2AQVA

Crystal structure of e. coli isoaspartyl dipeptidase mutant y137f
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
389
structure length
374
Chain Sequence
b'MIDYTAAGFTLLQGAHLYAPEDRGICDVLVANGKIIAVASNIPSDIVPNCTVVDLSGQILCPGFIDQHVHLIGGGGEAGPTTRTPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRALNEEGISAWMLTGAFHVPSRTITGSVEKDVAIIDRVIGVCAISDHRSAAPDVYHLANMAAESRVGGLLGGKPGVTVFHMGDSKKALQPIYDLLENCDVPISKLLPTHVNRNVPLFEQALEFARKGGTIDITSSIDEPVAPAEGIARAVQAGIPLARVTLSSDGNGGVAGFETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMTPELRIEQVYARGKLMVKDGKACVKGTFET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isoaspartyl dipeptidase
publication title Functional significance of Glu-77 and Tyr-137 within the active site of isoaspartyl dipeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 131
structure length 374
sequence length 389
chains with identical sequence B
ec nomenclature ec 3.4.19.-:
pdb deposition date 2005-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2aqvA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2aqvA02
2Z00A 4KETA 3UR2A 2R1LA 1FWGC 1GKPA 2I9UA 3T81A 4C60A 4ERIA 2Z28A 3TN6A 2F6KA 4H9MA 1A5OC 5CH9A 1PB0A 4DLFA 1V4YA 4KQNA 4QROA 4PBEA 3F2DA 4DO7A 3EWDA 1FWJC 4XD6A 2A3LA 3S2LA 3E74A 2VM8A 2BB0A 1EJUC 1UIPA 1EF2A 3GIQA 4V1XA 4JOMA 1IE7C 1PO9A 3GU2A 2Z2BA 1DPMA 4LAOA 1W1IE 1RA5A 4C6QA 4CQBA 3UBPC 4CNSA 3GG7A 3MTWA 2UBPC 1V77A 3K2GA 1YMYA 3DC8A 4F0RA 3A3XA 1ONWA 4IFKA 2E25A 4LCSA 5HMFA 1R9YA 2Z4GA 4L6DA 5FSEC 1R9XA 2QT3A 2AMXA 3LSBA 2HQAA 2FTWA 1FWHC 1ITQA 3A3WA 2HNHA 3KM8A 1XRTA 4H9TA 1FKWA 1P1MA 2QPXA 1EJRC 1ZZMA 4C5YA 2ADAA 4HA0A 1EZ2A 3G77A 3O7UA 4F0LA 1FWIC 4J35A 4IFOA 3IJ6A 4GYFA 2GZXA 2R1PA 2OGJA 4LAMA 3ORWA 1M68A 4WVXA 3IV8A 1V79A 4B90A 3E3HA 2VUNA 3OQEA 1NFGA 2D2HA 1S3TC 3FDKA 3B40A 1XGEA 2CZVA 2P50A 3UPMA 4XAYA 3GU1A 4C6IA 4GXWA 3OVGA 4HJWA 4RE0A 2QVNA 1K6WA 1FWAC 2HPMA 4WHBA 1EJTC 1YBQA 4M51A 3E2VA 4TQTA 4C6CA 1A5MC 2Z29A 3PBMA 4KESA 3C86A 4GY7A 3NEHA 4D8LA 3ID7A 3PNZA 1I0BA 1R9ZA 4IGNA 1EJVC 1GKRA 1J6PA 4G7EB 3OODA 2Y1HA 3MVTA 1POKA 3MDUA 4GC3A 1FWDC 1EJWC 4LFYA 4QS6A 4GX9A 2UZ9A 3QY6A 4QS5A 2XIOA 2I5GA 4LEFA 3RYSA 3GTXA 1O5RA 1PSCA 4PCPA 4GY0A 4C6OA 1FWCC 4C6DA 3JZEA 2ANUA 3LGGA 4IGMA 2GWNA 4DNMA 4C6BA 1EJXC 2PGRA 2GWGA 1ITUA 4C65A 2ZC1A 4DZIA 4GK8A 4C6FA 5HMEA 2AQOA 3F4DA 4IFKB 3FEQA 3GGMA 3E0FA 4RZBA 3T8LA 4H9ZA 3AUOA 3GU9A 5E5CA 3A4JA 3TN5A 3GRIA 4DI9A 4EP8C 4KEVA 4DZHA 2RAGA 3NURA 3LY0A 3WMLA 1NDZA 3LNPA 2FVKA 4H00A 3K5XA 3QY7A 3AU2A 3CAKA 4GX8A 2FTYA 3IACA 3PANA 4H01A 4R85A 4R88A 1RJRA 3MJMA 1YIXA 4IG2A 3WZ0E 1P6CA 4IQJA 2BGNE 2WJDA 2G3FA 2R1NA 2EG7A 1FWBC 4KERA 3K4WA 4LAKA 4DIAA 1J6OA 4PE8A 2PAJA 4UBPC 3LGDA 4CEXC 1XWYA 2Z25A 4XD5A 1ADDA 5LXXA 2P53A 3LA4A 3URQA 1UBPC 1QXLA 4HK7A 1KRBC 3ITCA 4LCQA 1NDYA 3T1GA 4AQLA 4BKNA 1RAKA 4EPEC 1YBQB 1J79A 2YB4A 2AQVA 2PGFA 1WXYA 1O12A 2KAUC 4XAGA 3FDGA 1A5LC 3LSCA 1E9ZB 3IPWA 2OB3A 1EYWA 4ERAA 2OODA 3E0LA 3OU8A 2D2GA 4IFRA 3URBA 1NDVA 3S4TA 4J5NA 3D6NA 2DVTA 1A5KC 2WJFA 3PNUA 4BY3A 4CEUC 1V51A 3BE7A 4C6MA 3RN6A 2WM1A 4H9VA 4ZSUA 3B0XA 