2AQVA

Crystal structure of e. coli isoaspartyl dipeptidase mutant y137f
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
389
structure length
374
Chain Sequence
MIDYTAAGFTLLQGAHLYAPEDRGICDVLVANGKIIAVASNIPSDIVPNCTVVDLSGQILCPGFIDQHVHLIGGGGEAGPTTRTPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRALNEEGISAWMLTGAFHVPSRTITGSVEKDVAIIDRVIGVCAISDHRSAAPDVYHLANMAAESRVGGLLGGKPGVTVFHMGDSKKALQPIYDLLENCDVPISKLLPTHVNRNVPLFEQALEFARKGGTIDITSSIDEPVAPAEGIARAVQAGIPLARVTLSSDGNGGVAGFETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMTPELRIEQVYARGKLMVKDGKACVKGTFET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isoaspartyl dipeptidase
publication title Functional significance of Glu-77 and Tyr-137 within the active site of isoaspartyl dipeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 131
structure length 374
sequence length 389
chains with identical sequence B
ec nomenclature ec 3.4.19.-:
pdb deposition date 2005-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2aqvA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2aqvA02
4I6KA 2OB3A 1ADDA 3TN6A 4B3ZA 4Z42C 2E25A 1J6PA 3GTHA 1XWYA 4LAOA 1FKWA 2W9MA 1A5LC 1GKQA 2HBXA 3G77A 5A6TC 4MUPA 1A5MC 2P9BA 2VC5A 2PLMA 3S2NA 1K6WA 1NFGA 3LSCA 3JZEA 2HQAA 2F6KA 4GX8A 1WXYA 3EWDA 4C65A 2G3FA 2QT3A 2HPIA 2R1KA 3E38A 4IG2A 2UBPC 1RK5A 1EF2A 5E5CA 3S2JA 3SO7A 3MJMA 4C6FA 3IARA 1EJUC 4B92A 3OQEA 5HMFA 2BGNE 3ISIX 4H01A 2CZVA 3F4CA 1YIXA 2ADAA 4XD5A 4WGXA 4IFKA 4XD6A 3UF9A 3PAOA 2Z28A 3QY7A 1NDYA 1A4MA 3SFWA 3IV8A 4V1YA 3IGHX 2PGFA 3NURA 4DZHA 4LAMA 1RJQA 3MDUA 4BKNA 1POJA 1K70A 4AQLA 4GY1A 2EG8A 4PCPA 2EG6A 4IGMA 3QY6A 1PB0A 4ICMA 4LANA 2D2JA 3NEHA 3LS9A 2ICSA 3R0DA 1EZ2A 3GTXA 3GU2A 1FWEC 1IE7C 3K2GA 1FWJC 4DI9A 4DLFA 4V1XA 4CNUA 3FEQA 4L9XA 4C6MA 4J2MA 3GUWA 3URNA 4ERGA 2YB4A 4KESA 1R9YA 3AU2A 2RAGA 1EYWA 3EWCA 1YRRA 1O5RA 1J6OA 4C6OA 4IFRA 2GSEA 4KEVA 2O4QA 1E9YB 4RE0A 4KIRA 1NDWA 2HBVA 3F4DA 5HMDA 3N2CA 1EJRC 2AMXA 4IQJA 4H9ZA 3LU2A 2GWGA 4H9MA 4DLMA 1PSCA 3K5XA 3GIPA 1KRBC 3URAA 3UPMA 4PE8A 1PTAA 4EPEC 1VFLA 2YXOA 4RDZA 2UZ9A 1EJTC 2Z26A 1A5OC 1V4YA 4NI8A 1FWDC 3B0XA 3E0LA 4I6VA 4C6QA 4C6EA 4C60A 4GXWA 3GRIA 1UBPC 2KAUC 3MDWA 1P1MA 2QVNA 4F0SA 4C6CA 3AU6A 2QPXA 2VR2A 4GC3A 4QSFA 2Z7GA 4J5NA 3FDGA 1RJPA 4DI8A 4H9XA 4HK7A 1R9ZA 1RA0A 3E74A 2Q09A 4BJHA 4CQDA 4C6NA 1W1IE 2FVMA 4GBDA 4P5UA 1ZZMA 2Z24A 4E3TA 1GKPA 3S2MA 3B40A 1M68A 1KRMA 1KRCC 2OOFA 2FFIA 2AQOA 3OU8A 1FKXA 2I5GA 4ZSTA 4AC7C 4G7EB 1ONXA 4DO7A 3MKVA 3HM7A 3MVTA 3RYSA 4HK6A 3RN6A 1YBQA 4GYFA 3OVGA 2HNHA 4DYKA 4ZSUA 1FWGC 2I9UA 2VHLA 3PANA 4H9YA 4BY3A 1GKRA 1YMYA 4GZ7A 2Z4GA 4KEUA 4ERAA 4M51A 4H9VA 1FWCC 4IGNA 2DVTA 3URBA 3ITCA 3QGAC 4ERIA 4HA0A 3B0YA 2Y1HA 1XRTA 3A3XA 4XAYA 1J5SA 1M7JA 4C6PA 4QROA 5CH9A 1HZYA 4RDWA 4TQTA 2R1NA 4F0RA 1FWFC 2AQVA 4LCQA 4LH8A 4XD4A 4H9UA 1I0BA 4H9TA 2IMRA 1ITQA 3K4WA 4CQCA 3E0FA 3BE7A 1V7AA 4GY7A 3WMLA 3F2DA 2WJDA 1V77A 3CAKA 3A4JA 3S2LA 3TN4A 4R7WA 4IH3A 2ANUA 3TNBA 4C6IA 5FSEC 3URQA 4CNTA 4LFYA 3KM8A 3MTWA 1KCXA 3QY8A 3MSRA 2PUZA 3UR2A 2Z29A 3IPWA 3EGJA 4F0LA 5HMEA 4IG2B 1P6BA 1UIPA 1RA5A 3LA4A 1RAKA 3ORWA 2PGRA 1O12A 4KF1A 4IFKB 3OODA 3GU1A 1DPMA 1FWBC 3HPAA 4B91A 3IJ6A 4KETA 4C5YA 1XRFA 1FWAC 1QXLA 2VM8A 3RHGA 3GU9A 1V79A 4QS6A 2R1PA 2FTYA 4J35A 4QS5A 3PNZA 1PO9A 1YNYA 4NG3A 2QS8A 5FSDC 2Z2AA 3GG7A 3WYZA 3GGMA 1UIOA 4R88A 2XIOA 3DUGA 4YIWA 2BB0A 1RJRA 3PNUA 3QGKC 4PBEA 3CS2A 1RK6A 2Z25A 3LSBA 4EPKA 4UB9A 2OQLA 1NDZA 4CQBA 3S4TA 2FTWA 4LALA 4KQNA 4DIAA 2Z27A 3NQBA 3IACA 4R85A 4NP7A 2FVKA 3T8LA 3E2VA 4PCNA 4QRNA 3PBMA 2YZ5A 4C6JA 3GTIA 3LGGA 2GZXA 1EJXC 4HK5A 3UR5A 1P6CA 1EJSC 1BF6A 4RZBA 4INFA 3IRSA 4LEFA 3LNPA 3ICJA 5LXXA 1A5KC 3A3WA 3HTWA 1FWIC 3DC8A 3E3HA 2WJFA 3V7PA 4KERA 4XAGA 4C6BA 4C5ZA 3ID7A 3MPGA 2R1MA 4B90A 3DCPA 2GWNA 1UMLA 4XAZA 2Z2BA 2VUNA 4QTGA 2HPMA 1JGMA 4XAFA 4D8LA 4GOAA 1ONWA 4HJWA 3O0FA 4G2DA 3WZ0E 4IFOA 4C6DA 1QW7A 2Q01A 2EG7A 3GTFA 1R9XA 2PAJA 1XGEA 1E9ZB 2Z00A 4RDYA 4C6LA 2R1LA 2WM1A 1FWHC 1V51A 3OOQA 4XD3A 3GIQA 2E1WA 3FDKA 4PBFA 3F2BA 2P53A 3LGDA 4WVXA 3F2CA 1K1DA 2A3LA 1NDVA 4EP8C 4OFCA 3OJGA 1J79A 4DZIA 2OGJA 2YB1A 3TN5A 1WXZA 3TN3A 1EJWC 2P50A 1ITUA 2DVXA 2O4MA 3O7UA 4GK8A 4UBPC 3LY0A 1I0DA 2WJEA 4IF2A 1EJVC 4LCRA 4RDVA 1YBQB 4KEZA 1A5NC 4CEXC 4G7EA 4DNMA 4C6KA 4CNSA 4LCSA 2OODA 4CEUC 1POKA 3CJPA 3D6NA 1A4LA 3AUOA 2VC7A 2ZC1A 2GOKA 4GY0A 5G4HC 3MVIA 3T81A 4L6DA 3T1GA 4WHBA 4EPDC 3RCMA 3UBPC 2D2GA 4GX9A 1KRAC 1M65A 2D2HA 4LAKA 1S3TC 3C86A 4H00A 4JOMA 5AKQA 2DVUA 4EPBC
chains in the Genus database with same CATH superfamily
