2AQVA

Crystal structure of e. coli isoaspartyl dipeptidase mutant y137f
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
389
structure length
374
Chain Sequence
MIDYTAAGFTLLQGAHLYAPEDRGICDVLVANGKIIAVASNIPSDIVPNCTVVDLSGQILCPGFIDQHVHLIGGGGEAGPTTRTPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRALNEEGISAWMLTGAFHVPSRTITGSVEKDVAIIDRVIGVCAISDHRSAAPDVYHLANMAAESRVGGLLGGKPGVTVFHMGDSKKALQPIYDLLENCDVPISKLLPTHVNRNVPLFEQALEFARKGGTIDITSSIDEPVAPAEGIARAVQAGIPLARVTLSSDGNGGVAGFETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMTPELRIEQVYARGKLMVKDGKACVKGTFET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Isoaspartyl dipeptidase
publication title Functional significance of Glu-77 and Tyr-137 within the active site of isoaspartyl dipeptidase.
pubmed doi rcsb
source organism Escherichia coli
total genus 131
structure length 374
sequence length 389
chains with identical sequence B
ec nomenclature ec 3.4.19.-:
pdb deposition date 2005-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2aqvA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2aqvA02
5A6TC 3E0LA 1O12A 3S2LA 1KRMA 2P50A 4DYKA 2D2JA 4EPKA 2ICSA 5G4HC 3E74A 1E9YB 1V51A 3GTFA 3GGMA 3DCPA 3TN5A 3LY0A 3DC8A 1GKPA 4J5NA 1POKA 4PCNA 4ZSUA 3FDKA 4XAFA 1S3TC 4V1YA 4IG2B 2G3FA 4YIWA 1A4MA 1IE7C 4KEUA 5E5CA 4QRNA 2Z7GA 2I9UA 2Z2BA 3V7PA 2QVNA 4BJHA 3RCMA 1J5SA 4V1XA 4DI8A 3EGJA 1R9YA 2R1LA 1M7JA 1PO9A 2GWNA 2QPXA 4J2MA 4B90A 3LS9A 4PCPA 1EJRC 4H9XA 1EF2A 3IGHX 4G7EA 1ONXA 3B0YA 4DNMA 3S2NA 2A3LA 3MSRA 4LANA 1EJXC 4EPDC 4LCSA 4G7EB 1V7AA 4H9ZA 3ICJA 4C6OA 1J6PA 1RA0A 3LSBA 4GX9A 4DLFA 3T1GA 1M68A 2EG7A 4IH3A 2O4QA 2YB1A 1QW7A 3EWCA 4NP7A 4IF2A 2QS8A 2Q09A 2E1WA 1XGEA 4H9TA 3HPAA 2OOFA 4L9XA 4R85A 4C5YA 2RAGA 1EJVC 4GBDA 3GTHA 1XRTA 4CNTA 2PGRA 2Z29A 1RJPA 1R9ZA 1PSCA 3GUWA 4DI9A 3D6NA 1PB0A 4C6FA 3QY6A 1V4YA 1ADDA 1UBPC 4D8LA 4B3ZA 4RDYA 2R1PA 4C6LA 1FWDC 4MUPA 4OFCA 4J35A 2FVKA 4LH8A 4QROA 3A4JA 5HMEA 3F4DA 1FWEC 4LFYA 4P5UA 5FSDC 4WGXA 1RK6A 1K6WA 3SFWA 3RYSA 2PGFA 3QGAC 1UIPA 3QGKC 2OODA 4GX8A 2PLMA 1EYWA 4CQDA 3PNUA 4KQNA 1DPMA 3S2JA 2GZXA 4IGNA 2DVXA 3IARA 2VC5A 1P6BA 3ID7A 4H9MA 2Y1HA 4KERA 3C86A 3B0XA 2WJEA 1WXYA 4UBPC 3E0FA 4GY7A 3B40A 4H9VA 3F2BA 4KESA 3T81A 2PAJA 4M51A 3MTWA 4PE8A 4BY3A 2Z26A 3IJ6A 1ZZMA 1A5NC 3TNBA 4C65A 3UF9A 3N2CA 1UIOA 4EP8C 3CJPA 4B91A 1ITUA 2Z4GA 3UR5A 2XIOA 4JOMA 3EWDA 4AC7C 2W9MA 3IV8A 1P1MA 2WJDA 4LAOA 4C60A 1EZ2A 3MVIA 1WXZA 5HMFA 2E25A 3NURA 1FWJC 1KCXA 2Z27A 3PNZA 4HA0A 4TQTA 5FSEC 2WJFA 1O5RA 2F6KA 3AUOA 4C6DA 2HBXA 4XAYA 3S2MA 1RK5A 1ONWA 4KETA 4NI8A 1J79A 3LGDA 4C6CA 1A5OC 3GTIA 3TN4A 3K2GA 3SO7A 1PTAA 3KM8A 4RDZA 2PUZA 4CNSA 4GZ7A 3CAKA 1V79A 1A5LC 1GKRA 3URQA 1FWCC 4H9UA 4QS5A 2Z25A 4C6KA 3G77A 4GXWA 3UPMA 4DIAA 1I0BA 1UMLA 3OVGA 1EJSC 2VC7A 4C6JA 2R1MA 2VUNA 2R1NA 4C6IA 2KAUC 2EG6A 4PBFA 4C6QA 3NQBA 2Z24A 2OQLA 4H01A 3F4CA 1FWAC 1RJRA 2Z00A 2IMRA 1EJWC 4C6BA 3OU8A 3F2DA 4HK6A 3E38A 2UZ9A 4F0LA 1K1DA 2ZC1A 4IFRA 1FWFC 5HMDA 2O4MA 1A4LA 4INFA 2VR2A 3URBA 2YB4A 4LAKA 3LNPA 2EG8A 1EJUC 4CQBA 3E3HA 4HJWA 2ADAA 4RZBA 1BF6A 4C6NA 4C6EA 3FEQA 1VFLA 3OJGA 3PAOA 4DZHA 4XAGA 5CH9A 2QT3A 2VHLA 4WVXA 2Z28A 4LCRA 1R9XA 4QS6A 2DVTA 3GG7A 3K4WA 4XD6A 2Z2AA 4GY0A 1KRCC 3E2VA 3FDGA 4IFOA 2HNHA 1RJQA 1FWIC 5LXXA 4XD3A 2AQVA 2BB0A 4C5ZA 4Z42C 2GWGA 3OOQA 2OB3A 3WZ0E 3GU2A 2P9BA 1KRAC 3LSCA 4LEFA 4IFKA 4NG3A 3GU1A 1FKWA 1NDYA 2Q01A 3ITCA 4KEZA 4HK5A 2GSEA 4IFKB 1POJA 4CNUA 1FWGC 1I0DA 4DLMA 3MJMA 1YRRA 4R88A 1FWBC 4EPEC 2FFIA 3MKVA 1ITQA 2BGNE 3OQEA 4H9YA 4QSFA 1RA5A 4GK8A 3AU6A 2ANUA 3LU2A 4IQJA 2YZ5A 3PBMA 1EJTC 3PANA 3MDUA 4C6MA 5AKQA 4IG2A 3IACA 3O0FA 4RE0A 2HQAA 4PBEA 4H00A 1KRBC 1P6CA 3S4TA 4XD4A 3OODA 1HZYA 1GKQA 3QY8A 4I6KA 3WYZA 3UR2A 2P53A 2D2HA 4R7WA 4L6DA 3R0DA 1JGMA 2HPIA 3DUGA 3MVTA 4I6VA 1YNYA 4KIRA 3UBPC 1A5MC 3LGGA 3CS2A 3ISIX 3F2CA 2CZVA 4ICMA 2OGJA 4DZIA 3GRIA 3MPGA 4BKNA 4LALA 1NFGA 3TN6A 1NDZA 2FVMA 1XWYA 4G2DA 3IPWA 4F0RA 3URAA 2R1KA 1E9ZB 4CEXC 4CQCA 4QTGA 4XD5A 4GYFA 4ERAA 2VM8A 4B92A 3GIPA 1W1IE 4CEUC 3GU9A 3BE7A 1M65A 3TN3A 3K5XA 4GY1A 4IGMA 1XRFA 4AQLA 3QY7A 4ZSTA 1J6OA 4LAMA 2AMXA 1A5KC 4RDVA 3WMLA 1K70A 2FTYA 4GOAA 1FKXA 4RDWA 4HK7A 2WM1A 1RAKA 4KEVA 4LCQA 3GIQA 3A3WA 4EPBC 2UBPC 4KF1A 4ERGA 4XAZA 3URNA 1YBQA 4E3TA 2HPMA 3ORWA 4GC3A 3AU2A 1NDWA 2HBVA 1V77A 4ERIA 2FTWA 3A3XA 1YBQB 2D2GA 3NEHA 2YXOA 1YIXA 4C6PA 3T8LA 2DVUA 3LA4A 2GOKA 3RHGA 3HTWA 1NDVA 4DO7A 4F0SA 3JZEA 3MDWA 3O7UA 1QXLA 3RN6A 3HM7A 1FWHC 3GTXA 2AQOA 4WHBA 3IRSA 2I5GA 1YMYA 4UB9A
chains in the Genus database with same CATH superfamily
