2AQVA

Crystal structure of e. coli isoaspartyl dipeptidase mutant y137f
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
389
structure length
374
Chain Sequence
MIDYTAAGFTLLQGAHLYAPEDRGICDVLVANGKIIAVASNIPSDIVPNCTVVDLSGQILCPGFIDQHVHLIGGGGEAGPTTRTPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRALNEEGISAWMLTGAFHVPSRTITGSVEKDVAIIDRVIGVCAISDHRSAAPDVYHLANMAAESRVGGLLGGKPGVTVFHMGDSKKALQPIYDLLENCDVPISKLLPTHVNRNVPLFEQALEFARKGGTIDITSSIDEPVAPAEGIARAVQAGIPLARVTLSSDGNGGVAGFETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMTPELRIEQVYARGKLMVKDGKACVKGTFET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional significance of Glu-77 and Tyr-137 within the active site of isoaspartyl dipeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Isoaspartyl dipeptidase
total genus 131
structure length 374
sequence length 389
chains with identical sequence B
ec nomenclature ec 3.4.19.-:
pdb deposition date 2005-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2aqvA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2aqvA02
5LXXA 1A5OC 1FWFC 1XRTA 3ORWA 3IV8A 4KEZA 5HMEA 4IFKA 2BB0A 1E9ZB 3B40A 4CQCA 3GIPA 2VC7A 4C6NA 4DNMA 4F0SA 2EG6A 1FWDC 2Z00A 4KIRA 2HNHA 2RAGA 1V79A 4EPEC 1RK5A 4GY7A 2AQOA 4IFRA 3PAOA 2Z2BA 4HK7A 4H9YA 1EZ2A 4L6DA 2A3LA 4UBPC 2GSEA 4C6QA 3RHGA 4C5YA 4IG2A 4E3TA 2R1MA 2UBPC 4C65A 3SO7A 2O4MA 4LAOA 5HMFA 3WMLA 1RJRA 2OB3A 1UIOA 3E74A 1KRMA 3GIQA 4R7WA 3NURA 4UB9A 4KEUA 3OVGA 4IF2A 2ADAA 2I5GA 4PCPA 4B92A 3CAKA 3MDUA 4C6DA 3A3WA 4C6MA 1NFGA 4C6OA 1R9ZA 1FWEC 2GWGA 3IPWA 4C6FA 2AQVA 3T81A 2WJDA 1POJA 3HPAA 4LCRA 4GOAA 2R1KA 3S2JA 4MUPA 3UR5A 1EJWC 4WGXA 4H9MA 3LSCA 2PUZA 1YBQA 1J6PA 3GTIA 4IFOA 4XAFA 1FKXA 2D2JA 4LAKA 3DC8A 2YXOA 1XGEA 4H9VA 3N2CA 4C5ZA 4QTGA 3LU2A 4HA0A 2R1PA 1FWBC 4BY3A 4CQBA 5E5CA 2AMXA 3F2BA 5HMDA 3SFWA 1FWCC 2FTWA 3QY8A 3EWDA 3E3HA 4KF1A 2OOFA 1FWHC 1KCXA 2Z25A 4GYFA 5A6TC 3PANA 3DUGA 4DIAA 3DCPA 4H00A 4GX9A 1KRBC 4P5UA 4PBFA 3MJMA 3A3XA 2Z24A 4JOMA 2Z27A 3GTXA 4C6PA 3UPMA 3GTFA 3URQA 2QT3A 2ANUA 4D8LA 1J6OA 3OOQA 2Z2AA 1A5MC 2GOKA 2Q01A 2Z7GA 2OGJA 3URAA 1ITUA 1UBPC 3LGDA 1EJRC 4ERIA 4DLMA 2VC5A 3RCMA 2HPIA 4KERA 4IH3A 4V1XA 4LANA 4KETA 4DZHA 3IGHX 3K5XA 3HM7A 1M65A 3IJ6A 3E0FA 4RE0A 3IARA 4GZ7A 4H9ZA 2E1WA 4IGMA 4QSFA 4C6LA 4HK6A 2Z29A 4XAZA 2R1LA 1GKRA 1NDWA 2P50A 4NP7A 1WXZA 1V7AA 1GKPA 3E0LA 1JGMA 3MSRA 4B91A 4EPKA 4CNUA 2YZ5A 3TN5A 2Y1HA 4RDZA 3URBA 2YB1A 3ID7A 2WJFA 5FSDC 4PE8A 2ICSA 4EPBC 3OU8A 2VHLA 4AC7C 2PGRA 3TNBA 2GZXA 4NI8A 3WYZA 5FSEC 2FVMA 1FWGC 1S3TC 4Z42C 1RA0A 3LY0A 1YRRA 2WM1A 3D6NA 2E25A 2D2GA 1PTAA 2Q09A 1PB0A 1E9YB 4IFKB 3GUWA 1ADDA 2OODA 4IQJA 4AQLA 3FDGA 4WHBA 2BGNE 5AKQA 4CNTA 1BF6A 3F2CA 5G4HC 4WVXA 4EP8C 4G7EA 4I6KA 2VUNA 4C60A 1EYWA 3AU6A 1DPMA 1W1IE 2O4QA 5CH9A 4CEXC 1ONXA 1A5KC 1PSCA 4XD4A 4LH8A 4DO7A 2CZVA 1P6CA 3RN6A 4QROA 2OQLA 2EG7A 1ONWA 3LNPA 3S4TA 4H01A 4H9UA 4DI8A 3LA4A 3T1GA 2P9BA 3S2NA 3K4WA 3GTHA 3PNZA 3OODA 3OJGA 4LALA 1EJVC 2GWNA 4IGNA 3AUOA 2PLMA 1K6WA 4CEUC 1XRFA 2HBXA 4ZSTA 3QY7A 3PBMA 4XAYA 1WXYA 4ERAA 3LSBA 3MDWA 3K2GA 3B0XA 2HBVA 3TN3A 4RDWA 4LFYA 3O0FA 4ICMA 3GU2A 2D2HA 1O12A 1FWIC 4GC3A 1J5SA 1RAKA 1FWAC 4KESA 4GY0A 3WZ0E 4F0LA 3GU1A 4XAGA 4J5NA 3S2LA 1YBQB 4C6EA 3IACA 1KRAC 4HK5A 1KRCC 2XIOA 4H9TA 1V4YA 4B90A 3F2DA 2QS8A 1M7JA 2FFIA 4H9XA 4QS5A 3QGAC 3QY6A 4C6CA 1RJPA 2G3FA 1YNYA 2WJEA 2FTYA 3IRSA 2W9MA 2VM8A 4DYKA 2YB4A 4J35A 4GBDA 1NDVA 1R9XA 4C6JA 1QW7A 3GG7A 4ERGA 3R0DA 1J79A 2Z26A 1POKA 4LEFA 4NG3A 1EJTC 3MKVA 1IE7C 4GX8A 1M68A 4XD5A 3UBPC 2I9UA 4C6IA 4C6KA 4XD6A 3KM8A 4QS6A 3S2MA 3FDKA 3FEQA 1QXLA 2DVTA 4M51A 3C86A 3MVTA 2IMRA 3HTWA 1YMYA 4G7EB 3V7PA 4KEVA 2DVXA 4RZBA 4GK8A 3URNA 1XWYA 4B3ZA 4LCSA 1EJSC 3A4JA 3MTWA 1YIXA 1HZYA 1PO9A 1ITQA 3RYSA 2PAJA 4QRNA 1UMLA 4F0RA 3T8LA 2KAUC 2VR2A 3OQEA 1RJQA 1GKQA 4IG2B 3F4CA 2PGFA 1O5RA 1RK6A 1EJXC 3G77A 4I6VA 1NDZA 4OFCA 4DZIA 1UIPA 3E2VA 1FWJC 1A4LA 2R1NA 4YIWA 1A5LC 3AU2A 4J2MA 2F6KA 4RDYA 1K1DA 3BE7A 3LGGA 4DI9A 3NQBA 1P1MA 4XD3A 3EGJA 4HJWA 1V51A 3ICJA 2HQAA 1A5NC 4TQTA 3PNUA 2FVKA 3NEHA 3MVIA 3JZEA 1I0DA 3TN4A 1VFLA 2ZC1A 3CS2A 2EG8A 1ZZMA 4RDVA 4L9XA 4PBEA 4EPDC 4DLFA 3CJPA 4PCNA 4R85A 1EJUC 4BJHA 3UR2A 3QGKC 4GXWA 3F4DA 3ITCA 2Z28A 4LAMA 3LS9A 1RA5A 2QPXA 1I0BA 3GU9A 3ISIX 3E38A 2HPMA 2Z4GA 4BKNA 2P53A 1A4MA 2QVNA 4LCQA 1FKWA 4CNSA 4R88A 4ZSUA 1P6BA 4INFA 4GY1A 3UF9A 4KQNA 1V77A 2UZ9A 3EWCA 3B0YA 1EF2A 4CQDA 4C6BA 1K70A 3MPGA 1NDYA 3O7UA 3GRIA 3TN6A 4V1YA 2DVUA 3GGMA 1R9YA 4G2DA
chains in the Genus database with same CATH superfamily