2A5HA 3VIJA 2W67A 1OBAA 3R8RA 1CGUA 5CGTA 5DBTA 1R87A 3M46A 2PD5A 3T08A 1E56A 1Q85A 5BROA 1TPB1 4B5SA 1IEVA 1SMDA 3H26A 3QVQA 3TDFA 3W7MA 1FRBA 3LXBA 3L4WA 4JHOA 2G95A 3R2GA 2VRQA 1CEOA 1EF2A 1OQFA 1WPCA 4A22A 4MKNA 1T6MA 3JW7A 3NQ7A 4Z1BA 2OO6A 4UR9A 1S5MA 3E02A 4XIAA 4MM1A 1QCWA 2BLEA 4IICA 3PC0A 1ADOA 3ZWSA 3UXAA 2PGFA 3NURA 4X9SA 2QCLA 1R47A 3WBWA 1F2JA 3S9YA 4AF0B 4FS9A 2INEA 2TYSA 3W1NA 1J8VA 1S38A 1TZ7A 1Z69A 3UXKA 4UTKA 1FY6A 3U3HA 4KRTA 3M0JA 3AMCA 1K7FA 2FHCA 1FWJC 1B54A 4MAVA 4D6GA 4CNUA 3H70A 3SSJA 1EPXA 3NQAA 4QW9A 4A29A 1E1CA 2O9RA 4IRDA 1H49A 1GOMA 2DSVA 1M41A 1JDEA 2RAGA 3UY7A 3B03A 1AH0A 3CMFA 3VK5A 1SZGA 3VX1A 3BW3A 4HNCA 1O1ZA 1BVWA 1YNQA 4P7OA 3HN3A 2ZZ7A 1J6OA 1J0HA 4TTGA 1TFVA 1VCGA 3WNNA 2AL2B 1TPWA 3GHRA 3PVFA 2HSAA 4ZCWA 1W5OA 3ITYA 3BQ2A 1X1NA 1I6NA 1GOWA 4J2PA 5LHFA 2E4TA 4C91A 4M7SA 4KFNA 3RB3A 1NEYA 4WIWA 2A0NA 1XXXA 1B31A 4RNHA 4MDOA 5FCZA 4HB7A 3HGOA 3GC2A 5IDIA 5BYWA 8RUCA 1PWLA 3QZEA 2CZDA 2PWEA 1BQGA 3HJEA 4NASA 3UETA 2YJQA 3KS5A 3GG8A 1RV8A 3KOFA 2WC4A 3LM7A 2G3NA 3O15A 1XGDA 1UP2A 3SN4A 1CXFA 4HNLA 2WQPA 3TONA 4O12A 4GBDA 3W76A 2Y4SA 1F3TA 4RNIA 3MJYA 1UWRA 1BEUA 2PD9A 3FVMA 3FYYA 2VEMA 3H2CA 4HPHA 2I5GA 2VT0A 2X0SA 3RR1A 3V4BA 3RDKA 1XH0A 4GYFA 1CW2A 5DQHA 4CQ8A 1J4EA 4QNWA 5A1AA 3BUVA 3OLIA 4ERAA 2DT2A 4BZYA 4A8LA 3HQPA 3GUGA 4CCDA 4JQ4A 4LUTA 2I14A 1S3HA 5F2MA 4LS1A 3CUIA 2QJIA 5K9XA 1AMYA 5TQLA 4R34A 2WANA 1SJDA 5HQEA 4F0RA 4FALA 4GQGA 4EACA 2EJAA 4C7DA 1XLJA 2AGQA 3DFHA 3E0FA 4D2JA 1I8JA 1R3TA 4O15A 4JIPA 1TWIA 3PB2A 3QHNA 4R8UA 2ANUA 1EP3A 3M9YA 2W79A 2A6NA 4X9YA 2XZ7A 2AQWA 2X0YA 1OK4A 3RM4A 3TYAA 1ODZA 3VIGA 1XLEA 3TJIA 7TIMA 1G1YA 2Z1VA 4B5WA 4YPJA 3P3BA 7PTDA 3AIBA 1GK8A 1BTMA 3D5HA 2DZVA 2GQAA 2G97A 1N8WA 1J9YA 3WJSA 3CWOX 4O1AA 4OVXA 2HWGA 1XLFA 3ZLHA 2A3BA 3W72A 3FW6A 2POTA 4QS5A 4R3UA 4DZAA 3TROA 3UZ5A 3WYZA 3LMZA 2P76A 2I5QA 1S5NA 3A4WA 1FFQA 4NY2A 4MWAD 3BGAA 4EE9A 3A24A 4B5NA 1IEQA 3CS2A 4BQ4A 2WZHA 5HR7A 1R5YA 1UWQA 1UKQA 2Z1SA 1HIZA 1QATA 3EPNA 3LHZA 2YLAA 4I9TA 4CN4A 3KP1A 1F8MA 5D2XA 1JUKA 2VDGA 4B4FA 3BV4A 2NW0A 1CX9A 4GO8A 4QWCA 1HJQA 2RUSA 3TCEA 4AZ7A 5I3KA 3OZYA 4Q8OA 4V27A 2DPIA 3VOGA 1HF6A 2PGEA 3GNXA 3ID7A 2VD9A 3VOIA 3KBMA 3RPMA 5AN7A 2HPMA 3GXFA 2XGBA 4UTWC 5KG1A 3U0HA 3E9AA 2NVCA 4TR9A 2Q01A 4AZ6A 4OUEA 1OF8A 3L65A 4DBEA 1JIBA 2BY1A 1H5VA 3CO4A 3UD6A 1TREA 2C2RA 3UG3A 1E1FA 3PK7A 4XD3A 3GIQA 3SUWA 3UW6A 5G1MA 5E9XA 3QZ7A 1MUCA 3CTTA 4CUCA 3UJSA 2I1OA 3WD4A 1HW6A 4QBXA 4DZIA 3PJUA 1R0MA 1EC7A 1DIDA 3TN5A 3Q8RB 1UD3A 2H9AA 4ED2A 3GDBA 3P8IA 4P7LA 3TSMA 1DJYA 3M9NB 2FTPA 5C0QA 2QUMA 5CAHA 4ECRA 1V0NA 2VC7A 4GY0A 4LNYA 1H2JA 4L6DA 1XDJA 2DW6A 4Y9MA 3NZPA 1K9TA 4LAZA 1N2VA 5EWGA 3BG3A 2Y5SA 2EF9A 4FIRA 1J6PA 3RBEA 3S6OA 4WOQA 3TW9A 3G1DA 3KOWA 2W9MA 5KFPA 3MA8A 3V1HA 4MNMA 3ZR5A 1YPFA 1KBLA 5D04C 2V69A 4N9BA 4MB1A 3L2IA 3KDNA 3MBDA 1E4IA 1NY1A 3LCLA 4MB4A 4WXZA 4AD5A 4GC7A 4ML4A 4ZFMA 2PWUA 4K8GA 2BGQA 2WYSA 2XG9A 5XINA 1LBFA 2WKLA 4DJDC 3UF9A 3MW7A 4DHGA 1ZCOA 3HGRA 1NDYA 1V3HA 5ABHA 4HOWA 1S0OA 3GXDA 4GPNA 3DXIA 5AZ1A 4F0MA 4AQLA 3NZGA 1Q6QA 1CPUA 4JTLA 5D03A 1HQTA 3CTLA 5JBDA 3IK2A 4UFIA 3FOKA 3ZQ9A 4WKAA 1XDMA 3SY1A 1H1ZA 1UD4A 2QMJA 1OIMA 1TX0A 5FJPA 4AW7A 5I24A 3MV01 3M5YA 4JIIX 4XV0A 4CGTA 2JEPA 2W7OA 5BXSA 1Z3NA 2OEJA 3JRKA 3RJXA 4FS2A 4AX6A 4W4QA 1LQ2A 2XC9A 1XFCA 2GSEA 4KEVA 4RE0A 1SR9A 5DGAA 1N48A 5D33A 2C22A 1OX4A 3LZ5A 1O5XA 4Q4MA 2OSWA 1YXCA 1BYAA 1Y5XA 2V2HA 2UY2A 1UJQA 2Y7EA 3L4XA 4D71A 4RCXA 1QT1A 1SUXA 4Q8VA 1Q6OA 5D09A 3T0AA 1CTNA 1EP2A 1HKMA 1QO2A 4QG9A 4DL3A 1XUZA 2BFGA 1A5OC 1ZENA 3LQGA 3P93A 5EY5A 3T0CA 4C6QA 5IRPA 3N17A 2Y70A 1KB3A 3GRIA 1M01A 3LI0A 3T0TA 3CB3A 4H2CA 3P80A 4AMCA 1OZQA 3AU6A 1HP5A 1EB3A 2J62A 3QMTA 1K1SA 4IUGA 1TV5A 4PMYA 4I8DA 2EPHA 4QDMA 4NSBA 3AXMA 3IJ7A 4HK7A 1Z8AA 1FP9A 2VFGA 1QO5A 1H61A 3UPBA 3P84A 4X3ZA 3KLKA 3UZYA 3B40A 2B7OA 3UESA 3GYCA 1UOZA 5DLFA 1TE6A 1NSJA 3OU8A 4Q8EA 4GJJA 3BJFA 4KCVA 6REQB 2QYGA 4ADTA 2AGTA 3A5VA 4U33A 3PANA 4E6MA 2PP3A 2OQYA 3LHWA 2Y0FA 4J3TA 2J9XA 3STPA 5ENLA 1OGSA 3U4FA 2Y1HA 3JVAA 3KXQA 3HZ3A 1REQA 1RCXB 4JTHA 2OG9A 4XD4A 3UY8A 1IZCA 1G7VA 4HU0A 2IMRA 2BP1A 4DJEC 4XZIA 1NOFA 4K1WA 5DO8A 5C2XA 3W7RA 1KFJA 3QV8A 2QUVA 4N9CA 4ZFCA 1PVNA 3OP2A 1SFJA 4DWSD 5FSEC 1UKPA 4HPJA 4CNTA 4JPGA 3VNDA 3TU9A 2Z29A 3PJWA 4L1GA 2DH3A 4MWAB 3TSDA 3BLKA 4UTTC 3RPTA 4OT7A 2O9PA 1UQZA 2E6DA 4JHZA 2VELA 9CGTA 1BXCA 2MUCA 4QFUA 3BLIA 1XH1A 2HV5A 3QLDA 4GCAA 4YCOA 1MRAA 1A53A 5BXPA 5FAGA 4A6GA 4QS6A 3IEBA 3DDMA 2BG5A 1G6CA 3PNZA 3SECA 4WXYA 4XX6A 5G5IA 2QS8A 5FSDC 1KTNA 4PUMA 3S8HA 2BGSA 1ODUA 4FLOA 3O63A 1BYBA 3FV9A 2XIOA 5A6KA 4JFSA 1KO0A 2JGQA 5JBFA 4KW2A 1RJRA 4NNBA 2F6XA 4FNPA 1LZOA 2FZNA 3LSBA 3E2QA 1BYCA 3F4NA 3W7QA 5KFTA 2BHYA 4F4YA 1YPXA 3FKKA 4WF7A 1Q2SA 2FVKA 3T8LA 1M1BA 3M0VA 3CZLA 3GTIA 1TE1A 1W1ZA 2VC6A 1DJZA 3U7BA 3RM9A 1UJPA 1M5WA 4W85A 5BCAA 2VO5A 2WMHA 5T91A 1VHCA 2V2DA 3AICA 4ES4A 4UOZA 5A6BA 1E70M 2ISDA 1DWIM 2D0FA 3OGSA 1XIHA 2VUNA 5LGXA 2NWSA 5KFOA 3W29A 1IXNA 1HN1A 5CJ5A 2FH8A 1LBMA 3V6JA 4MLRA 1ZQ5A 2QCNA 1SQ7A 2OMAA 5KG6A 4Q8QA 3WN6A 3KAOA 4S3AA 1JPMA 1BD0A 4BI7A 3ZZ1A 4UTLA 1YDNA 1VBRA 4DBUA 4M6VA 2BQUA 4O1DA 5D30A 1GVSA 2X0HA 3TMLA 3BPWA 3EAUA 4JD4A 1AJ2A 1UR3M 3EEZA 5D2YA 2C8NA 3MKKA 3W07A 4JICA 1H7XA 3AROA 3TN3A 4S3EA 1VAHA 1PCKA 4LY4A 3IIVA 1AQMA 1WZAA 2XTKA 4E0CA 5HA7A 1VBJA 1F6KA 2PU1A 1L9WA 3BCFA 3W87A 1XIMA 3SCQA 3DG3A 2FZDA 4X60A 4WDWA 1S3TC 4UXDA 3SUVA 2P5NA 3MR2A 1DV7A 1B3YA 4MG4A 4IMDA 2ZC8A 2V68A 5FF7A 1YLVA 5B7YA 3DENA 3VGHA 3G77A 4Z1CA 1XBZA 3QFWA 3MKCA 1RSCA 5L9FA 4QGCA 3M4HA 3U2EA 3WD0A 4IMGA 5FF2A 5EKYA 5F9LA 2F6KA 1S46A 4JTUA 