4C6NA 2OOFA 4J2MA 4B3ZA 1RK5A 3QGKC 4KEUA 1A4LA 3URNA 3DCPA 3IRSA 3OJGA 3F2CA 4C6PA 4EPDC 3B0YA 3CJPA 4B92A 4KF1A 2PLMA 2DVXA 3WYZA 2VC7A 3NQBA 4C6LA 2R1MA 4XAFA 3GTIA 2Z26A 3CS2A 2FFIA 4LCRA 4GZ7A 4YIWA 1KRMA 3HPAA 2WJEA 4I6KA 4HK5A 1M65A 2YXOA 4P5UA 4CNTA 4IH3A 3S2MA 3LS9A 4ERGA 2YZ5A 3IGHX 4C6KA 1FWFC 1HZYA 1A5NC 4V1YA 3URAA 3V7PA 4H9UA 3MSRA 4ICMA 2Z24A 2PUZA 4IG2B 2HBXA 2GSEA 4RDVA 1I0DA 3TN4A 1V7AA 4DI8A 3O0FA 2Z2AA 1E9YB 3ISIX 4ZSTA 4H9XA 1GKQA 2E1WA 1FKXA 1P6BA 3RCMA 2EG6A 4G7EA 4EPBC 2D2JA 4BJHA 1J5SA 4XAZA 4EPKA 4RDWA 4IF2A 4INFA 1KRAC 4LH8A 4L9XA 3PAOA 3RHGA 4C6EA 3E38A 4LANA 4KEZA 1UMLA 4GY1A 1PTAA 1RA0A 2Z7GA 2IMRA 2OQLA 3QGAC 4LALA 4DLMA 4GOAA 4DYKA 3MVIA 1KCXA 3QY8A 3UF9A 5G4HC 3SFWA 4RDZA 3EGJA 4GBDA 4F0SA 2HBVA 1KRCC 2YB1A 1RJPA 1NDWA 4E3TA 4KIRA 3GTFA 3S2NA 4QSFA 2Z27A 3OOQA 4R7WA 4AC7C 4QTGA 2GOKA 2Q01A 2EG8A 4G2DA 3LU2A 2FVMA 1YRRA 2VR2A 1POJA 4RDYA 3SO7A 4C6JA 1VFLA 1WXZA 3TN3A 3DUGA 1YNYA 1XRFA 4CQCA 4I6VA 5HMDA 3GIPA 4PCNA 2DVUA 2R1KA 4NG3A 2VHLA 4H9YA 2Q09A 1RJQA 5FSDC 3MKVA 2HPIA 2P9BA 4PBFA 4QRNA 3GTHA 4Z42C 1K70A 1A4MA 3UR5A 2VC5A 1JGMA 1FWEC 3F4CA 4XD3A 4CNUA 3N2CA 3R0DA 5A6TC 2QS8A 3MPGA 4CQDA 2ICSA 3EWCA 3GUWA 3AU6A 2O4MA 5AKQA 1ONXA 3IARA 1BF6A 2W9MA 3HTWA 3HM7A 3F2BA 4MUPA 4WGXA 3S2JA 4UB9A 1EJSC 3ICJA 4NI8A 4NP7A 4OFCA 1QW7A 4B91A 4C5ZA 1RK6A 1M7JA 3TNBA 2O4QA 1UIOA 4HK6A 3MDWA 4XD4A 1K1DA
chains in the Genus database with same CATH superfamily
3QF0A 1DWAM 5KFUA 3FGCB 4CCDA 3G0XA 1B90A 3B0UX 2XIIA 3T07A 3VC5A 4JY8A 4DBEA 3POHA 4Z0SA 4PGLA 4H9MA 4RL3A 3ZJ6A 4GACA 2VNCA 1LRQA 4O57A 2W67A 3IIXA 1BWLA 4JZ5A 1J9YA 3M43A 3SY5A 1H63A 1H7RA 4GYPA 3QLDA 1IGWA 2UVUA 1J10A 4JICA 2PTXA 3BXWA 5T14A 1Y5VA 4G1NA 5CBJA 2JBMA 5IFPA 4C7DA 4R9XA 2JEFA 1FVPA 3C2FA 4GYJA 1ONWA 3N4AA 1ICPA 1Q7ZA 3W3OA 3C0QA 2Z4GA 4KS0A 4L6DA 3NQGA 2AMXA 1DIKA 4RNIA 5BZAA 4MZYA 2VX7A 5FL0A 2J7HA 3O2LA 2XDFA 4FBUA 1BRLA 2R14A 1S2TA 1MFVA 3SCQA 4QX4A 1XCWA 1XLKA 3EPGA 3TJLA 1E5NA 4J35A 2FTPA 1XYZA 2GZXA 3CAWA 1IWPA 4LAMA 2QJJA 2ZUMA 4JNYA 5HQEA 5A8QA 4M29A 4CN4A 3CZ8A 4PBGA 4ED8A 3KOFA 3RR4A 1P0EA 2W9BA 3WK3A 5C7VA 3BOFA 4ORMA 1XGEA 5C55A 2CZVA 2CBIA 4XAYA 3GU1A 4LNCA 2GQ9A 1R8LA 1G69A 1EJTC 3AMGA 3TYAA 4MY9A 2C1IA 1NVMA 3WL0A 4GY7A 2NQLA 1R3WA 3W1QA 3W7LA 2VFFA 4GQGA 1VBGA 5CCZA 2V38A 2YDAA 3CHEA 3W87A 4ORIA 3VD5A 1BXCA 3CEUA 3M0LA 2YXXA 2X8RA 3RYSA 4ICCX 3CAQA 3ZT7A 5M03A 4C6DA 3R0UA 1VIZA 3D0CA 1DHKA 3HOJA 1JXLA 1TPUA 5F1UA 2AMGA 3ZFHA 4C6BA 1C8VA 2PGRA 1V02A 1WZLA 2IQTA 1XRSA 2O7QA 4QJ3B 1LQAA 3R5EA 1RP9A 4H8NA 3CLMA 5D37A 1AQFA 2VZTA 3VNLA 4IZGA 3AYVA 3AYSA 2RAGA 3TEVA 4WJXA 4EX4A 3LNPA 2CHRA 4H00A 1GVRA 2V67A 2YW3A 4UXDA 4G3IA 3HMCA 4Q22A 3EB3A 4R9OA 9RUBA 3O0KA 1J6OA 1WB0A 4NAEA 1GUVA 1Q66A 3LGDA 4CEXC 3S5ZA 3W0KA 4HSHA 2QUTA 1QXLA 1KV8A 2NT1A 3DU0A 3ITCA 3OHMB 1WOAA 1PZ2A 2MUCA 3LCXA 1AW2A 4EPEC 1SFTA 4Q45A 3KUMA 4UTJA 2P1FA 5DEZA 3UWWA 1EYWA 4PZVA 2OT1A 4K1GA 3PY2A 2DVTA 2NQZA 4PUUA 2VRJA 4I8YA 2FZBA 2E9MA 4Z1CA 1QHZA 3BJTA 4C6NA 2VZOA 4YTSA 1HG3A 3ZVHB 4NRRA 3WEOA 1V6UA 2ACQA 5J8LA 2FGZA 1J2BA 2SFPA 1TZ7A 1NWUA 4DAIA 