3RB3A 4JD4A 4NZCA 1XRTA 4ECVA 4IMAA 2XINA 2BB0A 1UZHA 4B5NA 1EC9A 3T0TA 3UJSA 2QV4A 5AVNA 3A5FA 4AEFA 2BQ3A 4WEVX 3CUXA 4EPEC 3PZIA 3TWBA 1P43A 1KGUA 2Q71A 3PAOA 4GFIA 2MANA 5L1KA 3CM4A 3EB3A 1OZQA 2YLAA 5CCZA 3KOXA 4PBGA 3UY7A 2JF6A 3MSDA 2GSEA 3SQMA 2NT0A 3R79A 3G24A 1MUMA 3NL5A 3N17A 3V6HA 3QXBA 4ILSA 3NQ8A 4I9AA 1LUCB 3IIZA 4ZGYA 1GQIA 1OD0A 2BODX 3GIQA 2NXGA 2PC8A 4FX8A 3WN6A 1Z69A 3SCVA 2WMKA 1XP3A 1WZAA 5FA5A 1C9DA 4PCPA 1LL7A 2JKPA 4WGHA 4NZJA 2V69A 3BO9A 3W7JA 4C6MA 4C6OA 4IMEA 1Y5WA 1LBMA 2GWGA 4QG6A 3TK7A 1XW8A 1LG2A 3HPAA 3OW1A 4ZO7A 2ZADA 4UTIA 2BXZA 1Z9AA 4FB7A 1KO0A 1YBQA 2E8ZA 1NOWA 3E2SA 4MJ2A 1VJSA 3N9SA 3VA8A 1D7FA 4LAKA 4GQRA 1VPXA 3EYPA 3KUMA 3WLRA 1L0PA 1XH1A 3SCRA 3CYJA 4GC4A 1FH7A 3MKCA 1EGMA 5DXXA 1LT7A 3WQCA 4DJEA 1XCXA 3TJXA 4KCUA 3OTRA 1R30A 1EIBA 4FS2A 5D9NA 4MPKA 5KFIA 5C7VA 1KFEA 2VURA 4DRSA 1GOMA 3QMTA 2HISA 4H00A 4PUJA 2DORA 4EBCA 2P76A 3BW3A 2DUZA 2AOSA 1W8GA 4K37A 1OIFA 4JX6A 1I45A 1PDZA 3O07A 3QR3A 2ZRXA 4Q4OA 3W27A 4WY0B 3MY9A 3QZ8A 3HG4A 3B05A 4DWDA 5I3JA 1B54A 5KFAA 3M6YA 4F79A 2OGJA 3LCIA 1DTUA 4QJ1A 4G9PA 3GNDA 4W8AA 4ERIA 2OZTA 1OQFA 3C56A 2VZTA 5CSRA 2XPKA 4KERA 1TYGA 3UETA 2QAFA 4U4MA 4OBSA 4BF7A 2E6FA 2GK1A 4CU7A 4D6HA 3ZSTA 3V6KA 2DZTA 3GM8A 2YBUA 4ZVJA 2XN1A 2D20A 2VR5A 4C1LA 5E93A 3BQ1A 5JH2A 3RILA 3WK2A 3ENLA 3RO8A 4JYEA 2D0GA 3TU9A 2HZGA 1IWAA 3W7KA 1SSDA 1Z48A 5A2AA 5REQB 1SSGA 1S9FA 3G1YA 4DL4A 2FHBA 1FQ0A 3A21A 3QZAA 2XVNA 4JQ4A 4IQDA 3W7LA 1E3XA 4MB3A 3LV6A 2XUCA 3AHXA 4GH1A 1HJXA 3IVTA 1NJJA 1E9YB 1J0KA 3HF3A 5JXQA 1E0TA 1FTXA 4JFWA 5LNVA 4FXJA 3O6CA 4EK7A 3MT1A 3AHYA 4A2RA 1GJPA 3WD3A 4NSBA 3VIOA 3WG6A 5KFZA 2YR1A 4XD4A 4DO7A 1K7EA 4JHZA 2PDBA 4GC7A 3M16A 2OZ0A 4AIOA 3ZLFA 2POTA 3VDHA 3KE0A 4B5VA 4ENLA 3STGA 5H8PA 2P5NA 3OBEA 3PBMA 4WSKA 2H9AB 5DX7A 4ERAA 1TMLA 2OPJA 1QR7A 3KCOA 3AHTA 2V5JA 2X1TA 2CZ5A 1ZHAA 2WW5A 4PUDA 3RU6A 3UXLA 4O3NA 4H8VA 4GQQA 1H63A 1U33A 2ABBA 2QNEA 4B3KA 4O0ZA 3PFMA 1KRCC 1WXJA 4QW9A 4KRTA 2CLOA 2QUNA 3ARXA 2OCZA 3H70A 1REQB 4H9XA 1QO5A 1CBGA 3P74A 1XQKA 2GVEA 4EAYA 1KM3A 4E8CA 3LRMA 3IJ8A 4E2VA 2YFOA 4AD0A 4O0QA 4ZFCA 5CPTA 2YB4A 1Q4NX 3WD1A 1KLZA 2W7PA 3SGZA 1J79A 2CNCA 3VD7A 2X09A 2HMCA 2Y70A 3PJXA 4I7VA 4W89A 6TIMA 1F6PA 3ZVHB 1B31A 4NYYA 2DQWA 4G7EB 3C0LA 4EXAA 5HBFA 4RZBA 3GC2A 3N73A 3FIGA 4B3ZA 2ZWZA 3A4JA 4JS3A 3WQ8A 1N8FA 4HPNA 1JUEA 2CHOA 4HSNA 1RQBA 5IDZA 1GW9A 3GXTA 4NAFA 4S3DA 1L6YA 4P8XA 4TQSA 1BYBA 4PA8A 3CL6A 4J2MA 4O19A 2J7DA 1XLLA 1XYZA 5C9XA 2GVLA 3PZQA 2O56A 3CUHA 2IPGA 2BLEA 1BVWA 1QI5A 1D9EA 3P61A 4H6EA 4WJ8A 5BMXA 1XL9A 3C0JA 2W5FA 3VGEA 1H7PA 2E9MA 5E09A 5KFTA 2FHFA 3LERA 4GXMA 1S3HA 1T7LA 1B5TA 4P7RA 3QGKC 1S2TA 2X1RA 3MB9A 2YL5A 2ZUSA 1I0BA 5C8BB 4PMZA 1YADA 3NDZA 1JYXA 1XDLA 3TTSA 5ABTA 3MR6A 3NQCA 4D6IA 3DHDA 4UIOA 3PB0A 1Q6GA 2J62A 4O3QA 3LYEA 3U2ZA 4HOXA 2VA3A 1YPFA 3P14A 3GG0A 5DRIA 1A53A 2X7WA 1V02A 2V2DA 3BSHA 2A4AA 1JXLA 1E4LA 5C55A 2BS9A 1XIBA 2QR6A 3VNLA 4C6NA 1UP2A 5EMMA 2Z00A 3B8TA 2RAGA 5A6LA 1T5AA 2F38A 1KM2A 1IEVA 1E0UA 2AQOA 1I1WA 5FAJA 4JIHA 3C52A 3LBMA 1V02E 3OYZA 1EZ2A 1M3UA 4HD5A 5T91A 3BSGA 4AIUA 2WKGA 2DDXA 3GR8A 1HO1A 3OZMA 4PL2A 4R7WA 4UXDA 2C91A 3O2LA 4RNFA 4O1FA 4ZQNA 3IJ9A 3MDUA 4O54A 4ACYA 5HR7A 2G3JA 1TPH1 2EJ1A 3MUCA 4M19A 5CGQA 1E73M 3W29A 1S2UA 2AKZA 5EPDA 1U30A 4DL5A 2IQ0A 4DVOA 4DUVA 1W1YA 4MJZA 1IF2A 4RCXA 3H21A 3K8LA 3QHMA 1TTQA 4OV9A 4DJEC 4HHHA 1G6CA 5SWUA 1P0DA 4S23A 2WLZA 1FKXA 2ZRWA 5K4XA 1H1YA 3M41A 4K7YA 1JCNA 5DCDA 1LRTA 5FJRA 1RYRA 1E71M 4QE4A 5E5CA 1M5WA 1FWCC 3DI1A 4Z2JA 5K4ZA 1SZNA 1VFFA 3C0QA 5LNRA 2ZTJA 1TR9A 3LPFA 4P8UA 1FX6A 2BFGA 2HEJA 4GI9A 1SMDA 1WB0A 3TDFA 5H91A 4Q8NA 2Z24A 3N18A 3TUUA 4OBTA 4JEQA 2W62A 3T08A 3SZ8A 4S3JA 1YDNA 1VIZA 2TYSA 1TTPA 2V0TA 2QUTA 4PFMA 3HQNA 4RZ6A 3EPGA 4J4KA 2PI6A 3PULA 2OT1A 3QZ7A 1VFTA 4RK8A 3TFCA 2HPIA 3QPEA 4LW7A 4AC1X 4GRSA 3CUFA 3SURA 4ICCX 2H9AA 3CEPA 1OF6A 4IQLA 4TXEA 3RPDA 4AY8A 4IISA 5C71A 2VOMA 1M65A 3ITYA 4JTRA 1M6JA 2H90A 3GKFA 3PZUA 3N4AA 4OE7A 1E4MM 1P5BA 8A3HA 3WJWA 5K7JA 5ABHA 3RB4A 1HVQA 1GKPA 2VGGA 2WC7A 4JQAA 3VOGA 3DGBA 1H1NA 4H8HA 3TTEA 1REQA 2B81A 1B9BA 1GOXA 4XVEA 3VE9A 5AHLA 4RDZA 5BU6A 2FYMA 3K4AA 3GHRA 4RLIA 3OIXA 4U31A 2R8IA 1EQCA 1NVMA 4QWCA 1CXLA 1P48A 4K8HA 3FKKA 3QPZA 1MWOA 5KZEA 4Y6GA 1NWTA 3C8NA 3NQDA 4JDBA 2NV9A 2L5HA 4NZFA 2JGQA 1J01A 3WBYA 1WUFA 4KEMA 4Z0SA 1MUCA 2CHNA 4FXRA 3AU6A 5CSSA 3T09A 3EOUA 4J3WA 3ES7A 1W1IE 4QR6A 3OHBA 1ZETA 1BEUA 1ONXA 4OECA 2DP3A 2V30A 4HBKA 2B0MA 1DE5A 2DIKA 4PTNA 1SO5A 3ABOA 1OK6A 1AH0A 4G7FA 3L12A 4UZUA 4B5UA 2YBVA 1PKYA 1NEYA 2OQYA 4Z1YA 2A3HA 1NP2A 4HYWA 3LX9A 3OODA 2A3CA 4RV3A 3S0CA 3I10A 1A5SA 3W1TA 2V38A 3TE9A 2NW0A 1F3XA 2Z2UA 1H0GA 1WCGA 4D6DA 3TN3A 2ZX7A 3EWYA 4W86A 3ANVA 4IP4A 4DJED 3GU2A 2FLNA 2J25A 1AD1A 3SIZA 4S2CA 4AB4A 3W85A 1TPUA 1GEHA 4CU8A 4UQBA 1ZY9A 1V4YA 3ITVA 4W5ZA 1W5QA 2OYLA 2NXHA 5LSMA 4F3HA 5BOEA 5A6SA 2R8KA 2G3FA 2IPJA 2V5LA 3KBWA 3HJZA 4O1EA 4H7CA 3NQ6A 1JI2A 3ABXA 2BY1A 4FR6A 4YNGA 4GBDA 2JALA 4XZBA 1B3XA 1Q8AA 1K03A 2FMOA 2PCEA 5DEZA 5CZSA 1DWHM 3CV1A 2V8ZA 1KM1A 3DU0A 4C6IA 5BWAA 4XV0A 1IR2A 4QS6A 2XIIA 2P1FA 3MHUA 2GUYA 5XIMA 3GBEA 2DVXA 3TOYA 2DY3A 4BQ4A 4GYKA 1HJUA 4HPXA 4URIA 2ZDRA 3VKCA 4C91A 2IQTA 2IXUA 3DERA 1EJXC 3ZSSA 2G4FA 5I0DA 1Q3NA 4E8DA 4FX7A 1FWJC 3KOFA 1PHWA 2WMHA 3LBOA 1K1DA 4RDYA 4DI9A 6XIAA 3EGJA 1TV7A 3EDDA 1E6PA 1A5NC 4ZQMA 3W2KA 4GYJA 5H8UA 5KFOA 1WKDA 5CPLA 1GVSA 3UT0A 2XVGA 1A5BA 4L9XA 1FDZA 1NU5A 3TEVA 3VGFA 4F4WA 1XX1A 3LS9A 2BMBA 6A3HA 4DF2A 1S5MA 1I8JA 2FFCA 2ACQA 3MU7A 4QLLA 1A4MA 4UNKA 2ZRZA 3QLDA 1P6BA 2UZ9A 1S5NA 3IJQA 2EPOA 4IPNB 2FH6A 1ELSA 1SGJA 1ICSA 3WQFA 3PAJA 1XIJA 3ARTA 