA 1NDYA 3WQPA 5D32A 3H2OA 4LFYA 2DPEA 4TX6A 1DTNA 4FOJA 1YW1A 3WMLA 3B8WA 1UR2A 1OCBA 3Q65A 4GJIA 1R8LA 4KRZA 4NKCA 2G3MA 2AL2A 4QR6A 1LOQA 1S0MA 4JL2A 2GYIA 3WH7A 4ENLA 5C9XA 4IISA 1ZJAA 3AFBA 4YTQA 4IXHA 2X7WA 4M6VA 4JQ3A 1UHVA 1V4YA 2FPYA 1X97A 4C6NA 1KTNA 4HTBA 5KFMA 5HNUA 1TPB1 4ZENA 5HPOA 3C2RA 4YU1A 1UROA 1DBTA 1R3TA 1FWTA 1JR1A 1XL9A 1XLMA 3WQ5A 4EBDA 1Q63A 1VYRA 2HMCA 5KFNA 4C90A 4JL1A 2XIOA 1JDCA 4NJKA 1WZLA 2G97A 2GDUA 4DO5A 3M46A 3OP2A 4MJ4A 4OOUA 4ECSA 1TYGA 3DZ1A 3NG3A 3TCSA 3CGTA 3ZMRA 3GYCA 2GL5A 3ZYZA 4IOTA 5HMSA 3BQ1A 3KWXA 1DP0A 4LUTA 5DFAA 2ZX6A 3AHXA 1BFNA 2WVVA 5TQLA 4WXZA 1QBAA 5EWGA 2UVRA 2OELA 3PULA 3V6JA 3OVQA 4JTKA 1XWYA 4A8NA 4KFNA 1YTDA 4GY1A 1R47A 3NXFA 4BI5A 4LEQA 1PHWA 2A6NA 1H62A 2Q71A 2V63A 4H9XA 1MNZA 3IAPA 3K5XA 1GPFA 5C2XA 1XQLA 2QCCA 3DYOA 2BY0A 1S97A 4NAFB 3THQA 1W3IA 2YR1A 2WKJA 2NVDA 5DGBA 4UCGA 4WY0B 3G1FA 1S2VA 4LB3A 3WQGA 4GGBA 5DQHA 3DFPA 1OFDA 2X8RA 5DQPA 3A3XA 4CQ8A 3DHFA 4C65A 2PDQA 1JDDA 3MO7A 1H2JA 4F0HA 3OVRA 2YCKX 2GJPA 1K8ZA 4B3LA 1J79A 2VR2A 2G3JA 4UTKA 2CHOA 3G18A 4QM1A 1NDWA 5CBJA 4DF1A 3VD9A 3WQWA 1UBSA 3NVDA 5CJMA 3QN3A 3RX3A 4ORIA 3CAVA 1AH0A 2QAPA 4FMVA 3NGFA 3NZPA 2B7OA 2PEVA 3A4AA 1DJZA 4M56A 5ABHA 6PTDA 3N4FA 2JKPA 3GDBA 2XIJA 4ECWA 2DP3A 2NX3A 3FA4A 3CL7A 3LHYA 1TV3A 3PTDA 5CPSA 3CNYA 1QDSA 4W7WA 1B4KA 2GGJA 2Y5JA 1UW9A 3T44A 1K1QA 2IKHA 1K7EA 5IBXA 4OFCA 3WH9A 1HN1A 5CKSA 1JF5A 4IQEA 3PJXA 4DYJA 1SUXA 3HBLA 1UR3M 5JBFA 1XYCA 5LNRA 4W86A 5E6YA 2VCBA 1SJBA 4LAOA 1LUCA 4NZ4A 3EDKA 4DO7A 4JFUA 1NP0A 3QKEA 1U2YA 1DQUA 1PPIA 2QXWA 1YDNA 2IUZA 1MUMA 1DYSA 3PZQA 1F3TA 4B5SA 1HP4A 3L4ZA 4Z1AA 5AHNA 1LWHA 2DZTA 2JIEA 2BHZA 3N19B 3BGAA 1MXSA 3S9IA 1CXFA 1K9FA 4ED0A 3EKZA 4MLJA 2NX9A 3E0LA 3DH7A 4IG2A 4AY8A 2J7FA 2F8QA 2B0MA 2F7FA 9CGTA 3A4WA 1E1EA 3PZIA 2J8FA 1PO9A 3T6CA 3PANA 4TIMA 3ZVIA 2REQA 4J3XA 3KAOA 4D8AA 1OINA 2VEFA 1HVQA 4HVXA 4FF7A 1RPKA 2F84A 3NFUA 1MEIA 2D0GA 2GVEA 3TYAA 1K7XA 5T91A 1CNVA 3IVSA 1TTPA 4POCA 4YCPA 4PUWA 1OT1A 3A23A 5I6SA 4ZCWA 3ALGA 5AYIA 1YDVA 5LHEA 1WKDA 1SFJA 4L4LA 3BQ0A 3EWZA 2ZA2A 1FP8A 4B9ZA 4I5XA 2B7NA 1S2UA 3AIQA 5AECA 3V6HA 3VIMA 4JNYA 4XQ6A 3XIMA 1NIUA 3PZ9A 2PWFA 5HJYA 3AUJA 4PUKA 3N11A 2JKAA 2J7GA 3E49A 4PGLA 2WKLA 4WDXA 5HMFA 5KG7A 4HOXA 3P6LA 4LAMA 5TNVA 4O3SA 1EUAA 4QW9A 1NOWA 3MBFA 1Z69A 3AXMA 1MO0A 3HIJA 1U1UA 5CZJA 1HZYA 4LCQA 3SRKA 1HKVA 4L9XA 1J2WA 3KS6A 1HQTA 1F5ZA 1V6TA 2AL1A 2XCPA 1K4GA 3GH5A 4U3AA 1Q2RA 2WQPA 3UR2A 2ZX8A 2R1PA 4IIDA 3AROA 1F05A 4Q44A 1XRSA 3W53A 1MRAA 1KXHA 1F8MA 1N82A 4ZOCA 2X09A 4F50A 4JKMA 4RNMA 3LTSA 3APYA 4UQEA 4YMZA 1HJWA 4KWWA 4E2DA 4AYGA 1RR2A 3MQTA 1DQWA 2EGZA 3WENA 2VRQA 5A2AA 1MEHA 5D2WA 4H9ZA 5J04A 4ADTA 2C2EA 4NRSA 3KCLA 5LYRA 4LCSA 1CGWA 2PA6A 1F7BA 4JTSA 2W62A 4PMNA 5G1TA 3HPXA 3PB0A 3NQ2A 3MCNA 3VZYA 3N12A 5KFIA 2C14A 1F61A 3NTYA 2QYGA 1L2QA 3VDCA 2V8ZA 1XUUA 3UXKA 4K8EA 3QQ0A 1WPCA 4NRRA 1F76A 3UWEA 1T40A 2BVYA 1IEQA 3SJNA 5CBBA 3FFSA 2PRLA 4B3KA 3ARZA 1ZJIA 4QJ1A 1L9WA 3I3EA 2BOGX 5CJ5A 4IFKA 4GIEA 3S0CA 2FLLA 2C1GA 1EHNA 3VOFA 4JN7A 2O9PA 5H6HA 3GR8A 5F2IA 2J7EA 2A1YA 1E0TA 2J6TA 1KQYA 1YNPA 2Q01A 1MEWA 4H8UA 1MDRA 3W6MA 1CENA 1UH2A 4PFMA 3M43A 1J6PA 3SN4A 3WH5A 4PB3A 1NP2A 3S5OA 3SY8A 1UUMA 5CGMA 1IEXA 1UC4A 4OBTA 1VHNA 3S1XA 2X1TA 4GISA 5HINA 4UTJA 2QDEA 1L6SA 3TP4A 3TYZA 2GUBA 1ONXA 2E67A 3CQJA 3S46A 4AWUA 1QCWA 3L0NA 4IGNA 4YVXA 1G6CA 2DORA 2HS6A 3SUWA 3W74A 2QZRA 3FSTA 3L23A 4KWOA 3M7SA 4S23A 5FKYA 3ONCA 3RXZA 3KRBA 4X9SA 5GNXA 1KR1A 4DM2A 3VIFA 1XICA 3TW7A 3GM8A 3O6AA 2D20A 5HULA 4IFOA 4HU0A 3MB9A 3OLIA 4W5ZA 3WJSA 3UW6A 3N73A 5IFPA 1AQFA 4G56A 2IXUA 1M6JA 2VC7A 4RPQA 4AWTA 4Q43A 2FZ8A 4S3GA 3UWVA 4YPJA 5C55A 3U2CA 4F9JA 2RAGA 3EKGA 2Q09A 1KXVA 4BI6A 3W7PA 1QTWA 5FJTA 3K8MA 1FHLA 3RU6A 3N3TA 4LGXA 1GT8A 1ZY9A 3QC0A 4C6FA 