5A6TC 5DXYA 2OCZA 3AS0A 2WSRA 4IGHA 2D2JA 3DBPA 1WKFA 2PCQA 3O07A 1GVFA 4ED8A 1E9YB 3GTFA 4ILSA 3U2ZA 3UWYA 4UTKA 1OZMA 4O8RA 2EKCA 4LXFA 1EA0A 2GJXA 1POKA 3T0CA 4GXMA 2DT1A 3WBEA 1HJQA 1W1PA 4YIWA 2OEMA 5A69A 3UGVA 2WBKA 2I9UA 2FH8A 3BANA 1V02A 1M7JA 4GUJA 4LBRA 1CXHA 1DJGA 2HCVA 1KFBA 2O9RA 4J9LA 4HT3A 3H4BA 5FEPA 1TJPA 4HNCA 2QUUA 2E1DA 5DLCA 3W7DA 1FFRA 4LCSA 5EFDA 3PM6A 4LS1A 4HPXA 1VCFA 3UY8A 4NJKA 2ASDA 1JCMP 1HO4A 3T1GA 1R3QA 4PMQA 4W7VA 3W71A 2VRJA 4HTYA 5FF4A 3I6EA 3BV4A 3BLKA 4Q8MA 4FIRA 4UTWA 4C5YA 3ARQA 1GW9A 3GTHA 4B5WA 3CL7A 1Q6RA 3N18A 3PJTA 4GVIA 1EF3A 1YDVA 5A3HA 4C6FA 2P76A 1DIEA 3K8KA 5CPSA 1H41A 4B5UA 4ATLA 4TVDA 3F4DA 1BWVA 4PCSA 3E2QA 4BQ4A 1GTEA 4JQ1A 3I3BA 1G7UA 2ACUA 2R91A 1EYWA 2C1HA 2GVGA 3PUGA 2Y61A 5EWEA 5LNVA 2V9WA 2WVUA 1XYCA 3N9KA 4DBWA 4A35A 3TR9A 3VE7A 3UJRA 1F9CA 4FNUA 1F05A 3TJ4A 5T9BG 3BLFA 3GXNA 5CPOA 2Y1HA 4CUCA 1SO3A 1GOOA 4EXQA 3E0FA 1NQ6A 3FA4A 4WY0F 3I7SA 1EIBA 1XYBA 3IIVA 2J75A 2AGKA 1CXIA 4FF7A 1OFDA 4EBEA 5HR6A 3FX4A 4ZXLA 9XIAA 3DHPA 1P7TA 3EWYA 3GKFA 5I3DA 4DF2A 3FAXA 4K8GA 4MLRA 1A5SA 3IV8A 1V6XA 1SJBA 2J78A 2E25A 4PA8A 4LT9A 2PD5A 3TOYA 5KFNA 4YTUA 3OP2A 1EX5A 2V8ZA 4YR2A 4J3XA 2O9PA 4L1WA 3USZA 5KT6A 2OZ3A 4YTTA 4AXKA 3AIVA 1X97A 4C6KA 3G77A 6PTDA 3S0CA 3W86A 3CO8A 3SECA 3S3GA 4PMDA 4KWOA 2NX1A 3CMFA 2VEFA 3WX7A 4KIEA 2Y85A 3HPSA 4M6UA 3ARZA 4ML4A 2GVJA 2OYMA 4GJJA 1V03A 3SFKA 3NDZA 5XIAA 3PBYA 2QUMA 3BJSA 1ZRQA 2BY3A 1NQKA 3SUSA 4LAUA 3LNPA 3I65A 1JRBA 3SGGA 3OYXA 5PTDA 4KRTA 4NSBA 5T14A 2CLIA 3FEQA 3RB3A 3CUZA 4GXPA 1VJZA 3NVTA 1TWSA 1MXDA 2PBOA 3VCRA 5AY7A 2HTMA 3NUKA 1S2CA 2AQVA 4IJRA 1XCFA 1Y8BA 8CGTA 3N29A 4US5D 3GNNA 4IFKA 5KFHA 1G4PA 4J27A 2V5DA 1UUOA 2Q01A 1Q7QA 4WLCA 3AIUA 2FFIA 1M3UA 1T8QA 4JX5A 3IVTA 4FEZA 4GK8A 2DH2A 5DANA 2W8LA 3VUPA 1EBGA 1PTGA 2AL2A 3EYPA 4PL2A 3SCVA 1CNVA 3GDMA 4AD3A 3BSMA 1HZYA 2CKRA 3RGTA 2F9RA 2ISSA 3DFYA 4YWIA 2VA2A 5DMNA 1AZ1A 1JJKA 3QOMA 3WH7A 4KIRA 3W4RA 4LVGA 2R8HA 1XP3A 3TX9A 3NCOA 1PUDA 4GVHA 1H3GA 4U3CA 4WSJA 3WD0A 3WQ4A 3WNNA 4JQAA 1OCJA 5CGTA 3W1QA 3WLKX 3H8AA 4WOZA 1E9ZB 3ZJKA 4N9EA 4XD5A 3H4GA 1MWOA 2GQ8A 3W38A 1MXSA 3L7RA 2VFDA 3V16A 4AWUA 4LVAA 1Z41A 2XHYA 3HJEA 1Q2SA 4CN6A 4ZE5A 2Y8VA 3LBOA 4HSHA 5HWMA 3WMLA 3ATZA 3CUJA 4FA3A 2C2DA 3VGEA 2FZDA 3EA2A 3WLPA 4TX8A 4C7FA 5EU9A 3URNA 3ALFA 2HBVA 4AYGA 2DW7A 4U2YA 1ISVA 3ITLA 1RBLA 1KKOA 1TCDA 2CZDA 2YXOA 3GAKA 2HRWA 1LM1A 3KX6A 2IXUA 1RVGA 1AQMA 1SFSA 4JHOA 2Q8ZA 4ECLA 4U2ZA 4M6QA 5EFFA 4DYEA 1SW0A 1CPUA 3GK0A 3I4KA 1MVYA 4WKAA 1HTIA 4MJ2A 2A4AA 3GD6A 4O16A 2OYLA 1YMYA 1XIGA 1MEIA 5CSRA 4WDWA 1X1OA 2GK1A 2BXZA 4RNMA 1VCVA 1JDCA 3TLLA 3V4BA 1FCBA 5G1TA 5KFTA 3OGRA 1XIJA 4UTTC 1L6FA 4PCNA 1NTHA 2C3ZA 3WNPA 3DI0A 4MJMA 3V35A 2FB3A 2CZ5A 2CHOA 2PC4A 1FWTA 4N2YA 3CEUA 1BAGA 2EGZA 4JKMA 2QDDA 4V1XA 3EGJA 3CV1A 4WJEA 3SI8A 1SM9A 3EMZA 3B8DA 3ZR4A 3NQFA 3AIQA 5CCZA 3TXZA 1R3RA 4D6JA 1N56A 3MSRA 3WUFA 2JEIA 3KP0A 1UD6A 3VC5A 1QNPA 3LI1A 2BMBA 3WH5A 3GV5B 3MMUA 4CCCA 1Y0EA 2A6LA 2PLJA 2WBGA 3W1LA 4AC1X 1QW9A 3T9PA 4J4KA 3ES8A 4H9TA 4R8UB 3DI1A 1E9LA 1JDDA 2WZMA 1DORA 1DQWA 1W56A 3ABZA 1WV2A 2V5CA 5DY3A 4PCTA 3B9EA 1B4KA 3CV6A 3VIHA 3W29A 1OCNA 4LBSA 2IPJA 3SN1A 3AXKA 2YLLA 3SCWA 1D8WA 3CUGA 3O2LA 2X30A 3AHZA 1RCXB 3CGTA 1K6WA 3PP7A 5CPMA 3SFWA 4FLOA 1XLLA 1US3A 4UUIA 1V08A 1PYFA 4J3ZA 3QGKC 1EHNA 1OJXA 3FXYA 3PNUA 4KQNA 3M0LA 3V0SA 1D3HA 2OYKA 3BQ6A 3BW3A 2IS7A 3MCMA 4JY8A 1J0YA 2DVXA 2VC5A 4K37A 2C91A 5BNKA 4LS0A 2VEMA 4LUTA 3UGRA 3B40A 1Z89A 2RJHA 1TG7A 5DRIA 1QU4A 4PBGA 2ZZ6A 3QMTA 1ZHAA 2MNRA 3RDKA 1SZFA 2HMCA 3FHQA 3NSMA 1W9PA 3B9NA 1W9VA 2Z4GA 3GC5A 3HN3A 5I7GA 5L1KA 1V3KA 2W9MA 2W0UA 3UZYA 2OH2A 1K4HA 1LT8A 1LP6A 3ZS4A 1AH0A 3W7JA 5KG5A 5KFJA 1JFXA 3WL0A 3KLKA 4J7RA 3TH6A 2W9CA 2NQLA 5HQLA 1B9BA 2ISDA 3LGDA 3LHVA 1H1NA 4KCVA 1QR7A 1S5MA 4FPSA 2B31A 4AU0A 1SW3A 2JGQA 3OPSA 4Q45A 3UJEA 2I14A 3POHA 4CCEA 2R1NA 4J9NA 1OBAA 1KM3A 1TB3A 4OV4A 2QCDB 3WNMA 3ITYA 1QI3A 1Q6CA 4JX6A 1IWPA 3GR8A 4GKTA 3MCNA 1LRQA 1V0MA 3CYVA 3EX2A 1QCWA 1KTNA 3RX4A 4AVFA 2CESA 3WH6A 4L4LA 1F3TA 4EX4A 2GFTA 3H23A 4F50A 1WP6A 3B9DA 3WLMA 1ZAIA 3AAMA 3S9YA 1D9EA 1V0LA 3KOZA 1TSIA 3TA9A 1FFQA 3HGRA 4IQLA 7TAAA 1O1HA 3WQ5A 1LYXA 1JX4A 3QHOA 8A3HA 2Z28A 1KTCA 1AG1O 3ANVA 4M56A 5A8PA 5FF7A 2HNHA 5LXXA 1J10A 5EBAA 1QTWA 4QQ3A 4YL2A 1S46A 4MZ8A 3GHRA 2GUYA 3M9MB 1VYSX 3S1VA 3S6OA 4R27A 3EPNA 3G0XA 3ARUA 1NDYA 3CTTA 3WF3A 1OX6A 2E0PA 4RJEA 4CNUA 4GZJA 5ABGA 2PB1A 1ITQA 4Y9MA 2A3BA 2HE8A 4QSFA 2GVLA 4WCJA 4V27A 2OG9A 4DO6A 5IFPA 3VABA 1U1JA 1CTNA 1P5BA 4GGBA 3O0FA 3GHTA 1LL6A 5D2WA 1EEPA 4GQ0A 4WX2A 3W7PA 3F4VA 5CPQA 3RAQA 1RCOB 2ACQA 2TODA 3KRUA 5E09A 4HNTA 2CLEA 3UG4A 3UBPC 1H61A 3LGGA 3DYOA 3AXIA 4DY1A 2EEXA 4ICMA 4UR8A 4FMVA 2W62A 4WEVX 3NTYA 4RKAA 3ZIZA 4CN4A 2GGEA 3FV9A 1J2WA 5FEXA 3EXRA 4B92A 3T2QA 1EH9A 4HYKA 1XRFA 3N9SA 3IAPA 3EOSA 1Q6QA 3QYQA 4UFLA 2C18A 4GOAA 1FKXA 2GQAA 3AUJA 4Q8PA 5FEZA 4LCQA 1Q6DA 4MWAC 2J88A 4Y9AA 1R7OA 1VBRA 4A8NA 2UBPC 1B0IA 3GO2A 4ZB0A 2HPMA 4XK2A 3AU2A 3GH5A 2X7WA 3NDYA 2A3HA 5FCZA 3SCNA 2DY3A 2PDFA 3WQ8A 2NXHA 2PCEA 3NG3A 3IK4A 1FHVA 1W3KA 2YA2A 5H6HA 4XZ9A 2NSXA 3ZLGA 2FZ9A 1W3LA 4TOQA 1AFSA 3C0LA 1XIFA 1A3WA 4ECVA 4JTEA 4UQ9A 4LRTA 1VZWA 3HGSA 3M0KA 1BXCA 5LA2A 1HL2A 1KV8A 3G24A 3CUXA 5C9RA 4Q22A 1IXOA 1O12A 4DBDA 1KRMA 3OVQA 3ITOA 5CPTA 3T07A 3MYPA 1F8MA 1LBMA 1VYPX 3ARXA 5RUBA 4YLWA 2QJIA 1NOWA 1CB7B 3VIKA 3MUY1 2G95A 3EX1A 4KEUA 1PIFA 1S5NA 4QIUA 4QRNA 3ARRA 2Z7GA 2FB2A 1PZ3A 3QN3A 3I68A 5A8MA 3AMDA 1OK6A 3EKGA 4DXVA 1RP8A 3CAWA 3C4UA 4WF7A 4IRCA 4UCGA 1R9YA 3OLDA 2PGWA 3NVDA 4KFPA 1GQIA 4MKVA 4A8RA 1EPVA 4J2MA 4NZ3A 1TKKA 