3LTYA 2A7NA 4PRTA 1X6LA 3E1F1 5LXXA 1S10A 3BQ6A 1PUDA 3OIHA 4UTJA 2QEZA 1F2JA 1TE6A 5G1MA 4PB3A 4DB7A 4MTVA 3CQIA 3MKKA 4MB1A 5HUOA 2IPFA 1FWDC 1V79A 2AGKA 3WCZA 1RK5A 3BMVA 1JZ5A 5C2GA 4RE3A 5CBIA 3G1VA 4UTWC 4BA0A 4LYPA 3ARSA 4C6QA 4ECLA 5KFRA 1Q85A 5D05A 3KZSA 2Y4SA 1KRMA 1JULA 4QSHA 1JYWA 4IF2A 2ADAA 4OU1A 3ABSA 4K8GA 2RDWA 4PCFA 4C6DA 2SFPA 2QIWA 3N29A 3FDSA 3PG9A 3QVQA 3KDNA 1FY6A 1TO3A 2HXUA 4ZXOA 4DAFA 4K36A 3N6JA 4IOTA 3UXAA 4GOAA 1AQFA 2EHHA 3LPOA 2PDKA 2ASDA 3F4VA 1QCWA 1OSEA 2PTXA 3BW4A 2WHKA 2V9DA 4C5ZA 3LDVA 3AMKA 2V3DA 2VVSA 2CETA 4LAZA 4NZ5A 3DZ1A 2BXVA 2A6NA 4P7LA 4KT2A 4YTRA 2XDFA 3GNPA 3B0VC 5AHNA 3G3DA 4HT3A 2CBJA 2J8TA 4OJYA 2GGJA 1S5WA 3UEQA 4TOQA 1OGBA 1XGDA 1FVPA 1RALA 3PHAA 4MNKA 4M29A 2R94A 2E67A 1U5VA 4FO4A 1AMYA 2Z6IA 2DW7A 5FL1A 1V3JA 2Q01A 5CZKA 2PDGA 3R4IA 4YXGA 2W67A 2EBNA 2VGBA 2D3NA 3GH5A 3KTXA 1XRVA 1OCQA 2CPUA 1QNPA 2HV5A 2CZDA 4QX4A 3I3EA 1F73A 1PZ2A 4RUCA 2ZE0A 3M44A 1S0OA 2YOCA 3L5MA 2X2GA 1QNVA 2XVKA 1TJPA 3N12A 4GJJA 1TVLA 3UZJA 2VEMA 5DRCA 2RJGA 3O0KA 3NVDA 5HK4A 1M7OA 4HK6A 1M9HA 5I2UA 5GJPA 1IIGA 5J5RA 1VD6A 3NQVA 3R94A 5F2MA 1EKOA 1C93A 1E6QM 5KG6A 1PV8A 4NRSA 3I6TA 1CXFA 3ANYA 4DWSD 2B31A 2WWDA 4L1GA 3LQLA 2NVAA 1TKKA 3MP3A 3CV2A 3QQWA 1R46A 3ALGA 4ZENA 3P6LA 3WK1A 1VP5A 5A6AA 2FKPA 1XBXA 5DBTA 3UWVA 3GUWA 4Q4QA 3VNDA 3V1HA 3GB6A 3ZVIA 3BUVA 1OGGA 3T4CA 1E56A 4I8DA 1IHIA 4EP8C 1PE1A 1KBIA 4ML4A 4HYRA 5I03A 1B3WA 4AMAA 3BCDA 4MZYA 7A3HA 3VDBA 2XVLA 1JQXA 1SPQA 5H1WA 2E28A 2OQLA 1ONWA 5BCAA 3WUBA 4ZQPA 4DEZA 4H9UA 2VEIA 3QYQA 3FEMA 1JX4A 4M82A 4M7SA 3V35A 2PLMA 2NQ5A 4L80A 3N9KA 2BOGX 1IGWA 5DMLA 2NUWA 3DYOA 4XBKA 4DWSB 5TIMA 4JNZA 1TA3B 3TOPA 5D04C 4QBXA 4S3BA 1DEDA 3OLEA 3Q45A 4KESA 1EDTA 4J9KA 4NILA 3AXHA 5MF5A 3BCFA 4G3IA 1I2PA 4AF0A 2GGIA 1DXEA 3IACA 1KRAC 3BG3A 1VHCA 1MUWA 1U5HA 2XH0A 4GI4A 2FFIA 1JIBA 3N3TA 3HGOA 5C5YA 1JL8A 4G1KA 1JZ3A 3H2OA 3IRSA 3LHUA 3CZ8A 3CPGA 4GYPA 4XISA 1LQ0A 3EXRA 3WBEA 1JIHA 5KFYA 4JZ5A 1JI1A 3O05A 1YNQA 4JUZA 3MKVA 2Z1SA 1D7KA 3WF3A 1DYSA 3MC5A 4OUIA 3OBAA 2QPSA 5D9OA 4U3CA 2E5DA 1KKRA 1IGSA 1JUKA 5HULA 1T8QA 3T8QA 3HZ3A 3LXCA 1EQPA 4O1CA 4WZHA 4Y96A 3W38A 3OGVA 3GILA 3NSMA 3GVRA 3HQPA 4G6CA 2RDUA 5CJMA 4HIBA 4BI6A 1UIPA 1DQWA 2OEKA 4FS1A 3AU2A 4H7VA 2ZZ6A 3S5YA 1G67A 5I3KA 2J79A 4Q8MA 1YTDA 2ISFA 3TW7A 2WCAA 4KCWA 4UOJA 3TN4A 2NX9A 3W2NA 4QW8A 2FZMA 2ZC1A 3VMOA 3CTLA 3CB8A 1GCYA 1ME9A 1K9DA 3DFQA 4DLFA 3HPFA 3CUJA 2W9AA 3RF9A 3S3GA 5AN7A 3T5HA 3PJWA 2WMJA 4NHVA 4UFHA 2HPMA 1L6GA 5E1QA 1FHUA 3RX4A 3GUGA 3EKLA 3EZ4A 3EWCA 3CT2A 1HO4A 1LQ2A 1TPB1 4GVGA 3G1DA 4CQDA 4Q8OA 2BTMA 5C5JA 4Z1CA 4HZMA 2V81A 4CN1A 2CEQA 3C2RA 3ORWA 3ZJ7A 1DBTA 1TWIA 1IIHA 5D8WA 3GIPA 3AYTA 5LNWA 2WB5A 4A3UA 3TZFA 2J6VA 5F2GA 1TUFA 2EG6A 1Y7VA 3P67A 4DN1A 1NH6A 1BLIA 2VDIA 4RXFA 1ITXA 1K1SA 3EPIA 3O6AA 2ZUTA 2LLEA 5MKGB 3CWNA 2NLIA 2D1ZA 5C7HA 3IANA 4HCLA 4B9YA 5JBFA 1OGSA 4XKMA 3I3BA 2OH2A 1KD0A 2R1MA 3D47A 5CC7A 2GJPA 3PZTA 3GW0A 3WD0A 1D3CA 3VX1A 3WLMA 3TX9A 2FIQA 1C8VA 1ZALA 5HQEA 3ZT5A 3DYPA 4PMQA 3BJYA 4F4ZA 3A13A 1NFGA 1JPHA 4AZIA 1RY0A 3VAVA 1FWEC 1BWKA 2DPIA 4C6FA 4ROPA 4TX6A 4IMCA 3W24A 4L1XA 4HGXA 1OBAA 4B5TA 3KBNA 3H22A 1Q6QA 1JXJA 3WEZA 4Y90A 4DWSC 3QV8A 2WC4A 2E3ZA 1RVGA 1NF0A 1FHVA 2WZHA 4O0KA 4PFHA 4ZOAA 3UJRA 2I16A 3NQAA 1VBGA 2RH9A 2OGYA 3BJSA 2H3DA 1CX9A 5TQLA 2DZAA 5HWJA 4X9SA 1KKOA 3H12A 1GG0A 4GYFA 3QC0A 3ANUA 4OOUA 3DUGA 3WDPP 1DWJM 4HNOA 4JPGA 4PBFA 4IHCA 1UKSA 1CYGA 3TFXA 1NWUA 3R43A 3L0NA 2HVOA 1VR6A 1HL8A 3WIJA 4DM1A 3RJYA 4ZEPA 1ZL1A 3ARRA 1RCOB 2VCBA 2B7QA 1GYMA 3AIRA 3AJ7A 1R8LA 4HU0A 4W87A 1BGAA 5U7SA 4DWSA 3VD3A 2Q8LA 3KCJA 3L2LA 5FF0A 5IM51 4C6LA 2YXXA 4XAZA 3KVLA 1UWIA 4FXFA 4AMCA 1MVYA 2Y5JA 1J2WA 3AHZA 3PWAA 3EOSA 4HMEA 3URBA 5FSDC 3NAVA 2DZVA 2VHLA 1OYBA 1G4SA 2YCKX 1Q8JA 5BU9A 1A3HA 4H3DA 3VUPA 4UTTA 3GAYA 2DH2A 3D6NA 4HJFA 1QTWA 1C29A 7PTDA 3OSPA 2XGBA 3IIOA 1TJ2A 3W26A 1JDFA 1TTJA 4LVGA 4Q32A 3HU7A 2DQXA 2CLKA 3VABA 4QITA 1R3VA 1FWWA 3POCA 3PUGA 4C60A 4AY7A 3SCNA 4IMGA 2A0NA 5LHFA 4CNNA 3UXDA 4S3EA 3W70A 5ENLA 2PDFA 5A1AA 2JEPA 4UWMA 3T0BA 5A6JA 3AUJA 3DDMA 5I3FA 3G0UA 1U2YA 4LS2A 4LS0A 3ZR5A 3O3RA 4NU7A 3USBA 2V5KA 4IP7A 3NYDA 3WNMA 2W0UA 4LV9A 1BTMA 3RBEA 3S2NA 2Z1BA 5BOFA 3PW4A 3PNZA 4GNJA 1GOWA 1N82A 3AUOA 3LHVA 4M81A 1NM9A 2C2DA 1UKTA 1CT5A 5FF4A 1Q4WA 4XAYA 3PUEA 1U1JA 3WLKX 4AZCB 3TQKA 3T4WA 1TPWA 2QQ6A 3C0SA 1JG9A 4JQ1A 3NWRA 4MADA 1RYSA 5C9ZA 4HMNA 4D6GA 4GC3A 5CBBA 3KVMA 3S2CA 4LNCA 2HVMA 1KXQA 3WSUA 4K38A 2RDTA 2A2IA 1ECQA 3NO5A 4HOZA 3VCNA 3U2EA 2P88A 2QS8A 2WKLA 2R6OA 2VL4A 1M7JA 2BQUA 1WDDA 2J7HA 2J74A 1Z6KA 3WUGA 2VX4A 3G0XA 4AYSA 3A5VA 3TA6A 1LOLA 3EWWA 1UH2A 4DHGA 4HPGA 2Z26A 2C6QA 4E4FA 4AHOA 3MSGA 3KOWA 4JKLA 4XD5A 4QDMA 5KG4A 2VRQA 3YPIA 1LT8A 3S2MA 2CYGA 1JCJA 3FEQA 2DVTA 3STCA 5ABFA 3VM5A 1K1QA 3HTWA 3VTRA 3DBNA 4GK8A 4IR9A 3SCSA 4PUEA 1JYNA 3RR1A 2OOGA 2B7NA 5D32A 2TMDA 3IRDA 3ABQA 3RG6A 3SRHA 1YIXA 3W7GA 3EDFA 3W76A 1B57A 2XN2A 4QRNA 1UMLA 4WK9A 3CL7A 4ATDA 4XX6A 1EWEA 3F4CA 4Y9MA 2PGFA 2WHJA 4YR3A 1XBZA 1KFWA 1ALDA 4CD8A 4MYXA 3RFAA 1AH4A 4GGBA 3VOFA 2QJIA 3M0JA 2IS7A 