1CT5A 3OEXA 3CLWA 1V0NA 5CXPA 1PX8A 1QATA 5E0CA 4U5KA 1L6YA 1WBHA 2C1HA 1VKFA 3H53A 4ZSUA 1OF8A 1XLBA 2G8ZA 4ZVJA 2Y6ZA 3WQEA 2FMNA 4HZMA 5T9BG 4B2DD 7TAAA 4UR7A 1LDCA 1ZPTA 2DEPA 3DGRA 3KL3A 2MNRA 3SN1A 4X9YA 5I3IA 2QF7A 4AY7A 3NR0A 5IBXC 2H8ZA 3BVJA 2VGFA 1QHZA 3DG7A 2OFJA 2WB5A 2RKXA 4D6FA 5DQIA 3LB0A 2J6XA 1MZHA 1W1IE 3N6JA 4N9DA 1WP6A 5L6UA 1DIEA 1FFQA 1TE1A 1WKEA 1PYMA 1F3XA 2P76A 4RE0A 5CPNA 2NSXA 2QUMA 2NSOA 4AMAA 4L6OA 3PPFA 3O6YX 3T4WA 1F4AA 2ZIDA 1CXEA 3SSJA 4Z2JA 4JYEA 4JDBA 2Z1SA 4WKHA 1YEYA 2OTDA 1RQHA 2WWDA 2H8XA 3DDMA 3JUGA 3NJ3A 1A0EA 4LWWA 1SO4A 5C54A 3O0FA 4FXFA 1W37A 2IPGA 3DFNA 2DSVA 4A3QA 2QCLA 2VVNA 4HA0A 2D69A 1BGGA 4LJ3A 4IPIA 4AHPA 1UPMB 3LENA 3SCUA 4U28A 1EF2A 4S3KA 4BJHA 3S5SA 1XSIA 4C1LA 3LHVA 4C6DA 3A21A 2WNWA 4IMDA 3CJPA 1BF6A 3VDBA 2A5HA 1RCQA 2KX9A 2R8WA 4B16A 1HNYA 3TZNA 3RB6A 3ARYA 2BODX 2W9AA 2E5BA 3CHVA 2A0NA 3LSBA 4DWSD 3MBDA 4WSKA 4JIIX 4GVHA 3BCDA 3KVJA 1NU5A 2NLIA 4B5VA 2ZKMX 4HN4A 3W1PA 3FK4A 3IK4A 3KBMA 3HA1A 1GVQA 4ECVA 4O1AA 1XS2A 5HQMA 2C2DA 5D30A 4B2DA 3GXPA 3PTKA 1JUBA 3RIKA 3RJXA 2P88A 2X16A 5SWUA 2YA0A 3AICA 1W5OA 3QR0A 2A3AA 4XKYB 5JU6A 4FI4A 4AB4A 4EF8A 2GWNA 4LF1A 1FCVA 3B97A 4P7QA 3OHIA 2TYSA 1LWJA 1QW9A 2FDSA 1F6PA 4NZ5A 1XF0A 3IGHX 5I24A 3PR2A 1KCKA 4DLFA 2DZUA 1ITQA 4QG8A 3JZEA 1NF0A 4WRHA 1R5YA 1TSIA 3NUKA 1JDFA 4RZRA 2RDJA 3P5ZA 2VZVA 2BXZA 4PMOA 5F2MA 1GG0A 3CPRA 4ZOAA 3UEQA 4AZCA 4JEJA 1YPFA 5L1LA 5FAJA 1QPNA 3TSDA 1M03A 2FHBA 4LVFA 4DL4A 4HB7A 1S10A 4B91A 4AWSA 4AF0A 3AJXA 2HVMA 2VEMA 3IJ9A 3MMTA 3WQCA 5GNZA 2VXNA 4O57A 3CZKA 4US5D 4KETA 3CZEA 3ITVA 1UMLA 4HIBA 2W9CB 1KM4A 4JTUA 4QISA 4RU9A 2C2RA 1OD0A 2OGJA 5FJJA 2EO7A 3VD7A 4AWEA 3LY0A 3PBUA 5DBTA 1JCTA 1R7OA 5LKYA 1E3XA 3TR2A 2B4GA 2QJHA 2QR6A 2IPFA 1RK5A 3BICA 3RR4A 3BG5A 2YFOA 3E0FA 2I5GA 5GJNA 3B8TA 3PUGA 4HZ7A 4HOZA 4F4XA 1UWAA 2FH6A 1GKPA 4DWSA 4O1CA 4DL5A 4DNHA 4LC6A 4X60A 1W1B1 2JBMA 5KFPA 2POZA 2Z26A 5BXRA 1KLZA 1KRCC 3B9AA 1JIHA 2GWGA 4GZJA 1NQKA 2OO6A 3E0VA 1RQBA 3UF9A 2VGBA 4ZOEA 5LNUA 4O1BA 5M03A 4FPSA 2OWCA 2BGQA 4ERGA 4PTMA 4H19A 1CXKA 1MW2A 4RJEA 1X8CA 2J25A 2ZZ5A 2XUCA 1Q4NX 3WF2A 3WLTA 4ECZA 4LCRA 3ABZA 4FNPA 1LM1A 4H9MA 1K9DA 2Y7DA 1RAKA 3PAOA 3UG3A 2YX0A 4NIRA 2A3LA 1MUCA 2QJJA 5A8QA 1NF7A 3AS2A 2IQTA 2IA6A 3HMJG 1RYRA 1NSJA 4FK9A 1EA0A 1W3HA 1UZDA 3UT0A 1XLEA 4PBEA 1ZTVA 3TSMA 4IPNB 2H9AB 2PDCA 1MMFA 3EPIA 3GFYA 2QVHA 4RDYA 4FX7A 4IL0A 5HUPA 1H0IA 1PS9A 2R6OA 1UWRA 4UB9A 3W07A 2BDQA 3PG9A 1QO2A 2YXOA 4US5A 4AXKA 3CM4A 1E6QM 5K2ZA 3KP0A 2PGFA 2WW5A 3L2MA 3Q8SB 5ABFB 4J3SA 5BMXA 3EX3A 1DE6A 5KETA 1UP0A 1U1HA 3TC6A 4K8GA 2CXGA 2ZUVA 1OM0A 3P0WA 3R79A 3PW0A 1A5NC 3GDMA 3BAIA 4DBUA 3SRFA 4AHOA 1YE4A 1JXLA 2I7GA 3B3DA 1FHUA 2E09A 4Q8UA 2J8TA 4P8WA 5K7JA 4HSNA 5M1TA 3ZSTA 5CC3A 2G0WA 3DFOA 4C6CA 1XLCA 5FD0A 4JY9A 3MPGA 3HJZA 1EC9A 2PRHA 2KAUC 4Z2IA 2QMKA 1PYFA 2IW0A 4MDPA 4E38A 1DKWA 2E9LA 1EWDA 1D9EA 1J0IA 1EP2A 3C0QA 1TV7A 2C18A 4A21A 5G2HA 1XIIA 1K70A 4F79A 3S42A 1GJWA 4RNFA 1V7AA 2ZC8A 2QJGA 1PZ1A 3MMDA 5C9RA 3LQLA 2ZVRA 5F2LA 3GTIA 4O52A 2FGLA 4CN4A 4IIBA 1UR8A 5D2VA 4MNMA 3C56A 4H6RA 5FEWA 1W1PA 3OTRA 3NM3A 3BJYA 3ZWTA 3TQ1A 3WUEA 4NZ3A 2FB3A 1B90A 2WSPA 1UD3A 1O7AA 2WVUA 1REQA 1WE5A 5KG1A 3TLQA 3M0JA 1OC6A 4QCFA 2ATLA 1HXJA 4U33A 3TTOA 3IGSA 3W1LA 4B5XA 5CSRA 4GC3A 4JNZA 3LG3A 4QROA 1P0BA 1V02A 1XLAA 5KFUA 1WBJA 1T94A 2WBGA 3PTQA 5HMEA 1YPXA 2Z1XA 1A3WA 3IUIA 4RV3A 4D8LA 4E8GA 2DH3A 1L2UA 3GUGA 4O15A 1BKSA 3Q94A 4A29A 1VAHA 2XIBA 2CXEA 2XN0A 3R1ZA 2CZEA 3RO6A 1KWKA 4GRSA 4JYDA 4RV8A 1FKWA 5TF0A 1KLYA 3AC0A 3GSMA 4NSBA 1QNPA 3UVAA 4GCXA 4HQVA 5EMUA 1GTHA 5M17A 3EB4A 8CGTA 1FBAA 3R0KA 4ECUA 3RAXA 1H7PA 4TV6A 5HBFA 5BRBA 5CZTA 3W7QA 2ZRVA 4BF9A 4ZXLA 2V9WA 1UD4A 4XZBA 3SW6A 3GG0A 1O4UA 1PTGA 4DYKA 2FGZA 3W26A 3ZR6A 4GG9A 4JX6A 2BHYA 2PSNA 