3R58A 2PLMA 5K7JA 4E0CA 4MJ4A 3NQBA 3UU0A 3IS4A 2X40A 3GTIA 2WZEA 4ZOAA 4N7QA 1YHTA 2QR6A 2WHLA 4YTTA 5FJRA 3ATZA 4AG0A 2HXTA 5EBUA 3H70A 2GGGA 2CXGA 4Q43A 2R91A 4UTFA 2RDXA 2PF0A 4H9UA 2OH2A 3W1MA 1GQJA 2VI0A 3P2VA 2YXGA 1XFBA 3VIPA 4A22A 5KTLA 3O0FA 2ZDRA 4OV9A 3AIEA 2EKGA 2E1WA 3IANA 3C3NA 4DPQA 4XAZA 3CWHA 2A3BA 1RSCA 1SW7A 1KM5A 4AIOA 3UP8A 5EMJA 2CLKA 2VOMA 4HZ7A 1FFQA 5KZEA 3AHZA 1ZNNA 4KWOA 4HN4A 4RPPA 5F2LA 4FALA 3ONCA 2WWCA 3DKLA 1T5AA 1OY0A 5REQB 1UKTA 3VMOA 4FIRA 3RCYA 1O94A 4E4PA 2Z27A 1W9PA 3VOIA 4AWUA 3T42A 3GHSA 2VZVA 4YYCA 3VOJA 1ZAHA 4HHPA 5A6BA 1XLMA 4B2DD 4HOWA 4HPJA 5DFAA 1CGWA 1R3SA 3BAYA 4KIEA 4F4RA 4NU7A 4HB7A 4J27A 4Q8OA 4A29A 1XG4A 2HRWA 5A2AA 1KFBA 3W01A 1Y5WA 5FJTA 1FDJA 3STEA 3T5LA 3WQWA 2WNQA 5CZKA 2ISFA 1JGMA 5CZSA 1J18A 3G5EA 3MR6A 2OZTA 2R8IA 1UP2A 1Q3NA 3EWCA 4DUOA 1IXPA 3GXIA 4FO4A 3TOYA 2YL5A 4IP5A 1LG2A 2GUUA 3THUA 1M3UA 3HTWA 3HM7A 4LRSA 1HXJA 3QVQA 3MUCA 6ENLA 3DOPA 3VKKA 3ZS4A 2ZX9A 3UY8A 4GABA 2CHOA 3IAQA 2GPTA 3UZJA 4MB1A 5D02A 4QG9A 2P8CA 4MWAB 4GC4A 1QK0A 4M7SA 1UIOA 1NFPA 4BEUA 5EWFA 2ZRVA 4E3VA 5LIYX 2GSJA 3CB8A 1ZP4A 3UR2A 1WDRA 1EC7A 3H2NA 4LBUA 1VCFA 1EPVA 3E5PA 3WUEA 3DN5A 1A5OC 1GTEA 4M6QA 1VPYA 2NZLA 2OWWA 2YCKX 4NAFB 2C0HA 2CLOA 4GHRA 4R53A 3E74A 3OLEA 4HU4A 1QAPA 3Q8SB 4V1XA 4S2BA 2G8ZA 4X22A 1B3XA 1JCTA 1BAGA 4O19A 3UBPC 3A23A 3K2GA 3I7QA 2WC4A 3W29A 4F0RA 1V02E 2Y6ZA 4QHRA 3NWRA 4FXFA 4HGXA 4OJYA 4QNEA 2ZQ0A 3G18A 5GNZA 3ZQ9A 2HNHA 1JDEA 2IBKA 4O3RA 4JDYA 2Q6ZA 3U48A 3EXTA 5J5RA 3C0JA 1QWKA 1DJHA 4FBTA 2X2GA 3DFSA 4EE9A 1MW3A 3PN8A 3RAQA 4RUCA 3M64A 4DWDA 4XSLA 3IJ6A 3UGVA 4OUEA 4J28A 2R1PA 3WF3A 3W7RA 2G4JA 1JUEA 3GDRA 3PFRA 3UR8A 1PTGA 4F2BA 1S9FA 3VNIA 1GNXA 1SZEA 4XQ6A 3EPIA 3T5JA 1ZJAA 3BMWA 3OVPA 3FK4A 4TQTA 1Z8AA 4N4QA 4PMYA 5CPOA 1S0OA 1I0BA 4C91A 1IEIA 3ENLA 1J6PA 4O13A 4QE4A 2Y7DA 2ALDA 4PMRA 4HSOA 3EWBX 3M5VA 3H23A 4ED3A 1E40A 4PMQA 3T2OA 4M6VA 3ZZ1A 2I5GA 1TQJA 1V5XA 1PIIA 9XIAA 1XLHA 2PRMA 4AVNA 2X0SA 1VH7A 5A6KA 1NOFA 1XLIA 1ICSA 3NQ2A 4DNMA 1XH2A 4X2RA 5DMYA 1JPKA 4J9NA 2G3NA 3EA3A 3R13A 4CNNA 1KA9F 1HJSA 4EWJA 3UA3A 5ENLA 2AQOA 3WENA 1TJ2A 3QHNA 2VEGA 3HZ3A 2OQHA 4H1ZA 4ZGYA 4PUJA 2FQIA 2WYSA 1B9ZA 3RK8A 4LX4A 2FB3A 2XFWA 3EXSA 4HNUA 2F2HA 3W73A 4WDTA 4W86A 4A05A 3MC5A 2IKHA 3FYOA 1LBMA 1RH9A 4LF1A 2XINA 1RVGA 1YIXA 4LUJA 4ECVA 4J3WA 4PMVA 1EX1A 4PC8A 3IJLA 5H8UA 2WVTA 1XICA 3LHUA 1PXGA 2HK0A 5KG1A 1DJIA 1XF0A 4AD0A 4MNJA 1CCWB 1XL9A 4AQLA 4ACYA 3T6CA 2OZ0A 5LXEA 3KHJA 3GNOA 1F05A 5F9LA 1XKYA 3USBA 1O12A 2PC8A 3GDBA 1FCUA 1KGXA 1IZCA 2VVSA 3IPWA 2C2EA 3LI1A 1NF7A 4IJCA 1NWSA 1A5KC 1W3NA 3CIWA 3TW7A 4U28A 1ZB5A 1RUSA 2YYTA 3UCDA 3O6CA 5FEPA 3WLJA 4OQVA 3DFNA 3W9ZA 1T0OA 3Q67A 3APGA 3CJPA 3NQFA 4RW3A 4W88A 4QJ1A 5EMMA 3G1HA 4J9JA 3WYZA 2FKPA 2PLCA 3NSXA 2JF7A 1YE4A 3HQPA 7XIMA 3F5JA 4GZ7A 3WMSA 3OG3A 1RQEA 4TOQA 1W32A 5TF0A 4DAFA 2YXOA 4JX4A 5E9AA 2ZKMX 4ERGA 4OOZA 3WDJA 4YN5A 2EJ1A 3I6TA 3LOTA 1IZKA 3MSYA 3BARA 3P8JA 2F8QA 3TQKA 3U2OA 1E0XA 4GVHA 1LCOA 3GDMA 4DHGA 3JS3A 1KLZA 2CETA 4J1OA 3V7PA 3T08A 3LLXA 1ISVA 3I65A 1GOWA 2DPJA 2HBXA 2ZZ7A 1XD1A 5JUMA 