3GXNA 2X42A 5LNSA 8CGTA 2C2RA 1IM4A 4U10A 2WZTA 3LXAA 1TE1A 1UOZA 2BVYA 5D2XA 2E68A 2X2YA 4BQ5A 1TRIA 3KLKA 5EMYA 5I6SA 2J7EA 3RGTA 3O06A 3M0HA 3TR9A 1XDMA 1VBHA 1R3QA 3OLIA 4X2RA 3D0CA 4GFSA 4Z17A 4O3SA 3Q65A 2XGPA 3WBAA 3O16A 1W9BM 4DO4A 3FK4A 5D9PA 4R88A 3WJZA 2V5CA 4HN8A 4AVNA 3M6DA 4YTQA 1G9HA 1QDSA 4AZ7A 4O28A 1OHLA 2G95A 2HK1A 3TN6A 2DVUA 3L65A 5D02A 2FQIA 3NUKA 1CGVA 1TMHA 4DF0A 1EX1A 4BI7A 3RLUA 4O53A 1ZP4A 3I65A 4L56A 5C9UA 1UR1A 1DJQA 4U2ZA 1BD0A 1XD0A 4X3ZA 1R2SA 4ZMGA 3ZVHA 2WVVB 1AMKA 3HPZA 3S46A 1E9LA 4N2YA 2F84A 4RNOA 4J9RA 3V16A 3CB3A 2PGEA 4UZSA 3N3MA 3S5ZA 5AC5A 5FJJA 1LORA 3WLJA 3UJ2A 4CKQA 3L23A 4E3TA 3CWHA 4C65A 1Q66A 3MR5A 5D2YA 1JJKA 3WH8A 2QDDA 2GUBA 2ZA3A 1E1EA 2X41A 3CZGA 3NURA 5C6MA 3VCCA 2WWCA 4KWWA 3WDJA 1TCMA 4OZOA 3RBDA 2OLAA 3MWCA 3PG8A 3UPWA 4I90A 1C7TA 2XVPA 4PH6A 3EAUA 2Y63A 3R8GA 4HNTA 2VQUA 1DWFM 4X60A 1CWYA 4DXKA 2OVLA 3FNDA 2ZXBA 1V6WA 3B9NA 4UFMA 5LA1A 2FHCA 1DKWA 2H6RA 4IIGA 5KT4A 2VFIA 4P2VA 3U57A 4HMDA 4J3XA 2QMKA 3VIFA 4KRZA 1THFD 4BY3A 5BXSA 3QY8A 2PTYA 2GL5A 4E4PA 3WKZA 1E6SM 1TB3A 1BGGA 3RAQA 1WBHA 3W37A 2HRWA 5D9MA 4K8EA 1QHZA 1TV4A 2CKSA 4FNPA 4YJ5A 4HN4A 4M1RA 5DG9A 2DGAA 5DT7A 5IXEA 1LCOA 3GG1A 3L2MA 3LLFA 1TWZA 3ITLA 3MV01 4R8UA 3UPMA 2WNWA 4TX9A 5H2ZA 3H24A 4Q43A 1WUEA 3LB0A 1M03A 4XB3A 4AX7A 1QHPA 4PSRA 3GVWA 2VZSA 4YVXA 3AAMA 3AFBA 1M41A 4E2DA 2BSLA 3E9AA 2Y7EA 2ZRYA 1QI2A 5CAHA 1US2A 4C7GA 3B0UX 3LM3A 3OSNA 1IR1A 2Q6ZA 2VUYA 3H54A 4KCTA 2J7GA 1K8YA 3ME3A 4JNMA 4C1NA 3T2QA 4AZGA 1DP0A 3TLQA 4W8BA 2DIEA 3BAJA 4UUIA 3G1AA 2PDWA 1Q6OA 4ONVA 3BLEA 3TW6A 4MKSA 2NSOA 1DJYA 4ACZB 4ATLA 4QSFA 3HGRA 4O3RA 3VKJA 3GDRA 2Z6JA 1Q5MA 3HV9A 2ZZ5A 1PZ3A 4W7WA 4IRKA 3L2IA 1R0MA 4M7TA 5T9BG 3OU8A 1AODA 1TV8A 4AC7C 3MQTA 2V63A 4M80A 1SO4A 1TSIA 5EWFA 1W2PA 3VGGA 4ED1A 1KM0A 2PTDA 4KKXA 1XIMA 4AQLA 4YYFA 4W5UA 3BQ0A 1LBLA 2YPIA 3TQVA 1B9ZA 4UFIA 1MI3A 2FVLA 4ALDA 3V0TA 3DESA 1XI3A 1FP9A 3M0XA 4Z2LA 1PSCA 4IM4A 2G4JA 5K3VA 1G4EA 2B7PA 1VHNA 3GNOA 2OLSA 4JTHA 4TMBA 4H04A 4GINA 3VD9A 4PMUA 3B4YA 3O6DA 1Z7AA 3W53A 2O9RA 2V68A 3S9ZA 2GDQA 2HNEA 5AY7A 2OZ8A 2J9ZA 3SADA 3MDWA 3M0YA 2G3NA 4R5EA 4XUGA 3UGVA 1TQXA 3AXMA 1R85A 3WJSA 4KRUA 3MFHA 2HROA 4JKKA 4O12A 4LT9A 1HG3A 1FWAC 4JV1A 3WNLA 1XKYA 6ALDA 1UWQA 3T2OA 1YBQB 3VGBA 4BQ3A 4S3GA 4DJFA 3FLUA 2VMFA 1XLHA 3LK6A 3L67A 4G1NA 3WK0A 2R8JA 1ONEA 2GLKA 5IBXA 1BSLA 2XWDA 4QS5A 5REQA 2CLFA 1RJPA 1YNYA 4LC8A 1EXBA 4GUIA 4OOZA 4Q4SA 3W4RA 1SMAA 4RNNA 1A0DA 3N2XA 4P7OA 4GXPA 1S5VA 4UCFA 1TELA 4WOZA 1JAEA 1K02A 2VEKA 2PBGA 4F2TA 3G22A 2DU2A 3BOLA 1NELA 3OLDA 5F7UA 1VEPA 4JIPA 1VS1A 3KM8A 3ITOA 1QXLA 1XIFA 1K7XA 1LROA 4IIBA 1XH0A 4HTBA 3WUFA 4CQAA 3N04A 5CJ5A 3NL2A 5KFLA 1UBSA 4Q8PA 4HU8A 3V36A 2QCEA 3IGUA 3ARUA 3P93A 3LPGA 2EPMX 2EKGA 3IJ7A 2KAUC 4YR0A 1XG3A 5IFPA 3DG6A 3E2VA 1Q65A 1YDVA 4DJFD 1UW9A 3JRKA 1S97A 3FJ6A 2IBKA 1KGXA 2ZKMX 4HJWA 1S2VA 4MUZA 3P8IA 1R7OA 2CXGA 4TQTA 1KV5A 2VVNA 2ZXDA 4NY2A 3G18A 2IA6A 1KCZA 3VXGA 3PZNA 1XYMA 1TPVA 3ARVA 1V3HA 4UFJA 2PDXA 1FBAA 1YXYA 4S3FA 2QGYA 4NJHA 2X8RA 3PUDA 1RR2A 2BASA 4F2BA 4N9DA 4GKLA 3G8RA 3S6OA 2OO0A 4INFA 3M9OB 3K1DA 1E6RA 1NP0A 5EMUA 5KG2A 1VEMA 4C6BA 4Q6JA 1NDYA 1VRXA 9XIMA 3RAOA 1E40A 5EL1A 4HTYA 1Q7ZA 4G2DA 1HKIA 1B4KA 3MCMA 4J9QA 1WDWA 2WMIA 3GV7B 4B2DD 3ARQA 1A5AA 1G7UA 1ZFJA 4DO5A 4UQEA 3KEHA 1CXHA 2QGHA 4RNMA 4L61A 4KIRA 1FDYA 2Y2WA 4XO6A 3M0ZA 4WD0A 4GY7A 7TIMA 2YCIX 2CLMA 1N56A 3SN4A 3K13A 2Y89A 4DY1A 3E2RA 5A8OA 1UD4A 3RHGA 5KG7A 1QJWA 4EWND 5HJLA 3SO7A 5CGTA 1XR2A 2BVTA 4Z1BA 4FBTA 4EKJA 1TJRA 3QJAA 3G0SA 1V08A 3TNOA 1J11A 3WBWA 3FSTA 2JEIA 1UHVA 1W5PA 3C8FA 4R9OA 1E0XA 4BEUA 5ABGA 2KZHA 3TAKA 1X1ZA 4GCXA 3NGJA 3RJXA 1TTIA 2WJDA 1B3VA 1X97A 3LCWA 3S6DA 1TPFA 1EHNA 3H2MA 1HGWA 1J6PA 3N6HA 4QDWA 3LQGA 1LBFA 3WLQA 3T0CA 4JTLA 3L4TA 1X39A 4CD4A 4O18A 1JXKA 5T9CE 3S5OA 2PC4A 4IICA 2ZX5A 1BWLA 1EC7A 4MFEA 4JTGA 1YDYA 3OEXA 1RQHA 3UA4A 4XBJA 1C8YA 1UJQA 1GOQA 4UFLA 1ZAIA 3PN8A 5I3IA 1SQ7A 4QLKA 3NG3A 3T2PA 3GDBA 4W7UA 2O7SA 4XTDA 1AUSL 1C3FA 1VKFA 2CW6A 3NZGA 4QM1A 2ZUNA 4TVDA 2GOKA 2EO7A 4MF4A 1V6TA 1ITUA 3QOKA 1EJRC 4PL1A 3CLMA 3SUVA 1QI4A 5F4WA 3APYA 2QDEA 3BTNA 3R10A 4JNYA 4R9XA 3QYSA 3NDOA 2C0AA 2ZUWA 4M6VA 2HWGA 3T0AA 3GIYA 1BHGA 3M0IA 4EAMA 1AZ2A 2Y7GA 5LIYX 3INPA 1XBVA 4O3OA 4QCFA 4RE0A 3IARA 3FGCA 3P3BA 1IYXA 3PZPA 2DV0A 3G3MA 3WELA 4DJDD 3B8WA 3M64A 4CD6A 4HOWA 1WXZA 1J18A 3G6YA 2I1OA 3IK4A 4A8LA 4G56A 1UP3A 3LHZA 3H4BA 1ZBCA 3RLGA 4HHPA 4J27A 2CU0A 2C28A 3CQKA 3T05A 1GOIA 4ZQOA 3QLLA 1RH9A 3RITA 4RL3A 3DC0A 3I7SA 1RA0A 3WENA 1CB7B 1RP9A 3QKZA 4IFKB 1VIWA 5BRPA 4RJEA 2FZBA 1QNRA 3VZXA 4PZVA 3RB6A 3CMJA 1MQRA 3NVTA 4WJEA 3U3HA 5CSUA 4EEYA 1QI3A 4KCVA 4BWLC 1EDGA 1EUNA 4GNKB 3MYPA 1IEXA 1AZ1A 3II1A 3QPYA 2X7VA 1JEZA 2EAWA 1X96A 2CWXA 4MLJA 3GXIA 5KT3A 3KL5A 4S2BA 3NSNA 3PR2A 3WLNA 4H8UA 4O57A 5LYRA 1PWLA 2VJXA 2MUCA 5E6ZA 1KXHA 3QGVA 4H2CA 1PS9A 4ADUA 4A8RA 1WDQA 1JCTA 3VI2A 1KCKA 1T0OA 3AS1A 3UWEA 4ZQCA 2PU0A 1LQAA 2QVHA 1UH3A 3PSVA 3W81A 1OT1A 3M5YA 1PWMA 1XIIA 3CH0A 3TTYA 3JR2A 1DIKA 3VNJA 9XIAA 5DQHA 3T5JA 1WKEA 3P0XA 2W9BB 2W27A 4F9JA 3V6JA 4BK9A 