3LZ5A 4Q8NA 3RFAA 4RE4A 5KFVA 3QV6A 5A6SA 1NDVA 4IP5A 3DC0A 3CBWA 4MZ8A 1R46A 3KOYA 4U2YA 7PTDA 1NAL1 1Y5XA 1WKYA 1OC5A 2RJGA 4DL6A 5HAOA 4S3EA 1IZKA 1E1FA 1LT8A 2PGEA 5KFGA 3WQ6A 1PCWA 5EU9A 2J24A 2O9OA 1BLIA 3WMBA 5HMDA 3MSYA 5DMMA 4ZE5A 3AMDA 3N2TA 4M7SA 3GXFA 4XAGA 3EOUA 4XD6A 4H6KA 2Y24A 3UXLA 4AHQA 3KRUA 3LU2A 3W00A 3P80A 1ONWA 1CECA 2INEA 1HVXA 2QULA 2YBTA 2WQDA 2IKJA 4ZOBA 1RBLA 1EFZA 1GVEA 4JTDA 3QGAC 2RDUA 5DRCA 4AZHA 1TREA 4PYSA 1C29A 1R87A 4G1KA 3GNPA 3THUA 1VBRA 3C2YA 3H22A 2CBJA 4NJJA 1VEMA 1QUMA 5IM51 4F2UA 3KE0A 1JDAA 3H24A 4REQA 1S2CA 1GVOA 3MYPA 4XAZA 8A3HA 2FFCA 1G69A 2OQHA 1UZ4A 5KFBA 2V3EA 1OYCA 2PDXA 1TFVA 3DFSA 3BLOA 1P1MA 4TQTA 4W85A 2OLHA 5F4WA 3P93A 5DMLA 4DWSC 3BLLA 4NZCA 3D46A 1AD1A 3QPZA 2HCVA 4MY1A 3G0SA 1SM9A 4OV4A 4RUAA 1UZHA 3VU2A 3RG6A 4XB3A 4EK7A 4AD2A 1T8XA 3PBWA 2Z0IA 3ZLGA 1LUCB 2VUYA 1XBVA 1BAGA 3ITGA 1KKRA 4J9MA 4QWDA 3W22A 4U10A 2JE8A 6XIAA 1UD2A 2FPTA 4UOJA 1KFCA 1Q6RA 1EL3A 1CI1A 4GFSA 4DXXA 4UR8A 5MF5A 2XFWA 1JCMP 4L6DA 4IMCA 1TIWA 1DPMA 4TX8A 4ZQCA 2G95A 4NY2A 4KW2A 1IIHA 1S0NA 1Z6KA 1GNXA 4PRWA 3Q8PB 1UB3A 2WO5A 3TWAA 2DY3A 4J35A 2REQB 2J7CA 2QF8A 3BCFA 4DF2A 1WXJA 1XIDA 2ISDA 3B0UX 2OODA 2W67A 1JZ5A 3W1QA 2OSWA 1BEUA 4S39A 4W8AA 4AC7C 4Y8FA 3CWNA 4NLGA 4B15A 3W2KA 4XISA 1Z7AA 4JIQA 2WCGA 4X0VA 3LM3A 3M0VA 4AC1X 2DVTA 4HYWA 4NJGA 2ZRZA 1IEVA 1JL8A 1GEQA 2JEJA 3QPEA 5H8UA 4U6PA 5KFZA 1A0CA 1XRVA 3U4AA 1K8CA 4YNGA 1EDTA 1YXCA 1VFLA 4WZHA 4O17A 1IHIA 5MHBA 1FWAC 1XFCA 3T0BA 4YCOA 3MWCA 4K1GA 4KCTA 2V82A 4FLQA 3KBVA 1MI3A 3VNDA 4PCSA 1KXQA 3G1YA 3INPA 1V6WA 3B8IA 4IWWA 1TMLA 4M7TA 1XYLA 3M5ZA 3LYEA 1V3KA 3IWPA 1FWDC 1I1WA 3RUBL 3PZUA 1ZGDA 4WVXA 1XUZA 5BXPA 2EBNA 5F4XA 1O5XA 1EJUC 3PBYA 2XN1A 4PMZA 1HL2A 2E0PA 1C8YA 5AN7A 1KNWA 3TU9A 3M47A 4MWAD 2HZGA 3GHRA 4GQQA 4YTSA 3B8DA 2V3GA 3THCA 1GQJA 3NQ8A 1FWJC 1R2TA 1X38A 3GVGA 1R6WA 2PF0A 1B3XA 3GD6A 3OLEA 2HDJA 3KXQA 3SRDA 4J3VA 5HXMA 5I2UA 1O95A 4KEUA 1EA9C 4CVUA 3ARRA 4MKVA 3ZR4A 3I6TA 3OHBA 3N2OA 4W89A 5LNVA 4UMBA 4DL2A 2VYOA 1NOUA 4QJ5B 2GUUA 3LS9A 4K7YA 4ML4A 2EPLX 4HCDA 1EXBA 3P7YA 1FHVA 4YLWA 1UUOA 4ICMA 4MMWA 5JH2A 3BURA 3H6OA 4WKAA 1JX4A 1XBXA 1UYQA 3KWSA 2GQ8A 3U9IA 2OG9A 4NX5A 3PPHA 4WJEA 1HO4A 4O53A 4Q8TA 2W92A 2VI0A 4HU4A 1BVWA 3BLDA 3PUEA 5C0QA 4MY8A 2Q8ZA 2B7PA 1CW2A 4J9SA 3E6EA 3UBPC 1RV8A 1X7IA 5E9XA 4NG3A 4GX8A 1PDYA 4JTIA 4JTAA 3IARA 4R27A 3ABXA 2CU0A 2RDWA 4KH2A 4GINA 3SUVA 2PE4A 3WF3A 3NQFA 1PHQA 2J7DA 1P1XA 3KFTA 1NELA 2X2YA 1ESWA 3GHSA 3W83A 4DBEA 4FNRA 7XIMA 2Z6JA 1HKWA 3OLDA 3QOMA 1OYAA 2DZVA 4JV2A 3ZO9A 1X1NA 3EDEA 3L2LA 3WDPP 5ECVA 1AH4A 1B4EA 3EA3A 2NWSA 1QNRA 2ZX5A 5M2FX 3FX4A 2R8IA 1TPEA 2HBVA 4MWAA 1E9YB 3HV8A 3SCQA 4GQRA 3TMQA 1QO5A 3N6HA 1ME7A 2IXVA 2ZWYA 2C28A 4S2CA 4MPQA 1X98A 3OIXA 3NURA 2D2HA 3GNRA 2OEJA 2XG9A 1U5HA 3Q58A 3PZOA 2BX7A 1I0BA 4PB4A 5EMLA 2PWHA 3ARQA 2YBUA 4R8UB 3EDFA 4D6HA 4KEVA 2YL6A 1KCLA 4HMNA 2PMQA 4FAMA 5CJNA 3WJZA 2WC4A 4GZEA 3NSXA 2XIMA 4GC4A 4AXNA 3SADA 1H11A 4F0LA 1RP8A 1UZ1A 1CGVA 3WD2A 3STPA 3HOJA 4GLEA 5DG8A 1HKKA 4ACZB 4Q8FA 4MG4A 4RNHA 3SAZA 4DYEA 1XW8A 4BK9A 3HJEA 4IMEA 3M9YA 2QEZA 3CQKA 3GUWA 4DM1A 2PTDA 1PL9A 5B7ZA 1M04A 4L4PA 3LD5A 4G8TA 1GVYA 1LG2A 3ZT5A 4GUJA 4C7FA 1AQ0A 3G1VA 1ODUA 4JN6A 5LSMA 1BTCA 3NQAA 3R2GA 3P0XA 2GSEA 4I9TA 4M82A 3D0CA 1N8FA 3C8NA 1BWKA 3VDGA 3NGDA 3GVRA 3KW3A 2QJNA 4LY8A 3I7QA 3QZEA 5IHSA 3O2LA 1V93A 1XSJA 2FHCA 3ARTA 4CQ9A 2DJLA 3G77A 6TAAA 5BU9A 1KBIA 1PZ0A 3DFTA 4KCWA 3PK7A 2XGPA 3MSRA 4PTXA 3W7EA 1TG7A 3UJEA 1YADA 2E68A 1JZ8A 4OGZA 3WBYA 1GVRA 3BCJA 3QM3A 3WLMA 2PTWA 2NV1A 1E4NA 2QDDA 3RLHA 3ZVHA 1UJPA 1ADSA 1S0OA 1OG6A 2Y5SA 3TDFA 4HP5A 4XZWA 2XH4A 4WY0F 3WUBA 1ADOA 1TCMA 3M07A 4Z2GA 4AVFA 5A69A 1W9PA 3USBA 3T81A 1EX1A 4M8UA 2XWDA 1E1CA 1JAEA 1J5SA 3F7JA 5BOOA 3MJYA 3KS5A 2IPJA 1Q3NA 