2I17A 4IIHA 3PZMA 3W70A 1NF7A 4WX2A 4JY8A 1OFQA 1Q45A 2D69A 2BGNE 3KE0A 4N4PA 1B0IA 2BVYA 3ME3A 4C7GA 1JPKA 2GVJA 4NZ3A 1U30A 4LVDA 2WO5A 1S9FA 4F50A 3C0QA 2V3FA 4Z2HA 5LNUA 5I06A 3S3GA 5CLTA 5C9RA 3W7PA 4G9PA 2RHGA 3TQVA 3UWEA 2I5IA 3FAWA 2B4GA 1DWJM 1KBBA 1QHPA 3WUEA 1SZFA 5LXEA 1GVQA 2IPGA 3HQ1A 5C8BB 4QAIA 3E96A 3LBMA 3ATYA 4DI9A 2YCIX 2ONEA 2VFDA 1GVRA 1R8LA 1EDQA 1QBAA 4GD0A 4UQ9A 4F4WA 3L4ZA 2ZZ5A 3C4UA 1TVPA 3OBEA 1W91A 2W8KA 4GXPA 2PI6A 3A9IA 2DH2A 2VGBA 4RNNA 2UWFA 2ZTJA 4NJGA 3UNTA 4LVFA 3VNIA 4H6QA 4AISA 1ZL1A 4QX4A 2DEPA 4FX7A 1THFD 4O10A 5DX7A 3V0SA 3LU2A 1UKSA 3NPVA 1F76A 4QNEA 5CC5A 1Q4NX 1I75A 1UKTA 5LA2A 1CYGA 4U3AA 1KGXA 1N56A 4ZQOA 3L0GA 4ONVA 5DRIA 4EPEC 3T42A 1UC5A 2VWTA 3WQDA 1SM9A 3KHLA 1PYMA 1PKYA 1SJAA 1K9EA 2GJXB 3C8FA 4DL4A 3K46A 4CN6A 4UNLA 4GC3A 1PIFA 4US6A 3C0LA 1ZBCA 3IK4A 2HE8A 4DI8A 2OPJA 1TV4A 5LNSA 1WB0A 1J0JA 4OOUA 1OFRA 1W8SA 4GI6A 1OFPA 1ITXA 3W75A 2E8YA 4PFMA 5HPOA 3P0WA 1QUMA 1M68A 3GH5A 5KFRA 2PDYA 1KRCC 2J8FA 1LTDA 2QMKA 1TPC1 3W6YA 2ZZ4A 2BS9A 1JUEA 4DWSB 3BOFA 3NVDA 3W2MA 1O7AA 4UOQA 4O19A 3NSMA 3HQOA 2I9UA 3HV9A 3R6IA 3TVAA 1GKRA 3VINA 1KNWA 3I68A 2BOGX 1FWCC 5KFVA 1HXJA 2ZE0A 2O7SA 5H8UA 3O2LA 4FXJA 4ERIA 2R8GA 3LHVA 1C7TA 4FNQA 4AX7A 3A3XA 2P0OA 4JTGA 4AZCA 4JKKA 4GZJA 4XBJA 3MZ2A 3S2CA 3KL3A 3GH7A 1ZAIA 1H3GA 3B8VA 4H9UA 4EX4A 2DZPA 4H9TA 2ZWZA 2FGZA 3SSZA 2V5CA 4TX6A 5A6LA 2IKJA 1QBBA 4L64A 1P7TA 2WHKA 2V81A 3TC3A 1O68A 4HNVA 2YSWA 3N4FA 1EFZA 4LFYA 5K7JA 3ARSA 3NSXA 4FO4A 1MI3A 3NO3A 4Q4PA 4PMUA 3DYMA 5A69A 1K9DA 2G3IA 1OYBA 3GXIA 1OCJA 4L4LA 5TBOA 6TIMA 4TVUA 4FAMA 2PGRA 4NZ5A 5HXMA 3ARRA 5T9CE 4FF7A 4GC4A 1FWAC 1WOBA 5DFAA 3RHGA 3QC3A 3SCTA 2FTYA 3TJ4A 4IR9A 1FTXA 2EEXA 4BQ2A 3DESA 5DG8A 4J9SA 3NQCA 1WDQA 2ZZ3A 3TWAA 3TFCA 4R88A 2CIPA 5AECA 5FEXA 3GFYA 4JDYA 1NM9A 2A1YA 2CLEA 4JX4A 1LOSA 2X16A 3R79A 2UVWA 1TJ1A 2VKZG 3QGKC 4PBEA 3MFHA 1E0TA 2OCZA 3UJ2A 1KM5A 4EOUA 4LU0A 4LVBA 5EMYA 3SRDA 1IHIA 3N18A 4IX2A 1PTGA 3IACA 4ORIA 4QJ4B 4L9YA 3L12A 4C6JA 2E77A 2QCMA 3O3RA 4JS3A 1EJSC 5E6ZA 3QXBA 1W1PA 4INFA 2A3EA 2VEFA 4ZOAA 3G1HA 3KBSA 4AIEA 4KWSA 3BSHA 4KERA 1Z48A 2Z1BA 1LBLA 5TNVA 4DL5A 3A21A 2GQ3A 3WEMA 5PTDA 1P1XA 2YPIA 4JKMA 3V0TA 1T7LA 1JGMA 3B9EA 4HJWA 3G1YA 4RZ4A 2H8XA 3WJXA 3O0FA 3WZ0E 4FLSA 5DANA 3UWUA 1XGEA 1E9ZB 5GPRA 4TX9A 5D2VA 2Q8ZA 4OJYA 5A8NA 3EKGA 3H4BA 1XYLA 3HFYA 3FDKA 1JXJA 3VPLA 3JUGA 3A12A 3NUKA 5EL1A 1YTEA 3A4XA 1M6JA 3GVRA 2FVLA 4ML9A 1TMHA 1DIOA 4XUYA 1JCMP 3EBVA 1SZNA 4OBRA 5BRQA 3H2NA 2XSXA 4EBDA 3LY0A 3DFQA 3WL1A 1TVNA 3GVGA 2J7GA 2WCGA 5BRPA 1IEIA 4HTYA 1FWWA 3W37A 3IGUA 3LLDA 1JDFA 5A2BA 1AQHA 3A4AA 4HPXA 3SCWA 3FEMA 4GX9A 1M65A 3M7WA 2PCEA 2NQ9A 5HQLA 3LGEA 1XKJA 1FP8A 2FB3A 3UFYA 1EC9A 4JX5A 1K4HA 1ZJIA 5F1VA 3KCLA 1FKWA 4NI3A 2NX1A 1A5LC 1KM2A 3ZT5A 4P7RA 3LV5A 4O16A 3LRKA 3OLEA 3ZR4A 4AG0A 4OHQA 2PLKA 1XCWA 5KFYA 2FFCA 3VDGA 3V5FA 1EWEA 1U2YA 4EIVA 3ZWTA 2Y5EA 4U10A 2QJMA 1ZBWA 5C54A 1DWHM 2ATSA 3NPXA 1S5VA 4QG8A 4K39A 3T5JA 2YIHA 3M0HA 3WDQA 3G3MA 2CZ5A 1PUDA 1TIMA 4US5D 5BXRA 3AYTA 2ALZA 1EC8A 3SQMA 4CN1A 3L68A 3LTSA 3MP5A 5LIWX 5KT7A 1V6VA 3UGVA 3GG0A 5EWEA 3NOYA 3W24A 3WIJA 1QI5A 3DKJA 5CSUA 4JTEA 4H6EA 2AGPA 3N9SA 1EHAA 3K13A 1XRVA 3HPZA 3KDOA 4DXKA 1DE5A 3APGA 3NM3A 4IIEA 5F2IA 2PFHA 4OU1A 1PE1A 2D2JA 1LM1A 3OYXA 2OELA 3H7VA 4GUFA 3HGSA 3FA5A 3SQLA 4B2DA 3ENLA 3LHYA 8CGTA 3WLMA 3W00A 4YWIA 3G0SA 1XLHA 4NYYA 3BG5A 3TYCA 1JI2A 2ZZ2A 4KESA 4TO8A 2QDGA 2W4XA 3SUUA 4IIDA 3PVXA 4PULA 3MUCA 3ITOA 3W84A 4PMJA 1KTBA 5E1QA 3S5NA 1DJHA 2YGYA 4NAFB 4NZJA 3VMOA 5H8PA 2G37A 3WLNA 4HTBA 1OG6A 1OX5A 3GV8B 3M6DA 3QR1A 4E2VA 2RDXA 1CGTA 4UTFA 3H53A 5CZKA 2UZ9A 4ED0A 3ANUA 3BLOA 4HU3A 1ITCA 2QW5A 5HJXA 3R10A 3KHJA 5CZ0A 1BKSA 3N2TA 1ZALA 2WZMA 1PIIA 3RO6A 1J93A 1DE6A 2XH4A 1UROA 1ZP4A 4PUUA 3QC0A 1UR0A 3GTNA 3O9NA 1ZGDA 1F6YA 3E74A 4C6NA 4H1ZA 1AW1A 2ZX7A 4Q8NA 3WQ8A 5I07A 3AMDA 5FAJA 2E1DA 3AIWA 1KCKA 7A3HA 2TSYA 3W2KA 3PWAA 2HS6A 1OZMA 2WMFA 2GVGA 2VR4A 3RLGA 2ZUWA 4PSRA 4XKYB 3CL8A 4N9EA 1BWKA 2CHNA 4KEUA 1EDTA 3RAQA 2X40A 3ANVA 2HCVA 4R9XA 2DVTA 1D3HA 4ECWA 1IXOA 4NAEB 1J5SA 1LL4A 5HAOA 1A5CA 4RDWA 4GQ0A 3CZEA 4H4IA 4J9KA 2REQB 3PWIA 3SCVA 5HANA 1XH2A 4CNPA 4KT2A 3F2DA 3WLPA 1ZP3A 3TN4A 3DBPA 4EF8A 1PKMA 4AD3A 2IMWP 1KFKA 3GC5A 3L67A 1MUWA 3BV7A 3SR7A 1H0GA 1X38A 5ABFB 4FX8A 1QI3A 1D2KA 3ALGA 3QOKA 4JNZA 4AZBA 3EA1A 4H83A 1RA5A 4UTIA 4Q43A 3C2FA 4AFYA 1TJRA 2Z6IA 4S3JA 1XPYA 3G1XA 4MWAE 4CD8A 2DY3A 3QTGA 1ZPTA 4H6KA 4DUWA 5FJTA 3KOZA 4KETA 1UP0A 3L7RA 1QXLA 3DG7A 2VFIA 1OINA 3DOPA 4Y6GA 4KRUA 2C7FA 5M5DA 3E0VA 2PDMA 1LG1A 3HA1A 3EOLA 3TC7A 2GQ9A 1Q8JA 1VFHA 3C6CA 1KD0A 1BRLA 1TA3A 3AQUA 3PNUA 1X7FA 2CLPA 1OFBA 4KKXA 3H4DA 4UMAA 3UYCA 3L5MA 4BEUA 3L2LA 3NQBA 3AWOA 2WSKA 1KGUA 2WMIA 5IBXA 2D1ZA 1AG1O 4HHHA 3U2OA 1XD0A 5CEWA 1C91A 3AOFA 3DZ1A 1J2WA 3GX9A 4Q6JA 2A3AA 3GKFA 3H8AA 4XZ9A 1FWIC 1XYFA 2E5DA 5KG3A 5HINA 1VFOA 2CBUA 1PZ0A 1YX1A 1T8XA 4C6BA 2W5FA 1R3QA 4N02A 3QH2A 2ABBA 4QTGA 2O0TA 4ED3A 5JVLA 3BJYA 4XAFA 5JXQA 3ZXWA 1US2A 2PAJA 4AWSA 2HISA 3GWQA 1NIUA 4LV9A 1V51A 1R3RA 3BXWA 1Y5WA 3QF0A 1KR0A 4JFTA 2Z0IA 2Q6ZA 