1TE1A 4AD4A 1HL9A 4PMNA 4G1NA 4LF2A 2W7PA 1OGBA 5AVHA 3QMRA 1VR6A 1HFBA 4JEJA 2A3LA 4R3UA 2OKTA 1GK8A 2QQ6A 1EJXC 1TPWA 1QVBA 4MYAA 1T0OA 4HZ8A 1IHIA 1UCWA 1AJZA 4LC6A 2EG7A 3L5LA 4DAFA 2O4QA 3C5QA 3GVWA 4JTIA 1TVLA 1Q8AA 1M53A 4ZQRA 1RP9A 1FHDA 5F7UA 3SCQA 1QNSA 2C7FA 1ENUA 3MT1A 3N11A 4NAEA 4REQB 3SSZA 1KCKA 4C90A 1BXNA 1PSCA 4JTGA 2HK0A 3A9BA 1TRDA 1P0EA 5KZMA 4ZA0A 4WQ6A 4B3ZA 2YR1A 1IT7A 3PHAA 1LUCB 4URIA 2CETA 3LQLA 1JNEA 2GGGA 4LYPA 5D2TA 3AO0A 1DBTA 1G4SA 3QZ8A 2C1IA 1BGGA 2XN2A 2QAFA 3IANA 3EWUA 3GC2A 3CZ8A 5A6BD 1BSIA 1U83A 1FVPA 3PJXA 3CZKA 2Y89A 4L61A 4QJ1A 4IMEA 2OODA 1RALA 6TIMA 4IPPA 3UFYA 3GUGA 1X1NA 3W6LA 4DPQA 3G18A 2DJLA 5SWUA 5C9XA 2PSNA 2E9BA 3LQGA 1ZP3A 1WKDA 5HJLA 4IMGA 4Q4OA 3ID7A 3NIYA 2AGOA 4L1GA 5M1TA 1XS2A 4O0KA 5D02A 4MDPA 2OLAA 1TJRA 4HIBA 4BY3A 1J5TA 1JPHA 4TXEA 3OW1A 4GUFA 3K30A 1BYDA 1KFCA 4P8VA 3BQ2A 3NM1A 2V3FA 4EBCA 2WJDA 1E0WA 1WZMA 1HNYA 2OLSA 1BRLB 5CLTA 2AGQA 4GYPA 2ODOA 1O5RA 3G6YA 3KFTA 4G6CA 1XLKA 4K1WA 3S2MA 3CQKA 4FOJA 5U4NA 1Y5WA 3PW2A 1Z44A 2GJNA 1IIGA 4PEKA 4F4XA 4CLMA 4D6HA 4B4HA 4FIQA 5REQB 3KL5A 3PW7A 2D1ZA 4F2BA 4D6IA 3ITTA 3ABSA 2Z24A 1XDJA 3IAQA 5J5RA 3DG7A 5I3KA 4RW5A 4HN8A 3OEXA 3WF0A 4HCDA 1V6UA 1C8YA 1IEXA 1U22A 2UZ9A 2IKJA 1FWFC 1REQA 4O4WA 1B31A 4S3CA 1AL7A 2BX7A 3QPZA 1UR3M 4TQRA 5LNSA 2H6RA 4HQVA 4D72A 1TPVA 4YJ5A 4DM1A 4GZEA 4HU3A 3U9IA 5GNYA 1RXOB 3KRSA 3DERA 1KW1A 1YXCA 4CCZA 4XSMA 4LY8A 3CT7A 5ABFA 4H3DA 2VD9A 4C5ZA 1XLFA 4FNSA 2EJ1A 4JIIX 3PW5A 3U6WA 4F4YA 2PDMA 3PJUA 3T05A 4Z0JA 4I3GA 4A8IA 1SJAA 1SGJA 2DQWA 4NJIA 1EOMA 1WAWA 4AZBA 3NQMA 4NXSA 4Q4PA 3EB4A 1RA5A 1QATA 3QSRA 1MFUA 5AFDA 1PAMA 5KT7A 2IQTA 4G1KA 4PYSA 4HB7A 2A85A 3H7UA 2PE4A 5FL0A 7PTDA 1FUYA 1KRBC 4TMBA 4W89A 2IXVA 3CUFA 2VEPA 3G1YA 1QFEA 3PFMA 4L6DA 1EC8A 3V5FA 4ED3A 1L8NA 4JAWA 5C9ZA 4MWAD 3KE0A 1I2PA 2VFEA 3S83A 1PHQA 2G37A 1JCXA 4BI7A 1OB0A 1E0VA 4AY1A 4LUSA 5FEWA 2VT0A 1YEYA 1SZGA 3SJ3A 4ERAA 1N48A 2ZRZA 2R8KA 1M41A 4UOJA 2GQ3A 4H6RA 4YMZA 4RU9A 2E6AA 1VJIA 1JYVA 1TMLA 2Z0IA 2W3ZA 5C2GA 3DZ1A 1WDPA 1DJQA 3HG2A 1ONEA 1UR4A 1SO4A 3TYZA 3LXBA 3OO2A 2ZRYA 3M4HA 4H19A 2DEPA 2Z2UA 3GTNA 2P10A 1JG9A 3OSPA 3AIRA 4MWAE 1PIIA 1S2AA 2A7PA 3CXOA 1GNXA 1KLZA 4QITA 4FHAA 1E1EA 2FJKA 2V4QA 4HHHA 3V0UA 1L6GA 4R9XA 1UZHA 1CYGA 1QXLA 3H24A 1XYLA 1PZ1A 3SJNA 4X9YA 3HM7A 4JCLA 1IF2A 2FDSA 4H6QA 3M0XA 3KHLA 3SUVA 3H2AA 4JNMA 4ED6A 4QE1A 4X0VA 1HJUA 4GUGA 3GAYA 3VFCA 2IPGA 1E3XA 4QX4A 3TZFA 2BY0A 4PTDA 1TPC1 2BLEA 1PX8A 1XLIA 1DTNA 1P4CA 1E0UA 1YTEA 2E9LA 4F2TA 3S42A 4U6PA 4XAFA 1K9EA 3R1ZA 4IG2B 1PXGA 5KFMA 3L0KA 2QGYA 1ML1A 1XGDA 3UA4A 2QGHA 4U33A 3G5EA 1GVRA 5BWAA 3M44A 3PW0A 1LRTA 4A29A 3S8HA 4M3PA 3T7VA 4ES4A 4H9XA 1EF2A 2PP3A 4U3AA 3UJ2A 1JDEA 3NWRA 1VFTA 4H7ZA 2CLMA 3TAKA 4IL2A 4AISA 1RA0A 1SFJA 4R53A 3UXIA 4HZ6A 4EBDA 4EOUA 3MBFA 8XIAA 1E15A 2XZ9A 3TWAA 4B3KA 3N2TA 2QS8A 1HKJA 4Q8FA 2EHHA 4PZVA 3UERA 2ON3A 4L9XA 1SQ7A 2YGYA 5HPCA 2J8TA 4CNTA 1UYQA 2WVVA 1EQPA 1RJPA 3EEGA 2YW4A 2WHMA 2ZZ1A 5JUVA 4TV5A 1V3HA 1P6WA 5M3WA 3PZVA 4M29A 2X41A 2R1PA 2VVSA 2X0HA 5HNNA 3TONA 1A5AA 1S2VA 5I24A 3HMCA 2ZUSA 1ISWA 1LLWA 3T44A 5D9MA 3P84A 3QV9A 4UCFA 5JQ9A 4P7OA 1ISZA 5EDWA 2XUCA 3RXZA 5A6MA 1CBGA 2JKEA 3S46A 4H8NA 4QEHA 1GQLA 4GGHA 2P0IA 3P82A 2YL9A 4J9SA 3MKCA 4WKFA 2XGPA 3PPCA 2HSAA 1O95A 1C9WA 4XVDA 3B0XA 2PMQA 3TEVA 1YDNA 4ZENA 3L4UA 1JZ4A 2XTKA 3OIXA 4FO4A 1BVNP 1XDLA 3KOFA 3W2UA 3DFQA 1R5YA 3QFEA 5EMUA 1OG6A 3HQPA 3U3HA 1JYNA 3LZ3A 4MAZA 2JALA 3LYEA 2EAWA 2G5WA 2QIWA 1XCWA 4J3SA 1JYXA 4GC7A 4QAWA 2J7FA 4MAVA 3BCJA 1GVIA 1G0CA 4WDTA 3VE9A 1KCXA 1W5PA 2D0HA 5C6MA 2OSYA 4A2SA 1QK2A 1SR9A 3W84A 4JTHA 3Q2DA 2C14A 3UVIA 2WC4A 5B80A 1FP9A 4RR4A 2JEQA 4C1NB 4DL7A 5KFLA 4OGZA 1S1RA 1V79A 2P8BA 2A21A 4H9UA 2ZUMA 4GXWA 4ZOEA 3OG3A 3S2CA 2FZMA 1NARA 2DJXA 4C6IA 2PWDA 4AX7A 5F2MA 3NQ6A 1H09A 1XLHA 2P88A 5HA7A 4W88A 6TAAA 4S38A 4UC5A 1LG2A 4NX0A 4O1AA 5DFAA 1S2WA 1SR0A 4O14A 1RJRA 2F38A 1XKJA 4PTVA 4HYWA 3OTRA 3OU8A 4FNPA 4F0LA 5I5RA 3TYAA 3QLLA 1E5NA 5KFUA 1W8GA 3L9CA 1PCKA 3QHMA 1NWRA 2OWWA 5LIXX 2GVYA 1A4LA 3PG8A 2IA6A 1KR1A 2VR2A 3URBA 2YB4A 1XH1A 3AMCA 3E3HA 2ADAA 4CKQA 4C1KA 3ECQA 4ORMA 1J9YA 1C91A 4GO9A 1Q7MA 4AIEA 1EDTA 1FH9A 4NHVA 3M5YA 4LCRA 1V6YA 4KS0A 2QPUA 1KBJA 2XINA 2RDXA 3KLLA 4GJ1A 4V33A 2CWXA 2VENA 3AWOA 4Z42C 1UBSA 1AK5A 4GMEA 4L65A 1H7WA 1UD3A 4B9ZA 3IGSA 3NR0A 3GDRA 5I78A 3QH2A 4PSRA 3LZ5A 4HKPA 1DKWA 1EUAA 2JBMA 1HW6A 2GSEA 5KFKA 2UVWA 1FWGC 4R88A 3ZSSA 3ZT7A 2B7NA 1Q6EA 3WLTA 5DT7A 1BQCA 2FZ8A 5T9CE 1H11A 4YTQA 3SZ8A 2X1IA 3EDDA 3EOEA 1W2PA 5H2ZA 3VIIA 4AD0A 2FHFA 3UZ5A 3SIZA 1PWLA 3GXPA 2VNCA 4RE0A 2HQAA 5I0DA 1UZDA 4JV0A 3MU7A 5AHLA 3WH8A 5ECUA 3B03A 3B4YA 4NI3A 2PWUA 2VVNA 3UR2A 4N9DA 2F61A 1THFD 5A94A 5IDIA 3CS2A 3MV01 5KMYA 3RM8A 2VGFA 1UQZA 3UJSA 2WCAA 2G0WA 1E1CA 2YL8A 4G2DA 3RG6A 4F0RA 3OSNA 2DORA 1I9CB 2Q02A 3LLFA 5HWJA 3E6EA 2R1KA 3MFIA 4QTGA 3GHSA 5F1VA 5BMXA 1IR2A 2EPLX 3WQEA 4CEUC 1F6YA 3GBDA 2P3ZA 3DESA 3SY8A 4PCFA 2I56A 1TIWA 3T5KA 1GONA 4NUWA 3STEA 3P60A 1WDRA 3NL6A 1RAKA 5AYIA 4DAIA 3CUIA 1BG9A 3WJWA 4O0QA 2TAAA 4AEFA 5LXEA 4N6EA 1E6QM 3PBUA 1LDCA 