1B3YA 2UVWA 3EBVA 4MB1A 1AQHA 3QQWA 1D8WA 3WBAA 1HIZA 1S5MA 3CZLA 4OKDA 4J9JA 3O05A 1W0MA 2CEQA 3QV9A 4LYKA 3TIMA 4A3UA 1O6IA 1RXOB 5KG5A 4IR9A 3KRSA 4I8YA 2QGYA 3SCTA 3OIHA 3BLIA 3HQPA 3RM8A 3WNOA 1S3HA 1POJA 2J6UA 2C19A 2NX1A 3GBDA 2H3DA 4Y9MA 2BG5A 3AXIA 4H3DA 3PFRA 3S5YA 2ASJA 4LC8A 3DG3A 3RB0A 4K8HA 4JN8A 4BEUA 4DZIA 3B8VA 2XWEA 3STGA 5A8GA 2W9BA 3MV01 1DWHM 1CGTA 2FB2A 4OWGA 1N48A 3W9ZA 5AB3A 3FJ6A 3CUJA 1TPVA 4HMEA 3T4CA 4IQJA 2FMOA 3VIJA 3GU9A 3H2AA 4X61A 2ESCA 4CEUC 3QH2A 3RYSA 1GOKA 4DEFA 4Q32A 2ZUWA 1IGSA 3RO8A 1P7TB 2I9UA 1LLOA 5HNRA 1X1OA 2Q8XA 1NFGA 5HQLA 3ME3A 3TZFA 3O0KA 1K77A 2F6KA 4MY9A 3TN6A 2XFRA 3W6LA 3AQUA 3VINA 1VPYA 3FEMA 3IJLA 4GACA 3U7VA 3M6YA 2O92A 3MMWA 1FXQA 3OZMA 4DEZA 7REQA 4H4IA 3EX1A 4FXRA 4IFRA 1FVPA 1H3GA 4GIYA 4XG1A 3ZXWA 3RX2A 1J4EA 3TA6A 3UJSA 2PDUA 2GOUA 5RUBA 3LNPA 4D71A 3QV7A 2BV9A 3W37A 2Z2AA 9XIAA 1YNQA 1VZWA 3T05A 2EKGA 3CUFA 2VD9A 3RLUA 3HTWA 4UTUA 4DWSB 2WJFA 5C6MA 3A5FA 3SCNA 1Z41A 2GJXA 1W31A 1YHTA 2PTXA 2AGTA 2CLHA 4DI9A 3OBEA 2IQDA 1FWEC 3EEZA 2I14A 1C9WA 1QNSA 2YXXA 4DBSA 2VEPA 4OUEA 5CC6A 4H9YA 3IACA 5LXXA 1TVPA 1ME9A 1RP9A 5J5RA 2OT0A 4BQ5A 3R4IA 3WNKA 1QNQA 4EXBA 4FIRA 4PH6A 1ZRQA 4P5UA 1VGAA 2DU2A 4J7RA 3G0XA 3MKKA 2Y0FA 4EX4A 3L0KA 1UH3A 2E3ZA 1VPXA 3UZYA 4YTTA 3M0XA 3NO5A 4FNTA 2CLKA 2OOGA 2PI6A 2Z6IA 1KM1A 1UP2A 4MWAC 2RDTA 1C93A 5E0FA 3WMSA 4Q4RA 1TWZA 2YW4A 1IZJA 1NWUA 3UPMA 5PTDA 4M29A 1ICSA 1H7RA 1UCWA 1YXDA 5U4NA 1JEZA 4ZO9A 2DT3A 2GOKA 2BBFA 3R8RA 3NGJA 4JCMA 1W5QA 3EOEA 3IJQA 1H7XA 5BNKA 3T78A 3BSGA 1Q6LA 4CNSA 1JFXA 4C7DA 3B9OA 2JF6A 4L5ZA 4ZODA 1D7FA 3NQGA 2Y88A 4NX0A 3L67A 5F4SA 2ANUA 2C0AA 2PLJA 4MB5A 4XUYA 3TA9A 4C6LA 3RAOA 1RCXB 1PKYA 3W72A 3POHA 1FKXA 1VJSA 1XX1A 4M51A 3ZJ6A 3AIRA 3E3HA 3WLLA 3N29A 4LALA 4OZOA 1RALA 3KOFA 3PR4A 4O3QA 2PD9A 2XH0A 3R5EA 4QAIA 4UTMA 3SCRA 3V16A 2QCMA 4Q4MA 3EDJA 1CTNA 2W27A 4QE1A 4Y9AA 2V2CA 4R88A 2Q3OA 5CBIA 1UD6A 1X8FA 3NA8A 4GK8A 4E2BA 2GGHA 1TKKA 5HA7A 1XPGA 4XBSA 3PZNA 5E0KA 1JPIA 4L6HA 3JW7A 1WAUA 3MU7A 4Y6GA 4H04A 1BQCA 5HNTA 3LI1A 1MQPA 5CQ1A 3GV8B 3ITXA 3CAQA 1MNSA 4AW7A 2XH7A 2WMGA 1XC6A 3VIKA 3VNKA 1OIFA 4F2BA 3LBCA 3PN8A 2XC9A 4XWUA 3OB8A 4I5RA 4CNTA 2TSYA 3FNDA 3PY2A 5CCZA 3G6LA 1QOPA 4A05A 2WTFA 1V6XA 2WZEA 3FHAA 2FDMA 1WO2A 2HK0A 3UD6A 3WH6A 1K9TA 2OQYA 3P81A 3T0CA 5DO8A 3N13A 1NVMA 4DPQA 3T9PA 3M5XA 1GZ1A 3RDKA 3AYRA 4GIRA 1A3XA 3U8GA 2WNZA 3SQSA 8TIMA 4H7VA 3TQPA 2BR0A 2VA3A 2ZRUA 4J3ZA 1GORA 1KGXA 1F9CA 2V2DA 5CLTA 3A9BA 1I75A 3BMVA 2AOSA 4DB7A 3V36A 1W2PA 4H41A 1O1HA 4C6BA 1VH7A 2E6DA 2VT0A 1P0KA 4A8RA 1VRDA 5DMNA 4XKMA 3T09A 4C60A 3WD0A 2V38A 3RLVA 2D0FA 3HO8A 1JZ6A 4HSHA 1K03A 2ICSA 2QJIA 4LY4A 4MGGA 3TJLA 1VHCA 1G7VA 4BCEA 5DANA 4F2TA 4YQWA 3HQNA 3WEZA 2WMKA 3CIVA 2DV0A 3L0GA 3EOOA 4DZ5A 1TV5A 2X1UA 1J5TA 5XIMA 1SGJA 3WNNA 1GVIA 2ACUA 3FXYA 2NLYA 3P62A 4TXEA 3T40A 1KM0A 4EYHB 4O1EA 1SW7A 2G3IA 3H7RA 3GXDA 1QHPA 2OSXA 2ACRA 3L5AA 3TNOA 3FVDA 3GTXA 5G4EA 4ED7A 1RPXA 3S1UA 1ZBKA 4J5NA 2OYKA 3UFYA 4Z17A 3VX0A 4V1YA 4OVXA 3ITCA 4D6CA 5BCAA 4CU6A 3PFMA 4F40A 3VZZA 5KINA 2ZXAA 3L12A 4FLOA 3E02A 3WEOA 2HS8A 2ZQ0A 4DBDA 4KMQA 1QXLA 3B0XA 4DQWA 1E0XA 2FQIA 4NJHA 4UIOA 3ECQA 3V0SA 5J5DA 3UNDA 4WCJA 3SDOA 3AU2A 2OO0A 1TPFA 3TV8A 3N04A 1XYMA 3BLFA 3L66A 3T2OA 2P5NA 3TFXA 1ZNNA 2NW0A 3BW3A 5I78A 3KEHA 4CD4A 3CTTA 4BF7A 5I5RA 3RPMA 1DJYA 4IP7A 3V5CA 3IIPA 5JVLA 5I77A 4D72A 3AMLA 2JEPA 1JPHA 2PDKA 4XZLX 1BQGA 4HN8A 4MDOA 1EO7A 4AX6A 4PC8A 2YL5A 5CPOA 3UWQA 3DECA 1LROA 3MA8A 1VF8A 3MZNA 2W79A 1DIKA 4CD8A 4KGLA 2VCAA 4KIRA 2XN2A 2XVNA 3SI8A 4AVNA 3TCEA 2AAAA 4PMYA 3B9NA 4DJED 4G7EA 1ZFJA 2NXGA 1ZCOA 4DPPA 4QSFA 3EX6A 3BPWA 4UOQA 1JIBA 2ZZ4A 4XTDA 3MP3A 1JCXA 4URIA 2O55A 3GG7A 3S6TA 4I5UA 1KO0A 2TODA 1QI3A 3QBUA 2Y61A 3UZ5A 2QS8A 1VPQA 4GKTA 4MVAA 1WQ5A 3GDKA 