2XYLA 4NYUA 4POCA 3NQVA 4K7YA 3BL3A 4WGHA 2GGHA 3S9ZA 3QM3A 4YL2A 4UBPC 4IQLA 5LGZA 1VGAA 5EBAA 2YCJA 1E71M 1ZFJA 3C2VA 1GQIA 3EPMA 4TXEA 4JN6A 2EPKX 3DYPA 4PUJA 4JL1A 4TV5A 2J6TA 4F3HA 1P0NA 1AFSA 3A9BA 2VD8A 3KBNA 3CHCA 5KETA 4Z1AA 3UBPC 2Q71A 1G5AA 4WR3A 1LF1A 1Z41A 1UZHA 2QCDA 3I7SA 5CPNA 3EKZA 3PTMA 3WFZA 2VFFA 3GYEA 3GTHA 1U83A 2Y61A 1JYXA 2CHRA 3EWZA 2ZX8A 1KGWA 3GLCA 1P0KA 2B7PA 1H1YA 1SZEA 4XTDA 3EPIA 2YL6A 3SIMA 3NPWA 1XSKA 1VFTA 3VGGA 2NVDA 3W1QA 4IG2A 4OECA 4E4FA 1KV5A 1V8EA 3TXVA 3NIYA 1EDGA 2QDEA 4Q8WA 4HKPA 2P1FA 1EJUC 3GHTA 4ECLA 4O1FA 3CEUA 3LCHA 2CPUA 3QQWA 3RGTA 3EKLA 4XD6A 4EYIB 1ZJAA 3QY7A 1GOKA 4AEFA 3TXZA 1A4MA 1CWYA 5IFPA 4FZIA 3VD5A 3WJYA 2A6LA 3OHMB 2XZ9A 2EG6A 2Y7GA 4K1GA 4NL1A 4JIQA 2QCHA 4ZR8A 2C71A 3JR2A 4O3SA 4ICMA 4LANA 1Q13A 5A8MA 3R43A 3LCWA 3BGGA 1LROA 3ZM8A 4ATDA 1QPOA 2JF7A 3V5CA 4LSBA 2OYLA 4GYKA 2BX7A 4GWEA 4L9XA 4LT9A 3PBGA 4GI8A 1V0MA 1Q65A 3TTYA 1NWSA 2DIEA 2F84A 1TWSA 3WF3A 1NFPA 1XBVA 5C5YA 4PUNA 3KEHA 4IPIA 5AYYA 3BQ0A 1JR1A 4YNGA 3I7RA 3ITTA 1F3WA 1SYTA 5I3DA 5I77A 4IJBA 1RYSA 3LQLA 2XWEA 3AIQA 3C56A 4DQWA 1RVKA 1C90A 1Z89A 4U7CA 5CPSA 4ZQCA 1VP5A 1WYIA 4JQAA 3K5XA 4IMCA 1LT8A 4Y7EA 1W1TA 3WNPA 2O56A 2CHOA 2V67A 4UC5A 3II1A 3WNMA 4QISA 3CIVA 3GXPA 2DORA 1ZTVA 2CBIA 3Q67A 3CT2A 4GXWA 3G24A 3W25A 2YL8A 3V3WA 2Q8LA 2YKKA 3NNTA 4Q4QA 3WQ4A 9XIMA 1B3WA 2H6RA 1QNQA 1AK5A 4O28A 4H9XA 1GTEA 4IZGA 3CLWA 4H7CA 3EWYA 3WD3A 4ACZA 4JV0A 4P5UA 3AHXA 3RB0A 2VZOA 3WH8A 1BWLA 2YL9A 5ABTA 3KLLA 3IN5A 1QJWA 4NJHA 5KSWA 3MVTA 4J28A 8XIAA 3GW3A 4PMXA 4M19A 4OV4A 1UOKA 1F4HA 3KVLA 4H19A 1LYXA 1VLIA 1JZ8A 3B0UX 3EWXA 3URBA 3PW0A 1F6PA 1MQQA 1K3UA 3NOEA 1P43A 4LYPA 1XHGA 3KOXA 2JEIA 5LNVA 3UGRA 2YCLB 3GB6A 1EEPA 1TJ0A 5BOFA 3WF1A 1ITQA 3K4WA 1RP9A 2Z2UA 5CC7A 2QGYA 2C15A 5DQPA 2QV4A 1B30A 3A4JA 1C7SA 3CWNA 2FYMA 5D02A 1ADSA 1DP0A 4IR1A 1TQJA 1KCXA 3EGJA 5KTLA 3GZ3A 3L4TA 1JULA 2CERA 1GG0A 1XLDA 3V18A 3WX7A 1DTNA 1QWKA 4EEYA 4LJ3A 4Y9AA 4MYXA 2B0MA 2YYUA 3WCZA 1JYNA 3A6OA 4Z1DA 4IFKB 2R91A 3FIGA 5FJUA 1FWBC 2PDWA 4JTAA 1O95A 2E28A 1X6UA 3TYBA 1GYMA 3F5JA 4Z2JA 2AQ4A 4QWEA 4O13A 1NELA 1JNEA 4UTJA 3GG7A 3M1ZA 6XIAA 5AC6A 2WLYA 4YIWA 5HUOA 4DJFC 3I6TA 3ZVHA 4NIRA 4JQ3A 1UW9A 4Y8FA 1N7KA 4UNKA 2V5BA 3S4TA 5CC3A 1DHKA 1V3LA 3I65A 1Q2RA 1S0MA 3WDIA 5T8GA 1GORA 1BF6A 2J47A 3VNMA 2TMDA 4UMBA 3VKKA 3LNPA 4JYDA 1R3SA 2BXZA 4TQSA 2QAFA 1E0WA 3S1WA 2QJHA 4JFVA 3B9DA 2BVTA 3AXKA 4IHCA 1JL8A 1F9CA 4K6AA 3CUFA 1PCWA 3GNPA 1U5VA 1GYLA 5D4YA 3H2FA 4GE8A 1P48A 4YU1A 3VO0A 5CBIA 1CXHA 5C9ZA 3W1MA 1OFOA 4LW7A 4S39A 3GDLA 2HEJA 3FJNA 4PBFA 3SM0A 4IP4A 2DZSA 3WLLA 3MO7A 1NDVA 4JIEA 4EP8C 2J9YA 5KFSA 3PZTA 3SEPA 3BOLA 4YLWA 5JUVA 2IXVA 3JU2A 1LRNA 4HZ7A 5AC7A 2WCSA 1VRDA 1XG3A 2VC9A 1EJWC 3A64A 1EBGA 3D46A 2CW6A 1UPMB 1E0XA 3M16A 3GIIA 5JIWA 3GAKA 4HU4A 5BNKA 1GQJA 2R8IA 2XN1A 1PBGA 2ISSA 3MCNA 2XIMA 1UD2A 5DEZA 3F4WA 4CQ9A 1H7RA 2XVLA 4ZVJA 3VMNA 5BW6A 4MPQA 4F2UA 3BAIA 4FNSA 3MR3A 3PHAA 4QE5A 2BOFX 3W28A 5FF0A 1EGVA 1XG4A 1W3IA 4OUIA 1WDPA 2QJGA 4JAWA 1KQZA 4LF2A 1OWQA 2YYTA 3M9MB 3HO8A 3E5PA 2YW4A 4A21A 3GK0A 5CPQA 2YOCA 4W9TA 1NFGA 3VNLA 1D8WA 1EH9A 1WXYA 4TVDA 5JU6A 2P0IA 1FUYA 4IL2A 1E6SM 4WKHA 4JGDA 1G4EA 3VU2A 1EWDA 3F4CA 5IOBA 2D22A 4O17A 4XD5A 3QLLA 3WQVA 2GVLA 1BLIA 4ZZ9A 3VZYA 4N9DA 1W8GA 1WQ5A 3C3UA 2FPYA 1EUNA 3QPEA 3ITGA 2TRSA 1M03A 1GQNA 1B9BA 2QCGA 2ZUSA 1UR2A 3U7VA 1AQFA 3DFPA 3EEGA 2UY4A 3TFXA 1FWEC 5I3JA 1AZ1A 3LCXA 4UNIA 3GUWA 4X2RA 4X63A 3MSGA 3URNA 4JTSA 2FJUB 2VYOA 1VYPX 3DG6A 4JR5A 4ROPA 3LHTA 3NL3A 2ZXAA 3TYZA 3BLFA 3W7EA 2G96A 3B0VC 4UR7A 2QXWA 1CT5A 5EMKA 4IRKA 3QR0A 5KT5A 2ZUNA 3F4DA 3CV6A 4QLKA 5J5DA 5HULA 1VB9A 1ISWA 4J4KA 3N2CA 3W1LA 3PUDA 4W87A 1ICQA 2NUXA 3LG3A 3MR6A 1OCNA 5DCEA 1MNZA 4PMZA 2C1GA 3DC0A 5M03A 1PTAA 1IQ8A 1KXVA 3ES7A 5FEZA 4Y9PA 3THDA 3KBWA 3BQ6A 4FBUA 3VKDA 3CU2A 3E0LA 1M53A 2I57A 2NVAA 2KAUC 4BCEA 4H7VA 3G6LA 2ZRXA 2XM1A 1XCXA 4QSFA 4GYJA 3SBFA 2FDSA 1VCFA 4LPCA 1R9ZA 3M0KA 4CQDA 4ZQNA 2WBKA 3TP4A 2EPOA 4WY0A 5L9XA 2Z24A 3SDOA 3S2MA 1S2WA 1M3UA 3GR7A 4PR4A 4K2SA 3GV7B 4GI4A 3RNDA 4KFPA 2PBGA 4ED6A 1GJWA 5MKGA 3RILA 2CLIA 2GGIA 3PR2A 1K7EA 3OVGA 4MJ4A 4LB3A 4A8RA 4CLMA 4OGZA 3FNDA 3CHFA 1MWOA 5AHMA 3GE7A 1GEHA 2G3MA 3PTKA 1XRTA 4D72A 3MSYA 5FEWA 4C6PA 2X8RA 2WC7A 3G1RA 1YW1A 3THAA 4TMCA 1XLMA 2AQVA 1DVJA 4LH8A 1UB3A 1XP3A 3RCYA 3SUTA 1TTIA 1PAMA 4AWTA 4HCLA 4ECTA 2WJDA 4DXXA 1YE6A 2BSLA 1CLKA 4HPNA 4QEEA 4MYAA 4PTVA 3AISA 3MI3A 3UXDA 3DHUA 2CKRA 3BANA 3WUFA 5FIPA 1HKIA 2WSYA 3M5XA 1WOAA 1FHVA 2HVNA 1YYAA 4XIMA 1HG3A 1G4PA 2F7FA 4YVXA 5BU9A 2ZTKA 1Q6FA 5CPOA 2BY0A 3VVGA 4E2OA 3HG3A 4G7FA 3OZPA 4UZSA 3FXGA 5I00A 5DCDA 2C2DA 5KG5A 2J25A 2GLKA 2ZUVA 4FIQA 1DPMA 5FACA 2PEVA 2V38A 1JZ3A 4UFHA 3KRZA 2BQRA 1Q7QA 1JRCA 1MXDA 1VJSA 4RKAA 1TV2A 4UWMA 3GDTA 3HURA 1S5WA 1TV7A 2GFTA 3M43A 4M3PA 1RUSA 1AJ0A 1RH9A 4FI4A 4JNMA 3PUGA 1GOIA 1E1CB 2PP0A 1I2OA 3BCDA 5A6AA 3BAYA 2RJGA 3DFSA 3RG6A 3CV1A 4DWDA 1TPVA 3F03K 3A5FA 3B9OA 3WQGA 4KWUA 4DX3A 2C0HA 3WMCA 1B57A 1ME7A 3BZJA 1Z7AA 1E40A 4I5RA 2ISFA 4W86A 4AZGA 1W37A 3TW7A 2FQIA 4JTKA 1DTUA 4D8LA 1XM3A 3TQKA 