1R3TA 3G1XA 4X63A 4C91A 3PC0A 4O3RA 3O0KA 1OX4B 3G1DA 3HTWA 1NDVA 3TROA 4F0SA 4Q4KA 1E71M 1E6RA 3OHAA 3N3MA 1GVYA 3QTPA 2PGEA 1K03A 4AXNA 1P0NA 2PLCA 1HGYA 2GGJA 3LXAA 4A4AA 3HPXA 3QLDA 2QUVA 4F2UA 5EL1A 3S2LA 2W6RA 2R14A 4M7SA 3DFSA 4WKHA 3QMSA 1V51A 2G50A 3AWNA 3SCTA 5BU9A 1RR2A 1B3VA 4ED7A 5AN7A 1Q4NX 5FF0A 5IBXC 2VEGA 3R13A 3UWZA 4UTMA 3PBWA 1JPMA 2PU1A 3F1QA 1GOMA 2ALZA 3FEMA 1CI1A 4Q4SA 5CPLA 2QF7A 4FXFA 3D0CA 1E6XM 3E2RA 4AMCA 3R94A 4TQSA 4IMDA 1CGYA 4UTJA 3VMNA 3H26A 2WKJA 3QOKA 2J6UA 4B90A 5LYRA 1VC4A 3LENA 4MM1A 3RPMA 4JNYA 2Y4SA 4DL2A 3L4XA 3S2NA 5KG4A 2QLYA 5IRPA 4H7VA 2B7QA 1C7SA 4G7EB 3QC3A 4O8AA 3UJFA 1TPEA 3ARYA 4RX0A 4CQ9A 3ONCA 4GX9A 3W24A 1EBHA 1KFEA 3LMZA 4PMYA 1F07A 4DWSC 4V2XA 3K8MA 4IF2A 3O8AA 3SADA 2Q09A 1AJ2A 4REQA 4YP3A 5AZ1A 5J8LA 1KM2A 1B30A 3EXSA 1FCQA 3OHMB 4R85A 4KW2A 1QWKA 4AZCB 2RAGA 2QUNA 2X42A 3MI3A 2PD9A 5KT5A 3OVRA 2YOCA 1LUCA 2OSXA 3WK2A 3N34A 3OGVA 4Q8NA 3NM3A 4NQ1A 4JFWA 3QY6A 3RM9A 1FCUA 2Z1XA 3UXLA 1XINA 2J7DA 4BQ2A 3GH7A 2RGMA 4QROA 4A3HA 3GNXA 1ODUA 3EZ4A 1TTJA 4ZO9A 1R3YA 1FBAA 2UVRA 3UA3A 5IDZA 4LW7A 4MZYA 3VCNA 3W2JA 4BI5A 4M19A 3D3FA 4O1EA 2PDUA 2H9AB 4QM1A 1SFTA 3UETA 5A6AA 4LUJA 2DQXA 2WMJA 5AC4A 1TRIA 3H54A 4GG9A 5BMWA 4UQBA 1K77A 3A5FA 2WMFA 5A6LA 2D24A 4KT2A 4AD2A 3B8IA 4UTUA 2P0OA 3TTSA 2Z26A 4JTTA 2HZGA 2PFHA 4ECZA 1OIFA 2ZRVA 5EY5A 2DP3A 2XIOA 1E3ZA 1R8LA 1BRLA 1DXIA 1Q66A 3WUBA 3PUOA 1VBJA 1JF5A 4UTWC 3PNZA 3GFYA 3W88A 1KFKA 3GS6A 4JTCA 1CIUA 4D6CA 1V93A 4ROQA 2E5DA 2QPSA 3BVJA 1ONWA 4GLEA 3KBSA 1EDGA 4O1FA 1DJZA 3PZPA 1PTDA 2Z6JA 2C28A 1XXXA 3VKCA 4S3JA 4S3DA 1GKRA 3EOUA 3VX0A 3TJLA 4KCTA 3OVGA 3CUHA 2R8JA 3THCA 5CSYA 1UC5A 2J9ZA 4C6JA 3KL3A 3R25A 3W7KA 3AZSA 3BAJA 1Q3NA 5AC6A 1H49A 1R0MA 1XIMA 2ONEA 3N15A 4MY8A 2C22A 6CGTA 4AZIA 3UQNA 3CWOX 3MZ2A 2VOMA 2WCGA 1BLIA 3C2YA 2PWVA 3TQKA 3H2CA 3QQWA 4UFJA 4H8HA 3W2LA 1W1TA 4UR7A 3ELFA 5JU6A 4PC8A 4F66A 3VKAA 5C5YA 3GR7A 2OLHA 3A6OA 3EPIA 4RE4A 4GQBA 5F9NA 1E4LA 5LKYA 1R87A 3W27A 4IMFA 4KFNA 4LAKA 5G1MA 3RR4A 4HJWA 1I6NA 4PMXA 3NGJA 3PAOA 4DZHA 3WLQA 3M0IA 3V0TA 1RVKA 1R9XA 3TW9A 5D05A 3AS3A 3KBWA 3ZT6A 2F8QA 2DVTA 1B90A 3B9AA 3K4WA 3W9ZA 5KFAA 2ATLA 4CNOA 3RRAA 3KWSA 3W70A 1MSSA 2CKSA 3VX1A 2BBFA 2PDIA 4JBRA 4JIQA 3FHAA 1T5AA 3PTQA 1EGMA 3C0SA 4PMUA 1JFHA 3CHFA 2XZ7A 1GT8A 2A5HA 4M7TA 4MB4A 2AKZA 4D8ZA 4LQ1A 5FJUA 3ALGA 4DLMA 4YU1A 2GL5A 3AHVA 1HN1A 4PFHA 1X96A 2CWNA 2R9RA 1LORA 3IGUA 2FHBA 3VCCA 2QDHA 4QR6A 2X16A 3AXHA 3T2OA 4KH2A 4BHYA 1QBBA 1DWHM 3CWHA 3PBMA 2WMKA 4K7VA 3DKJA 4FSAA 2WO5A 3ONBA 2J9YA 4JFTA 1FWNA 1MUMA 4J9OA 2XIIA 3CASA 5IHRA 2PU0A 1TV7A 3VDBA 4LX4A 4Q32A 1WCGA 3KOYA 3OGSA 3Q8RB 4CU7A 1H1YA 1DIDA 3RIKA 3D47A 2CBVA 1R2SA 3FVDA 3RBEA 2F6XA 2A3CA 5HANA 2ZVIA 3FYPA 3NO5A 1LOQA 5HAOA 3P0XA 4I9MA 4NL1A 3IRDA 3ZWSA 4ED1A 5HPOA 4MUZA 1TE6A 1AZ2A 3BGGA 3GIPA 2OT0A 3SCOA 3C61A 1HXJA 3MZNA 1Z69A 1ME7A 4HNNA 3AICA 4HPGA 1SJDA 2QR6A 1VFSA 3TQPA 2H8XA 1UH3A 3LUTA 3KS5A 2G97A 4KEVA 3MMWA 3IVUA 5D33A 1HP4A 2G96A 4FK9A 3HOJA 2F2KA 4IUGA 4AZ5A 2FTWA 4O0ZA 1XD0A 2JF6A 1XUZA 2Y0FA 2CNCA 5CG7A 1QOPA 3CH0A 5CJ5A 3A13A 3MS8A 3WDJA 3TUUA 1GVOA 3ZT5A 3RB4A 3M64A 7TIMA 4DYJA 3BG9A 4NVTA 1HVXA 1GQJA 1JZ5A 3RNDA 5AB3A 3MO4A 3O06A 1JI1A 1OEPA 1WO2A 4ZFCA 1WDSA 4OTKA 3WQ6A 4IIFA 1IV8A 3GFZA 3IRSA 3G3DA 1MQPA 4LPCA 3U4FA 1SZRA 3WCZA 1W1YA 1K1QA 1OADA 2HE5A 1ADOA 1JZ8A 3WFZA 2NUXA 3BL3A 3HMJG 2XU2A 5L6UA 3KDOA 1J96A 4I5XA 4TTUA 3REQB 2WOQA 1HKMA 1VENA 5HINA 4UNKA 2VEKA 4NT0A 5DQHA 1W32A 3WQOA 3C2RA 3L0NA 1IZCA 1CXFA 2OX4A 4DWSD 1IE7C 4DB7A 3PW4A 2HEJA 1BKHA 5AC5A 3JW7A 4DI8A 3TC6A 1VFHA 4MFEA 5DF0A 1EXBA 2NQJA 4CQAA 4R9OA 4N4QA 1IT8A 1HJSA 1LWHA 2PZNA 1T41A 1WZKA 3B0YA 1F3EA 4DJFA 3B8UA 1MW0A 4GHRA 4QSHA 1KCLA 5C9WA 2YW3A 1XG4A 4FS9A 4LC8A 2DZBA 2QEZA 2EPHA 4JIEA 2G3NA 1J6PA 2V69A 3UNTA 4HJFA 3BQ0A 1X38A 2RDJA 3LK6A 3SQSA 2DT3A 1LG1A 3IUHA 3L12A 5KFXA 2X09A 1XICA 4TMCA 1XGEA 3R11A 3HPAA 5D38A 3XINA 5BU6A 2ZC8A 4PB4A 2D69A 2Z29A 4F48A 1AMYA 1KXQA 4FLQA 1JIHA 3W76A 5BRQA 4WXYA 3GC4A 5LSMA 3WY1A 4ADTA 1ADDA 4RDYA 2V82A 1TPUA 3QQ1A 1HKIA 3OLGA 4IXXA 1S2TA 1DQXA 1FWEC 3GIMA 3H55A 1KWKA 1O4UA 5CJMA 3SBFA 5DN1A 3GE7A 3TE9A 5CXPA 2W91A 2WANA 2VFFA 1T99A 1SZNA 4P2VA 3V5OA 3MSYA 1JNDA 3TVAA 4A05A 2VCBA 2OU4A 4QISA 4QG9A 4MIMA 3V75A 4B9YA 4E2VA 2V2CA 4HNVA 3N13A 4O1CA 2CW6A 2BY2A 4J3TA 2CLPA 5FAGA 1SMDA 5KFSA 1UH4A 1YE4A 4RLIA 2REQB 1V02E 5E6ZA 1NU5A 3VXGA 5DBUA 4F9JA 4ICCX 1JIBA 4AD1A 1S0OA 2DUZA 3L4WA 1IQ8A 5D2YA 3W2KA 4PN2A 4GPNA 4JIHA 3T40A 1XD1A 4BA0A 4AC7C 4JN7A 1QPKA 4H7CA 2J7HA 3O16A 1TUXA 1R2TA 3NEVA 5G4WA 5DMLA 3MCOA 1H63A 2PEVA 4ED2A 2JK2A 4FALA 2HBXA 1TZ9A 3C6CA 1O7AA 3QR0A 2J4GA 1FDZA 1ME8A 2C79A 3SW6A 4C6CA 2D23A 3L5AA 4GI8A 3ZR5A 1JZ3A 2XGBA 3CAKA 3DFHA 1BTCA 3UPMA 3H7VA 1CGUA 5AYXA 4E0CA 5KFZA 4XZMX 4CNPA 1QPNA 1Q4WA 3P14A 3U2EA 4GIYA 2PDBA 4W8AA 2ZWYA 4MMWA 4CD6A 1ICQA 3WLOA 2YCEA 3UR7A 1FA2A 4H01A 3NZPA 4LB4A 5GJPA 1W1B1 1YXYA 1ADSA 4J3UA 1VYRA 1VRXA 2IMRA 3N4EA 2VRQA 1DIKA 1GOWA 1TVPA 2WMIA 4IFRA 5KSWA 5FACA 1RYRA 3V18A 4NZJA 4K7YA 2INFA 3P7YA 1IXPA 1H0IA 3IV3A 3SGZA 2IQDA 1IGWA 2EPNA 3VINA 