3VKBA 1ZAHA 3PZGA 3AS0A 1CXKA 4NIRA 4RE4A 3N4EA 3EXSA 1GJWA 4MHBA 4PTDA 4N4QA 4GVFA 5B7YA 4NL1A 3ZOAA 5E6YA 4N6FA 4F4RA 2QV5A 2EPLX 2W7OA 1X7FA 3ONCA 4YL2A 2YL6A 5DCBA 3FDKA 4HZ8A 4Q22A 1H41A 4BF9A 2PLJA 3R25A 4WY0A 1VJIA 2X1IA 4ZCWA 1NWSA 3W1QA 3KHJA 4I9JA 4FA3A 1JFXA 1N8IA 1RP8A 1XRSA 5L1JA 4ECWA 5D2TA 3ZT6A 1PXGA 1D8CA 3R2GA 3C6CA 1GG1A 3W1LA 1CB2A 1UR4A 4K7VA 3PW0A 1XPYA 3IGXA 3RCNA 3M47A 1R3YA 2QJGA 2WAGA 3ABRA 1X1OA 4NAEA 1HXJA 1LWIA 2GK1B 3SFKA 1UR0A 2OSXA 1MZHA 1V51A 2NQZA 2VT0A 3RXZA 4PMNA 3MO7A 2VX6A 1I0DA 1W1B1 4X63A 4BI5A 4IX2A 5DQPA 1RBOB 1OCNA 1UC4A 1XC4A 1WYIA 2PFHA 5KG3A 2VWSA 4NXKA 3CHCA 3JS3A 1PIGA 1AK5A 4LTSA 2DZBA 2OR2A 3PW7A 3OZPA 1ZUAX 3ZFHA 1HUVA 2P53A 1N2VA 3H4WA 2QVNA 4NX5A 3RLVA 2P3EA 4ZSUA 1I6NA 5AYZA 3UF9A 3UG5A 1H51A 1ISXA 2ALRA 1EF2A 1RCXB 4W88A 3MO4A 3W88A 3O7UA 3F7JA 1P0EA 3L7RA 4V1YA 4UTUA 1R9YA 2DW6A 3IV8A 2PRLA 3SN0A 3GTNA 4HPHA 4M24A 2OEMA 1O60A 5CPQA 2WC3A 1UPMB 4DNMA 3PUOA 4OVXA 1EB3A 3AXIA 3VE7A 1EOMA 3VFLA 4JHOA 3I68A 2BGSA 3VC5A 4Q4KA 4PC8A 4Y9PA 1H7NA 1E9IA 3T78A 4TR9A 1MMFA 1RY8A 3STFA 4L6DA 3V75A 1BRLB 1QATA 3P62A 5F9NA 3B04A 3WQ5A 4AYGA 3UQNA 2Y61A 4N42A 1YX1A 3USZA 1C9WA 1OFDA 4IIDA 3B8VA 4LVFA 6PTDA 3GH4A 4EX4A 5CC5A 1SW0A 3NO3A 4M0XA 5CJNA 4B92A 3DECA 1VGAA 3ZYZA 5K9DA 1XIHA 5A6KA 4AZCA 1XDJA 3HV8A 3WNNA 5DO8A 4NXSA 1TA3A 4EWJA 4NASA 1I9CB 4JTEA 2XM2A 1OABA 2J4GA 2VD8A 4AWSA 3VZYA 2NWSA 1L6WA 5KFUA 1EGVA 3S2JA 3UR5A 2UY4A 2J88A 2ZIDA 3F5JA 4H41A 4H9MA 3TWAA 1NIUA 4LWWA 3LN3A 2VYOA 2YXOA 2WYSA 3VIMA 1O5XA 4QTGA 4HA0A 3KS5A 4EANA 2FMNA 3UD6A 3AJXA 1V3LA 4MKVA 1MSSA 3RMEA 4D6CA 2Z25A 2YGYA 3SRKA 2FDMA 2EJAA 1Q45A 4GX9A 4GJ1A 1FH9A 3KHGA 4FMVA 2F6XA 3T55A 1QPKA 2OFJA 4JOMA 2GGGA 4L1WA 3RRAA 3LI0A 4U5IA 3EDJA 2QT3A 1H4PA 2UY3A 3N14A 3M5ZA 5HATA 5G5IA 3SJNA 3M9YA 4PTVA 3H6OA 1RQEA 1T6MA 2Z1KA 4ZQRA 2TAAA 3FYYA 4NUWA 4H8NA 5A2BA 4V1XA 3NPWA 4XIMA 3MBFA 2NUYA 3N19B 3WLTA 3EPNA 1EZWA 1Z3NA 2G96A 2JEQA 2UV8G 1EA9C 5T26A 1RD6A 3E0WA 4QDPA 4MIMA 2PB1A 3E5PA 2XZ9A 3PK7A 1GYLA 1FWSA 5M2FX 1GKRA 4KBXA 1CDGA 4U7CA 1YXDA 5FEZA 3S42A 5HAOA 4D9PA 1GUVA 2VP8A 1LG1A 5G1TA 2YB1A 2O9PA 4JTDA 3WNKA 4ZB2A 2ICSA 1HTIA 2E5CA 3PBVA 2XSAA 1S3TC 4UNIA 5AYBA 4XK2A 4H4IA 3MR3A 2XN0A 5T8GA 1OCJA 1FFRA 1PTAA 3IN5A 2V3EA 1Q6FA 3FXGA 3FA3A 5RUBA 3UR8A 5LZLA 1DXFA 1KFKA 2WPBA 1P0KA 1BF6A 3P7YA 4IMDA 1FCBA 1TZ9A 1K8ZA 3EPMA 2XH2A 9CGTA 1GZJA 3UR7A 4WJXA 5CH9A 4BZYA 3AOFA 3GO2A 3JZUA 3WLLA 3RCYA 5CG7A 4M5PA 4H6KA 4H1ZA 2I56A 2DSUA 3UYIA 1IXOA 1Z32X 5KFNA 2VZVA 2R8WA 4RNJA 3C5QA 1ZP3A 1L8PA 3W82A 3GTHA 4EYHB 3ATZA 1GTEA 3L5LA 3E96A 2VNCA 4YMZA 2HBXA 1MXSA 3BSMA 1GVRA 1JDDA 3KRUA 1WXYA 3TYDA 3N9RA 2VRKA 4O1BA 1J0JA 6ENLA 3A47A 5FL0A 4JTFA 2VQTA 4RDWA 1RPKA 1R47A 1G1YA 1KBJA 1XISA 4IR1A 3TYZA 4QJ5B 5E9AA 4EXBA 1OADA 4F0LA 4GQBA 4XAGA 3W1AA 3B06A 4DZAA 3BWWA 3FJ4A 2UY5A 3D5HA 2YSWA 2OWCA 2JIEA 2D3LA 2DZWA 5AECA 1F5ZA 3ARZA 5EMKA 4MNMA 1EIXA 3E12A 1PPIA 1SZEA 3EA3A 2FTYA 2G5WA 5GQBA 1ZENA 3SCTA 1QMLA 1BTCA 4H19A 4I5UA 4LEFA 1DJZA 1EJTC 4MMWA 5EB8A 5HWMA 4S3AA 5DLFA 5B7ZA 1K4GA 1V0KA 3MBDA 4XBSA 3M5XA 4MWAB 4C1KA 1A49A 1JZ4A 1BYCA 4KFPA 1LJYA 3IIVA 4PTMA 3E0IA 4LCSA 3ERPA 4AW7A 1OF8A 4JFVA 1PO9A 1G5AA 1ME8A 3CUGA 3W1UA 4F0RA 3QKEA 3A3HA 3OQEA 1WBJA 2RUSA 1Q6RA 1O5RA 1RK6A 3EX2A 4UTKA 4OFCA 2GSHA 4JIRA 3Q8RB 4G5DA 3LGGA 3NQBA 4JN7A 4ZTYA 3R0KA 4N0RA 3PP7A 5DBUA 3AIQA 2VELA 3WL0A 1NTHA 3CS2A 1TR1A 1HT6A 1F6KA 1X38A 3UYCA 2POZA 4MGGA 1E1CA 3U8GA 3H4GA 1KGWA 1EJUC 2BDQA 5DGAA 3F4DA 1W3LA 5DT5A 4EOUA 3D3AA 3SJ3A 7TAAA 4FLOA 2D24A 6REQA 1C8XA 1QK0A 1EOKA 1WKFA 2G8ZA 2REQA 4DYJA 3WLSA 4EIVA 4C7DA 4YWSA 3LV5A 5FKYA 5AC6A 1ZJHA 3LLDA 3HG5A 2ALDA 3CNYA 5DY3A 3GGMA 4C6CA 4XKYA 3UNTA 1F9CA 3O9NA 5KFBA 4IRCA 1Z8AA 4DL7A 3C2FA 5DN1A 2ZXAA 2Q8ZA 1Y65A 4F0SA 4IL2A 4LV4A 3VNYA 4HHLA 3IJDA 4TVUA 3GFYA 3LM7A 3FHAA 3QN3A 1SM9A 2CHRA 2Z2BA 3G6LA 3EB4A 1MDRA 3SDOA 1VZWA 1VENA 3GAKA 2QW5A 4ED7A 4NJIA 3EOOA 5TBOA 3QF0A 2NT1A 3OVQA 4LY8A 3MR2A 1DIDA 3H55A 2G3IA 2E6AA 1OG6A 5AYXA 1ECEA 3MA8A 1YPIA 5M17A 2CERA 1XGZA 1CPUA 3VKDA 1CXIA 2A6LA 4Q4RA 1CLKA 3G6MA 1SJDA 1JUBA 1PX4A 2J7FA 1EHAA 3BZJA 1H5YA 4MJ4A 5M1TA 2V5BA 1R3TA 2W8KA 4AF0B 5HXMA 3KOYA 2R1KA 3C3UA 3LTPA 4AD5A 1VBUA 1HL9A 3M1ZA 3OLGA 4LAUA 3NZRA 2PDCA 3EDEA 5A94A 3CXOA 3HB9A 3GH7A 2OXNA 1H7RA 1K77A 4HYKA 2QCMA 4B9ZA 3AS2A 1HP4A 4O13A 3F5KA 3E5BA 1ISWA 1QW8A 3UCDA 2NX1A 3PY2A 1QI0A 3FW6A 1XQLA 3NQEA 3W75A 2XCPA 5D37A 1CGTA 3WLHA 5BXTA 4Q8VA 5F1UA 1DORA 4TV5A 4I5XA 3S5NA 2Y24A 3SY5A 3STEA 1FP8A 4E2OA 1FWRA 3CMFA 2P0IA 2GJLA 2BHYA 3AWNA 1OIMA 1K9FA 2JE8A 2OZ3A 3BVJA 2BWGA 3G8EA 2XIQA 4XAPA 2VA2A 1C8QA 5ECUA 4EE9A 1FWTA 1A0CA 4J2PA 4NZ4A 5E9XA 4IZGA 2PDYA 1YW1A 1SJBA 4CQ8A 1W1TA 4E2BA 3TA9A 1LUCA 4KETA 3FJLA 3DX5A 5D03A 5CC3A 3S1GA 3MHGA 1OX5A 4GZJA 2V4RA 1L2UA 4QAIA 4O4VA 1A47A 1TIWA 5DANA 1P0NA 3WEMA 3WY1A 3J7HA 3GNXA 2WVSA 1O1HA 4HZ6A 2P0OA 3NEVA 1ADOA 1GEQA 2J6UA 4Q33A 4D6JA 3MSRA 1H2JA 3WUEA 4MZ1A 4HMCA 1B4EA 1QVBA 2C79A 2J7BA 2VC6A 4A3RA 1S2WA 3VX0A 1K7FA 3OP2A 1PVNA 2W4XA 1GGOA 3CIXA 3SCUA 3VC6A 1T41A 2D2GA 3KWSA 4WIWA 9RUBA 2E5BA 4WKAA 3NL3A 