4AY7A 4R27A 4P7NA 1Q7ZA 2AMGA 3TSBA 1MEHA 1E0UA 3MMUA 3P0XA 3WNOA 4G1NA 2JEQA 3GQCA 4MADA 4OBSA 5DMYA 4E4UA 1GEQA 4RNOA 3EOOA 3MU7A 3PG9A 3PULA 1XINA 1EIBA 5FESA 4P2VA 3YPIA 4LC6A 3DKLA 4L4OA 3PZPA 2OZTA 3O7UA 7REQA 2V4QA 1WO2A 3W4RA 1UWIA 1A5NC 4XG1A 3NXFA 1T8QA 1O6IA 4P8VA 2F9RA 3CJPA 1A4LA 3AUOA 1QK2A 3T2PA 1RY0A 5G4HC 4LUTB 2FHBA 4AAJA 4IPNB 3VCNA 1AUSL 4Q8UA 2ZVRA 1JZ5A 1T5AA 5M17A 4GJ1A 1ISYA 4ICNA 2AU0A 2PE4A 4TUFA 4Z42C 2C91A 3D47A 3O06A 1UH4A 4YTUA 1NF0A 5C2GA 4R8UB 1XLAA 2FLNA 2VC5A 4I7WA 2C0AA 3W3OA 4F8XA 2XPKA 5A2CA 2WQDA 3N6JA 4A3RA 5C2CA 4L65A 3EPGA 2NUWA 3BAXA 4HYRA 4AVFA 1RK5A 3S2JA 1A5UA 1E9IA 1ZNNA 3UR8A 1MDRA 3LXAA 1T94A 1GNXA 4HIBA 1M04A 5IXEA 4LX4A 1YIXA 2G8ZA 3SFKA 4LAUA 4MTVA 5D05A 4MFEA 2GL5A 4YHGA 1L2UA 3B9NA 3SFWA 5G2HA 1WZKA 3WDPP 3LOTA 3DHFA 1LOQA 3APYA 1Y65A 5A8PA 5HJLA 1XW8A 4W7WA 3GY1A 1F74A 3QSTA 2PDLA 2D24A 4F48A 3T40A 2WC3A 2YCEA 4JCLA 1E4LA 4FS1A 4KWOA 5LA1A 3CYVA 4L7ZA 4I9MA 1PKLA 1IE7C 4DLFA 1PDZA 1W3JA 4I3GA 2HMCA 1G4SA 3CUJA 4IT1A 4OTKA 4ERGA 3E2RA 3KL5A 3WH7A 4C1NA 1X7IA 3MFIA 1V3IA 1W1YA 1GHRA 3CH9A 2YCKX 4D1IA 3OG2A 4BF7A 5C71A 3APTA 3N2OA 4I90A 1W31A 4V28A 1W3LA 1VIZA 2Y8VA 1RCQA 4HYVA 2XU2A 1OFAA 3FX4A 1H60A 5KFNA 5REQA 1TJ2A 2FGLA 4BWLA 3ABRA 1C8QA 2CXEA 4KCWA 4JNYA 2OYKA 1X6LA 4HHMA 4WJXA 5KFUA 1ZHAA 1AA1B 3F5LA 2ZZ6A 4U5KA 2KX9A 2W91A 4NI8A 1J96A 4A05A 1TZZA 2BY2A 2DGAA 4OV9A 5EGRA 4ZE4A 1UUQA 2Y6ZA 3AC0A 3GVQA 1QW9A 3CH0A 1QHZA 3PW4A 5KFAA 2QUUA 4NRRA 5L1LA 3CB8A 3BLDA 3WF4A 2CBJA 1W1IE 2J66A 2DV0A 5A6BD 2VCCA 1VENA 3L2MA 3L4YA 1ZZMA 3CV2A 4V15A 1UH2A 3L5AA 5GJPA 4WDTA 3UWQA 4DJEA 3VABA 2H9AB 1MQPA 1W3HA 3CAWA 3WDRA 2BQ3A 4Y8EA 1VC4A 2PGWA 5KZMA 4RNMA 1ONXA 1NJJA 2R14A 5KMYA 5KZDA 2IS7A 3RN6A 2R8KA 2VZSA 3GQYA 3H7UA 5I02A 1JIHA 4HNTA 1DQXA 3N19B 2WOQA 2NV2A 2E5CA 2Q3OA 3SN1A 1PKNA 4D6HA 1K8YA 2BDQA 3BTNA 2EPNA 3RX2A 5SWUA 4GMEA 3W02A 3PTQA 4CU6A 3LERA 3GILA 1I45A 3JZUA 4PB5A 2HXTA 3VKJA 3CQKA 5DMMA 1LDCA 5HNRA 5DCBA 4Q4OA 1E6XM 1JEZA 3QSRA 2QF8A 3PZQA 3RIKA 3W1TA 1OJXA 4WSJA 3ORWA 4LEQA 2BXVA 1YKWA 2RJHA 3ZOAA 3PTDA 4OE7A 2ACUA 1E5JA 2PTYA 1KQYA 3DH7A 4PCTA 1HNYA 3HPAA 3RUBL 3FGCA 3IUHA 3T44A 3VILA 3UP8A 3TQ1A 1KW1A 2WMGA 4ORMA 3ABOA 3PR5B 3SZ8A 3FYOA 4JV2A 3ZIZA 2B81A 4XZHA 1UIOA 1B1YA 3BSGA 1A49A 1MFUA 1UPPA 3VC5A 2CLMA 2GJPA 5FJIA 2EBNA 3LENA 3RAXA 3EB2A 1GZJA 8TIMA 1BSLA 3WLJA 4EPKA 2PWDA 4JTRA 3RITA 4U4MA 4UB9A 2OQLA 4A3HA 3THQA 3E2SA 2XN2A 1D7FA 3QOMA 5KFDA 2DJXA 3M47A 4Z2KA 3OGVA 1IGWA 4PODA 4OKDA 3PAJA 3LGGA 1KM3A 3LNMA 2EAWA 1J0YA 5A8OA 1FH8A 1OX4B 5IHSA 3DC8A 1BF2A 1W9PA 4N4QA 5H8MA 3CUHA 3BOXA 4HSNA 3ABZA 1Q4WA 4A8NA 4TVCA 5DY3A 1T0OA 3MUAA 2DZWA 2PC4A 1A0EA 1AL8A 4A2SA 1WA3A 4LUIA 3KUMA 4PCFA 4AEOA 4YXGA 3VC6A 4C6LA 2Z00A 4ECZA 2R1LA 2CLOA 2YDRA 2IKHA 4DO5A 4MJMA 2J8TA 5LIXX 4LS2A 4DUOA 2E9LA 4GH3A 3EA2A 1MW2A 1TR1A 4EANA 2ZRVA 4PMRA 2A4AA 4XZWA 3DX5A 3EWWA 4W88A 3T78A 1TJPA 2P50A 1LJYA 1KLYA 1TVLA 3N14A 1E43A 4LCSA 1C3FA 3VNJA 1XIBA 3VDAA 2H90A 5KZEA 2DJLA 4XBKA 6PTDA 2DW7A 5KFCA 4W89A 1SFLA 2D2GA 1KRAC 1REQB 4LTSA 3GXNA 1TTJA 4EPBC 3TYUA 4I6KA 2OB3A 4J9MA 1G94A 3REQA 1B3VA 1S5TA 5KG7A 1RLDA 5FI8A 4ZB0A 4W84A 5U7SA 4B15A 4DAIA 1BTCA 5KFEA 4J9NA 4QE4A 3NG3A 1VD6A 2XIBA 3HJZA 4QE1A 1VF8A 1CGWA 3NDYA 4WQ6A 5CQ1A 3VM7A 4AY8A 5JQ9A 3N73A 4P8UA 3VKBA 2JFEX 4FR1A 2R24A 4HBKA 4YP3A 2OZ3A 2UBPC 2WNQA 3OG3A 4PC8A 2VEIA 2YLLA 1EGMA 5F4WA 3RMEA 4Z17A 3LEPA 5M3WA 4Q4RA 3PBVA 1Z44A 1UR4A 5AYBA 1AH4A 4C1LA 3RRXA 1S2TA 1U33A 1W0MA 3OBKA 3PFMA 1YQ2A 2INFA 4NXKA 3PW2A 1VFSA 2VQUA 5KFJA 4ZXLA 1L8PA 4O3QA 1D9EA 1VHNA 2PWVA 3QHMA 4I9AA 3QY6A 3O0KA 3AZRA 2DT3A 2V2CA 5MF5A 1W17A 3ZVIA 2OKTA 3WQOA 3BCJA 3LS9A 4MWAC 4PEKA 3ZT7A 4UUIA 4JZ5A 2VZUA 1SO3A 4J2MA 2OVLA 3AU2A 3ZJ7A 1LCOA 2QUNA 3UZJA 3VTRA 5LA0A 4HYWA 1TPDA 3EWCA 1TPEA 1O5RA 1WKEA 3W7OA 4AIUA 3R13A 4O0KA 3DGBA 1Y5VA 2IQDA 3CZJA 2GPTA 1ENUA 2HBVA 5F9NA 1A3WA 4N0RA 5HMDA 1S97A 3OIHA 1HGWA 5G4EA 1XYAA 2PTWA 4L1XA 1UD5A 2RFGA 3SUSA 2YFNA 3N12A 2PDUA 3KFTA 3P8JA 1EJTC 3BO9A 5HNTA 3KTSA 2HDJA 1V4YA 5D9OA 1QPQA 5L1KA 1XGZA 4I6VA 4ED1A 1EA9C 1L6SA 3TTEA 3TTQA 4XB3A 2NSXA 2DFAA 4O52A 5CSYA 3G2GA 1U1HA 2E5BA 3AXIA 3IRDA 1RA0A 3W7HA 4DPQA 5J5RA 2CWNA 3NCOA 3VYLA 3B8SA 3B8TA 3GW0A 1W2VA 1B4EA 2PF0A 5CGQA 3ARQA 5GNYA 3QZ6A 1B5TA 2J13A 1RCOB 3BGJA 2DSZA 1ICSA 3PJTA 3NL6A 4H7ZA 1AODA 4GABA 5AHFA 3RYSA 1GWJA 3SW6A 3N2BA 2WVVA 2WCAA 3FK4A 2OU4A 4G3IA 1GQKA 5D2WA 4D8AA 1Q6LA 1ZB5A 1PDYA 4L56A 4O18A 4M51A 4NKCA 3WO8A 4RPQA 2MNRA 2NT0A 5I3GA 3W6LA 1BYDA 4ADSA 2WZIA 1DOSA 1DIKA 2AAMA 1FXPA 3OVRA 2OX4A 4GFIA 4FLRA 1R7OA 4WRHA 4HQVA 5DF0A 3K1GA 1UA3A 1XJBA 3WMLA 5KFFA 1CGVA 3AIEA 4O3RA 2BTMA 1ZUAX 5AOUA 2J7EA 3M0ZA 4DL7A 4RW5A 1RQBA 1EQCA 1RD5A 3AHTA 3Q45A 2WHMA 5FEPA 4GH1A 2B31A 3MTWA 1VEMA 4ILSA 4LS0A 1H0IA 1E0VA 2NUYA 1FH9A 4XZLX 4IMAA 3W7GA 2DPEA 5CBBA 3MUZ1 1A5SA 3BSMA 2I16A 4FP1A 1QFEA 1P0EA 4B9ZA 3IJ6A 2C18A 5E0CA 4ZXOA 4FR6A 1GZGA 5B80A 4I5UA 3WQEA 3MY9A 2PRHA 1HTIA 4E5TA 1PO9A 3MP3A 1YNYA 4NG3A 5TF0A 4YYFA 5ECVA 3FHAA 2V5JA 4J9QA 1NAL1 4IQEA 1F61A 2J4GA 2YA1A 3ZJ6A 2ISWA 2W9AA 1N82A 3PN8A 5ABEA 2FJKA 3R5EA 