2PC4A 4JFTA 4BWLC 5T26A 5A69A 4F4YA 5JVLA 3T2PA 1FKXA 4U2YA 4FA3A 3MMTA 3AMLA 5I2UA 1J5SA 2WW5A 4PMNA 3LBMA 1KRAC 3TMLA 5FOOA 3QPYA 1EZWA 3E38A 4HNNA 1UMLA 4DELA 1PTAA 4F9DA 1OX4A 3OP2A 4AB4A 1W3JA 3SFWA 2XCAA 4RDZA 1KBKA 3U7BA 1HT6A 3UNTA 2DZWA 2HV5A 1EGMA 2QJHA 2YB1A 4DBDA 8CGTA 3SDOA 3FVMA 4M19A 3W6MA 4MG4A 4AYSA 2GGEA 1VRDA 4IPJA 2ZFAA 1MRQA 4JEQA 4G2DA 3WIJA 3GXNA 2HK1A 2PDWA 1QNPA 2X2YA 4C6JA 1A5UA 3DG3A 4QE5A 3CPUA 1ZUAX 4ZB5A 3RM8A 3G1DA 3W26A 1RLDA 5HMDA 1J0YA 2WVUA 1VEMA 4H9YA 1TZZA 4LXFA 3BAWA 2I9EA 5J5DA 3BQ6A 1ME7A 3T0CA 1QOPA 3M0ZA 1S1PA 3AHVA 2XH2A 5C0QA 1XIIA 4XBSA 4L1GA 2Z1BA 1X97A 3CLWA 3M0KA 3EOSA 1L6WA 4XZIA 3CQ0A 4UTMA 2J8TA 3WNLA 1XBXA 4QDWA 3LPFA 1AMKA 2C13A 2A3AA 3A6OA 3WLNA 2QMKA 3GC2A 4BS0A 1I9CB 2VRQA 6ALDA 1U5JA 1S0NA 2CBVA 4W8LA 3EWWA 4HTBA 2WC7A 4GKTA 4C5ZA 1M7PA 3LV6A 4WDWA 3CZJA 5FCZA 1RBOB 4GYKA 1AQMA 3VGBA 3WK0A 4KETA 2ASLA 3QQWA 4Q8UA 3QTPA 1W1VA 3VGGA 3I7RA 4F8XA 3KOYA 1VFUA 2YPIA 1CENA 3PZIA 4WK9A 1PB0A 4R8UB 5E93A 2G96A 2OFJA 3W7CA 2A3CA 3EDFA 2QCGA 3F4NA 3NFUA 4YTUA 3C8NA 1G1YA 1DWJM 4BR1A 2R8KA 1TX0A 1CXEA 4NJHA 2RJGA 1TKKA 1KFWA 2XVNA 4JFUA 3TSDA 1OX6A 1K8CA 1QPQA 4ATDA 1LOQA 1XBVA 3UQNA 4JXCA 2PDBA 1OEPA 3P3BA 3CUHA 4RXGA 3VNKA 1EUNA 4M3PA 2VX5A 5DBUA 2E25A 3AS2A 4DEZA 3ERPA 4A8IA 3RAXA 1WZAA 3ZIZA 3LQLA 3L12A 4PULA 3TQVA 3WQVA 4ROQA 1DJXA 4GKLA 5K4XA 4JV2A 3G77A 5DLGA 3PZTA 4D6FA 2F2KA 2W9CB 3M4HA 1QI2A 2P50A 1QJWA 4UTWC 3WBYA 4C6IA 3J7HA 1KNWA 4PH6A 4JTUA 1P7TA 1JZ5A 3WH9A 3O3RA 4PRWA 3V36A 4AY1A 3E0IA 3KOWA 5FF3A 4M51A 1WOBA 3C86A 5CC6A 5LYRA 4AWSA 4IMGA 4DF0A 3NEHA 1E1EA 3BGJA 1B31A 3I3BA 5H91A 1FTXA 2AQ4A 1OCBA 3Q2DA 4RUBA 5DRIA 1E9IA 2XFYA 3WFAA 1KM2A 2FLPA 3BSHA 3CT2A 3NJ3A 1TTPA 4H83A 1EP1A 2XCPA 3GTXA 5I3DA 1DKWA 1PTDA 2BGSA 1OIMA 3ABRA 1HUVA 4PCTA 3KOZA 4YCPA 5ABFB 1H61A 3AJXA 4I9JA 1CGVA 1D9EA 5A2CA 1TQXA 4OGZA 1EJXC 4S3KA 2H6RA 1V3LA 5EGRA 1E9LA 3WLRA 2GWGA 5F2MA 4RE4A 3E2QA 5JMUA 3WQEA 4JQ3A 1TRIA 2BHYA 5HMEA 2UV8G 2OT0A 3WSUA 1KBJA 3MFIA 2PU1A 1ISZA 3WH5A 4DL3A 1XINA 1J0JA 2WVVB 4KEVA 1XIBA 4DVOA 3E2RA 3WMBA 1HF6A 1NM9A 4MHBA 3WMLA 7A3HA 2CIPA 3SJNA 4RNMA 5KFLA 1ME9A 4JGDA 4ZOBA 2J7DA 2BDQA 3MHGA 4RJEA 5D32A 5JQ9A 4GFIA 4WY0A 2BGNE 2WJDA 3K13A 4X3ZA 3DYOA 3EKGA 4DM1A 2O9OA 2NV2A 3O05A 4DL2A 1MNSA 3PJWA 5C9RA 1XWYA 2DQXA 2FHBA 2AL1A 1N82A 2BVTA 2NXIA 2W79A 2YJQA 5CC3A 3HG5A 1E6RA 3WQCA 1O68A 1R2TA 3ARUA 4UTLA 5BU6A 1JFHA 5CG0A 3WL1A 4J5NA 4LS1A 4D6IA 4EYIB 3T7VA 3U2ZA 4AYGA 4W4QA 5A6SA 2ISWA 1XLBA 1L6FA 3TTQA 3V1HA 1SU5A 4FI4A 1A5SA 5JBDA 3RPMA 1W9VA 4C6PA 1WDSA 2D1ZA 2FHFA 3DIPA 4LV9A 3RAOA 4FK9A 1JAKA 2VEMA 4JIEA 3AAMA 3BW4A 1PDZA 1OCQA 5DELA 1IT8A 5AC7A 3A5FA 2FFIA 3OHAA 1QU4A 2ISVA 4JFWA 1NARA 1B3OA 3UXDA 2DZXA 4O4WA 2JEGA 4C6KA 4J9LA 1S38A 1G01A 2I5QA 3QZ6A 4WGHA 2WJZA 4ICMA 4FAMA 3AXIA 2QQ6A 4E4UA 3ANYA 4C1NA 4JD4A 4NASA 4L1XA 3V6JA 4DXKA 5D8WA 1V7AA 2NWRA 4MNKA 4FP1A 4FR6A 2XIQA 2EG6A 4G7EA 1O95A 3IIZA 1AZ1A 3PAOA 5BXPA 4S39A 1WP6A 1T3NA 1UPMB 1VBUA 1GVOA 3WLPA 3U9IA 1JD7A 3DAQA 3REQA 1AVAA 3QGAC 4K3ZA 5JU6A 4ZCWA 1UKQA 5M17A 2YA1A 1YPIA 4DRSA 1KXTA 2R94A 