2JIWA 4JTQA 2C0HA 5KEZA 1OCBA 4XSMA 3GKAA 4GQGA 1YYAA 3BLPX 4WVXA 2AMGA 4Y9OA 1BF2A 1F8IA 4ZOEA 2O92A 4US6A 1QO2A 3JW7A 3MJYA 1VLIA 4GIRA 5A95A 2DUAA 1XLCA 1J10A 1OX4A 2INEA 3W7MA 8RUCA 2KX9A 2A3EA 1CGWA 4CVWA 4W85A 5A6MA 4LRTA 4IGNA 4DYEA 4JDYA 3QY7A 3CIVA 1HW6A 3MP4A 3KCLA 3L0KA 1F74A 5EFDA 2PEVA 2HBVA 3TYEA 3P82A 5KFCA 3W71A 3ZO9A 3VGHA 3UJFA 1OYAA 2FH8A 3H2NA 2WSQA 2V5DA 4Q8EA 5A8GA 4ACZA 2J8FA 2V67A 3S2LA 4PTWA 3F2DA 2VX5A 2FPYA 3DIPA 1C7SA 2OSYA 3M9MB 4AY1A 1X8FA 2AL1A 2XZ7A 2IXVA 4W93A 1J12A 2WJEA 1JZ7A 5L1IA 2RKXA 4GWEA 2VENA 1PEZA 3SY1A 1H3GA 3JUGA 1WDSA 3GG7A 1KR1A 3W73A 4H6QA 1X6UA 4V15A 3TTQA 1IT7A 1XICA 3H26A 1IE7C 2VGIA 3W72A 3LBCA 3VDAA 3MZNA 1E5NA 1DJXA 2X30A 3AIEA 3MMDA 4B15A 4WUIA 3CTTA 3UZZA 2CLEA 3TCSA 3B9DA 2RDIA 5BROA 3K46A 5I00A 4F0KA 4DZ5A 3MTWA 5IBXC 3APTA 4FNTA 4IX0A 5I06A 1PKNA 3EMCA 4D1IA 3QMSA 1OY0A 2V9WA 4P61A 4DZIA 1XLGA 4HNNA 2GDVA 3M5VA 3S1UA 1XIGA 2VDGA 3PWGA 2NVDA 3DN5A 3VVGA 3THAA 3G1HA 4BWLA 4QG9A 3R1ZA 5B80A 4C1NB 1W37A 1PX3A 2YDSA 4HKPA 1IEWA 3SUUA 1PHQA 4GD0A 3W7CA 1XIEA 4EF8A 3PTQA 2C1GA 4IPLA 6TAAA 3NDYA 1QRQA 3VDGA 1KNWA 2QUVA 1L9WA 1T8XA 1HKJA 1VYRA 2GQ8A 2PF0A 3MW7A 3UXKA 3L4UA 5FF2A 5KFSA 1I2OA 2QYGA 1OZMA 1UJPA 1XYFA 3E2QA 2NV2A 2W8LA 1UWRA 1UG6A 2J8GA 4FOJA 1ZBKA 4B5WA 2JEFA 2OYMA 3EX1A 1QNQA 2HXTA 3ZQ9A 1TCDA 3DYMA 4GIYA 3VUSA 5HMEA 1QWGA 4IFKA 4S1FA 3AXXA 1E0VA 4YWIA 1VPQA 4B3LA 1QPRA 3IEBA 1A3WA 3BW2A 3W87A 2DEPA 2HNHA 5BXRA 3I7QA 1HNYA 3BAYA 5G1YA 1PTGA 2QCDB 3IVSA 4L6OA 3R6IA 4JX4A 4EF9A 3OA3A 4ZE5A 5J04A 3BLIA 3E6EA 1M01A 5KFVA 4UBPC 2VFGA 1WDRA 3GK0A 1V03A 4C5YA 1CLXA 2X1UA 3W7RA 3P81A 3UWWA 1S2CA 4NJGA 1TPDA 4JCLA 2QCLA 4UNLA 4L4PA 4WR3A 2ZRVA 4QGCA 5FJUA 2PGWA 1B0IA 2YJQA 1H7XA 3IV3A 3WEOA 3BLFA 3A4XA 1GJUA 2F2HA 2AQ4A 3RPTA 2WNZA 5D2VA 1EO7A 3GHSA 3CZJA 1Q6DA 3GDKA 3GNRA 3QFWA 3RM9A 3CEUA 4X0VA 1O66A 2WKJA 3VU2A 1XM3A 4Z2HA 5C2XA 3ONBA 1JPMA 1QWKA 5KG5A 2VZUA 2YCLB 5JQ9A 2PUZA 5TNVA 4A8NA 4WOQA 5FJOA 2VDHA 1GPFA 5AHEA 4FZIA 1XGEA 4LYRA 2ONEA 4J3VA 3W23A 3TYCA 5HOSA 2XGQA 3WMSA 1LLWA 3UZ5A 3VIPA 4QJ4B 3CO4A 3F2BA 5T14A 3ZR4A 1HF6A 2DPJA 3TTOA 2WV8A 4MYAA 3HO8A 4KWSA 1YPXA 4I3GA 4Y2WA 2VTFA 3RM8A 1KRBC 4B16A 4WSHA 3TC6A 3GZ3A 1S1RA 3BGGA 3MJMA 3SI8A 4FXSA 3FY1A 3QQ1A 3KZPA 1XLBA 1PDYA 1AJZA 1LRNA 3ZR6A 4JN8A 2PPGA 3VMNA 1HJSA 3ECQA 3F5LA 5CPSA 5EWGA 4Z0JA 3GZAA 3CT7A 5EY5A 1RV8A 4GMEA 4Q7IA 1NSJA 3CQJA 2HCVA 3TV8A 4JIEA 1AL7A 4RXGA 3MANA 2CWNA 4LBSA 1LZOA 4O17A 1LLZA 1OFBA 4DZHA 2BOEX 3GIMA 2W61A 4FF7A 4HSHA 1OFAA 3JU2A 2DSZA 5JUMA 4NI3A 5HPCA 3H2AA 3WF1A 4H9ZA 4YS1A 4AVFA 2ZE3A 1NDWA 2QUMA 1VCFA 3NYZA 1JZ8A 4PB4A 3E0LA 2Z0IA 2BHUA 1GHSA 1MQQA 1TWSA 2YZ5A 1PTDA 3GXFA 4D2JA 1HFBA 1TV3A 3B9OA 3SIMA 3VNKA 1KBKA 1KBBA 2ZZ3A 3TNBA 4M3PA 3P5ZA 1OFQA 1UKQA 3MMUA 3TMLA 3KVKA 4ASTA 2E25A 3HQOA 5D38A 1DWGM 4U2YA 3MMTA 1AW1A 5EWEA 2PP1A 1GK8A 1GQJA 1JF6A 1XLAA 2OJPA 3TIMA 2C1HA 2WMIB 4WXZA 4ED6A 3F2CA 3OZOA 4Q8WA 1KTCA 1V0NA 1CLVA 2YDAA 5IRPA 4W84A 2CZVA 4NAFB 4QXIA 4AH7A 3QSTA 1QBBA 3LA4A 4J9JA 4JAWA 3DI0A 3QTGA 3S6TA 3M9NB 3C2VA 3NFUA 3A4AA 4E3VA 1XRFA 2XC9A 4ZSTA 1V6YA 2RGMA 1DWIM 1KLYA 4LUJA 5EA9A 4F0HA 5CZTA 3K1GA 3POHA 3NR0A 3T44A 3RX2A 1U1UA 1XLFA 1TJ1A 5E70A 3CPUA 2AGPA 3DGRA 2WZMA 5FJTA 1G4PA 1EPVA 1RVKA 3LCXA 4WF7A 1W3TA 4KWUA 3WO8A 3O1NA 3GIJA 1FFQA 2PSNA 1QT1A 2E6YA 2E09A 1NDVA 1R9XA 2ISWA 2VGFA 3FA5A 1K9TA 2FGLA 4TTGA 3ARYA 4UR9A 1POKA 3FVDA 3H53A 5F2IA 2OG9A 2FLPA 1M68A 3U2OA 3W25A 1QNSA 2B4GA 4U5KA 4LS1A 4UOZA 2PF8A 3DENA 3QR1A 2NQHA 3EA2A 2OT0A 3P80A 4ZODA 1YTEA 3BDKA 1VCGA 1B30A 4JFUA 2QF7A 4AU0A 2F8QA 3WH6A 1UC5A 4XVDA 4OKDA 1VFOA 2BY0A 5E0FA 3W6LA 1SJAA 1NDZA 5I5RA 2WQPA 5G4WA 1XD1A 1RLDA 1E0WA 1P1XA 1A5LC 1EJ7L 4J9LA 1XJBA 4V28A 3O8AA 1V6VA 2PZNA 1P1MA 5KFMA 3TP4A 3T42A 2QAPA 4GLEA 3UWYA 1OC7A 1W3IA 3LNMA 4U33A 1E15A 5AB3A 2R9RA 3PBWA 3QZ6A 1JZ6A 3PR4A 3HGSA 1B1YA 3GNNA 2VWTA 4JL1A 1H62A 2YYTA 3VNIA 5EDWA 1V5XA 2XSBA 1VJZA 2ISVA 1VFUA 4QEEA 2VCCA 4FNUA 3H7RA 3AIVA 4QNWA 2P8BA 4HCHA 3M7WA 2WSRA 4FS9A 1E70M 1FKWA 3BG5A 1DOSA 4MWAE 4KQNA 3PZOA 4LPCA 4QIUA 2YW4A 2WQDA 4LYKA 3RX3A 1R2RA 4KWVA 4LUTB 3ZMRA 1W91A 4MKNA 2GGHA 2WBGA 3DH7A 1E9ZB 4S3CA 1B90A 3F03K 3QQ0A 4LUIA 2XFFA 2NSXA 1HKKA 2Y8KA 4ED8A 3DHFA 4OHQA 2XIBA 3NXFA 1W3JA 1TJ0A 4MM1A 3TONA 5JBEA 4B5XA 4L9ZA 2PLCA 3SQSA 4A3QA 3W22A 4AISA 3IGSA 1PKLA 1XINA 2JQXA 1AJ2A 4D8ZA 2XM1A 3WFLA 3WDHA 4POCA 4O8AA 5HPOA 5HMFA 4ZO6A 4JQ2A 1E6NA 4LB4A 3VOCA 4OV4A 4V33A 5C2CA 4QCEA 3STPA 3H2FA 2VFHA 4O4WA 3HPXA 2VEPA 4X9YA 3UXIA 5HUPA 2PDHA 3V5FA 4GO8A 4X0NA 2E77A 1POJA 3HOJA 3K8KA 5A6BD 5IOBA 2YXGA 1ITCA 3BAXA 4Q6XA 3FAXA 2I57A 4H9VA 1EBGA 5KFQA 4ORIA 4F8XA 3WL1A 2R1PA 4Q8QA 2W79A 4Y7EA 5CAKA 2AGOA 5CEWA 4G8TA 3A23A 4N9CA 4E6MA 2OOFA 4C90A 4ZZ9A 4NNCA 5KG1A 4NX0A 1WAUA 1KXVA 4R7JA 4LUTA 2OLHA 4DJDC 1GQKA 1YNPA 2DSKA 1UD2A 4PUKA 3EOLA 2JFEX 1SZGA 3CHEA 4LBUA 1MW3A 1A5MC 1XF0A 4JICA 3ITGA 1P0BA 3KFTA 4D1JA 4GCAA 3TH6A 7ENLA 3D3FA 2HS6A 2F7FA 1J5TA 3KS6A 5A8MA 4B2DA 5A8QA 3F4WA 2PWGA 1E6XM 3MYOA 3IIPA 2A79A 3R89A 2DZXA 1IT0A 4UCGA 3IIXA 1CCWB 4A3HA 5H6HA 2QLYA 4GH3A 5HQLA 4GI6A 3AI0A 4U28A 