2DT0A 4JEQA 5HJXA 3A4AA 5TAOA 4O3QA 2WVTA 3FK4A 3BPWA 3UG3A 4HMNA 3S1XA 5AHEA 2X0YA 1JZ2A 5B7ZA 1VPYA 4QS6A 2H8ZA 4HNLA 4D9PA 2Z2AA 1KRCC 4H6KA 3F4NA 2WXDM 3P2VA 1QRQA 4D1JA 5AHIA 1FWIC 3R5EA 3VDGA 1XI3A 5D03A 4UTIA 3GNDA 3MWCA 2W27A 3Q8QB 1R30A 1G6CA 1EB3A 3T5HA 1RQHA 4BCEA 3S9ZA 1OIMA 4R34A 3QV6A 4WR3A 3I3EA 3W7QA 5ENLA 1I2NA 3EDKA 1I0DA 3FN9A 3WLNA 4EPEC 3W75A 3AHXA 1RD6A 2YBVA 3P80A 4H9YA 1XHGA 2A3AA 3SUUA 4A22A 3LPGA 4IQJA 2WZHA 5DMMA 3A4WA 4MADA 4HCHA 2I17A 3W22A 3CQ0A 2HXTA 3AHTA 2WZTA 4NZFA 1E6NA 2CFFA 3D5HA 1WDQA 3S4TA 3U0HA 3KTSA 4N7QA 5I6SA 4TU1A 5FJPA 1GTHA 4R7WA 4OUEA 1L6YA 3EPMA 3VZXA 1US0A 4YYCA 5EMYA 4PTMA 2ZCGA 1PV8A 3W25A 1NFGA 4DXXA 2NUYA 2AAMA 4S23A 4WD0A 2QVHA 5I3JA 3U7BA 3FSUA 3URAA 1UQYA 5H8UA 3NQDA 2GJLA 1V7YA 4AZHA 1P48A 2PDYA 2V63A 2BQUA 1M65A 4J9RA 3TN3A 3FNDA 4ADSA 3MMDA 3HG4A 2E9MA 3MHUA 4AFYA 2NLIA 4W7WA 3QY7A 5HWNA 2XSXA 3TSBA 3GXTA 1VGAA 2ZUTA 3MR6A 4S3GA 4QLJA 2ABAA 1GOQA 3II1A 3NL3A 3GIJA 3TA6A 4WY0A 4U28A 4CQ8A 2IUZA 1KNWA 1QJWA 1A0DA 3ORWA 4A3YA 3EKZA 3KVJA 2GDUA 3NZQA 2YJQA 5KFVA 4FS2A 4RV8A 3SI9A 5E0FA 3RLHA 4B2DA 1ZCOA 1DE5A 1VB9A 5EWGA 1H7RA 2DPEA 3NAVA 3FSTA 3JS3A 4W5ZA 2ACSA 4DO7A 4XQ6A 2ZX6A 3HGJA 2BASA 2RDTA 3PR4A 1T6MA 1FWHC 4ZB2A 4Z17A 1U2YA 2V5BA 4HYRA 4H2HA 2F2HA 3EOOA 4DUOA 4ZO7A 4YNGA 2DFAA 4W7UA 4ZQMA 1UA3A 3USBA 1KXTA 3LMYA 5D2VA 1Q6FA 1PL9A 2ZYFA 5A95A 2DUXA 1GKPA 2QHAA 2VI0A 3G1RA 4J5NA 1H7PA 4A21A 1MFVA 5DT5A 1G94A 5L1JA 3BOFA 2C16A 3AI0A 1ZCCA 3AIBA 4KEMA 1UZ1A 3JZUA 1GHSA 2JF7A 3M41A 1HF6A 1OCBA 3KCOA 4GKLA 2ZTJA 4Z1BA 3RM4A 1DJIA 1MNZA 3BSHA 2QPXA 4NKCA 4XTIA 4HMDA 9RUBA 1E4IA 3UXDA 3ZVHA 1EJRC 3PVXA 3CL6A 4G7EA 2AQWA 1FHUA 4N4PA 4LANA 1ALDA 3MUXA 4EPDC 5FAJA 4H9ZA 5CEWA 4DLFA 2VYOA 4WSHA 3TCEA 4ZO8A 1M68A 1VEOA 3W85A 3JR2A 4W5UA 3W7GA 5HQEA 1A5CA 2VGGA 5CSUA 3VTRA 1DWJM 1XGZA 1YW1A 1CEOA 1KFWA 5KFFA 3PZQA 3BTNA 4IR1A 1R3WA 4GISA 2HV5A 4GUIA 1A47A 4O3NA 4JNZA 3QBUA 3VD5A 4RNOA 3NPVA 1EHAA 3W81A 1FWDC 4WIWA 1BSLA 1JUEA 2FVKA 1JUBA 3NGDA 1VFFA 4J28A 1DQUA 2GOUA 1UKTA 4YS1A 1YPXA 1PX4A 2H9AA 3NZRA 3PB2A 4K1GA 2XPKA 3UYCA 2G4FA 1VFUA 3P62A 5GVJA 3TYCA 3ABRA 1XFCA 1F4AA 2V3EA 1L8PA 2A7NA 1G67A 3VIJA 2RDWA 4M80A 1B3OA 4RUBA 1ZBWA 2OZ8A 4CNNA 4KERA 4AF0A 4E6MA 4GY7A 3WD1A 2PRMA 4LV4A 3SR7A 3VOGA 3MTWA 3HQ1A 4U5IA 4F3HA 4EAYA 5ABTA 5ABEA 3GBEA 4WJ8A 2DIJA 1GVEA 2Y8KA 4IP7A 4QLKA 4JTQA 2WCSA 1BYAA 2HXUA 5C55A 1P1MA 3N2OA 2J62A 4HNUA 2PRHA 4TQTA 2A79A 4MJ4A 1PWMA 5D32A 4LNYA 3AIWA 4D6FA 4U10A 4XIMA 3L2LA 3FJNA 2ASLA 3WN6A 2Y2WA 1UA7A 2NT0A 1RBOB 1W2VA 1R86A 3WF1A 1VHNA 3CU2A 4BQ3A 1QHZA 1E55A 3OA5A 2YA0A 4PBFA 5CZSA 4RK8A 2HNEA 4RNFA 4PSPA 2FHCA 1UUMA 4LOCA 1MQQA 1ZU8A 3W1PA 2JEFA 2QYGA 4JIPA 2Y5JA 1VRDA 3W7EA 5D37A 2E3ZA 4BWLA 4ACZA 1TPFA 4H6EA 2JEGA 4MNJA 1X7FA 1A3XA 1ZJHA 4S3KA 1KGXA 1ZP4A 1W9BM 2AKMA 4IX0A 3OJGA 2W92A 3IN5A 5DMYA 5GJNA 3TYUA 5MKGA 1WZAA 2XH7A 1JUKA 3W26A 5A2BA 3ANUA 5F4WA 4JTAA 2VX6A 3M0HA 4LS2A 5I07A 2A6NA 3ZOAA 3BLPX 4GYPC 3F5KA 3TW7A 1T96A 4IIGA 4M6PA 4ROPA 4HPNA 4ZOAA 5I2UA 5I09A 7REQA 2V5KA 2FDMA 1YQ2A 1I60A 3N12A 3PN8A 1YRRA 3N6QA 1FWBC 1HKVA 2BZNA 4Y9OA 2PODA 2X1TA 3LBCA 2E6DA 5F2GA 3G6XA 1XLGA 1JQXA 3N6HA 5MF5A 2JEPA 2OKOA 1JI2A 3MA8A 2HWGA 5GPRA 2E7FA 2ZDSA 1QHPA 2W61A 1TJ2A 3VGFA 4N6FA 2C15A 4H00A 1W1A1 2XM2A 4Z08A 3E2SA 5BOEA 3PWAA 3RF9A 3WYZA 3FIGA 2WSKA 4Q4MA 2PTYA 3MVTA 4I6VA 5TNVA 4XBSA 4FXRA 1VLWA 4DBEA 5J04A 1J0ZA 3WK0A 5C70A 3LOTA 3M0VA 4EWJA 2Y88A 1PCWA 3EMQA 3TP4A 1MNSA 1V3LA 3FGCB 4CQCA 3V6KA 2OR2A 2PC8A 2VELA 5BROA 3GB6A 2QV5A 3TKFA 3ZJ6A 3Q94A 4TTGA 2X8RA 5D30A 1UR0A 3P5ZA 4QDMA 2DZAA 1MUCA 3ITXA 1V8EA 3JRKA 1XSJA 1HJXA 4RNHA 1RBAA 3FKKA 5JBDA 4A3UA 6XIMA 4QNEA 2VRKA 4EPBC 2QIIA 4NZ1A 1E70M 3GR4A 4ERGA 5FKYA 4PTNA 2VTFA 1PJ9A 3R89A 2QCNA 2ZX5A 3L68A 4G8TA 1H0GA 3M5VA 2ZRXA 1UWAA 2XC9A 7A3HA 2EPKX 4FNQA 4RZ4A 4QGCA 1H4PA 3PZUA 4DO4A 4HA3A 5D9NA 3SN4A 3VKJA 1J0KA 3NGFA 3C2EA 3CTLA 4JKLA 3OBEA 1B4EA 3QSTA 2R8WA 3OLIA 4GWEA 2FLPA 2BQ3A 4EXBA 1TV3A 4PR4A 3TR2A 4GE8A 3RILA 4I8DA 2EF9A 6REQB 1FH7A 5K2ZA 2TMDA 4EPKA 1FY6A 3SRHA 2QXWA 1QWGA 2ZUUA 5LNUA 2PDLA 2W7OA 3RX2A 3DC8A 4N42A 2PDXA 1AD4A 3TWBA 4KPLA 4ZSUA 1SO5A 4H2CA 2I7GA 3K4AA 3FDKA 3R43A 5LA0A 2J79A 5E5CA 3FVMA 4JTLA 5BXTA 5EA9A 3N3TA 3QZ6A 3V7PA 4BJHA 4L4MA 5LIYX 1XIDA 1X8CA 3TTYA 4U5KA 1YX1A 3L0GA 3T0TA 4TX6A 2BFGA 2ZUWA 3IGHX 1ONXA 3TQ1A 3EA3A 4IIHA 2XGIA 5I3FA 2WSQA 3VILA 4DJEA 3WLLA 2VDIA 2OWCA 3Q58A 1M7XA 3NQCA 1J0JA 4DJDA 2YB1A 3QV7A 3H70A 1O5XA 3MR2A 1OZQA 1X8FA 1LROA 2NSOA 1TA3B 4PTWA 1RLDA 1EJVC 3NQ8A 4GBDA 4N02A 3TNOA 2EPMX 4EACA 1UOKA 1H50A 1TWDA 1XBZA 3WDPP 1ISXA 4D6GA 3UWUA 1D7KA 4DI9A 3VC6A 1J01A 5HXMA 1AODA 4TR9A 1OFQA 3UW6A 3WBWA 4AVNA 3WQGA 1MZRA 1Q2RA 4S3EA 1W5MA 2ZE3A 4DXKA 3KZPA 1LL7A 1N8IA 2X7VA 3QXBA 4E4UA 5DQIA 4DWSB 2NV1A 4NRSA 3WNLA 4AG0A 4XO6A 3RLGA 1C29A 3TZNA 2EJAA 3TQ0A 2I57A 3SY1A 3AYTA 3O9NA 5JBEA 4ZFMA 3W82A 3GZ3A 4HP5A 3AYRA 4JICA 4AH7A 3C86A 1U5HA 4NAFB 4DL5A 3NO1A 3QYSA 3WH9A 1VLIA 4O1BA 1KKRA 4GIEA 1R3VA 4PE8A 3VA8A 4EKJA 1A5NC 3KW3A 1B3YA 2GJXB 4AYSA 3CJPA 1FDJA 1LRNA 2RHGA 5EWFA 1OQFA 2OELA 4ZODA 3EWDA 1N8FA 