1KWGA 1F4AA 4XWUA 3GNDA 1ICPA 3QV6A 3B05A 4JTQA 5FA5A 4AEEA 4CQBA 4GVGA 1KFWA 1V6TA 4LALA 3VD3A 3OVPA 1IT8A 1DWGM 1RQEA 1YE4A 4RXFA 1P6CA 4MKSA 3VOFA 3GHUA 1MO0A 3LUTA 2CNCA 2GDVA 3VD4A 4Q8PA 3UJEA 2W9CA 2TPSA 4B2DD 3AHVA 3DCPA 3WLOA 4ZB5A 2ZA2A 1E73M 1CB2A 2YR1A 3W1RA 3H12A 4JTTA 4GKLA 2DT0A 3LI1A 3AMKA 4IGHA 1QW7A 2RKXA 1R46A 4H41A 3WENA 3HBLA 2X05A 4CD5A 4DM2A 4UCFA 1Q6EA 2JEGA 6TAAA 4D9PA 5HPCA 1R38A 2OGYA 3SI9A 4O0ZA 3CL7A 3UEQA 3EXSA 3BLPX 4Z08A 1SZRA 4ENLA 3UNDA 3I3DA 4MIMA 2YB1A 2OZ8A 3ITLA 2CLFA 1WAUA 3VKAA 5LSMA 3ARPA 3HPSA 1RQHA 1JRBA 4JTJA 3WD1A 7CGTA 4G7EA 1WDDA 4DNMA 4GKTA 3PR4A 2HS8A 2XH7A 2B7NA 3VGFA 4D1JA 5D32A 4MZ1A 4JYEA 4AZCB 4AH7A 2JIWA 4UIOA 4REQA 2DPJA 2J7DA 3AIVA 2VEKA 3C2EA 4TV6A 4HHPA 2RDIA 4GZIA 2QJNA 2CYGA 3W2JA 4S3KA 5GVJA 2XUCA 2VX4A 1XICA 1F7BA 3H4WA 4UTMA 4A2RA 1P7TB 3B8UA 2NV1A 3S2NA 4AD4A 2WPGA 4DWSC 3U2CA 1MVYA 1SW0A 4G5DA 2DT1A 4Z2LA 5G4WA 1V02A 3KBJA 1GOXA 3GIJA 2R1KA 1EOMA 1ISVA 5I78A 2X1RA 3GC4A 5I79A 3TQ0A 2ZX6A 1H41A 4ZQPA 3ISIX 1G0CA 3MHFA 1FWNA 1LLZA 2PS2A 4YVPA 4UQDA 3AS3A 1TWDA 2PDCA 4PMOA 2XSBA 3N3TA 4IIBA 3O6AA 5IBXC 3VZZA 2ESCA 4IPPA 4AVNA 2BOEX 4MZ8A 4IGMA 3TW6A 5KG2A 3UJRA 1R86A 2QNEA 3CL6A 1A5BA 3GH4A 3K8MA 2XVPA 5T26A 4UTUA 1AQ0A 1JJKA 1VYSX 1EX5A 1YTDA 5JIPA 5E9AA 2ZKMX 3FEQA 1QPKA 3QJAA 1QWGA 1UR8A 1UKOA 1XIDA 4IJCA 3EXRA 3VA8A 3S1GA 5HJYA 1IEXA 1MDLA 1BG9A 1GT8A 3EZ4A 1EKOA 4L80A 1EYWA 1XLCA 1AJZA 4IFRA 3AYRA 4NQ1A 2PPGA 1XLKA 3LTPA 1OIFA 1RBLA 5HWJA 2X2GA 4M1BA 3M07A 3UWYA 3TCSA 2AMXA 1S0NA 4AC1X 1ECEA 2QLYA 2CEQA 1KA9F 2QEZA 5DG9A 5EYWA 4RPPA 4LV4A 4HSHA 4E8CA 3CMJA 4RDZA 4N6EA 5FJJA 2XFFA 1KFEA 4JYFA 1PL9A 2CLHA 5KG0A 3A22A 3G0UA 3H4XA 3QYQA 1CLVA 2ZRWA 2JALA 5C9UA 2PDNA 8A3HA 3CYJA 4Z0SA 3P67A 1C9DA 2PZNA 3ZLGA 3UZZA 1K6AA 3GDMA 5F4XA 1LQAA 3GIKA 1OC7A 3TUUA 1S1PA 4PEEA 1DJGA 2UVUA 3UCQA 2VVSA 4XKMA 2Q09A 4PSPA 1UYQA 2XN0A 1LUCA 3RAOA 2WSQA 4E3TA 5CZSA 1D7KA 4S3CA 2OOFA 2W9BA 1FKXA 4OZOA 3M0YA 2PRLA 3SRFA 3LHUA 3VIOA 5KFLA 1LLWA 1YBQA 2ODOA 4PN2A 2J7FA 4J7RA 5C7VA 1PX8A 2O9OA 1S2CA 4IWWA 1J0ZA 1SO5A 3BJSA 5C6MA 1UD6A 3PBUA 4IGNA 4FXSA 4NZCA 2V6AA 3G6XA 2Y85A 3SY8A 4CD4A 2R8HA 4QROA 5CH9A 3THUA 3M7SA 2J74A 2CZFA 2R1NA 3W27A 2C14A 2DIKA 4MNKA 4A3QA 1K7XA 3IIOA 2G0WA 4CQCA 5BOEA 3L9CA 3S2LA 4DEZA 2Q3RA 1W1VA 3S1VA 2ZDSA 1ZSXA 4K37A 3BMVA 4W93A 3ARVA 1ESWA 2WHJA 1P6BA 1P5BA 1LT7A 1MQRA 3OA3A 4YWSA 2W27A 4TQRA 1DL3A 5FD0A 3MO4A 5HWNA 4KPLA 3NZQA 5KFMA 3DHPA 2DUZA 1J11A 1ZRQA 2PLCA 4GGHA 4TU1A 4RV8A 2AOSA 4NZ4A 5LZLA 3HFTA 4W8BA 4HA1A 2FPVA 1NU5A 4B5XA 5I3FA 4QM1A 3QKEA 4W7VA 1GYNA 4GQBA 2WJZA 2NSOA 3PBYA 2QDDA 2Z2AA 3DERA 4RXGA 3W7LA 3S46A 4AD0A 1Z42A 3FJ4A 4N42A 2BB0A 3B3DA 2WW5A 3AALA 2Z25A 1PWMA 4MB5A 4S3DA 1JVNA 1OY0A 4OOZA 4DL6A 4P7QA 1QASA 4ALDA 3VNKA 3T8QA 2Z27A 4NP7A 4PUWA 3LPFA 4O3OA 2C16A 2PB1A 4Q3MA 2O7QA 1KFLA 1YEYA 3G1FA 4GACA 3DGRA 3NXLA 1W56A 4HSOA 1FFRA 1H50A 2R94A 5E0KA 4RZBA 3U5UA 4RUBA 3PZUA 4MOZA 4YMZA 4DPPA 1A5KC 1SVDA 3AZTA 4RX0A 1BSIA 2ABAA 3OHIA 4R33A 2PTZA 3ITXA 3MPGA 1GQLA 1ZS2A 3AIUA 3HMJG 1DJWA 2Z2BA 1PHQA 2QKFA 3TZFA 3WH5A 5DN1A 3BARA 4XAPA 1XSIA 4L1WA 4O14A 2EG7A 2L5HA 1GCYA 3GTFA 2WK2A 2E3ZA 3W2UA 4Z0JA 1HKVA 4ECUA 1UG6A 1GHSA 3EPOA 2OH2A 1V6WA 3GNNA 3IJLA 3OGRA 3FY1A 3F4VA 3OJGA 3HB9A 1OHLA 3H55A 3W74A 1GGOA 1J12A 1UWTA 2Y8UA 3CZ8A 2WNWA 1WZLA 1TQXA 1ITUA 5F7UA 4GHRA 1BAGA 3NTYA 4HCDA 4RDVA 4DBDA 2D20A 3G6VA 1V0LA 4DUVA 1X98A 3PJXA 4ECSA 1P4CA 1TMLA 3GHSA 5TIMA 1A80A 2ZC1A 3N34A 1EOKA 3AZSA 3T1GA 4WHBA 1F07A 4EPDC 3DYOA 5AYZA 3TLQA 4B5TA 4PYSA 3MWCA 4H00A 3UG5A 3SRKA 3W22A 1OB0A 5JMUA 4OIFA 2VL4A 4WDUA 3TN6A 4MF4A 3PPFA 3CEPA 4DN1A 2VVNA 5FJRA 4WUIA 3MS8A 4LUSA 3TZNA 3DAQA 1NARA 4KFOA 4CCZA 4MUPA 3OYZA 2P9BA 1V93A 5I09A 4ATLA 2DP3A 1CGXA 3G1VA 3LSCA 3JZEA 3RX4A 2VEGA 3EWDA 4HJFA 2QT3A 2OTDA 2HE5A 4K36A 1G4TA 3VFCA 4J3XA 1FWRA 4NRSA 3VIFA 5GNXA 2ZRZA 3G5EA 4JQ2A 3OQEA 3A13A 4TOQA 3W88A 3CIXA 4WGXA 1LWIA 4E4PA 3GXMA 2C1HA 3SJNA 3AAMA 1TG7A 4N6FA 2VOMA 1P0BA 4UR8A 4IXXA 4X2PA 1POJA 1LL6A 3WH6A 4G8TA 5KT3A 4LRTA 1V6UA 2PWFA 2QF7A 2TODA 1VJZA 1VYRA 2WMJA 1BRLB 1LL7A 5CLWA 3TA6A 2QULA 5GJNA 1TA3B 4DYJA 2LLEA 3NEHA 1JD9A 2HTMA 5DY2A 4ZODA 3NDOA 3PZVA 2GVEA 3O16A 3VMPA 4Z1YA 2B7QA 2WMIB 3PPCA 1R9YA 5CC6A 3EYPA 3CQJA 4MY1A 1V3MA 2OYMA 3O6CA 1DYSA 2VUYA 4J9JA 2FLLA 4X0NA 4A8IA 4EK7A 5I3IA 1AD4A 2A3HA 2Y63A 7ENLA 2YDQA 4E8DA 2X1UA 5AHIA 2J88A 3MV11 5EBUA 3B0PA 1K8CA 2VQTA 4ZOBA 1HJVA 1MW3A 3PZOA 1IXPA 4FOUA 3QW4B 5KFZA 4M82A 1SFSA 4DAFA 3W23A 1P6WA 4W8LA 3KHGA 3W38A 2E68A 3ECQA 1TSIA 1H09A 1KM4A 2BVDA 1MEWA 1WV2A 1CI1A 5KT4A 1TPFA 1O66A 2O55A 3AHZA 3TR2A 4GIAA 4YVVA 1C8XA 1GKPA 2OWWA 4GIEA 4JCMA 4RLIA 1G69A 3PP7A 2AQOA 2G41A 4R7OA 1XYMA 3KVKA 5AZ0A 4DO7A 2OZ0A 4XSMA 7XIMA 1PTDA 4O4WA 2INZA 2W8LA 3E12A 1ZCCA 2XFRA 2W61A 4PRWA 3IUIA 2I7GA 4GZ7A 2Z4GA 1VEOA 4U2ZA 4A3UA 1OABA 3O05A 4AB4A 1E6PA 3SADA 4MFDA 3G0XA 2C6QA 3S83A 2QCDB 2V3DA 4F0KA 5T9BG 1X1ZA 1AZ2A 1FWFC 4LUJA 4AIOA 1LOLA 3DFTA 4AXKA 2ACQA 2VX5A 1UR1A 1TO3A 1GOQA 3S6TA 3AI0A 4JEJA 1C9WA 5K9DA 1TV8A 4KH2A 3DU0A 4KS0A 3QW3A 2OOGA 3MUIA 4IMEA 1XLLA 2PUZA 