1XIEA 5I0DA 3CTTA 2CBUA 1C8XA 3C56A 1UJPA 2NQHA 1GCYA 2BG5A 3BW2A 4V27A 1SJBA 2R8WA 3VE7A 3TTEA 2WMKA 4V15A 1I6NA 4LJ3A 3CTLA 3NM1A 1Y7VA 5BWAA 2J6UA 1EX5A 1FH9A 4XZBA 5FSDC 2Y0FA 2WANA 3AZSA 2A79A 1MXGA 1PKLA 4QRNA 5HWNA 3UR5A 4QWAA 3Q8RB 1QBBA 2XPKA 1UWSA 3G6VA 3KTXA 4CNUA 3RM9A 4DUXA 4DXXA 3AXKA 2J7FA 2HISA 1D8WA 3EOEA 3L4ZA 3W6YA 1F9CA 3OBAA 3SADA 3WDIA 6TIMA 1W56A 4DN1A 1HX0A 4RV3A 3WNMA 1QHPA 1TV4A 3TSMA 2FGBA 3MMUA 3VNZA 4DUWA 1M1BA 3TAKA 2BVYA 3NSNA 4XKYA 1FQ0A 4I5XA 4QISA 4O8AA 2IQDA 4DNHA 2PDNA 3HQ1A 2PSNA 3H2CA 1EO5A 4K38A 4LSBA 4TV6A 2QCCA 1MQPA 2FZDA 5K9CA 3V6HA 2PTYA 2XIMA 5EBAA 1OK6A 3CB3A 4GIRA 5CQ1A 3RLUA 2PDUA 4AWEA 3TA9A 1E1FA 5K2ZA 3T81A 1T6MA 2JEPA 4O50A 1VR6A 3DFPA 4CLMA 2V3EA 4M1RA 3BH4A 5CH9A 3LRMA 5F4WA 3LPPA 5E9XA 5FD0A 1UA3A 3VGHA 4RNOA 4AZ5A 3L2LA 2XWDA 1H5YA 4HPGA 1QNRA 1F61A 4UQDA 3TYDA 3EDKA 1W37A 5DN1A 4JX5A 4RNFA 4WX2A 3GNPA 1RA5A 2WNZA 3F7JA 4KFPA 3GDKA 2ZVIA 2Z6JA 4S23A 4P7NA 1MUWA 3A3WA 3VIIA 2Y8KA 3R6IA 5TD4A 1XRTA 5E09A 3IN5A 5L1KA 4GJIA 4UCGA 4DPPA 4ZOEA 3QC3A 2W7PA 1J8VA 4DWSC 2JF6A 3N9RA 1T99A 1TG7A 4D6DA 4IGSA 1VCVA 3IRDA 4MSSA 4CCCA 3WK1A 1B3YA 1B54A 2QCFA 4FNRA 1U5VA 3ORWA 2PA6A 4AZIA 3VOCA 3SI9A 2NT0A 3TA6A 1M53A 3B40A 3I4EA 4XZNX 2WSPA 3LTPA 3UG5A 6PTDA 4HJWA 3H53A 1YXYA 1VJZA 3HG2A 1H1NA 4L1WA 4K68A 4YR2A 3MCMA 3C2OA 5DLCA 4MY8A 3ID7A 5AVNA 4A3QA 2VEIA 3U4FA 2CESA 3CUZA 3OODA 1DIEA 3UPBA 2EPLX 2VELA 3NQAA 1EBGA 3NSMA 3DHPA 3TE9A 1IWBA 3H22A 1QI3A 3EX4A 5AYBA 1HW6A 3ZVHA 3W7IA 3BDKA 1JJKA 2FZ8A 5KFXA 1AH4A 4JEJA 1R46A 3TZFA 1A50A 4AISA 3C5QA 1XD0A 1IEWA 4JTHA 4F40A 2VX4A 1TFVA 2FVLA 4RUAA 1H4PA 2I16A 1TPEA 2QAPA 1W2VA 2R8GA 4LBSA 3TW6A 3GKAA 3RLGA 1W9DM 2I14A 3EMQA 1C91A 1LL4A 3PR2A 3SQLA 3EWXA 3AU2A 1TR1A 3IJ7A 3LI0A 4GX8A 3H4DA 1LTDA 4HCHA 1PVNA 2O0TA 2ISDA 2PURA 4TIMA 3WZ0E 3OG2A 1ZY9A 2UVRA 5G1MA 3K4WA 2AGPA 3KBJA 1EQPA 2PAJA 3IUHA 4Y2WA 7TAAA 3HV9A 3L65A 4L4OA 3SUTA 2QW5A 4WY0F 1ADDA 4QJ5B 3R12A 4YHEA 1UBPC 4CD6A 3LUTA 4TX6A 5BOOA 3OSPA 4LCQA 4J9QA 1V3KA 4KWUA 1YBQB 4CD4A 3SRFA 4M7TA 4W8AA 4QR6A 3PR4A 3A4AA 3LBCA 1XYFA 2PDQA 3DERA 1UD6A 1XH1A 3CH9A 1ODZA 2WOQA 5D03A 4K8GA 2B7PA 3MQTA 3P67A 1L0PA 1OBAA 2YGYA 2ZRXA 2V5KA 5LIKX 1WAUA 4E2VA 3AIRA 1WNOA 4J3SA 2WJFA 1ITCA 5T8GA 1V51A 3MYOA 3OB8A 4HU8A 3CH0A 2OOFA 2NW0A 1U33A 1N55A 4GIAA 1CPUA 1P5BA 1J96A 2Y7EA 4NVTA 4EPDC 4LVAA 5BW6A 1XLGA 1UWTA 5AVHA 3GHTA 2WNNA 1YTEA 1H11A 4KF1A 4V28A 4XAFA 5MKGA 1YW1A 4R3UA 3OVRA 3H2EA 1KW1A 2RH9A 2IQ0A 1I1XA 4FNPA 3R0KA 4B3LA 3H2FA 1DQWA 1KLYA 3H7VA 3IWPA 4LYRA 4V1YA 4CNPA 1JRCA 3TFXA 2XVLA 3QH2A 1GOMA 1P48A 2PWUA 3UETA 4QAIA 2BBFA 2ZYFA 3TLLA 3GXTA 2AL2B 1JF6A 1B57A 3GVRA 5KG6A 1FFRA 2GGJA 2CKRA 2PDXA 3N13A 4B4HA 1Q6FA 2B31A 2PODA 3MR2A 1P6BA 1QR7A 1HKVA 3R94A 4S2CA 2W0UA 3H4XA 4PTVA 2JEQA 4Y9AA 4XK2A 3W1PA 2Y85A 1K4GA 4OIFA 4XUYA 4MWAA 1HL9A 2PE4A 4O18A 2RFGA 4PTXA 3SCSA 1K9EA 1W3HA 4AH7A 2C3ZA 1N8IA 3MVIA 4ICNA 1CXHA 1GVFA 5D9PA 1LOSA 8A3HA 3N9SA 3N3TA 4TVUA 3OEXA 4UFLA 3EYPA 3I6EA 1M9HA 3S83A 3VCCA 4O3NA 3QR3A 4IMFA 4XTIA 1UUOA 3O15A 1ONEA 4IMAA 4UTTA 5AHFA 4NAFA 4W7VA 4B4FA 5EMLA 3S5SA 