3KOWA 3V5FA 1UKOA 5A94A 5I07A 4U31A 3WK1A 2VFFA 4KQNA 3C2FA 1KBBA 3NYDA 4GYPA 4XK2A 5HWNA 4ECYA 3PWAA 1SYTA 4F0MA 4RUBA 1V3LA 5KG6A 2WWCA 1LBMA 5HNNA 1KB3A 3UR8A 4LAZA 5CZKA 4V15A 3GVWA 1RCOB 3FDGA 3ZT7A 1K1SA 2BY2A 2E4TA 3WQ8A 4GD0A 3GKAA 4NZFA 2IMRA 1P0NA 3G3MA 3ANUA 3CMJA 4DF0A 2PTZA 4W87A 3FVMA 4HNCA 4PUNA 4DJDD 2OYMA 3VIGA 3W38A 4U2ZA 3OSNA 4YS1A 5DT5A 2ON3A 3IIZA 4E8DA 1A4MA 3GIMA 4ZO8A 5HWMA 3WX7A 5D04C 3M41A 4A8IA 2DVUA 1KD0A 4R7JA 2NXIA 4OIFA 4J9QA 3DERA 3OVGA 4DL3A 4US6A 5I7GA 1JZ3A 1MRQA 5KFDA 2HPIA 1EOKA 1KCZA 3VNMA 2NQHA 3W7RA 2FLNA 3NYZA 4N6EA 4GH1A 2XM2A 1QAPA 3W27A 2E9BA 3K1DA 1QPRA 1K02A 1B5TA 5FJPA 3SCVA 2L5HA 1EZ2A 2J66A 1VQTA 3GIJA 1HJQA 3OU8A 3DKLA 4Y9NA 5HDRA 4LUJA 1I45A 1BYDA 2GDVA 3LN3A 4O0KA 3R8HA 2CLIA 4I7VA 4J3UA 2XVGA 4PE8A 1ZSXA 2BLEA 3AZTA 3HMCA 1ZAJA 4Y7EA 3MANA 2W0UA 4DJEA 3WLPA 1Q8AA 4ZB2A 1SSDA 2O9TA 3OGRA 1BRLA 4O8RA 2Z2BA 1J0YA 3TK7A 2YDSA 4ML9A 3WJYA 2DPIA 1TE6A 4PUDA 2W7OA 3P8JA 3TJXA 1WNOA 3ISIX 4KFOA 4Q7NA 3C3UA 2E6FA 1H1ZA 4JQ4A 4RXGA 6REQB 2OZ0A 1DORA 1Y8BA 3UJFA 1G1YA 1EC8A 6XIMA 1YNYA 4GI6A 1TRIA 3SJ3A 1M7PA 4RUCA 3P60A 3QY7A 1XSKA 2WC7A 4JD4A 3T2QA 3G1RA 4P7OA 4YP3A 4ZB5A 5CG7A 3IPWA 3AIWA 4PEEA 1VP5A 1OCQA 3P3BA 1GGOA 3CT7A 5LA2A 1OZQA 3S9YA 1EPVA 2DH2A 2VL4A 1MXDA 1UP3A 3OZYA 4AIOA 3QPYA 3AS0A 3QZAA 4MYAA 3UGVA 1G4EA 4D9PA 1GHSA 1MW1A 1M5WA 3CHFA 1P0EA 5DBUA 2E8ZA 4HOWA 3W1AA 4K37A 5KFCA 1RYSA 4K38A 3SEPA 3SIZA 4K6AA 1C91A 1UKPA 2FJKA 2GDQA 5C71A 1E56A 3PJUA 4GZIA 2WMHA 1J0KA 3VIIA 1L8NA 3WFAA 1ISZA 3RPTA 1W9DM 2GJRA 1OADA 5IDIA 3ZOAA 4W5UA 3SGZA 3S6DA 1PBGA 1EGZA 1FOBA 3CL6A 2D0HA 2XSBA 3EWBX 4D1IA 2G41A 5T9CE 1LQ0A 4ED3A 4QBXA 4AEOA 1WDWA 4UNKA 1E15A 4XD5A 4LEFA 4NT0A 3NOEA 3TYCA 1O94A 1XCFA 1QBBA 5AFDA 3NPVA 4JPGA 3B4YA 5LXEA 3CZGA 3TN3A 3I10A 5JUVA 4WJ8A 5I3JA 2BFGA 4DIAA 3H70A 2RDXA 3LM7A 1O12A 1K4HA 4GXMA 3CUIA 1IEIA 1R3WA 4AEFA 1D2KA 3MT1A 3CO8A 2WSYA 1H61A 3CV2A 1BKHA 4IPJA 3KZSA 3IIVA 5D2TA 3BAKA 2EPKX 1VFTA 3EPOA 5REQA 2D1ZA 2UY2A 3MHUA 2VURA 2UWFA 5FAGA 5L1JA 3ENLA 1E43A 3QLDA 2NUWA 1TV4A 4QE4A 5C7VA 1WOAA 4E4FA 2Z7GA 2FGBA 1ZU8A 4RZBA 4ZO7A 2QVNA 2W61A 1DOSA 1ZS2A 4OV9A 1F74A 1JF6A 2V5DA 4CD7A 1DJXA 2YL8A 3BXWA 1OB0A 2RGMA 1ECEA 2WV8A 3CQ0A 1VFFA 3MUIA 1LL4A 2A7NA 1E0UA 3NIYA 1SR0A 1A5MC 3SRHA 4GH3A 1E6SM 4JQ1A 3R7MA 3BOFA 3UCCA 3BMWA 4FNSA 2E9MA 1ZJHA 1BXNA 1LG1A 3NPUA 4GVFA 5AZ0A 3OZOA 3MHGA 2WLYA 4JHMA 1M41A 4JV1A 4ECTA 4XD4A 4PMJA 2OLSA 2FH8A 4HCLA 3TX9A 3VOGA 2AAMA 4JKKA 3ES7A 4LS2A 3ELFA 3NPXA 3CIWA 1C7TA 1A47A 1EX5A 1Z3NA 4IRDA 4F48A 3VIPA 4Q3MA 4W88A 5A6BD 4EXQA 1QR7A 2QPXA 2E77A 3LBMA 4GO9A 3E5BA 2PDPA 5HANA 2ISFA 3HM7A 3H7UA 4X2RA 4JQ2A 3IK2A 4PB5A 2CBUA 2FTWA 3VNIA 2PDHA 3S6OA 3QZ6A 4AFYA 1TJ0A 2ADAA 4YTRA 4DHGA 2GVLA 1CCWB 1JQXA 2Z25A 4GYPC 4GZ7A 4JX4A 1SFSA 3ZJ8A 1Q13A 4ICCX 2HJPA 3M0IA 3O3RA 3SCWA 1EJWC 1GJPA 2ATSA 3EPMA 1AG1O 4IQLA 3QY8A 3BE7A 3W85A 3NOYA 1EWEA 5I09A 3MR2A 1TPH1 3N2CA 4H6EA 4JFSA 2Z4GA 3C8FA 3AMCA 3TQKA 4I90A 3EOLA 4EANA 1Z48A 2CBVA 4Y9PA 3WK3A 2O7SA 1S9FA 2DSKA 4LF2A 2WC3A 4B5NA 1UA3A 1W1ZA 2W8KA 1UWQA 5BWFA 1S2WA 1QI4A 5LIKX 1QPQA 2QDHA 1J10A 3CEUA 5EBUA 1JPKA 2PWEA 4AZ7A 4WR3A 1O5KA 1E1CB 3OGSA 4L1WA 1M65A 4GKLA 3G8EA 3A3WA 3NL6A 4IT1A 4UFLA 3NZRA 2DZWA 3UXIA 5G1MA 3I3BA 3WK0A 1FH9A 1PJ9A 3PSVA 3PS7A 4MYXA 5D9MA 3BSMA 2OEMA 3CC1A 1M7OA 3R10A 1KFLA 1GONA 4EPBC 1PTDA 2YJQA 2ISSA 3IEBA 3M0ZA 3SGUA 3WLNA 2ZA1A 2UBPC 1RJPA 1OFRA 1VBGA 4YR0A 1ZP3A 4JTHA 2D24A 1SSGA 1TIMA 2XSAA 1BF2A 1OX4B 1YXYA 3JZUA 3CEPA 4QEEA 2H6RA 2YCLB 1Q85A 2WM0A 1EJSC 1O60A 1SMDA 1A50A 5DGAA 3KRZA 4I6KA 1UR4A 4JTQA 4DJEC 1OGGA 3BJSA 2QUUA 1OC7A 3DBPA 1H49A 3KCJA 4N2YA 5A6BA 4GBDA 4EPEC 1GYMA 3IJ8A 3LXCA 1JZ4A 3RNDA 2WHKA 3HG3A 3WY1A 3WZ0E 3QSRA 3PW7A 2DZSA 2W9BB 1QI5A 3E2VA 1A5AA 4JAWA 1HKJA 3LK6A 3IJ6A 1US0A 