2V8ZA 1PV8A 4IG2B 1YXDA 2ZIDA 4DJFA 4EBEA 3EWBX 3Q37A 2VENA 3PZ9A 1VQTA 1XYZA 3KBVA 4BR1A 5CG0A 1WP6A 3F1QA 3P2VA 3T0DA 1HJWA 3U9IA 2VWSA 1OK6A 4XO7A 2DU2A 4XZNX 3WUBA 1RD6A 3Q94A 2G50A 4DBSA 2DSKA 2OWCA 5HNUA 3GU9A 4JFWA 3QQ0A 1KM6A 3AMLA 4JFUA 4DF0A 3LRMA 2BODX 3PUEA 4LYKA 4NNCA 4PTDA 2J7CA 3PM6A 3WLHA 4HOZA 4PMDA 2GQ8A 4YS1A 4WD0A 4M6UA 4M5PA 1T41A 1MNSA 1O4UA 3S5SA 4JY9A 2XCPA 3S5OA 5CG7A 1Q6CA 4MJ2A 1AL7A 1XS2A 3PBMA 4XISA 1OYAA 4F4ZA 4QR6A 3Q4DA 5HATA 3IGSA 1JQXA 3RM8A 1CXIA 1L8NA 1F3XA 3IRSA 4J3ZA 4IXHA 3FXYA 1UP3A 1X6NA 3HTWA 1PYFA 4L6OA 3CPRA 2JBMA 1DBTA 3ARUA 3GDRA 1MXSA 4JKLA 5EMJA 2ZUMA 3VOCA 4HZ6A 1VH7A 5KEZA 3RCNA 4B90A 2J77A 4JL2A 1GONA 5LHEA 1C93A 5AVNA 3ARZA 3UCCA 4EYHB 2YA0A 1WBJA 2PBOA 1X39A 4HMNA 3VIKA 3T09A 1V03A 3RLHA 1KKRA 1M7PA 4LVAA 2D23A 3OOQA 3BG9A 3OHAA 3GNOA 2XJ7A 1NH6A 2PWHA 1T99A 3P81A 1IGSA 3FS2A 4MHBA 4JTIA 4ACZB 5DELA 2V4RA 3CQIA 3N29A 1ONEA 4U31A 4FSAA 3H2OA 3M0IA 2PTXA 4MPKA 3E0IA 2DVXA 2VGGA 1JCNA 4XBSA 3I6EA 5AHLA 4YYCA 5K2ZA 4XTIA 4W8AA 1VPYA 3C5QA 1HJXA 2ZUUA 4D6CA 3D6NA 2PSNA 1MEIA 4AXNA 3QEZA 2ZZ1A 3ATZA 4QHRA 5KFKA 3R0UA 4HP5A 1VZWA 3W7DA 3QTPA 1GPFA 5LKYA 1AW2A 3CT7A 4LAKA 2GJNA 5BWAA 4KWVA 4R5EA 2WTFA 2VXNA 3U2ZA 1E6ZA 5AB3A 3VIIA 1KXQA 3N6QA 1UWUA 3OPSA 6XIMA 3DBNA 2JQXA 1CXEA 1IT7A 1JD7A 1MW1A 2HBXA 2VFEA 3P60A 3HG2A 4J3SA 2H3BA 3NYDA 1AMKA 2ASLA 2IKGA 4PGLA 3QPZA 4Y9OA 5F2GA 4H8VA 1EYEA 1HKJA 1N8FA 3C0SA 3I3BA 3VAVA 3NQ6A 1WNOA 4IJRA 2PDGA 3DFNA 2G3FA 3W1AA 1QNPA 3HG4A 4U2YA 5CAKA 1US3A 4J3VA 2J6UA 3M0MA 3AJ7A 3TJLA 1M9HA 2Y89A 3VFLA 1UWSA 3PZNA 3UR7A 3QZAA 3VX0A 2EJ1A 4LWWA 4IGSA 4Y9NA 3W71A 1MSSA 1QNSA 2YXXA 4KBXA 4X0VA 1PXGA 2XINA 3OB8A 1K70A 1QOQA 3PFRA 4LGXA 1AD1A 1WDSA 3UU0A 3T55A 1WKDA 3DI0A 4TIMA 5AFDA 4CD7A 4A35A 3ZVHB 1QAPA 4J27A 2GK1A 4QCFA 4HNUA 4P8XA 3R0DA 3GTXA 1IIHA 3R89A 2OLSA 2BV9A 2W63A 4UFKA 4W5UA 1LWJA 3TTOA 4C6MA 5CSSA 2YB4A 3DEQA 2OEKA 4WCJA 1I1WA 2AL1A 4MY8A 4PBGA 1S1RA 4GXMA 1OFEA 2VRJA 1O5QA 3NM1A 1Z9AA 2Z1KA 1X96A 2V5LA 2A85A 4MNJA 1Q8AA 3KZSA 5KFIA 1EEXA 1HFBA 3TTSA 3T2QA 2C79A 2XGPA 4FA3A 1JX4A 5AHNA 1E5NA 1NWRA 3R1ZA 3KS6A 4H9ZA 3L4UA 2GWGA 4H9MA 3AS0A 3WNKA 4FB7A 2XGQA 1KRBC 1JAEA 3MHUA 3MMDA 2D0HA 2ZVIA 2OX1A 3FCPA 1VFLA 4Q8MA 1Q63A 1HKKA 2Z26A 1FWDC 4DEFA 1I4NA 2V30A 4S1FA 4HCHA 4N2YA 3EX1A 1W3KA 3NQ8A 1WE5A 3T4WA 1EF3A 2WKGA 3R11A 1ZJBA 1X1OA 4GUJA 3HG5A 4BJHA 3UWVA 3B9AA 3K30A 1RYRA 1BXNA 4F2TA 2ACRA 4DNHA 2BR0A 3NVTA 3S0CA 4IIFA 4XUGA 3QV7A 1J01A 3H4GA 2YZRA 2OT0A 4ZE5A 3G18A 4ZSUA 3WSUA 1JG9A 1W3TA 1DJXA 4QSHA 1DEDA 2ZXBA 4Q7BA 2J6SA 3CGTA 1E55A 4H9VA 1PEZA 1JCLA 3KW3A 3GFZA 4W5ZA 1TCMA 3CLMA 1QI0A 4ZQMA 4K38A 1EO5A 5D38A 3T6CA 1Y7VA 4MSSA 4C7FA 2NX3A 4KEMA 1V3JA 1NFBA 4JV1A 4M7TA 3IJ9A 3I6RA 3CC1A 2WLZA 4GFSA 5BU6A 4YQWA 4IH3A 1WX0A 5F4SA 3URQA 1QOPA 2NQJA 2CITA 1HL2A 3KM8A 3L66A 3W7JA 2VX6A 1IWBA 5IM51 2J8GA 3IPWA 3MZNA 4FEZA 3R12A 2NZLA 3SGZA 2KZHA 5E70A 3LD5A 4JIHA 1KKOA 1O12A 1JXLA 1XLGA 3WFAA 4BEQA 4RE4A 4AUBA 3IAQA 4DJDD 1XISA 3GNRA 3NWRA 5D8ZA 3OO2A 2Q8XA 5EU9A 1JDAA 3GO2A 3C3NA 2D2OA 3WUGA 4QEHA 2R1PA 3T07A 1I9CB 4O4VA 1W1A1 1H7WA 1TTPA 3O6YX 1PS9A 1XR2A 4QLLA 3GGMA 4IISA 4AF0A 1EXBA 4NVTA 5C70A 4DB7A 2O92A 1O5KA 2PODA 3S6DA 1WDRA 4I5XA 2P10A 2BHZA 3MB9A 1EO7A 1GW9A 3TE9A 1DXFA 1XC6A 4Q7IA 3LB0A 1GJPA 1L6FA 5F1UA 5JH1A 1EA0A 1NDZA 1RLCL 2FTWA 2ZX5A 4BWLC 3QMSA 3G22A 1VFUA 4JQ1A 2YZ5A 3IVSA 4R7JA 1EJXC 3UVIA 3FAXA 1JZ4A 4ZEPA 3I10A 5EMMA 3LZ3A 2AL2A 3CZGA 2WJFA 3V7PA 2AAAA 4XAGA 2YA2A 5CBJA 3N4EA 1Q5MA 1HKWA 1XQKA 1HX0A 1E6NA 4G56A 5G1TA 3C52A 3BC9A 2VCAA 4GOAA 3S9IA 1YTKA 3OIXA 4ZMGA 2XH0A 4UQAA 1SFTA 1SO4A 3FN9A 1G9HA 4GYPC 1XIIA 3GIMA 3I4KA 3N3MA 1CGYA 3SN0A 4DF1A 1UH3A 2V5KA 3CM4A 3HGJA 4GNJA 4AYSA 2A3LA 2BZNA 4IPJA 2FDMA 2R6OA 4L4PA 4WY0B 4URIA 1B3XA 4GI9A 3THCA 4NLGA 1SSGA 2HK1A 3R25A 3LN3A 3V75A 3SJ3A 5MKGB 4FX6M 2PDJA 2DQWA 3KVMA 3WQ6A 3RBDA 2OODA 3UCDA 4GNVA 3VGEA 2GYIA 2GOKA 4JDBA 1OF6A 2C1IA 1IEWA 4HA3A 4AYGA 1GTHA 5AY7A 4LVGA 4KWWA 1QVBA 1A0DA 3OSNA 3LXCA 1QR7A 1UZ1A 3VNYA 4DJED 1I60A 1ML1A 4LAOA 5ABGA 2PZ0A 4Q8FA 4EWJA 2WXDM 1PZ1A 4K7VA 3UA3A 1FCVA 3STGA 4EAYA 2NQHA 2FGBA 3ELFA 3RU6A 3VGBA 4JTDA 1QNOA 1E4MM 7ODCA 4PUKA 2JF6A 4UFMA 4YTQA 4D6EA 1TX2A 2ZUTA 4C1KA 4ZO8A 4L6HA 4ASTA 4M6PA 4DELA 1RALA 3E38A 3KX6A 2POZA 1A0CA 2VI0A 5I3HA 3QMRA 2VEPA 1ISZA 2VR5A 4M56A 3LCGA 1JYVA 4XZMX 3MQTA 5MHBA 2IXUA 1QI2A 4H3DA 4J3WA 3P61A 1IV8A 3LDVA 2YL5A 5IDZA 1E4NA 2PLJA 2YXGA 5DT5A 3VE9A 5A94A 3OW1A 3IGHX 5CPMA 4DUXA 1RJQA 4BKNA 1VFFA 3OHBA 1F8IA 1FDYA 3MCOA 2OT1A 4HN8A 3S47A 1PX3A 5AYXA 2RDWA 1PB0A 4O8AA 4AHPA 2VZVA 5HBFA 2AKMA 3T05A 2Y62A 2IBKA 4B9YA 3N6HA 3AS1A 5L6UA 2D0GA 1GVOA 1ZJHA 2EXOA 3PWGA 3M9OB 2IQTA 2FB2A 3K4DA 2EO7A 3TAKA 1O1HA 3S42A 4AHQA 4GUIA 2EKGA 2ASDA 2XSAA 4TX8A 2ZE3A 4MNLA 1YRRA 4FMVA 3ABQA 1A3HA 1DWFM 4J40A 2OEMA 1NDWA 1MZHA 3H22A 4QLJA 2E40A 3CZKA 1VRXA 4GINA 3MR5A 1EJRC 2X7WA 3L4VA 4IQJA 2DIJA 2DSWA 3SCNA 5BRBA 3CUGA 1W9XA 1KFCA 1VR6A 5EFFA 1RBAA 1K4GA 3WKZA 1BPLB 5HMSA 1U1UA 3URAA 1R2SA 3TWBA 2CESA 4QJ1A 4X22A 2WVSA 3E1F1 5A6SA 1W5QA 2YXOA 5CXPA 1I2NA 2ZX9A 4QWAA 4UQEA 4MGGA 