3PFMA 2CWXA 1G0CA 1MXDA 4WIWA 3VC6A 3W85A 3NDYA 4UIOA 2PRLA 3AWNA 3GFYA 3TC3A 1RD6A 2NUYA 3SAZA 3GV5B 4DB7A 2INZA 2YR1A 2BLEA 1FH8A 2CERA 2P76A 5C9WA 4P8UA 4RCXA 1JDCA 3K8MA 2AAMA 5IRPA 3R25A 1MO0A 3BMXA 2HE8A 1XI3A 1EP3A 4ACZB 1DWFM 2WVSA 3JW7A 1L6YA 1W3TA 3R0DA 4QWBA 3G0SA 1ZCOA 2TPSA 1UH4A 1BPLB 4AMAA 4TQSA 3M7SA 3B9OA 2CXEA 2ZTKA 3N2XA 1UKPA 1YQ2A 3QV8A 2QCMA 2ZRZA 4GG9A 4WD0A 4AD2A 2QDGA 3RIKA 4B15A 3RCNA 5HMSA 1GQLA 2QV5A 4DX3A 5T9BG 4LYKA 3TROA 2XM1A 1VB9A 5CSSA 3VZYA 1EHNA 2GQAA 4PCFA 4XD4A 5BROA 4H8HA 1JCLA 1R6WA 2R1LA 4TO8A 5KZDA 4XO6A 5EMKA 1KTBA 3GD6A 2NSOA 4YVPA 1U5HA 2UWFA 4W89A 3BURA 3EMZA 1C7SA 4F0MA 3S9IA 4ZO6A 2LLEA 3V75A 3FJ4A 2QGHA 4LOCA 1XIFA 4GJJA 3FA5A 3MBFA 1DEDA 2FLNA 4ZENA 1EJUC 3T44A 1KTCA 2XZ9A 3NA8A 3DENA 1DPMA 1TR9A 5KT4A 1W91A 3GG7A 1K4HA 3WUFA 1HO4A 2XWEA 2HROA 2FDSA 5FSEC 4J3XA 5D8ZA 1CXLA 2FTWA 4NIRA 3VAVA 3ARYA 2Y5SA 3MMDA 1G94A 2QNEA 2QCHA 5DGAA 1F2JA 1QVBA 3SUWA 1K7FA 3GFZA 3P74A 2IMWP 3NL3A 3GNNA 3GXMA 1QASA 3W1NA 3CL7A 4Y8FA 4DZ5A 2VUNA 4ECWA 1S97A 4DYEA 3ARZA 4LYPA 4C1LA 1B3WA 4K37A 2IW0A 4GXWA 1TPWA 1LLZA 1BQCA 4DQWA 2HPMA 5L1LA 4EEYA 2DSVA 2QVHA 4KESA 4AEFA 3NZRA 3ARXA 4BQ4A 3AXMA 3UZYA 3LZ3A 2VC9A 2VFGA 1EJVC 4MIMA 1K02A 1RY8A 5ECUA 4ASTA 4F50A 2Z1WA 3OA3A 3GQYA 4HPXA 1UPPA 3RO8A 1US0A 4WOZA 1JX4A 3N4EA 1WBJA 1LL6A 3VILA 1TTQA 2NV1A 3GFXA 4P8WA 3H7RA 1LT8A 1OK4A 2ZC1A 4DZIA 1DTNA 1E43A 2EPNA 4UQEA 1UOZA 3N2TA 2EPHA 5HINA 4HHLA 4JL1A 5AYIA 3TN5A 1KR0A 2VL4A 3TTYA 2OEMA 5JBEA 3GVVA 3ARVA 3UXAA 5H8PA 5DMMA 3SEPA 5KFSA 4WDXA 3K5XA 4YWIA 2VEPA 3BAJA 2FTYA 5B80A 5DF0A 2BOFX 3K8KA 1LBFA 3JUGA 4EK7A 1LBLA 4D72A 3CK5A 2XGZA 2GJRA 1ZP3A 5HXMA 2D24A 1AG1O 3SQMA 4FX7A 3PPGA 3MP4A 1A0CA 1F74A 2AGOA 4WDUA 1MMFA 1YE6A 1RAKA 3CZEA 4N9CA 3RBEA 3BZJA 4DM2A 4JKKA 4XAGA 1GT8A 1A47A 3E0WA 4YTRA 4MWAE 3CQKA 2ABAA 4GQQA 4CGTA 2ASDA 1WZMA 3FJLA 2GJXA 3NCOA 2E40A 4PMUA 2Q3OA 2OJPA 4NZ1A 2OPJA 1ME8A 2PZ0A 3C0LA 3DHDA 3DHFA 1QI5A 4X61A 1VJIA 4M24A 3B05A 3B0YA 3R11A 5FAGA 3VIKA 2E09A 2XC9A 2ZBTA 2VWSA 2XTKA 3MT1A 2WHKA 3PZGA 4YIWA 5JBFA 1FWRA 4IH3A 3AROA 3C52A 4OT7A 3WJYA 1ISXA 3A9BA 4HA4A 2IKIA 4J2PA 4RDVA 3SJ3A 4HIBA 5KFZA 4PUDA 1K9FA 3IK2A 3NR0A 3HPZA 3NPVA 1FCQA 2E7FA 3AI0A 3APYA 5M5DA 2GOUA 4JV0A 5E0FA 2DY3A 4REQB 5AYXA 4A3RA 1XV8A 1YTKA 1R30A 4ES4A 4UNIA 1EGVA 3ZWSA 1RA0A 2Z7GA 2EGZA 1NAL1 4U6PA 4OTKA 5ABGA 3TU9A 4HZ8A 1H7WA 3RX2A 3SURA 4B9ZA 1EKOA 1B30A 4K8HA 4JX6A 3M44A 5LNRA 3M7WA 2PDLA 4R8UA 3II1A 1NTHA 2C1HA 2DT1A 3FS2A 1GW9A 5I3GA 4WSKA 4A6GA 5LIWX 3MP5A 2JFEX 1W8GA 1OD8A 4P8VA 2ZRUA 3CV2A 1YADA 1OADA 1YNYA 4JY9A 4D1IA 4YU1A 1TWIA 3ECQA 2J24A 3CO4A 2ABBA 4MPKA 2A7NA 5CPMA 2ZCGA 3C0SA 3D47A 1GW1A 2BTMA 1BG9A 2I7GA 2TSYA 4X0NA 4JN8A 5CJNA 2PWEA 3GB6A 5DX7A 2R8HA 3LCLA 3MPGA 1DQUA 3N19B 4CQAA 2HE5A 1VEOA 3IIOA 3F4WA 1HO1A 3OZMA 3UJFA 3OBEA 4GUFA 2FZMA 3NEVA 4G1KA 3WH7A 2W9CA 2YCLB 2PWFA 3AISA 3N6JA 2PLKA 2PTZA 3E0VA 3VIOA 3NO5A 1GQNA 4MJZA 4B2DA 6TAAA 1KR1A 3KBVA 3DGBA 1ZBVA 2JKAA 1Q6CA 2O4QA 3CHCA 1MUMA 4IT1A 3MDWA 4KPLA 5L6UA 3RM4A 3NXLA 3PWIA 1DBTA 1KXHA 4E2DA 4FEZA 3D46A 4JTIA 3BSGA 1OCJA 