3LRMA 4MAZA 2R9RA 4KESA 4B5WA 2CESA 2QW5A 5CAHA 3RLGA 1BSLA 4IIEA 2B81A 4BS0A 1KR0A 1V6YA 2JK2A 3UPBA 5EWFA 2QUTA 3RN6A 3IRSA 4UMAA 3RM9A 5BXTA 3FV9A 2E1DA 3W2LA 2EG6A 3IANA 3LGDA 5D02A 3KHHA 4YYCA 5GQBA 1CLVA 3PZGA 1XKJA 3SURA 3JU2A 4N9EA 5T8GA 3AUOA 1KCXA 2XINA 3PF3A 1ELSA 1HF6A 2ZBTA 1JRBA 3B04A 4TU1A 1JRCA 4A3RA 2VQTA 4H1ZA 3GU2A 1XLJA 1XIGA 2CKSA 7REQB 2DZXA 4X0NA 1UJQA 4DJDC 2QCHA 3ALFA 2NUXA 4ZTXA 6CGTA 4Q8MA 2Q02A 3WD1A 1QWGA 4NJIA 3RU8X 1Z44A 3ZJKA 2J9YA 1E4MM 3W2MA 4HA3A 1KBLA 3APTA 2I17A 3RCYA 2OU4A 2DW7A 2BVWA 3IV8A 2Z1VA 3EX2A 3H4GA 1AW5A 1Y5VA 2GJXB 1OGSA 3TEVA 4JFVA 2OLAA 3UVIA 2YDAA 1H60A 4WK9A 5I3FA 1BSIA 3N2XA 2O0TA 1TVNA 3RB4A 1E4LA 2J79A 1JAKA 3M1ZA 3KP1A 4L4OA 4KRUA 4GOAA 1ECQA 4HBKA 3CQIA 1TX0A 4C7GA 3T42A 3NEVA 2ZZ3A 3WD4A 4C6QA 2DSWA 3R94A 5BRQA 1XKYA 1ISVA 4HK6A 1Z89A 4C6PA 4RNOA 1Z32X 3E2SA 3TN5A 3VYLA 1RLDA 3ID7A 4LAKA 4B90A 2G3NA 1TA3B 1EOMA 4F4RA 1BYBA 3AYVA 1GW9A 3WNLA 1KM3A 1JD7A 1HL9A 1H5VA 3LTPA 3U3HA 1YX1A 1VIZA 4IZGA 1HJSA 1B2YA 3ABSA 2FPVA 3QJAA 5AOUA 1ZUAX 3FJNA 3HV9A 4OECA 3LXAA 2HXTA 4R85A 4GCAA 1UWTA 3GY1A 4A3YA 1J01A 2R8HA 5DRIA 4GUIA 4FR6A 1C3FA 4PBGA 2VM8A 3WN6A 1RZMA 2QCDA 1TJ1A 3PJTA 3KTXA 2NT0A 3NQVA 3GNDA 2FYMA 2UV8G 1Y0EA 1RVGA 2ASDA 1D3CA 4HPHA 2B7QA 4LS1A 4DAIA 4P2VA 2WZHA 4FO4A 4LBUA 3HG2A 3YPIA 2FVLA 4TUFA 4GC7A 1ZENA 4NAFA 1MYRA 1V3JA 3VKKA 3U57A 2E25A 4WY0A 5BXSA 5KFLA 3RCNA 2P8CA 1VFUA 3MV11 5B7YA 3MCMA 3VNLA 4XVDA 2C15A 4GNVA 3C2EA 5EA9A 2RGLA 3Q4DA 2VWTA 3W29A 4HNTA 3N25A 3W28A 3P2VA 4O1FA 3N6QA 3BC9A 3EXSA 4NASA 3I6EA 1VJZA 3VMNA 1T3NA 2QPUA 4G2DA 4C1NA 4J3TA 4LU0A 1OQFA 3UETA 3LHWA 2PURA 3TAOA 5KZMA 1K7FA 2R94A 3U2EA 1SVDA 5KFJA 4QRNA 3O6DA 1PKLA 1R0MA 1DVJA 1SJDA 1E6ZA 4BKNA 1T0OA 2FVMA 1Q45A 2OVLA 5I3KA 5DLGA 3GXIA 1YPIA 2Y7GA 4EYIB 4I9AA 1TQJA 4DUVA 4QSHA 1OVDA 4DLMA 4NZ1A 5FF2A 1LOLA 4C5YA 1EBGA 3F4VA 1JJKA 3GIPA 4RDZA 1R3VA 2VQUA 2YL9A 5MKGB 3DI0A 3CWHA 3S83A 3AMKA 4QNWA 1B1YA 1R9ZA 4J9NA 1KXTA 4MSSA 1H7NA 1KTCA 3ZSSA 3PPCA 3T5KA 1UG6A 3VD3A 3VUPA 3WDHA 4RL3A 1ONRA 3MI3A 3OQEA 8XIAA 3MZ2A 1EKOA 4U7CA 3W88A 5JBEA 1W3NA 2NQ9A 2AU0A 2AQWA 1TZ9A 2PCEA 4TVCA 1FCQA 2JGYA 4PUEA 5LIUX 3RGTA 2QUVA 2AKMA 3BLEA 4XZNX 4ASTA 3G8RA 2GJLA 3BAYA 4NL1A 4B9YA 5H8MA 1V03A 3V1PA 1ME8A 2CLEA 2WZMA 1ODZA 1RD6A 4GWEA 1NY1A 4G9PA 3L4XA 1VYSX 4CCZA 5TBOA 1XDMA 1BVZA 4CQCA 4EXAA 1CLKA 2OZ3A 4G7FA 2VC9A 4FALA 4V28A 3CPGA 4M1RA 2FZNA 1YLVA 4TQSA 1AA1B 5I06A 4HHPA 1VYPX 2VFGA 1DQXA 4RCXA 4Z1DA 4JTEA 2PODA 3ARVA 3M7WA 4YN5A 1A49A 3CHEA 5DXXA 1IZCA 2V0TA 2YSWA 3PZPA 1AJZA 4JIRA 3RB3A 5HWJA 4CN1A 4UNLA 4UQDA 4AZBA 5BU6A 5I0DA 2BY1A 4A2SA 1G4TA 4RK8A 3GR4A 1IV8A 4QG6A 5A8PA 4AVOA 1IGWA 3MUCA 3AWOA 4J3WA 3VI2A 5K9CA 4JR5A 3NQCA 1BYCA 3OA5A 4DY1A 1DIDA 5AC4A 3CS2A 3GVVA 2ZXBA 3OOQA 3K1GA 2BB0A 4FBTA 4C6IA 4UWMA 1B31A 1GOMA 4QP0A 2A7RA 2ZRXA 1TTQA 4TOQA 4RDWA 1C8VA 5KFKA 4AAJA 2JKEA 2WM1A 2ASHA 4GGHA 4LRTA 3OA3A 5EY5A 3PG8A 4KIEA 1XJBA 3IV3A 3KL5A 3NO3A 2INZA 4N02A 3G1SA 3W6YA 5JIWA 4GQGA 3SSZA 2NUYA 3DHDA 1JCJA 2C13A 1OX5A 4EE9A 4WIWA 3CTLA 1BWVA 4AYSA 3FSUA 4RW5A 1I2RA 3CUZA 1XRTA 4PMDA 1JXJA 2YA2A 1GVSA 1OK6A 3RBDA 4KT2A 3WLJA 3U7BA 2VD8A 4HD5A 3CB8A 4PR4A 3D6NA 5CG0A 1H7WA 4F4WA 1IE7C 4NXSA 5EMMA 1U22A 4Q4SA 2PGWA 3TYUA 1OABA 5CPQA 2JQXA 1LRNA 3VOIA 4KFPA 2J9XA 3GXMA 1KV5A 1A5KC 1TB3A 3FAXA 3DENA 4EIVA 4ADUA 4X3ZA 4WOQA 3M0LA 1JVNA 2WMIB 3WUGA 2ZVIA 4GXPA 2POTA 4QLJA 1JI1A 3UERA 4MKSA 4H2HA 1W8GA 4PMVA 3TC7A 4ZB0A 2PP0A 2C16A 1K6AA 5AC6A 3HGRA 3FW6A 5LA0A 5CGQA 1TZ7A 1AH3A 3HU7A 3NSNA 1V51A 3WQ4A 3B4UA 1FWNA 4Z42C 3KHGA 1MQRA 4CU8A 4HTYA 2NWRA 4PCNA 2JFEX 3LBOA 5KFFA 1QI2A 5A8OA 1N8WA 5D9PA 2E5CA 4MM1A 2J6SA 2P0IA 3FHQA 2DW6A 3GAYA 5IRPA 3B0VC 3VE9A 4A6GA 2RDIA 1SJCA 2QHAA 2WZTA 3ICJA 3WJXA 2DJXA 1FWWA 3VDHA 2HE5A 3W7IA 4V27A 4ES4A 5I00A 