5DQGA 1UR3M 1F4HA 1Q2SA 4M6UA 4IGMA 2E1WA 4QG8A 4NP7A 1CW2A 1JGMA 1RBAA 3GXDA 4CNOA 3KTSA 5I24A 4J9MA 3BQ5A 3LCHA 2QHAA 4MY8A 3HJEA 1MDLA 2J78A 4PE8A 5FSEC 1LLOA 2DT0A 3GSMA 4HB7A 1J0YA 3LHTA 1TQJA 2WHLA 5DFAA 3GC5A 3HG3A 3KBSA 3A12A 4DXXA 3BQ2A 4MB5A 4JCMA 3UG4A 2EKCA 2IW0A 4I6KA 2VUNA 5FI8A 1XSIA 3RM4A 4K39A 1QPOA 1Z89A 3WD2A 3SGUA 1ICQA 1XFCA 3FXYA 4LC6A 1VB9A 4PUWA 3ZT7A 3RN6A 4QROA 3KBVA 3KL3A 1E6ZA 4Z08A 4PR4A 3UWUA 1SU5A 3LNPA 4YU1A 1JYVA 4UTTC 3WF2A 2G97A 4DI8A 1H7WA 2P9BA 3WF4A 3GX9A 4BR1A 4Q8FA 4JX5A 4F9DA 1EJVC 1LL6A 1V6UA 1G0CA 1K6WA 4RNIA 1MEIA 3SM0A 2IKIA 4ORMA 1K9EA 4Q7BA 3EX6A 3K2GA 5CLTA 3B0XA 2PDPA 1UUOA 4EXQA 2PD9A 3TSBA 1NQKA 2ZQ0A 3F1QA 3N25A 2ASHA 1QASA 1RSCA 3QV9A 1W9UA 3TROA 3CQ0A 3CUIA 2JKEA 1IZKA 4FI4A 3OGSA 4WKFA 2WVTA 3THQA 2Z1XA 3IJLA 4LUSA 3HURA 3W1MA 2WXDM 4MOZA 3BOFA 2WOQA 1NY1A 2YA0A 3HFYA 3MUXA 5LHEA 1RCQA 4J7RA 4NT0A 3W9ZA 5KT2A 1JZ2A 1S38A 4ED2A 1UCWA 4GZIA 2PTWA 3NA8A 4BS0A 2J6XA 1EUAA 1TWWA 5AHMA 3FVMA 3I4KA 4XD6A 4KIEA 1LP6A 4CN4A 4UQCA 3AYRA 3N2OA 3IUIA 3T0DA 2WM0A 4MDPA 3URNA 3RIKA 4AAJA 3FCPA 3N15A 1BRLA 4FPSA 4MPQA 3VMPA 1PZ0A 4JN6A 1OWQA 3W1RA 2VR2A 4IG2B 3TVAA 2P3ZA 2WVUA 4WDTA 5A8NA 4MZ8A 3Q2DA 4MFDA 4O14A 3NJ3A 4YIWA 3VOIA 1DQUA 1S2AA 5H8MA 1YXCA 4GIAA 3AIUA 5AC4A 2Y88A 3MI3A 3TAOA 3NQ2A 1EC8A 3IK2A 3W1NA 5DY2A 4HPJA 1AG1O 3OVRA 1ZCOA 2EG8A 1ZZMA 1ONRA 4Y8EA 3S9YA 1E4NA 1I60A 1KW1A 1W1ZA 1EBHA 1V6XA 3CJPA 3CBWA 3LRLA 2C1IA 2V3FA 2TPSA 1W3KA 4AZ6A 1JDEA 2ATLA 2FB2A 4LNYA 3GDMA 4NYUA 3KP0A 4KGJA 5DLGA 4QWAA 1I2QA 2YBTA 4OUEA 3NTYA 3RNDA 3OG2A 4KMQA 2PDIA 3VPLA 2NQLA 1NOFA 2PBOA 4JFTA 4MVAA 3MP5A 4GUFA 2UVVA 1TWDA 1SZFA 1KQZA 2X40A 1OC5A 4JBRA 1S0MA 3Q37A 3H4DA 4ED3A 2QXWA 4UR7A 2J27A 2ZZ4A 1HJWA 4CQCA 2W92A 3KVJA 3MMWA 1OFEA 1KM6A 4LU0A 3IUHA 5IDIA 2RDXA 4Z2KA 1HVXA 4QNEA 3I7RA 1XPGA 2GJXB 4PTXA 4IJRA 5CBJA 4YHEA 3ZS4A 1FWNA 1A3XA 1W8SA 3BV4A 4AZ5A 4E4UA 2JEGA 3W84A 4IG2A 5EKYA 1MEWA 2G0WA 1P7TB 4UQAA 3PR5B 1L6FA 1SR9A 1GQLA 2YCEA 3OVGA 5AHIA 3U48A 3NNTA 3WQDA 3FGCB 2ZOXA 3QV6A 1DJIA 1GZ1A 1W5MA 3O63A 2NQJA 1FCVA 1IZJA 2XIMA 4O1DA 4D72A 1Q7QA 4DUOA 4GACA 4PMRA 4XZIA 3TYUA 3G2GA 3LSCA 3NGDA 4R7OA 5F4XA 3KBJA 3SGGA 2Z7KA 1BYDA 1Q7MA 3DC8A 4I9MA 3N2CA 1EP2A 4M1BA 2ABAA 1W17A 3CAQA 1BYAA 1ZU8A 5D30A 2BHZA 3HMJG 3B8IA 5CC6A 2AMXA 4XUYA 2V3GA 4GE8A 2R8GA 3O15A 3WD4A 4YYCA 2ASLA 3UPBA 1JGIA 4Q45A 1DE6A 3SUSA 2JF7A 5A6TC 4GUJA 3PANA 4GC6A 4HQVA 3U6WA 3DCPA 1GVEA 5GNZA 1W5NA 3K8MA 3NSXA 4H83A 3DKLA 5BRQA 2CZFA 1UYQA 3MUY1 3VKKA 4NRRA 4C6PA 2OEJA 1XIDA 2X1SA 1W3NA 1UUMA 3T9PA 4A05A 1EP3A 4B4FA 2E9LA 3URAA 1A80A 2ISSA 2VFFA 1ZLPA 2PP0A 5A8PA 4GUGA 3KP1A 2UVWA 2ZFAA 1JD7A 4UTWA 4J3UA 3K30A 2ATSA 1TPEA 5IHRA 4LANA 4JTKA 1A50A 1TV2A 1DHPA 4LRSA 4WLCA 2Y5SA 3IWPA 4UOQA 2DZPA 4LXFA 1E51A 4ED0A 1IEQA 1AH3A 4QWEA 2QMJA 3IJIA 3Q4DA 1UASA 3NZQA 2ZTKA 3VIIA 3VDCA 4B91A 4XZNX 4EPKA 3TN5A 4QJ3B 1F61A 1U22A 5C0QA 1IV8A 5DMMA 2GZXA 2PP3A 3REQA 1F4AA 3WYZA 2RGLA 2W9CB 3QEZA 2REQB 3U4FA 4Z42C 2OU4A 1SFTA 4V2XA 4DPQA 2WM1A 2D23A 2QCCA 1ZJBA 1GTHA 1PZ1A 2CIPA 1ISZA 4X2PA 4A35A 1HX0A 5I77A 4IQJA 3ZJ6A 4WHBA 2C18A 4HA4A 4ECTA 2PODA 3G6VA 1US3A 3VM7A 5KFWA 1SO3A 2G37A 1HKMA 3PPCA 3BV7A 1UR9A 4DQWA 1UPPA 3SI9A 5LGXA 5L6UA 4IP5A 1N8WA 4GZEA 1H60A 3LRKA 1WX0A 2EPHA 4PYSA 2EG7A 3LUTA 2AAAA 1V3KA 4IJCA 2F6UA 1NAL1 3K4WA 3W01A 4LALA 5GJNA 2VXNA 3MFIA 1F8MA 4PMJA 1MO0A 2FZDA 2YZRA 2Y6ZA 5DMNA 4A22A 4NF7A 4HZ7A 2VOTA 2X0YA 3PTKA 3W7PA 1BKSA 1MQPA 3EWXA 3U7BA 4V27A 3W2LA 1MZRA 4OWGA 4KWOA 2W63A 5GJMA 3OO2A 2QCHA 3ZIZA 4J5NA 1V0MA 4CD5A 2DFAA 1I2NA 3P2VA 1GOKA 4HK5A 3NIYA 2PLKA 3BCJA 4CN6A 3B9EA 2BX7A 2WCGA 3NXLA 2FPVA 2EGZA 3GXMA 4AZBA 1SFSA 4MB4A 2W9CA 4F40A 1TV5A 4BEQA 4OGZA 3MCNA 5LXEA 1IWPA 2E9BA 2DUXA 4W4QA 4ECYA 5TAOA 2WHMA 4R53A 5KFEA 1O5KA 4K68A 2QJNA 3MVTA 1R3WA 1X8CA 4YQWA 4DJFC 2TRSA 4X61A 4CVUA 2ZX9A 2DT3A 2WSYA 4UQ9A 1ITQA 4RR4A 2PAJA 3C3NA 3PW2A 3HIJA 1GKQA 1NWRA 1K8XA 2E7FA 5GNXA 4I6VA 5D2WA 4L9YA 4LB3A 5KINA 1XSKA 2WSPA 3NL6A 1V93A 4XQ6A 5G4EA 3E0VA 1QUMA 4GG9A 3VGDA 3RR4A 2BP1A 1ZBVA 2FVKA 1UD8A 4A4AA 1QNOA 2FZ9A 1DJWA 3PZVA 3HN3A 4LVDA 1VYSX 3OHMB 3TQPA 1UD5A 1XBYA 1H0IA 1XFBA 2E0PA 1BWVA 3L4VA 8XIAA 4N9BA 1BVNP 5KT5A 5JIWA 2C16A 1GONA 4ZB0A 4DL6A 3IAQA 3C4UA 5F2LA 1KFLA 2YLLA 4P7NA 2J6SA 4CNSA 3AYSA 3CASA 4NVTA 3W07A 3TMQA 1EP1A 1B3ZA 1V77A 2IKHA 4M6QA 1K70A 3GC4A 3GR4A 3GRIA 1VFMA 5A69A 4DLMA 1A5OC 4HSOA 2GVGA 3HG2A 3DFOA 1FHDA 1DIEA 3CPRA 3JVAA 3TSDA 4JIQA 3OVPA 1MW1A 3QC3A 3KRZA 4LOCA 3WDIA 3V5CA 2QJMA 1WE5A 2AL2B 1EEXA 4BF5A 1GVYA 2DJXA 1VH7A 4H9YA 3RK8A 2A3LA 4TMCA 3W3OA 3KWXA 1WV2A 4FNQA 3DHPA 1H61A 1TREA 4P8WA 2UY2A 2RDJA 5K9XA 2G50A 3ZJ8A 5G2HA 4GGHA 2OQHA 4JTUA 3DFHA 3SSZA 1JDCA 5HJYA 1PKMA 4KEUA 3THDA 2NQ9A 1MNSA 1QK2A 5KT6A 5I3GA 4JYDA 3CAKA 3CAWA 1ME7A 5MHBA 1FRBA 1LWHA 1UUQA 4GIEA 1LF1A 2VFEA 2I5QA 1M7XA 1AA1B 3GHTA 4GISA 4WDWA 2WMFA 1CI1A 1N55A 3AYVA 3WX7A 2IPWA 2Y8VA 5A5WA 3N2TA 4MLRA 4QWBA 4NLGA 4GVIA 2ZC8A 3HBLA 4TQRA 4LCRA 2DPEA 1HGYA 1TZZA 1W9DM 2XISA 4GJIA 5LKYA 2D0HA 3FFSA 1HKWA 4ZL1A 1AFSA 3EOEA 3U5UA 1FA2A 4XAFA 1UR2A 4IGSA 3KOZA 5XIAA 