3AIVA 4JDBA 1PV8A 2PDFA 3PM6A 4AWTA 4I9AA 3TN6A 1JFXA 1BGGA 3EBVA 3QLLA 3BK0A 4QROA 1CW2A 1S2UA 2ZUWA 4GLEA 2ZRWA 5CZJA 3BGGA 4JAWA 3H2AA 3AICA 3QMRA 3LMZA 3GU2A 5EU9A 4D2JA 1W1IE 4UFHA 5A8MA 1XCXA 1KFEA 1IQ8A 4CQBA 5FEXA 1YMYA 1TV2A 3KW3A 3POCA 3OGSA 2QT3A 3UJSA 2HQAA 2WVVA 4LPCA 3MB9A 3R10A 5JH2A 3WBXA 1U1UA 1JULA 3I3DA 3M0HA 1P1MA 1XXXA 3RUBL 4QCEA 3RJYA 2YCJA 4F0LA 1EWEA 4DO4A 1P1XA 5KFRA 4PL2A 3KL5A 1QRQA 4M1BA 1GPFA 1M68A 3IV8A 4ZE5A 4MADA 1FWTA 1YNQA 3N11A 3PULA 3UVIA 3UPMA 3EDDA 1O4UA 3UG8A 4WHBA 1UUQA 2QEZA 2WNWA 4LAZA 1BYDA 1ICQA 2VQUA 3QV6A 1CB7B 3DDMA 1SZGA 3TJXA 5TQLA 2BODX 4J9RA 2YFOA 3GY1A 2ZZ2A 3MDUA 2RDWA 1E73M 1CBGA 4N4PA 1MUCA 1F3TA 2BQ3A 2DW6A 2GDQA 1XBYA 4LEFA 3VGDA 3W07A 2BHUA 1FWCC 2A21A 3JZEA 4QQUA 2Y5JA 3KHDA 1XYMA 1Q8AA 5JIPA 2GVGA 3TAOA 5HJLA 3EMCA 4QM1A 1F76A 3KVLA 4Q6XA 1Z9AA 4C90A 3SFKA 2QJGA 4MLJA 4QGCA 5A3HA 1B3ZA 3W88A 3T8LA 1IXOA 2DSWA 2B7OA 3B06A 3PJTA 1ISWA 1Z42A 4E8GA 1OVDA 1O6IA 3QZAA 1NDZA 2HVMA 3OA5A 4AX6A 5F1VA 4C7GA 3MU7A 1AA1B 5DCBA 2FVKA 2PCEA 5A8GA 5AC6A 1E6NA 2ZXQA 3QY7A 1R7AA 1CLXA 3OW1A 1LOLA 3AUJA 3VD3A 2XJ7A 4R85A 2ZXAA 1BQGA 1D3CA 3GNXA 2DT0A 2G3FA 1ZJHA 2PWVA 1XGDA 2ZUSA 2YL6A 4LUSB 2BXVA 4IM4A 3ZLGA 3WF2A 3VIFA 1CXFA 2EHHA 3CZLA 1Q7MA 2OCZA 4HK7A 3FJNA 8XIMA 1FBAA 1ZL1A 4O1BA 4PA8A 3MFHA 5I3IA 3TYZA 1R2SA 1UWQA 3MBDA 1TZ9A 1A80A 4O0ZA 3OYZA 1EEPA 4Q33A 1GQKA 2OODA 3HPSA 3OU8A 3L4VA 3OLIA 3UR7A 1UP0A 4AZHA 3C2YA 3G24A 2QLYA 2FPVA 3Q58A 1GOKA 5AB3A 3WBAA 1KKRA 3R8RA 4H9VA 2Y2WA 1H50A 4NZCA 2KX9A 4H4IA 3GVQA 3MI6A 4YNGA 1F5ZA 4AD1A 4JYFA 2YCIX 3QZ8A 2E8ZA 1NQ6A 3WKZA 1GVIA 3NNTA 1OIFA 5L9XA 2E5CA 1JVNA 3W2LA 4FB7A 4WXZA 3HGSA 4QBXA 3T9PA 3TX9A 3S2MA 4L64A 5KFTA 1K8ZA 3W1AA 3LTYA 4W8BA 3R4IA 4RZ4A 1R47A 2W5FA 2OYMA 5L9FA 3KCJA 4IIDA 1FCVA 2V68A 1TRDA 1NOWA 3QTGA 1VHNA 1SYTA 2J78A 2GSEA 2PDPA 1BTCA 1I0DA 3ZLFA 3AS3A 2J4GA 3KL0A 3LN3A 1E9YB 2OWXA 2GL5A 4HMEA 1VKFA 1XLFA 3T0DA 3W23A 1WXJA 4EPBC 3GC5A 4PUWA 3GV8B 4ZB2A 1I60A 4WLCA 5GJNA 3I4KA 1K7XA 5I6SA 5C2CA 1JCJA 1TMHA 4FMVA 5KFWA 4ILSA 4EKJA 5KFAA 1I2RA 4UQAA 3L5AA 1FHDA 4Z2JA 5BXTA 1NIUA 1V0KA 2HBVA 2DSKA 4XBKA 4FIQA 1LP6A 3L5MA 3GTFA 2PS2A 1Y5XA 2V5JA 4NZ4A 5LGZA 1YDVA 5PTDA 1SW0A 2V8ZA 4KRUA 1TVNA 4X9YA 3V0UA 4HMNA 4U3CA 1W1ZA 1GQIA 3BSMA 4X60A 1POJA 1RR2A 4RDYA 1QBAA 3LNMA 3TN3A 1VLIA 3QFWA 1UD2A 4EOUA 1C90A 4RNNA 3W28A 4CQCA 4X63A 3GIKA 2J13A 4ZL1A 3T8QA 4NZJA 5CKSA 4KCUA 3V6KA 4K7VA 3ITOA 4IRDA 4YL2A 1WYIA 1RV8A 2PDHA 3THAA 2XH4A 4ZXOA 1E3XA 1KFJA 3GIIA 3EOOA 1TV7A 5I00A 1XLJA 2IXVA 4M82A 5BU9A 1U1HA 2OGYA 2J77A 1QDSA 4F79A 1I8JA 3FYYA 3DI1A 4RE3A 2XGBA 2QUVA 3M07A 2DP3A 4AFYA 3PTKA 3W7KA 4DBUA 5E70A 1X6LA 3AS1A 3CZKA 1VIWA 4PEEA 1ONXA 1ZQ5A 4GXPA 3PB0A 2GYIA 5DQHA 4OWGA 1K03A 4JHZA 1GOQA 2DIJA 2A6NA 4B5XA 4PMDA 4XISA 4O4VA 3WY1A 4ECLA 1HP4A 2TYSA 2YIHA 4ZQMA 1UZ4A 3TUUA 4GGHA 4NJJA 3BTNA 5FF2A 3U8GA 4NZ3A 2ZWZA 1K1DA 3VX1A 4GNJA 4EF8A 2QIWA 2REQB 4IQLA 2WHJA 3RB0A 4YVXA 3SUSA 1Z41A 1VPQA 2VFHA 1LRNA 3RX4A 4CN1A 2OG9A 2A3LA 1BHGA 2AGQA 3S2LA 4JBRA 1XIGA 4PMJA 3VIJA 2X09A 1UIPA 2ZZ6A 3RU8X 2ZC8A 3CNYA 4M56A 1MSSA 3V5CA 