2X1UA 1AL8A 3LCXA 2E09A 1PZ2A 5HMFA 2VUYA 3WDIA 4Q33A 3WQCA 1VCGA 2Y7EA 5DLGA 1CECA 4E5TA 3WD3A 5FJTA 1UKSA 4AIBA 1US2A 1JAKA 4GZ7A 1ZENA 2UY2A 3NO3A 4ZQNA 1SJCA 4UQEA 4DIAA 5E70A 1UMLA 4JHZA 1M03A 4XO7A 1PKNA 3F5JA 3QTGA 4GNKB 1CXLA 2KAUC 3M9OB 1ESWA 3SUTA 4Q44A 3IJQA 1I2OA 1OF6A 1R3SA 3L5MA 5KFDA 3CZGA 2Z00A 4NLGA 2XIBA 1AVAA 3WIJA 4L9YA 4F79A 1MXGA 3VIFA 3UU0A 5HNRA 4A2RA 1J0IA 4B5XA 3NYDA 4JD4A 3T8QA 3ZSTA 2XH4A 3WF4A 1UKOA 3W7CA 4C6NA 2Y7FA 3P61A 4AEEA 1EQCA 5BXPA 3TU9A 3L21A 4FOUA 3FOKA 4PL1A 2TPSA 2XIMA 1XDMA 2ZA2A 1OINA 4LVBA 5G2WA 5HK4A 3OOQA 1QOXA 4Q6JA 2ZBTA 1J11A 4YCOA 4IICA 1TJ0A 3CH9A 4UFMA 2Y7GA 2P9BA 4CD5A 2V38A 3BARA 4ZVJA 4Z2IA 1C92A 4JTRA 4QQUA 2XFYA 1X6UA 2WPGA 2XYLA 1PYMA 1KLYA 1R6WA 4JTDA 3EB3A 3W1UA 3TCSA 1ZY9A 4I5UA 2W4XA 3ANYA 3VAVA 3M9YA 2X05A 3VGDA 4OU1A 2GGHA 3N4FA 2H3BA 4ZMGA 1FWRA 1P7TB 4Q6XA 3BG3A 3LB0A 2OMAA 1XPYA 4PUMA 3IJLA 1GKQA 4YN5A 5F9LA 4GYJA 4I90A 3S1GA 1ELSA 2HPIA 3P8JA 2QF8A 3I10A 3RBDA 2B4GA 1J93A 3ZYZA 5XINA 1QI4A 5G5IA 3NSXA 3TN6A 1RD5A 3WMBA 1XWYA 1GJPA 1FHLA 3PBVA 3M6DA 5KG0A 1JCTA 5HNUA 3K1GA 1YLVA 3DGBA 3JVAA 2YL6A 1OT1A 3GW0A 2CLHA 4MKNA 2OVLA 1NIUA 3L67A 4QCEA 2YDRA 4GQRA 3WEMA 3GZAA 1NWUA 3G6MA 3QHNA 2PP0A 4RDVA 1XR2A 1CZ1A 4ML9A 8TIMA 4BK9A 2XVPA 2FZBA 4HK7A 3RITA 4HU4A 1BEUA 7CGTA 1R2RA 4NIRA 2WWCA 1GCYA 4UMCA 5I06A 5HBFA 5KFYA 5JMUA 5I3IA 4Z2KA 3LCFA 4OOZA 1DWFM 2PWGA 3WQWA 3PZ9A 3POCA 4Z1DA 1NM9A 1M01A 1JQVA 3O15A 1WPCA 3H6OA 3E0WA 3R8HA 4DN1A 1KC7A 5A6KA 3GDLA 2VD8A 4H41A 1O6IA 3RO8A 2D0GA 2CXEA 2W66A 1WE5A 5TQLA 5JH1A 4AVOA 5H91A 5DEZA 3E0LA 4RNIA 4HOXA 1XC4A 4O19A 1ZBCA 1ZPTA 2ICSA 3LHWA 1QNVA 1T7LA 4RUAA 1ICPA 1VAHA 4G7FA 2CC0A 5DCBA 1Q6OA 2FLIA 2FLLA 1FP8A 3CV2A 2QULA 2WSPA 1PPIA 1DEDA 3MR3A 1Y5VA 5H8MA 2WK2A 2AL2B 4QBXA 1RHCA 1K9FA 2GYIA 4HSNA 1TJ1A 1MDRA 3EBVA 4IWWA 2WHKA 2ATSA 3DFTA 5DLFA 3VIGA 4OKDA 4NX5A 3N25A 2R1LA 4ASTA 4EYHB 5H8PA 1TR9A 1MO0A 4BF5A 2PWEA 2V4RA 3SGUA 3QR1A 3CM4A 3GVVA 4DF1A 4QP0A 2VZTA 2OT1A 2E28A 3BAYA 4EE9A 5BXSA 4NZCA 4NYYA 1XX1A 1CLKA 4DPPA 2YDSA 4C6OA 3LSBA 1XBXA 4J3VA 4E8GA 3VNZA 4WK9A 3EWCA 3KCLA 1UWQA 4EVZA 2Q8LA 4Q8EA 3IS4A 1XBYA 3EX6A 4XKYA 3V6HA 3GDTA 4PMZA 5LNRA 3DOPA 3C0QA 3B97A 3TQVA 3D6NA 3NXFA 1QK0A 4GNVA 4D8LA 4FB7A 1B3XA 1EYEA 3M1ZA 4OFCA 3VNLA 1DP0A 2V81A 4UFIA 1GUVA 2DIKA 2GSJA 2E8ZA 3OHBA 1XYAA 1JCNA 2A3EA 4UIOA 3T09A 3UG5A 3BLLA 3WDHA 1DPMA 4RCXA 4GH1A 3T0BA 8XIMA 3BAIA 1X1ZA 5EMMA 4IPJA 1UH2A 4L5ZA 3VFLA 4UXDA 2WJEA 2GK1B 2NLYA 1BVWA 2OEKA 3MMTA 2XIQA 2AMGA 2NXGA 1GQKA 2DW6A 1LQ0A 4Q8QA 4XZLX 3B8WA 3TNBA 1DHPA 2BGQA 4BFAA 3LI0A 4GVGA 1A53A 4I8YA 4DBUA 4HA4A 1ZFJA 1DL3A 4Z1CA 4GD0A 4YXGA 1W3HA 4FAMA 4PULA 5KFEA 3NQAA 2POZA 4XKMA 3OB8A 2QMJA 4XAYA 2RDIA 4U7CA 3BQ5A 3VO0A 4MYXA 2BHUA 1WQ5A 4KCUA 3BW4A 6ALDA 2J27A 4IRKA 3LEPA 5DBTA 4ZOCA 5EGRA 4DZAA 2QCCA 2R1MA 3UZZA 3Q65A 2VC6A 1EPXA 4HHMA 3TIMA 1UD5A 1WDDA 1K9DA 3U7VA 5FF2A 4ECTA 3GV8B 4QDWA 4IOTA 1BXBA 3FKRA 2NQHA 1LOSA 3VGHA 4HSOA 1EJWC 1F2JA 2P1FA 2XVNA 3E38A 3AQUA 5FJRA 2ZC1A 1QI2A 2XIJA 3SAZA 3A21A 5CC6A 1RYSA 4PMJA 2NT1A 1IEWA 2AAAA 3VGGA 4FOKA 1ZJBA 2CYGA 1BF6A 2J9XA 1OD8A 2O7SA 3KZSA 2JIEA 1DTUA 3E1F1 2VHLA 5G4EA 4WVXA 3LNMA 3GXIA 4D2JA 3UT0A 4LGXA 4Z2HA 1H7OA 3A12A 1ICSA 4W4QA 4MNLA 2VZUA 3WZ0E 3PPHA 2VR5A 3GQCA 2NX3A 4NJHA 3ZLHA 1VEMA 2VGIA 1PX3A 1XLMA 1MRQA 4M5PA 1B57A 4XZBA 1M9HA 1AD1A 2YIHA 4UQAA 3VU2A 2VA3A 4LUTB 4YQWA 2FVLA 2FH6A 3ATYA 2IW0A 2C8NA 3R2GA 5DY2A 1PZ0A 3V36A 2BWGA 3LU2A 3EWZA 4AZ6A 4QE4A 2FMNA 3CZEA 1QT1A 1T3NA 1JL8A 1UP0A 3QM3A 4Y8FA 5I23A 4LYRA 4PBEA 4F40A 2ZRUA 2V9DA 3BQ1A 1M1BA 3W1XA 3W01A 2Z1BA 2FIQA 3W7IA 3LTYA 3EDJA 2P53A 3W53A 3PFRA 1BTMA 2P5NA 4POCA 3EDFA 4CD8A 1MZHA 2W9CB 4FNTA 4GC4A 3IJIA 3OG2A 4PODA 4DEZA 4PB5A 3GRIA 1ECQA 4LALA 4JTKA 5EYWA 4X2RA 4NJJA 2WB5A 3IPWA 3TXVA 3RMEA 5K3VA 1TUFA 3N04A 1TFVA 1TWZA 1XPGA 3VM7A 1LBFA 4W8BA 1RCQA 4QDPA 1YTKA 3K1DA 1YTDA 1E6PA 4E38A 4GY1A 1CGVA 2VFIA 1VBHA 1EKOA 2AOSA 1Z3NA 2BOFX 1PBGA 4Z2JA 1K8ZA 5D9PA 1PVNA 1UZ4A 1MW2A 3RCNA 4QJ4B 2QZRA 1UWRA 1W9XA 2YFNA 3NFUA 3NQEA 3PTMA 3UCCA 4F0KA 2J7CA 3BZGA 2ZOXA 2GJRA 4BR1A 2H3DA 3RLVA 4LY4A 1G01A 1YHTA 3RX3A 3AISA 2CLKA 1W1VA 5I02A 3KDNA 1F6KA 1YIXA 4BZYA 3B0VC 1H5VA 5HNTA 1AMKA 2Y6ZA 1VFOA 3MUAA 4IL0A 4I5RA 1BYBA 5G2HA 2P3EA 3L4ZA 3GQYA 5I03A 1GWJA 1MUWA 2OZ0A 4PB3A 5LNWA 4DZ5A 1E4MM 2GDVA 1L9WA 3B9OA 2INEA 4MY9A 4YTSA 1Y5XA 2WMHA 1Q63A 4LJ3A 5XIMA 1RQEA 2D22A 3SIMA 1E0XA 5EKYA 4OHQA 3TN5A 1QBAA 1EWEA 4X22A 1NH6A 2Q6ZA 1TWIA 2VEIA 3N1AA 3HPFA 4UTLA 3GILA 3IVSA 3WJZA 3UWWA 1JD7A 1A4MA 5H1WA 6A3HA 2W9AA 1OYCA 3GSMA 3QV8A 2O9TA 4MY1A 3CIVA 3G6LA 3KWXA 3EB2A 2XVLA 3PZNA 2OO0A 3BWWA 2GWNA 4O57A 1XSKA 2G8ZA 3LRKA 3LV5A 5AOUA 5JUMA 2IPFA 1M7OA 2WYSA 2ALDA 2X40A 1HG3A 1DJXA 1U5JA 3UP8A 3TMQA 3L23A 3GIYA 5FJOA 1KFJA 4C7GA 3F03K 4FLRA 3W2MA 2YXXA 3VMPA 4F8XA 1PEZA 3EAUA 4O11A 3C0JA 1IZKA 5J5DA 3BJYA 4LNCA 3DIPA 3SEPA 2NQ5A 1XRSA 3G1VA 3UD6A 2AGPA 4O4VA 1A3HA 2WW5A 5M03A 3PPFA 3KOXA 4L56A 4J1OA 3W23A 3ABOA 3DFPA 4JTUA 1UKQA 4AHQA 4I7UA 1LLZA 4DUVA 4LVFA 2JQXA 1E5JA 1V3JA 3VOCA 2ZIDA 4UFHA 3BMVA 4QLLA 3DENA 4LBUA 4MLJA 4UNLA 3WBYA 