1JQVA 2RH9A 4CU7A 3AJ7A 3EB3A 1J11A 1ZCCA 4IGSA 1FCUA 5H1WA 2WSKA 5F2GA 4AX7A 1ISWA 3FY1A 2VZOA 2AKZA 3E9AA 1OZMA 5ABGA 3WQVA 4Z0SA 5H8PA 3WCZA 5I3GA 2YW3A 2NV2A 4EKJA 4INFA 3KHDA 3WDRA 3QV8A 4DNMA 3I68A 2WHLA 4QQ3A 5GJPA 3HGSA 1IXQA 2PP1A 1EQPA 1BRLB 3UZJA 3DUGA 3ZZ1A 4BHYA 3LSCA 3H2NA 2DIEA 2CWNA 1I0DA 1JGIA 4EVZA 4AD3A 4LUSB 5KFQA 5KZDA 3DC8A 1OIMA 1WDQA 3FGCA 5A6MA 2LLEA 3L5LA 3BLKA 4F66A 1FDJA 2VKZG 1CX9A 3U48A 2PDIA 3N9KA 3AXKA 1ENUA 5FIPA 3Q67A 4FP1A 3GK0A 3FLUA 1LLWA 1M7XA 1SFLA 5L9FA 5I3DA 2YDRA 3UP8A 3LPFA 4JTTA 2CLLA 3DAQA 5KT5A 1G9HA 4KWSA 2IKGA 4IF2A 5FF0A 5BMWA 4RR4A 1V7YA 2OMAA 5KEZA 2F61A 4Z2LA 2P10A 4W8BA 3GGMA 2YOCA 1TPC1 5L1KA 2ZC1A 2P3EA 4LS0A 5CSYA 2V5KA 4QNEA 2AGPA 1ZBWA 3G2GA 3GNXA 2PDNA 5T14A 4MIMA 1J0ZA 1G4PA 4TX9A 4J40A 3VM7A 3AS1A 3GAKA 2AGKA 5D09A 3UY7A 1KM2A 3S5ZA 5DY2A 3S2CA 4MUZA 1BWLA 1POKA 4DZAA 5KG2A 2X40A 3IS4A 4I3GA 3GE7A 3MDUA 1BGAA 3EA2A 2R1MA 1TQXA 2OWXA 1XIBA 2C22A 3ARWA 3HG5A 3PTMA 3TXVA 1W1TA 1DWAM 3H54A 4JIHA 4Q22A 2C0HA 1T7LA 2QDGA 3MP5A 4OBSA 1XIMA 1HGWA 3TOPA 1H63A 3K4WA 5XINA 4HSOA 3FCPA 2QAFA 4Q4KA 4Q4PA 3L2IA 4G5DA 4UTTA 4NI3A 3MMUA 2ZDRA 2I57A 3AOFA 3WK2A 1LP6A 2X0SA 2G37A 2OPJA 4ZQPA 3VFLA 1UR0A 2EKCA 2W63A 3GTNA 4NQ1A 5IOBA 5DXYA 5A8MA 3SCOA 4MB3A 4RW3A 1DTUA 1XHGA 1RD5A 1E72M 4S3FA 4GABA 3MW7A 4HJWA 2AQ4A 4IJCA 2VZUA 3F5KA 4UCFA 4PRRA 4QHRA 4PMQA 3K4AA 3WIJA 5A6KA 2P9BA 1VEPA 4WSHA 3FKKA 4JICA 3V4BA 4GBUA 3E38A 2YCJA 1OJXA 2XHYA 1HO1A 1HJXA 4EWND 3SCPA 3VCNA 2A7PA 4PA8A 2J78A 4JX5A 1RVKA 5I02A 1IT0A 4IJBA 4NUWA 4GYKA 1KA9F 4G6CA 2CHRA 3AS3A 4L64A 4C91A 3U2ZA 4JTCA 3J7HA 3FYOA 2VFIA 2Z1KA 4JGDA 4GMEA 3WQDA 4BI7A 1UR1A 5HUOA 1UMYA 4IGMA 5HR6A 2E7FA 4XKYA 1NWTA 5DCEA 3GG1A 2VOMA 3OLGA 4JHZA 4PUJA 3M44A 3MCOA 5FA5A 4IR1A 3CQHA 1UOKA 3CV1A 4FZIA 3LX9A 4AIBA 4CD5A 2W8LA 1KM6A 3GB6A 1ZL1A 2XH2A 3BOLA 3M9NB 3ITTA 5KFEA 2X30A 1C92A 1OY0A 1XLGA 2QUNA 2QJMA 1ZBCA 1EJ7L 4E5TA 1BPLB 5DLFA 2VA2A 4MJMA 1F73A 3UWWA 3WELA 3FYYA 2INFA 4TVUA 4IJRA 4K39A 1J2BA 5I03A 2JGQA 3V18A 4M6QA 2I5QA 3AYTA 5FOOA 1V0KA 4KCVA 1A5BA 2A2IA 3SFKA 1GOXA 3F5LA 2W9CA 3IJ7A 3WLSA 2R1LA 3ITYA 4QGCA 1XGZA 3KDNA 2DFAA 3UA3A 2Z27A 4XBJA 1DE5A 3OW1A 3D5HA 1O66A 3RCMA 4UTFA 5A6LA 4PODA 4XO7A 2ZX7A 1G0CA 2FTYA 1IXOA 1EP1A 2EXOA 1WDSA 2XM1A 2QIWA 4IIGA 3MR6A 3UWZA 2I9EA 4Y2WA 3W7KA 4UZSA 5FESA 2XZ7A 2WBKA 4HT3A 3UWUA 2V5CA 1JI2A 3EB2A 4H8HA 2WHJA 4ICNA 4Z1CA 3VFCA 2P53A 2J7BA 3BZJA 1WZMA 4WDTA 1XP3A 2PDBA 2AGQA 1WKFA 2VFHA 3L4YA 3WFLA 2ZUSA 1J9YA 3HN3A 4RNNA 1FP9A 3ARPA 2GK1B 1CGUA 4CNUA 1VBJA 2D73A 3KLKA 1H50A 1PDZA 1AJ0A 2HTMA 3N9RA 3H2CA 3N4EA 2XZ9A 4JUZA 3S2MA 2D3LA 3K30A 3UY8A 3VCRA 2W6RA 1RLCL 2PB1A 5JUMA 1LT7A 3BMXA 2X0YA 4LUYA 4HHLA 1GK8A 4P8UA 5EYWA 4XAPA 2NXHA 1F2JA 3BJTA 1X6NA 3GXTA 4HPXA 2EF9A 1GYLA 4BQ2A 1Z42A 3MFHA 4C5ZA 3PW5A 3GIKA 3OYXA 1TTIA 4HNVA 3IN5A 5DN1A 4MHBA 2WCSA 4B3ZA 2HVNA 4UNIA 3CU2A 5DCBA 2BXYA 3K2GA 5GPRA 1WV2A 3ZWSA 1VFMA 1TWIA 3W3OA 2OZ8A 5A5WA 3VNYA 3WLQA 3WDQA 2H9AA 4O0QA 4M5PA 2VX4A 2NZLA 1B54A 1VENA 3SB0A 2NV9A 3TSBA 1RJRA 2WYSA 2HQAA 2AL2B 3VABA 4O11A 2HNEA 1EPXA 2VHLA 1XXXA 3SUUA 3URBA 1Q6CA 2JIWA 5FJRA 2HV5A 3A4JA 3LCHA 3MI2A 3E1F1 4TMCA 5ABFA 4OE7A 1LORA 3FAWA 2XDFA 3GTFA 3BZGA 1IM4A 3ZFHA 4LRSA 2WCAA 5KSWA 3KVLA 3AZRA 1QI0A 3P5YA 2RUSA 3E96A 3Q37A 4E6MA 1J0JA 2XTKA 4S38A 3RR1A 4PBFA 3AHZA 1BVNP 1E5JA 4UUIA 2YGYA 1H1YA 2Z1WA 1ADDA 3V1HA 4AZ5A 3CB3A 2WZIA 1EXPA 1TJRA 3CUHA 4NNBA 4YIWA 1E6RA 2VEIA 1OF6A 5KMYA 2OGYA 4Q8VA 1U1JA 3H8AA 4K3ZA 4OOZA 2V67A 4RX0A 3LGGA 1B0IA 1W1A1 4ADSA 4LUTB 3AISA 1B30A 2ZUTA 1ISXA 3Q8RB 4AD5A 3K4DA 1IXPA 2WVVB 3SI9A 5AC7A 4WGHA 2BVDA 3W2JA 4F0SA 4W7VA 3W24A 4MAVA 3I4EA 4UTTC 4S3CA 4LOCA 3F4WA 3WUFA 1BHGA 4EP8C 2R1NA 3LPOA 4JEQA 2QGHA 1JZ2A 4BQ4A 4KKXA 2ZADA 5FL1A 1UQZA 4YJ5A 5FEZA 3GZAA 1WXYA 