3NM1A 2ZCGA 4DF1A 2G41A 5HQMA 3TR2A 4US5D 5HMDA 1W9VA 2FTWA 2PWUA 5D4YA 3BC9A 1KCXA 2AGQA 3W28A 3TJ4A 1CGXA 2XSXA 3HGJA 4DIAA 2F9RA 3UW6A 3H2CA 3UZYA 1XC6A 3UA3A 3M0VA 3LMYA 3GWQA 4RU9A 4R34A 1IXNA 3SCWA 4LJ3A 3DEQA 3R58A 3URQA 2C15A 3GVVA 4ES4A 4HU3A 2WVVA 3OOQA 3HFTA 1J9YA 3NQ7A 4F50A 1JPIA 1SW3A 3RCMA 1Q6CA 1CZ1A 1JCYA 4A8IA 3LD5A 3G6XA 4DUWA 4DELA 4O1AA 3RU8X 4DPPA 1VFHA 3B4UA 4RNHA 3L68A 4O50A 1MFUA 3MS8A 2DIJA 1UROA 1F3TA 3ITXA 3OGRA 3BPWA 1W5OA 5XINA 3VNZA 4DXVA 5FCZA 1BG9A 1K6AA 1SW7A 4GZ7A 1E3ZA 1EFZA 4XZMX 3RLHA 2P50A 2QF8A 4F0MA 3FA4A 3W02A 1AD4A 4XZLX 3LMZA 1RUSA 2QCNA 4EPBC 2XFYA 1FCQA 2DT2A 4GNVA 4I8YA 4N7QA 1UQYA 1IZCA 1YRRA 4JEJA 5BYWA 3CYVA 1PB0A 5KZDA 1ZNNA 4ECRA 4RUAA 1W32A 4TTUA 3C2OA 4FX6M 4JTJA 5HNNA 3ZJKA 3CZEA 4OTKA 5AHFA 4LYQA 1GPWA 3FDGA 1RZMA 4IXHA 1EF3A 3T5KA 3SRDA 3W7NA 4FIRA 1NFPA 3WDRA 4R8UB 4PMOA 1KB3A 1GYNA 1K3UA 2GSJA 5I23A 3V5OA 4AXNA 5KZMA 2XH4A 4UMBA 2FTPA 2F2KA 1OFOA 5JIPA 2C3ZA 1LDCA 5HA7A 3BGAA 4NKCA 1JPKA 5KZ6A 3W7OA 1E5JA 3EPOA 1DIOA 2NLYA 3QHOA 5FIPA 4ADSA 2W66A 1XLEA 3S47A 3FN9A 1B3YA 1YHTA 4KW2A 1R87A 1R3RA 3W7DA 1O7AA 1RPXA 1S5TA 4O11A 1KFBA 2CITA 5EBAA 1J5SA 3A24A 1MXDA 1RAKA 2ZBTA 2WJZA 3TXZA 3NQFA 4QWDA 1O94A 3WBXA 1OVDA 3GVGA 1VRDA 1DHKA 1N7KA 4WRHA 3PTDA 2FJKA 4QEHA 4IQEA 3A9IA 2XIOA 4H9TA 3AC0A 3BLKA 4XSLA 5G2IA 2O0TA 3QGAC 5D09A 2A85A 4UR8A 1H11A 1TIMA 3GFXA 4YCOA 5DELA 3G5EA 4XZWA 3H23A 2V2HA 1CXEA 2ESCA 3VD5A 4AIBA 1HQTA 3T6CA 4O10A 3N2MA 4ZO8A 3ARPA 4CLMA 3CC1A 3CU2A 3BLDA 1B2YA 1NF7A 3GXPA 2E40A 1ZAJA 4AD3A 5BRBA 4H2HA 2PMQA 4AIEA 4C6KA 4M51A 2F61A 3V7PA 4W8LA 4FF5A 1I2RA 1TFVA 1ZQ5A 1XWYA 3T7VA 1J4EA 1D3GA 3FJNA 2J9XA 3PC0A 5DG7A 5DQIA 1GWJA 4ZOBA 3WQGA 2Q3OA 2E8YA 2R14A 2JBMA 8TIMA 2PDMA 2VX7A 3EEGA 4DAIA 2WSKA 1MEHA 4CCCA 3KRSA 2ZVIA 2C71A 2UVUA 5KFPA 3AQUA 3BXWA 3ICJA 2QJJA 1EYEA 5LA2A 1RLCL 1OFPA 2JKAA 1JQVA 5BWFA 4AX6A 1VFLA 5DCEA 1IEIA 2J7CA 4HNCA 4JTIA 3T40A 3D46A 4PN2A 2PURA 4IXXA 1TVNA 3W7EA 4DUXA 4GXWA 2Z28A 1FOBA 4X22A 3QFEA 1IXPA 2GQ9A 5HMSA 2QPXA 3LEPA 3ES8A 3AZSA 2WTFA 2YFNA 4WX2A 3UG3A 2Z4GA 1JRBA 4QFUA 5FJPA 2PDQA 4LCQA 1E72M 3CAVA 3U7VA 2YDQA 3EMQA 4BHYA 2PWFA 4YLWA 2OTDA 3UNDA 2CFFA 4GYPC 1WO2A 4R33A 1J93A 4W9TA 4AG0A 5LGZA 4IWWA 3PTMA 4H6RA 3WNPA 2XYLA 2VC7A 2GUUA 5CLWA 4ATWA 4MWAC 4JL2A 5M3WA 3V1PA 3E02A 3G1FA 5ABFB 1KTBA 4IFRA 3R8RA 4ROQA 3RDKA 3MCOA 3NOYA 4HK7A 4ZB5A 2AAMA 3EKZA 4HA3A 3WH9A 3EWBX 3BAIA 3L4XA 5A2CA 4RV8A 1DL3A 2BV9A 1F76A 3LTSA 4DM2A 3UZWA 4UB9A 1VFSA 2I5GA 3GQYA 3UFYA 3MSYA 3CQHA 1OK4A 1Q6EA 2C8NA 1PJ9A 1OX6A 4US5A 2FZNA 4F48A 3SEPA 1EEPA 5AVHA 4KGLA 4CGTA 4IIFA 4FSAA 2PS2A 2Y8UA 5L9XA 1UD3A 3PBGA 1KXTA 4B4HA 2VEFA 1UWUA 3CV6A 4RZ5A 2BVDA 3Q8PB 1DJNA 3LCLA 1UP0A 3AICA 2PCQA 5FEXA 2RJHA 3W0KA 4LUSB 3E3HA 2E4TA 2ZZ2A 4NQ1A 3LHWA 2A21A 4NNBA 4Y8FA 1ICPA 3B0PA 3KHLA 3FYOA 4Y9AA 4REQA 3A3XA 4PODA 3GTFA 3NPUA 1D2KA 3VD4A 5KFFA 5GPRA 2PDNA 2Z1WA 2C22A 4D8LA 1E4IA 1NOUA 3W6MA 4FALA 3FSUA 1UBPC 1ZSXA 2ACSA 1DJHA 4WXYA 3VCRA 5LIWX 4J28A 2EEXA 4WKHA 1HIZA 1Z41A 1XS2A 4PEEA 5KMYA 3PZMA 2WZEA 5JMUA 1BFNA 3AXKA 1YE6A 2ZXQA 4OQVA 1ZCCA 1UQZA 4D6EA 2IUZA 4MJMA 4UFKA 2J47A 3K5XA 2CZEA 1VC4A 3VYLA 1GHRA 3COTA 1R3SA 1SO6A 3OHAA 2WMGA 4TU1A 2O9TA 4MY9A 2PZ0A 1QBAA 4KS0A 2YDRA 1U5JA 1I4NA 1V7AA 3VK5A 3PZ9A 5KT7A 1SJCA 3DXIA 2ATMA 1OINA 2W6RA 3DAQA 3N13A 3RB0A 4UMAA 1S0NA 1BKHA 1XG4A 1RHCA 4YTTA 2E6DA 1XLKA 5ABEA 5BXPA 4PUNA 3B8SA 1HKVA 3TQ1A 3LZ5A 3WMCA 3KL0A 1Q13A 2EF9A 1KWKA 2OWWA 2OODA 1T99A 3BGJA 1EL3A 1FUYA 3W6YA 4CNTA 3UVAA 5CGMA 3PVFA 4AUBA 4UTHA 1OEPA 4G7EA 4REQB 3I6RA 1EYWA 1S46A 2QCDA 1U1HA 1FCUA 1XSJA 5MKGA 4CEXC 3AS3A 3LPPA 5EYWA 4LH8A 1PAMA 4AD4A 3I4EA 2ZRUA 4JY8A 5M03A 1W0MA 1YKWA 2D0FA 2VR4A 3T1GA 1OJXA 2PWEA 3KBMA 2CBVA 1ODUA 2FB3A 2QIIA 2GWNA 3I6EA 4UTLA 3EBVA 3LCFA 3KHDA 3L4YA 1P6WA 4L4OA 2VEGA 4IPPA 1R2TA 4JTCA 3CHVA 3PJTA 2HS8A 4DL2A 1JCMP 1NQ6A 3L21A 1GVFA 3FAWA 4J40A 3GG8A 1JNDA 3WZ0E 1WZKA 1KR0A 1JD9A 2Y85A 5F4SA 5FF7A 4NJKA 1SR0A 2I14A 3WJYA 3CZLA 1OM0A 3UU0A 4E38A 4YHGA 5DGBA 4YP3A 1L8NA 3B9AA 1DVJA 3SAZA 1EXPA 1M1BA 5FD0A 3KRBA 1QAPA 4UTMA 4XZ9A 5E0CA 1UKPA 4DYKA 3G1SA 2NV1A 4ERGA 1V8EA 1VBJA 5FF3A 3QMRA 4NG3A 2X16A 5AOUA 1ADSA 3A6OA 2TSYA 2QULA 1YDOA 3Q58A 2Y7DA 3SCPA 5F9LA 1UZDA 1X6NA 2X0SA 1BPLB 5CSYA 2DJLA 5FACA 2IMRA 1YMYA 3M46A 3KXQA 1XLMA 3SECA 5DXYA 5JU6A 4LSBA 1KA9F 7CGTA 3Q8SB 2PDLA 1HZYA 1HP5A 4JY9A 4B5SA 4MAVA 3T8LA 1RJQA 2J9YA 2WLYA 1P4CA 4ZFMA 3GIKA 4JR5A 4QQ3A 3G77A 4FLSA 2O7QA 4UTFA 4TUFA 1DTNA 1O4UA 3OPSA 3P8JA 4FBUA 2HSAA 2QZRA 3MWAA 1TG7A 2R82A 1UR8A 4ECSA 4XD3A 4HP5A 2Q8XA 2HQAA 4JKMA 3F4NA 3DOPA 1A0EA 5CKSA 4RPQA 4FNSA 2ON3A 1U83A 4TVCA 4CU6A 4PBEA 3SBFA 3AO0A 3TKFA 4EPDC 3KX6A 4ZA0A 3U0HA 4WY0F 1DV7A 3BAWA 5LIUX 4L65A 1VQTA 4XZHA 3BURA 4AVOA 3S8HA 4DBUA 3P84A 3E38A 4XG1A 2C7FA 4F2UA 2BXYA 4BKNA 1ISVA 4IGHA 2D2OA 2BZNA 2G3MA 3B0YA 1T96A 2XU2A 3M4HA 5AZ1A 3REQB 1QFEA 3SR7A 1GW1A 1F6YA 1QHOA 2RFGA 4KEZA 4GHRA 2A5HA 2C2EA 5KITA 3AISA 3SW6A 3PPHA 1WOAA 1DXIA 4D6FA 3GE7A 5HDRA 3S1VA 1UWTA 2R8HA 3FHQA 3OZYA 1MNZA 2XHYA 1YTKA 3UESA 2YX0A 3NM3A 3FS2A 4ECZA 5I3DA 1KWGA 2GPTA