4YR0A 4R7OA 1P0BA 1GPFA 2EBNA 3GG1A 3UWEA 4IGSA 4NAFA 2E8YA 2FKPA 1UR9A 1B9ZA 3VNDA 2J25A 1H2JA 4NNAA 3U48A 1TV2A 5DG9A 3NNTA 3RMJA 1GOXA 1EA9C 3W72A 2NW0A 4HOZA 1UWTA 3OZMA 4DJFC 4M51A 1SO6A 2RKXA 1IGSA 4I7VA 3CHCA 1K7XA 3N2CA 4MGGA 3TYEA 2GVEA 5C5JA 4MKSA 5L1LA 3LHYA 3S47A 4PFMA 3GV7B 5JIWA 3AS1A 2WKLA 4HA0A 2NVAA 1NWSA 2XISA 4HZMA 3ZMRA 1E6SM 1RK5A 5AC7A 4JDBA 3WEOA 3VZZA 3HA1A 2PTWA 3W28A 4GINA 2PUZA 1TX0A 1H5YA 3OA3A 8RUCA 1AW1A 1PS9A 4ZO6A 2YLAA 2FMOA 5CC3A 4UFKA 4UR9A 1LCOA 4MHBA 2ASJA 4LU0A 4LUYA 1MEHA 1XIEA 1G9HA 3BURA 1DJYA 2OEJA 4QJ5B 4JX4A 2PLKA 1UJQA 2X0SA 4MFDA 3F2DA 4DM2A 3DYMA 4XZWA 1I75A 4YVXA 4NAEB 2BVDA 3N2BA 2O4MA 5FA5A 4DELA 1PKMA 1OGGA 1VD6A 3WSUA 4IUOA 4OWGA 3LG3A 1BD0A 3EDEA 4R33A 4JS3A 5LGZA 1SYTA 1I8JA 2YCJA 1K3UA 3DDMA 5CH9A 1A50A 4DRSA 4QW9A 5M17A 1PDZA 3Q45A 1SZEA 3S5YA 4KGJA 3M0MA 3GYCA 5AHNA 2DV0A 5I79A 3GG7A 5DELA 3IEBA 5CGQA 3GKAA 1QASA 4Y9PA 1EGZA 2VDHA 5A2AA 3FW6A 2IKHA 3P3BA 2EO7A 3LSCA 4LEFA 3M0JA 2BGSA 4ZQOA 5AVNA 1XKYA 3W7RA 4NG3A 1Q5MA 4HOWA 3Q8PB 3K8LA 4KEZA 3NYZA 1R46A 3FDSA 4FZIA 5HUPA 3C8NA 4B16A 5HULA 1EIXA 3IUIA 2Z1VA 1G5AA 5FJIA 4J40A 2ZZ3A 4MF4A 3WUEA 3ITGA 2UVVA 1LLOA 4M0XA 2E67A 1P6CA 5KETA 4XD4A 1VIWA 3CZLA 3N2XA 3BH4A 2D2HA 2Y70A 3VZYA 2HDJA 1UG6A 3KS6A 1JGMA 2C2EA 4L1XA 3PULA 3T4WA 3OHIA 4TV6A 5LA1A 3WMCA 4K36A 4JL1A 3S5OA 3CV7A 2J7EA 5T26A 3TTOA 1UW9A 4PH6A 2VQTA 1GZGA 3AZTA 2J47A 1ZETA 4GQQA 3KBMA 1XLDA 4M81A 1XUUA 4AD5A 4NASA 4HMCA 1ODZA 3GX9A 5C7HA 2B0MA 1O1ZA 2VM8A 3KAOA 3W2NA 2IPWA 5HUOA 3IWPA 3R6IA 4W87A 1ISYA 3S5SA 2G3IA 1KFLA 4AQLA 4R8UA 3PZTA 1H7XA 4ZSTA 1ZJAA 4LAMA 2AMXA 1OFEA 3EA1A 4F4RA 1REQB 2O55A 4RDWA 1W3NA 2Q3OA 2V68A 3P67A 1XL9A 1J12A 1TVNA 4ORIA 2PTDA 3HF3A 1NDWA 1JD9A 4H04A 3A3XA 1Q8JA 2QV4A 1FQ0A 4GA8A 2AU0A 1OCQA 2DVUA 1M5WA 1OM0A 3RJYA 4XTDA 3W37A 3SCUA 2GOKA 3MHFA 3RHGA 1Q6GA 3WFLA 5ABFB 4RUCA 3OZOA 3ABXA 1QOQA 3C56A 3B06A 3E5PA 3LDVA 1D7FA 2VP8A 3U57A 1I45A 3FJ6A 2MUCA 1ZGDA 3OZYA 1E51A 4AMAA 3CAQA 2OSWA 3IJDA 3E74A 3VMOA 4UOQA 2ZZ7A 2PPGA 1XIHA 1C8VA 1EO7A 4HA1A 3KTCA 3O6CA 5CQ1A 1W3IA 5BOOA 4GO8A 2EXOA 5DGAA 3J7HA 1AUSL 1H62A 4IXHA 2IKIA 4PRWA 5KG6A 3HURA 3G2GA 3E12A 1OSEA 3GW3A 2I16A 3H21A 4GC6A 1OYBA 1LQAA 2BXYA 4ENLA 3LS9A 4PCPA 2FGBA 1XH0A 3SY5A 3S6DA 1W1ZA 1ZAHA 2DU2A 3W7OA 3KEHA 1W6TA 2PDJA 3RR1A 2CPUA 4LUSB 3UXAA 1O5QA 3THAA 3WUGA 1CXKA 2QCDA 4PUJA 4HHLA 1QW7A 5CG0A 1VJSA 4NP7A 4FBUA 3VKBA 3S9IA 2QCMA 2MANA 2WC3A 4C1LA 2PDNA 2OOFA 4IQDA 5D04C 4LVDA 4NZ4A 4KGLA 4KWWA 1R7AA 1XRTA 3MI2A 3IJ8A 1PKLA 4US6A 4J9QA 4Q4RA 4WDXA 5HDRA 1JPIA 3W3OA 1Y7VA 1JR1A 1HKKA 1PB0A 1FCVA 2WPBA 1NF0A 1XISA 2R8IA 3O6AA 2VQUA 4DJFD 5KFQA 4J35A 1B2YA 1SUXA 3G1AA 4O18A 3GM8A 1XYFA 4S3BA 1RK6A 1TREA 3CHVA 3NSNA 3DYPA 4HD5A 3QJAA 4JN6A 3PS7A 2VOTA 4RV3A 3TAOA 1GZJA 1WB0A 1KBKA 5L1IA 5K9CA 3BDKA 4IGNA 1N82A 5KT2A 4JTFA 5T8GA 3V5CA 2YFOA 4H8UA 4H9MA 3ENLA 4ZOBA 3C3NA 4P7RA 4MJZA 1UKPA 4YYFA 4CGTA 3T81A 1CLVA 4B15A 4Z1YA 2D73A 2R82A 2D2OA 3L4VA 4TVUA 3SRKA 3IJ6A 3XISA 5HJYA 2DSWA 1TCMA 2OJPA 3AMGA 3MB9A 3T5LA 3VYLA 4ZL1A 4C60A 1EZ2A 2NXIA 1CB2A 1WXZA 6XIAA 3P6LA 4N0RA 5FSEC 2WJFA 5KFCA 1TO3A 1W91A 1S5TA 3MW7A 3BZJA 3WJXA 1RQBA 1XIIA 1LT7A 1J79A 4K8EA 3CHEA 2ZZ5A 3K2GA 4ECWA 3ZJ8A 3KM8A 4RW3A 4AIOA 3RJXA 2VDGA 3H40A 4B5TA 1I2RA 1JPKA 3TSMA 2Z1KA 5KINA 4S1FA 1DOSA 3LPOA 2VC9A 3EPGA 1HJWA 1XFBA 2QMKA 2J13A 4A6GA 1TZ7A 1O5KA 1B1YA 3BV7A 3WO8A 4HU8A 4ECQA 3I6TA 5JBFA 1IYXA 4C6BA 2PDWA 4HN4A 1TV5A 1WKEA 2UY3A 3OBAA 2BXVA 5BCAA 1GPWA 3RLUA 1DWAM 1UASA 3HB9A 4H1ZA 3TMLA 2WVVB 4IX2A 1U1UA 3A5VA 4K2SA 2EG8A 1EXPA 1IZJA 1K8YA 1U33A 4DQWA 4RZBA 1YPFA 1PDYA 1ZTVA 4WOQA 1VFLA 3GVQA 3IIXA 4XAGA 3RU8X 4L6HA 3S6TA 3LHTA 3DGRA 5K4ZA 1V0NA 1EDQA 4Y90A 4ZXOA 3VOFA 4JYDA 2PZ0A 1BFNA 2ASHA 3I3DA 1RJQA 2PDQA 2NWRA 2BB0A 1NSJA 4M1RA 1NFBA 5DG7A 1DYSA 4AEOA 2PA6A 5KTLA 3GU2A 3ZLFA 3SCSA 1TMQA 1F6PA 4IMCA 3YPIA 1OFPA 1XLBA 4F4WA 3E0IA 3RFAA 4IISA 2OXNA 4G9PA 3PAJA 5AZ0A 3A24A 4LF1A 2YL5A 4GFIA 3NDOA 3R7MA 3F5LA 3UCQA 1KV5A 2NWSA 3WNKA 2WSYA 3L65A 3GFXA 3VOHA 1R38A 4FXJA 2QJNA 3DHFA 4ECUA 1EJTC 2PDPA 5CAHA 3MR5A 5KITA 2QJGA 2PDCA 3FLUA 2ZRWA 3NQGA 1W9DM 1XW8A 2IBKA 3B3DA 3M9NB 4ZE4A 3UY7A 2KX9A 3BLIA 3BCFA 1GHRA 2NZLA 3FCPA 4BWLC 4TO8A 3NZGA 4H4IA 2WZEA 1JF6A 5E1QA 2QW5A 2J24A 1XC6A 4YTRA 4XZNX 3G8RA 3VKDA 2WKGA 2ZE0A 2BOGX 2WQPA 2YKKA 3AZRA 4AX6A 1PKYA 5KG2A 3F7JA 1W1IE 3GU9A 2QDGA 4U31A 3WQPA 3LTSA 4IGMA 4JIRA 1IEVA 1V6VA 3AALA 5IM51 3KL0A 4OJYA 2C13A 1JZ7A 1VEPA 1K70A 5EB8A 5C2XA 4EIVA 3H2FA 2OFJA 4JV2A 4RZ6A 3AJ7A 2DDXA 4F0HA 2POTA 2WWDA 3QRHA 4KF1A 2DGAA 4Y7EA 3TW6A 3UXKA 4GC3A 2OX1A 3N6JA 1KXVA 1MI3A 1D8CA 1YBQB 3N73A 4U4MA 4C6PA 1NEYA 2OO6A 3GHUA 4FX7A 2CBUA 2WM0A 1UOZA 3PR2A 3BLEA 1KM6A 4QG6A 3MDWA 1JCJA 1S9FA 1RH9A 3RN6A 4Q8OA 2Y63A 1O60A 5KFPA 3RCYA 1QO5A 4WHBA 1KR0A 2BSLA 1W54A 4QWCA 2P50A 1BF2A 1XH2A 3WBAA 3VDCA 5HQMA 4NYUA 1CGWA 1JDAA 2BHZA 4B2DD 3HIJA 3TYBA 2UY5A 2QCFA 3LPPA 2QCHA 1S3TC 2WLYA 2J8GA 3V6JA 2G3FA 3HQOA 3T6CA 4QEEA 2CBJA 4H83A 4E4FA 3KUMA 1OK4A 3I6RA 1J5SA 3SCPA 7ENLA 4JDYA 2ZTKA 4DO5A 1S1PA 2WV8A 3UG8A 4RE2A 2HVOA 4QE5A 1FDYA 4E2OA 