1DWAM 4C6EA 4IIGA 2C2EA 3WJZA 1VKFA 1X8CA 3MDWA 2QVNA 3WLTA 3XISA 3SURA 3V35A 2QPXA 1JPHA 3ZMRA 1TIWA 2VR2A 5CPTA 2Z7GA 3CNYA 4FPSA 4HZMA 2WVTA 1SJCA 1TPUA 2XFWA 4B4HA 1E51A 3H7RA 3V16A 3UT0A 2QZRA 2FVMA 1RHCA 3VZXA 4AZHA 3R0KA 5L1JA 7REQB 2FFIA 3GD6A 2ZXQA 4O1CA 3HF3A 4ZSTA 4NZ1A 1FCUA 1MYRA 3HM7A 2YW3A 2VGIA 2FZ8A 4Z2GA 3LPOA 4KCTA 3SQSA 1CLXA 3BLEA 3NQEA 2CU0A 4GVIA 3LCIA 3VCCA 1F73A 1X8FA 3ONCA 4KCUA 3QGAC 1FDZA 4HA0A 3W1XA 3U4AA 2FMOA 2P3ZA 1XI3A 3W1PA 4CU7A 4YTRA 1B4KA 4FOKA 3WDHA 3G3DA 4H8NA 5KFXA 3WY1A 4GVFA 3BMXA 1XBXA 1WKYA 1E3ZA 3W53A 1TZ9A 5H1WA 5C7HA 1N8IA 3OTRA 5FF4A 3TNBA 3E5BA 4EXQA 3UWWA 2G5WA 3MI2A 2QVHA 1CECA 2IPFA 3EB3A 3SGGA 4HNOA 4QQ3A 2PF8A 1RAKA 1H1NA 3GFXA 3V6HA 4PA8A 1KXHA 3ONBA 5DLGA 5EB8A 5AVHA 3TX9A 1OEPA 4E38A 5CZJA 5K4XA 4XSLA 5T14A 5DXXA 3ES8A 2FKPA 2RDTA 3L5LA 3TKFA 1JF6A 1S10A 3ZR6A 3FSTA 4BK9A 1JCJA 4CKQA 1V08A 3NAVA 4O3NA 1IR1A 3BQ5A 3MYOA 3LX9A 4GG9A 4H8UA 2R82A 2WKJA 4PB3A 2UVRA 3MANA 1XIGA 1K8XA 1Z32X 3GM8A 1VFMA 5LIUX 2GGGA 1B90A 4XQ6A 2J7BA 1OYCA 4ECYA 4W7UA 3RLUA 2J79A 3HPFA 3AS2A 1KM0A 4C1NB 1OFDA 3AYVA 2DUAA 3LBOA 4H2HA 1VPXA 1E3XA 3UR5A 3WBYA 3VXGA 2RGLA 3VKCA 3H2EA 1IWAA 1Q7MA 4YTSA 2VDIA 5DBUA 1A47A 3GXTA 2Y88A 1HJUA 5REQB 3O6DA 1TUFA 4C5ZA 4IRCA 2R1MA 2GWNA 1UMLA 4H8HA 3IWPA 1EX1A 1QI4A 3CWHA 3B8IA 1JDCA 5BZAA 3K4AA 4C6DA 2YDAA 7TAAA 1ZETA 5C9XA 4UFLA 3PBWA 4FF5A 4LRSA 3EX4A 2VP8A 1DJNA 5IFTA 4DYEA 1JNDA 3GDKA 2E1WA 3BDKA 3BAKA 4J9LA 4ZBCA 3ZLFA 5EMLA 4C90A 4G6CA 4OFCA 2DZAA 1PJ9A 1ZY9A 3MWAA 4LY8A 5F2LA 2GDUA 4O0QA 2DDXA 1XBYA 4WZHA 4NF7A 2O9TA 1W32A 2OO0A 1VEPA 4ACYA 1CENA 4CEXC 1C8VA 1FBAA 6REQA 3FLUA 4CNSA 4RUCA 4CCEA 3MMWA 1NOWA 1LRTA 3GV5B 1K03A 5A8QA 2OQHA 3STFA 4FK9A 3PUOA 1ECQA 4PRRA 4QWDA 3SGUA 3WFLA 4RV3A 4QXIA 2ATMA 4A4AA 4JOMA 5AKQA 5CGMA 2EKCA 4CNNA 3QZ8A 2E25A 4PL2A 1W54A 3EMQA 3SY5A 2ALDA 2Y7FA 4DRSA 5BMWA 4CQAA 2PDFA 1E72M 2W92A 3NQDA 3DHDA 4HA4A 4PRTA 3SIZA 5E0FA 1D3CA 2IW0A 3RFAA 3A3HA 1R7AA 4JTFA 4PMQA 2AKZA 4OBTA 4MWAA 1BGGA 5E5CA 2NQLA 1TMQA 1D8CA 2GOUA 2V5DA 2WAGA 4B92A 4H01A 2CZVA 2EPMX 1DHPA 2ADAA 4YN5A 3W01A 1ZAJA 3W2NA 3FGCB 4WJ8A 3WQWA 1IM4A 4PTMA 1E9LA 2J9ZA 1ZAHA 4Y2WA 1K02A 4ZO7A 4HVXA 2XVGA 1F5ZA 1H7PA 2EG8A 3QYSA 3RR4A 3U5YA 1LWHA 4PCPA 2P88A 2XH2A 4YR3A 1HL9A 1UR9A 1CCWB 4R9OA 2VA2A 3NGJA 1UASA 2EQDA 3K2GA 3T9PA 5EDWA 3S1XA 4V1XA 3AIRA 1OGBA 4DM1A 3S1UA 3PZIA 3NO1A 3VD9A 5G2WA 4OQVA 2P8CA 3KZPA 3N2XA 5DLCA 3ZSTA 1EGZA 1KBIA 2G3JA 3NQGA 4C6OA 2PDKA 1E9YB 2PDQA 1GVFA 2YFOA 3WBAA 2JEFA 2F61A 3WLKX 3TMQA 4FXRA 4DLMA 3FVDA 1PSCA 4JEQA 5CZTA 3GIPA 1JCTA 3TIMA 4EF9A 1BKHA 4PE8A 3KHDA 1XFBA 2XCAA 1OCBA 3TQPA 3P82A 4AD1A 5EWFA 1IZKA 1IT0A 1R6WA 3MUY1 4AIBA 3EA3A 3NYZA 3H40A 4ECXA 3OZMA 4ZA0A 1H4PA 2XGIA 2A3CA 3NA8A 3A47A 1IF2A 1MUMA 2A21A 4PH6A 3IIPA 3B8WA 4IMFA 1SSDA 1KBKA 2E9MA 3FA3A 1EP1A 5ECUA 4ZTXA 3O07A 4UTWA 5H91A 1UD8A 2PDBA 4Z2IA 1GOOA 1WZMA 5E09A 3IJ8A 4DF2A 3QPYA 2BY3A 4IQDA 4LYRA 1F3EA 3BH4A 2DZBA 1I2QA 4GIRA 2CZEA 1FOBA 3FKRA 3M0XA 3LK6A 4DYKA 3LPGA 3CHEA 1I2PA 4MAZA 4H9YA 4BY3A 5KFHA 1SGJA 2WWDA 1L6WA 1TWZA 3KP0A 2PC8A 3NFUA 2ALRA 3OSPA 2JKAA 1UUMA 4GCXA 3MMTA 1SMAA 3WJWA 3PB0A 1ONRA 2CLLA 3B0YA 4PMNA 2F38A 4NT0A 4ZOEA 1CIUA 3KOYA 3WK3A 3GVWA 3GAYA 5I23A 4TQTA 3REQB 5DQIA 3CHDA 5TAOA 1RBOB 4O53A 1I0BA 3MP4A 3UG4A 1MXGA 1V7AA 2OFJA 2CWXA 3VUPA 2HZGA 1B3OA 4Q22A 3GVVA 3MC5A 2QAPA 4HT3A 1Q6GA 1XF0A 2HNEA 1Q3NA 3QY8A 3R58A 5IHRA 3P6LA 4FXFA 4IL0A 4QCEA 4CVUA 1CXKA 1UIPA 3ZT6A 3VE7A 1EUAA 1X97A 5KZ6A 4YCPA 4F9JA 1E15A 2VURA 4KF1A 3OODA 2YBUA 3AUJA 1UZ4A 3Q65A 3CHVA 1E1EA 4LF1A 5C9WA 1O94A 4WOZA 2VM8A 2ZRUA 2QUTA 3POCA 5DG7A 2WV8A 3L0NA 4L61A 2CKSA 2PURA 3QR3A 1R85A 2OKOA 2GUBA 1UBSA 1WUFA 3CPGA 3PPGA 1K1QA 3HV8A 4DJDA 3MCMA 3IIZA 3W7NA 2X41A 1QNRA 4RUAA 1OM0A 4PTWA 1BWVA 1JDDA 3AYSA 1G01A 4NUWA 1ZLPA 3XINA 3WK0A 4R85A 2DZUA 2FPTA 4HK5A 5KFWA 1H11A 4M29A 4M8UA 1FA2A 4S2CA 3U57A 4AU0A 4DZ5A 2NV9A 3TLLA 3V36A 5LXXA 1IR2A 3GR4A 1OC5A 1XYBA 2NLIA 3P7YA 2ASHA 3M44A 1VBHA 4BF9A 2X30A 3GKAA 3R7MA 2PCQA 4GUGA 2C28A 4J9OA 3EX6A 5TD4A 5CJNA 2JE8A 2BASA 4RL3A 3R8HA 4E2DA 3INPA 3PG8A 5EA9A 3I3EA 4AWUA 2HVOA 5DGBA 3KTCA 3CQ0A 4HMCA 2IUZA 4JIRA 2GJXA 4O1EA 2D73A 1NQ6A 2P53A 2V9WA 2QPSA 2E09A 3H23A 3P5ZA 1W5MA 2DUXA 2F2HA 4BQ3A 3F2CA 3U48A 1BXBA 2GGEA 3IJQA 1JZ6A 1MZRA 1WAWA 2OSXA 1GZ1A 3QQ1A 4F0HA 1MFVA 5A6MA 4ED8A 4ZENA 1VPQA 1XIEA 1YDYA 4O11A 2Y5JA 1WXZA 3CXOA 1LLOA 2XVNA 3DFYA 3GR8A 2Y8KA 1C8YA 3ARYA 4XK2A 1KTCA 2R9RA 2WJEA 1OG0A 5KFBA 2WVVB 3CV7A 2R8JA 3TA9A 4K8EA 4EAMA 1JZ2A 2C3ZA 4DWSA 3FJ6A 3K8KA 2ZXDA 3SCUA 2Z7KA 1EL3A 3IJIA 3V1PA 5I6SA 3P5YA 4HMEA 4YJ5A 3EX3A 3MVIA 5HNNA 3QRHA 3Q8SB 3EDJA 3N4AA 5K3VA 1PIGA 4UMCA 4RR4A 4P61A 5BMXA 2D2HA 1ZBVA 1V6YA 4FOJA 4F9DA 1GVEA 3DECA 3RPDA 3AHYA 4KGLA 1NOUA 3HMCA 4NX5A 4Q44A 2E67A 3RU8X 4B3ZA 2Z1XA 1XWYA 1XX1A 3N2MA 1GKQA 2XIQA 1YADA 2PA6A 3H21A 1TELA 4B3KA 2W7PA 1MRQA 4M24A 3WK2A 4GO9A 1R3YA 1XDLA 3FJLA 4HN4A 1OT1A 2NLYA 3BAJA 4IUOA 1IIGA 2HQAA 3L23A 2DSUA 4LBUA 4C65A 4P8WA 4ROQA 2RH9A 4FLQA 3TOYA 5B7ZA 2WSPA 3MJMA 1TCDA 5HMFA 3EMCA 3HPXA 3HQNA 1N55A 2FZMA 1CXLA 3FA4A 5FOOA <