2OWWA 2BTMA 4Q7BA 3K46A 3GFZA 3LCWA 3LPPA 4Q8QA 4YWSA 2ZYFA 4HK5A 1XG3A 3UR7A 3E0IA 3SM0A 3C4UA 1WDRA 1EGMA 3KM8A 3JR2A 3HGOA 4L7ZA 3QF0A 1M1BA 3N2BA 5U7SA 1GOQA 3R43A 5HQEA 4GA8A 9RUBA 3WYZA 1N2VA 3WQOA 5D2XA 1HX0A 4OJYA 4UQ9A 1NFBA 1SZRA 4WF7A 1FWRA 1LRTA 2V69A 1AQMA 2CNCA 4AQLA 1PAMA 5C7HA 2NQ5A 1Q8JA 3LGEA 4R33A 3SFWA 3GX9A 4Q7IA 4MKNA 1ONEA 1KTBA 1XCXA 2HK1A 5A6JA 1BXBA 4FA3A 2Y89A 2QCDB 2IKIA 2DQWA 1TZZA 1YDOA 3BL3A 3NO1A 4AZGA 1GQIA 2EEXA 3GNNA 1UKSA 1R3RA 3WDIA 1IWAA 4QAWA 2XCAA 4LTSA 2W4XA 1T99A 3TQVA 2O7QA 3EOSA 4D8ZA 3TE9A 1BG9A 3MJMA 4XUGA 3URNA 4IICA 2VEKA 1E6NA 4W4QA 3QY6A 5EDWA 4QLKA 3K8KA 3VILA 4HPNA 1A5LC 3EDDA 4ACYA 2IMWP 1S1RA 1GPWA 1EZWA 3A64A 2FVKA 2OT1A 5LNWA 5E9AA 5DG9A 4IGHA 1KC7A 3BJFA 3QSTA 1RQEA 3GKFA 3R12A 5K4ZA 3AXXA 2OYLA 3VGBA 2ZDSA 4JTGA 3TAKA 4C1NB 1KM5A 4RZ4A 3NPWA 5KFTA 2DZBA 5FACA 1AZ2A 2VEGA 3DFYA 4Z08A 4UOZA 7ODCA 4Y90A 1G5AA 1V5XA 1XYAA 3MI6A 1SO6A 3ABRA 3CMGA 2C71A 1LL6A 1S5VA 1PKMA 4ORMA 2X7VA 1QW8A 4J2MA 4JYFA 3CASA 3WLRA 2PF8A 4RLIA 4AY1A 3PNZA 2XIQA 4YR2A 3CH9A 4IG2B 1V77A 5AYZA 4B5TA 3W1NA 4P7LA 1KKOA 3IIOA 4Q8PA 3CL8A 4GY7A 2ZZ7A 2W7PA 1Y5WA 1HUVA 4LANA 2VC5A 3H23A 1HT6A 1Q66A 3W25A 2W9MA 2GQ3A 5F1VA 4J9PA 2DT2A 2XJ7A 1GKRA 3O8AA 2Q8LA 4WDWA 2VVSA 3CHDA 5DT7A 4KEMA 2VCCA 1H1NA 2VZTA 3VKBA 1B3OA 1MW3A 2CETA 1LJYA 5AZ1A 2W91A 1QASA 2PDGA 2ZZ6A 5FSEC 3A24A 3DX5A 4OBRA 4L61A 3W71A 3W1XA 5KZEA 1VIWA 2WJDA 1LQAA 2FLIA 5K9DA 1UKQA 5BRPA 3VAVA 2A3EA 3B8SA 1QPKA 1S2TA 4NP7A 3PVXA 1JCNA 3PZVA 3BWWA 4FNUA 2Y85A 3MYOA 4JOMA 3FDKA 3CAKA 3B0YA 1XLFA 1E73M 5TD4A 2PWUA 3B0PA 3VGEA 2WPGA 3DKJA 1UPPA 3B9EA 3M4HA 3TUUA 1OG0A 2G4FA 1IF2A 5LNSA 5AYBA 4HYVA 4TMBA 4GVGA 4Q8EA 1HL8A 2AMGA 3TROA 2E8YA 3KL0A 1E40A 3KVMA 3NZ1A 3PWGA 4E8CA 2VFEA 2VENA 1C8QA 1PSCA 3WL0A 2PLCA 3RAQA 1QVBA 1Q6QA 3SN0A 3I4KA 1I8JA 4C6KA 1X6LA 5BYWA 4HGXA 5ECUA 3BO9A 4DELA 2VX5A 3BGJA 3NL5A 1RH9A 2OQLA 1ISYA 4PUUA 1FH7A 1XLDA 2DT1A 2UY4A 3COTA 4K7VA 3T0AA 2VELA 3E74A 1GEHA 3A47A 2BXVA 1L6GA 4ED2A 5F9NA 4PL1A 2IS7A 1UA7A 1HJVA 5DLCA 4DRSA 4UFMA 2FZMA 3QEZA 2J6VA 3DOPA 1E9IA 4RPPA 4N4QA 1T96A 1AUSL 3MWAA 3WG6A 2QIIA 3TOYA 2Z29A 2TPSA 3FEQA 1PZ2A 1JD9A 2VTFA 4EPKA 1IR1A 4PMUA 3MR5A 1N56A 4PTWA 3GDRA 1VFOA 4NZJA 3FYPA 2YBVA 2UY3A 3VGHA 3RPDA 4DAFA 3G1DA 4W8LA 4FSAA 3TW6A 1PV8A 3O63A 1DXFA 3MTWA 3W86A 5CZ0A 4ONVA 3U0HA 1OFAA 2W5FA 5CSSA 1LWIA 1U83A 1W32A 4EAYA 2V5JA 5AHMA 5LIWX 2WSQA 4IFKB 3B03A 3UJ2A 3VUSA 3PB2A 5KT2A 3M0YA 3AHTA 3GW3A 4DBWA 1P4CA 5DF0A 1TWDA 2D2GA 4O50A 1Q7QA 3BV4A 3GWQA 1EC7A 3I3DA 3T0DA 4FLSA 4GUHA 3W2UA 2PDMA 3KBJA 2F2HA 3QLLA 4HZ8A 1WOBA 4DUOA 1HJUA 3OSPA 3WSUA 1XV8A 3S47A 4FOKA 4W93A 3TKFA 1SR9A 3TN4A 4GYFA 3GQCA 2HNHA 3M0MA 2WMFA 4B92A 1R2SA 4V33A 1J6OA 5FF4A 1A5UA 4FIQA 4EPDC 3LHUA 5DQGA 1LZOA 2XPKA 2WVTA 3PBVA 1CXHA 3GW0A 3GHUA 3N17A 4QWCA 3F4DA 3MDWA 2EAWA 4N9BA 1FDZA 4L80A 3QYQA 1D3HA 4HA4A 2V4QA 3MKCA 3WL1A 1AD4A 2YB4A 3A12A 4H8NA 1XIHA 5LIXX 2EPHA 3W84A 1WB0A 2D23A 2VC6A 2W66A 2FKPA 4GC6A 3UA4A 5CH9A 4F0KA 2PP3A 3JS3A 3LMYA 4K36A 3TC3A 2QCNA 4HHHA 3S9ZA 1UBPC 1KBKA 3HPSA 3EWYA 4PTDA 1Z9AA 3WMCA 2C1IA 4UR9A 2Y7EA 3WJWA 4F0RA 4PMRA 4YYFA 4JFTA 1CBGA 4L9YA 3E2QA 5DELA 2CIPA 4CKQA 2H90A 1KW1A 1Q7ZA 2PUZA 4H83A 4LX4A 1QU4A 1J12A 1M3UA 4LVDA 3Q45A 1NJJA 4EOUA 1XLIA 1K9EA 1TWSA 2DIKA 2P0OA 5ABEA 3QC3A 3P14A 3XINA 4MNLA 4GX9A 1AW1A 1XLKA 1EQCA 3Q2DA 3N3MA 1F8IA 2X05A 1IT7A 3OYZA 1RHCA 2J13A 1TX2A 2F38A 3QHNA 5AHIA 3H26A 4R8UA 1C90A 3THAA 2NT1A 1U33A 3FGCB 3TLLA 1H0GA 4Z1BA 1D3GA 2DQXA 3MKVA 4BFAA 2FZBA 3SO7A 1V6VA 1MFUA 4QFUA 5C9UA 4LYPA 4AISA 2J77A 1J93A 4BWLA 3MHFA 3LQGA 3QFWA 4KGJA 4NYUA 1EDQA 2OJPA 3N15A 2JALA 4ECQA 4LNCA 1K3UA 3W70A 4ACZA 3CYJA 3VKDA 8RUCA 4O3OA 4OT7A 2OZTA 3VD5A 5LGZA 1S39A 1A80A 2EPNA 3P74A 4QDWA 2PS2A 3S2LA 1XM3A 1PE1A 3L7RA 4NHVA