2BP1A 1GOKA 4XSLA 1OC5A 3VKKA 3R8GA 4EYIB 1N8WA 3AIEA 3WJSA 3RB6A 5REQA 2ALRA 1E1CB 5K4XA 3BMWA 1IEQA 4OV9A 5GNXA 4QWBA 5E0KA 3WF2A 3ICJA 5E9AA 1X6NA 2PTXA 5C71A 1RPXA 3SM0A 3UWVA 3E02A 5CBJA 2XN1A 4H8VA 3UYIA 4AUBA 4JN8A 5K7JA 3GVGA 1WUFA 3DFOA 1Q6LA 1BKSA 2NQ9A 3G1SA 4K38A 4ZR8A 3UPWA 2PGRA 1F74A 4IPIA 4O17A 4PMVA 2J8FA 2FZNA 1WZLA 5EMJA 2ESCA 4Q7IA 1JEZA 5TD4A 2OTDA 4M6VA 1JPDX 4QNWA 3LTPA 3CHDA 3QQ0A 3G6VA 4MUPA 4LH8A 5HMSA 1CCWB 2WJZA 4JHMA 3KBJA 3RYSA 2OOGA 3N17A 5C7VA 1OT2A 3CB3A 3A9IA 2I5IA 4GX8A 4IMAA 3KP1A 4AIUA 3O63A 1AQ0A 4BF9A 1BYCA 1DE6A 1NJJA 2GZXA 3LLXA 2R6OA 1GG0A 4UNIA 4PRRA 1VBUA 3QPEA 1DJNA 3T2PA 5D2XA 3VD3A 3KRBA 3PWIA 1TWWA 5E93A 3PPGA 1MW3A 1YNQA 4DJEC 2RGLA 2XFFA 3CB8A 4C65A 3D3AA 1OC6A 1DV7A 3PBGA 3MSDA 4DJDC 1KBBA 1JXKA 4P7NA 1S0NA 1EGVA 4WDUA 5K9XA 1GJWA 3VPLA 3WK1A 4GCXA 4L9ZA 4AWEA 5JXQA 1CENA 3ZVIA 1I4NA 2F6KA 3DEQA 4YHGA 1E56A 3AXMA 4BS0A 4RXFA 4MVAA 1RPKA 4O50A 5LIUX 1HL8A 4JUZA 3SO7A 4RDZA 4CNSA 1FWCC 1FOBA 4O28A 4O3SA 3G22A 1I0BA 3PJWA 3W7NA 4XV0A 1UWIA 1W5OA 3SCRA 2IMWP 1E73M 2YA1A 2YYTA 4QWDA 1C7TA 3ME3A 4JTSA 1TZZA 3FA5A 3F4CA 3M0YA 3BICA 3LCWA 1GVSA 1DHKA 4NJGA 2V67A 2X2GA 4FR1A 5CKSA 4US5A 3VNKA 2G3MA 4IPLA 2CLLA 3LCHA 5HMDA 2DZWA 1VF8A 3NZ1A 4ZQCA 2DUAA 1KCZA 4OQVA 1Y65A 3L2IA 4PUNA 4AY8A 4YR3A 5A8GA 1C93A 1ZBVA 4S39A 5KEZA 4V28A 4EF8A 3STPA 3GIKA 1F61A 3CWNA 4J2PA 3QR3A 2B81A 4UTFA 2VJXA 4FBTA 4L4PA 2RH9A 1CLXA 3PTDA 2NX9A 4XD6A 1DXEA 3E2VA 3NOEA 3QVQA 4W8LA 3VNMA 5E6YA 1WOBA 4NZ5A 1S10A 3MUZ1 3W7MA 2OWXA 4XB3A 2BR0A 2PURA 1KRAC 2O7QA 4O3OA 2ZICA 5DRCA 3E5BA 2AGTA 4XUGA 4JQ3A 5TF0A 5F4XA 2VFHA 4MWAB 3SDOA 3N9RA 3AU6A 3Q37A 4MDOA 4MPKA 2BQRA 4MNMA 3DAQA 4TX9A 1BGAA 4PUEA 4IG2A 2J77A 2BY1A 3PB0A 3B8TA 1S2UA 3CYJA 2J6TA 5I3GA 3OODA 3A4XA 3HV9A 4I6KA 4O54A 4MSSA 2DZXA 1GYNA 2PBGA 1MQRA 2PF0A 1C8QA 2WAGA 1A5MC 3TK7A 1OC7A 2HROA 2WHLA 3I7QA 3ISIX 3F2CA 1G4EA 4DZIA 2PP1A 3ZO9A 9CGTA 3B8SA 5I00A 5LZLA 1JXLA 4JGDA 5A8QA 2Z1WA 4QJ3B 3IJ9A 2BVTA 2ZXQA 3UPBA 1BWLA 2YBUA 2ZZ2A 4Z1AA 4GYFA 1Z9AA 2VX7A 4IIBA 3ZR6A 3GNRA 2HJPA 1GYLA 1YXDA 1EP1A 3DXIA 3UWQA 1KM0A 2OGYA 3QKEA 1KM1A 1EC9A 3BAKA 2VL4A 4OBRA 3LCGA 4PGLA 4N9CA 1AH4A 2JE8A 2ZKMX 4GIAA 3L66A 1XBVA 2I5QA 4JYFA 4GYKA 1QMLA 4JR5A 4QWEA 1O68A 1PHWA 4XZIA 5D4YA 4X3ZA 3LHUA 2QUTA 2VURA 4DX3A 3H2OA 1L6SA 2VCAA 3MY9A 4E3TA 2C1GA 4ZGYA 3LM3A 3Q8SB 1UMYA 1ZNNA 4ERIA 2ACRA 2YPIA 2WNQA 3W00A 3AS2A 4K39A 3A23A 2ZX9A 3T8LA 4R7JA 4AHOA 3FYOA 4XUYA 3EOLA 1UR2A 1K7FA 4EF9A 1YDYA 3GTXA 1XM3A 3R0UA 1E40A 4RNJA 3G8EA 3KBVA 2I5GA 2NUWA 3BSGA 2VKZG 1TQXA 4XAPA 4K68A 4DYKA 3HG5A 4M8UA 4UQDA 5KZEA 4ZB5A 3B8VA 5BW6A 2Q8XA 5FL1A 3N19B 4CU6A 1IXNA 4WZHA 1CXEA 1XLCA 4YVVA 2ABBA 2VX4A 3EWBX 5CBBA 5JIPA 3T5JA 1KWGA 2QCGA 1I1XA 3GWQA 4DUWA 3RU6A 4QAIA 3R4IA 1XQKA 2FQIA 3DBNA 1KTBA 3NJ3A 4GBUA 4OUIA 2I1OA 2Z2BA 4D71A 2QVNA 3TJXA 2DPJA 1QI0A 1UP2A 2J6VA 2DZSA 2EQDA 5FIPA 1G1YA 3KTXA 4C1NA 1OFAA 1F3XA 4L6OA 3L4YA 4PTXA 1IXQA 3F4WA 4UZSA 4DNHA 4MNKA 3CLMA 5CC5A 4KRZA 5KFBA 2Q3RA 4FI4A 3VI2A 1KM5A 2JKAA 5KZ6A 3LERA 5JH2A 1GQNA 3TTQA 4NU7A 4O15A 5M2FX 2VCCA 5CZKA 4AB4A 5A5WA 2E5BA 3PZMA 4PEEA 1XV8A 1FXPA 2XH0A 4KMQA 4EXAA 4UMBA 2UV8G 3VDHA 4XX6A 1T40A 3MO7A 2XDFA 4KKXA 4RE3A 4MG4A 2D20A 3QEZA 1UC4A 2RDUA 1TPH1 1GEHA 5FJJA 2YCKX 4DJED 2O0TA 3BW2A 3GDKA 5DGBA 4P5UA 5GQBA 2DH3A 3APGA 2XFWA 1IIHA 1NP0A 4DJDD 3ARPA 4A3QA 4CQDA 1EP2A 1S5WA 3E9AA 1EC7A 3M5ZA 2ZQ0A 1UPPA 5F4SA 2R94A 3K13A 4AY7A 5EBUA 3ARWA 4OBTA 1D3CA 3VNIA 2G4JA 3F2BA 3H12A 1R85A 3BXWA 4GFSA 1C90A 3KOWA 2JGYA 2VR4A 2ZXBA 1FX6A 4NILA 2QAPA 1UIOA 4EP8C 1GEQA 1UR8A 3WQVA 3WD2A 3UR5A 3E49A 3P74A 4JOMA 5E0CA 1XYZA 4JKKA 1LZOA 2ZADA 6ENLA 2NV9A 3MVIA 4NY2A 4QHRA 4Y8EA 1QDSA 3HFYA 3DC0A 4JV1A 1QAPA 3CQIA 4CCDA 4CD7A 3BJTA 1LBLA 3A3HA 1FRBA 4KFOA 4NI8A 4CN1A 5AECA 5CLWA 2CHNA 1X7IA 3GTIA 5I3HA 5EMLA 1A5LC 4QS5A 1TELA 3EX4A 2ATMA 3U5YA 4Y9NA 1OY0A 2BOEX 3CK5A 4RZRA 2FLNA 3RK8A 3LCLA 2Y5SA 4NRRA 5HOSA 3SN0A 1FWAC 3VUSA 3MWAA 1U1HA 2XCPA 2W63A 3IK2A 2XVKA 3R0KA 1L6WA 3H2MA 3WNOA 3CQHA 3MP5A 3VNJA 4INFA 3U5UA 4DVOA 4XISA 4LAZA 5KT4A 4EAMA 1Z48A 3C8FA 2NVDA 1QUMA 1C8XA 2IQ0A 4LUIA 3VIOA 1NVMA 1G4TA 1WBHA 4RXGA 2BV9A 3GLCA 1UROA 2FPTA 2GPTA 1SVDA 1UWSA 3TDFA 4J9KA 1OX4A 2V0TA 3UVAA 4S2CA 2XGQA 3LCIA 2RJGA 3SRFA 1EX1A 4Z0SA 5KZDA 4GIRA 3AMKA 1NOUA 2BTMA 4LB3A 4B5VA 5HATA 3PZGA 4DL3A 2VZOA 4I9JA 1CW2A 3ITCA 5CSSA 1XQLA 1POJA 2QKFA 4XWUA 4F4ZA 4HU0A 4Y6GA 1ZLPA 4RZ5A 3H4XA 3JUGA 3MKVA 3BOLA 2Z1SA 3MQTA 3PZOA 5T91A 2ANUA 1TTPA 2JIWA 3AOFA 3HPZA 2Q71A 4E2DA 3OLEA 4WRHA 1DVJA 4MPQA 3NPXA 4W86A 3BMXA 3CIXA 1WX0A 3O05A 2Z6IA 1ITXA 4BEQA 1QNOA 2GUUA 2NQZA 2QCLA 3TC3A 3DUGA 1ZQ5A 2ZVRA 1VH7A 1JXJA 1GVQA 4BEUA 3MPGA 3COTA 1H51A 1OVDA 3GYEA 1JZ6A 4IQEA 3MHGA 2W8KA 2W9BB 2PI6A 4CEXC 4IJBA 1ZBKA 3ABQA 4UTTA 3WELA 5AHMA 3DG3A 3CT2A 1MEWA 3THUA 3MKKA 4AZCA 3G1FA 1J6OA 1P0DA 3M43A 4LWWA 4O1DA 1NELA 2SFPA 2WMIB 4PUDA 4W9TA 2QJHA 3KXQA 1QPOA 4DEFA 3IIZA 4AZGA 2WM1A 3A3WA 4K6AA 5A6JA 2L5HA 2E77A 5BWFA 4UMAA 1R47A 4LTSA 4MOZA 1YBQA 4FS1A 4GQGA 3U2CA 4EEYA 3H2EA 1V77A 3OQ8A 3W7HA 5B7YA 2INZA 3WD4A 4S2BA 2D2GA 5CJNA