1UG6A 2A4AA 1SZNA 1KXVA 1TJPA 3MTWA 3CMFA 4S38A 2HNEA 4A2RA 4F48A 3QN3A 2JKPA 1OFQA 4LCSA 3NL2A 4CUCA 4HZMA 1UH2A 1R9XA 3W7DA 3QPZA 1ITQA 3IVSA 1AJ2A 4EIVA 3FHAA 3CO8A 2XSBA 4GNKB 5KFQA 4B5NA 1PHWA 1FRBA 2W66A 4IRKA 4O12A 1C93A 2W9AA 1PHQA 4HA0A 4CCEA 4UQBA 4MZ1A 5AHEA 3B8SA 1BKSA 3M5ZA 1DJWA 1AODA 3TYUA 1C3FA 2DPEA 2ZE3A 4F2UA 4ML9A 3E3HA 4H7ZA 4O53A 5ABHA 1XCFA 2BX7A 1TVPA 1S3TC 2VDIA 5HNNA 2D0HA 3PW4A 3BUVA 2QVNA 3SQSA 2C0AA 2FGLA 3MYPA 3HPFA 4ADUA 1IEVA 1ZALA 4U10A 4HNVA 3JR2A 2ZZ3A 3PF3A 5G1YA 1G4EA 1Y65A 4OE7A 1YBQA 3UYCA 4MLRA 3PBMA 1SM9A 3T55A 2OX1A 4Q4PA 2J66A 1HJWA 3CAVA 4Y96A 4DWSB 2V3GA 4Q4MA 4CQ8A 1QO5A 1GEHA 4MWAD 3O1NA 1KQYA 1N2VA 1ISYA 3FNDA 1FWDC 4LFYA 3GIYA 3BW3A 2CLMA 4FS9A 3H4GA 3WNKA 1JDAA 1PIGA 2NXGA 4TVCA 3GYEA 1UR2A 3GR7A 3LGGA 2OLSA 1OFPA 2P0OA 3PWGA 3LYEA 5BMXA 3PBUA 1D8CA 3U7VA 2O9PA 3V16A 3V1PA 3ZOAA 5I3FA 3PVFA 4PTDA 1SUXA 5E0CA 4KWVA 3VPLA 1SFLA 3M6DA 3WCZA 2V2HA 3STPA 2EAWA 1EDTA 4JTCA 3GGMA 1IZJA 1Q6DA 1QW9A 3GU9A 5KFMA 1REQB 2IUZA 1EFZA 2X0YA 1AJ0A 3PTDA 4XV0A 4L6HA 4AHPA 5GJPA 3CAKA 3IACA 1EUAA 3AJ7A 2FH8A 4XVEA 2ZUVA 2AL2A 3FSTA 3OGVA 2BV9A 1K3UA 3NYZA 1VPXA 1XLAA 4ZZ9A 3PS7A 3BLIA 5KFNA 2PDIA 2CCRA 2G50A 4QG8A 3N15A 1RYRA 3T40A 1OF6A 2JGQA 3HJZA 1NDYA 2TODA 2CLHA 3L4UA 2YX0A 4FZIA 1MDRA 2J79A 4KRTA 2NXHA 1XSJA 1W1B1 3WNPA 3E0LA 3S4TA 5IBXA 5KFYA 3KBMA 3KVKA 3AHYA 3SIZA 1XIHA 3NDOA 5DXXA 3RN6A 2C71A 4TTGA 4F4ZA 1F6PA 2BVDA 4IPLA 1F73A 2Q8LA 1TPC1 3OJGA 3WQOA 2XG9A 1E6ZA 3A64A 3KOXA 2Z0IA 3BMVA 4DF1A 1I75A 4QWDA 2AOSA 2V9DA 2X41A 5JH1A 3GWQA 1OX5A 3ITGA 4JFVA 3AMKA 3SCWA 4I9TA 3SUVA 3DI0A 1XGZA 2E77A 2DU2A 1EF3A 1X7IA 3N6QA 3SW6A 2QJMA 2YW4A 1EOKA 3VKJA 3VDGA 2AAAA 2QPUA 1FP8A 3ZWTA 2D0FA 2VUYA 3Q8QB 1AFSA 3DFTA 4I3GA 2NQ5A 1OT1A 5D4YA 3R89A 4H9XA 4HVXA 3ZJ8A 1I2OA 4Z17A 4GE8A 4IMDA 3VZZA 4S3CA 3HFYA 1BRLB 4GO9A 3M9NB 5LA0A 2IPJA 3T0BA 1FXQA 1VRXA 3GZAA 4IRCA 3RB3A 4GY1A 4LU0A 3NIYA 3N18A 3NQCA 3E1F1 4I8DA 1NU5A 4DYKA 1MW2A 1WAWA 3R8HA 1KCXA 3QY8A 1VEPA 3EGJA 4GBDA 4F0SA 2E68A 1K8XA 2V3FA 3F1QA 3TMQA 3VNMA 4AZ6A 4A35A 1KXQA 2CWNA 1FUYA 2HCVA 4AC7C 2IPWA 3O8AA 4QDPA 1UKOA 3N9KA 2VEKA 3FXYA 1YRRA 3RXZA 4HT3A 2XHYA 1TPH1 1OC7A 3GAYA 5IHSA 5D9OA 4RZ5A 1HJUA 3ZR5A 1KM6A 2VGGA 3K8LA 5DT7A 5C8BB 1OZMA 3MO7A 1LQ2A 3WQ4A 1K70A 2VC5A 2CFFA 2O7SA 1GGOA 4TX8A 4NSBA 4O28A 1W2PA 4HD5A 5KINA 4HYKA 3BPWA 3BOXA 3IJDA 4NT0A 2DJLA 1KM0A 3QHOA 3GUWA 3FW6A 4AXNA 3U57A 1CECA 1TPVA 5BMWA 3W4RA 1TUXA 1TUFA 3TNOA 3GBDA 1H41A 2Z6IA 5FAJA 5LSMA 1O5QA 3LLDA 5BYWA 3TZNA 3H40A 4RE2A 3ZVIA 3NPWA 1ZBCA 3LXBA 5AHNA 2QCDB 1DXEA 1IEXA 1B0IA 3BANA 1EJSC 3ICJA 2WLYA 1Q8JA 4DY1A 4N42A 4YR3A 2GQ3A 5DGBA 1ZENA 4JTGA 1H7NA 3KVJA 1US2A 2ZZ1A 2Z00A 4ZR8A 1FWGC 1OWQA 4K1WA 2WKJA 2C91A 5HPCA 1D3GA 4JQ1A 5FI8A 1ZGDA 5AN7A 3R43A 3F2DA 1MW1A 3BAIA 2VA3A 4A8NA 3L7RA 3QOMA 2CHNA 1PX3A 3W75A 4OVXA 3CASA 2FB2A 1MEWA 3LCGA 1UW9A 2PWHA 1N7KA 3CBWA 4WEVX 3CV6A 3EOUA 4QEEA 1N8FA 4JTKA 2D0GA 2XGIA 3M0YA 2FLLA 2VCBA 2WSYA 1ODUA 2KZHA 4ALDA 1S0MA 2QHAA 3R79A 1JPDX 1R9YA 3L4WA 1O60A 1PS9A 3KZSA 2AGKA 2WKGA 2IKGA 1S2CA 2YBUA 2O56A 4Q6JA 4H9TA 2CKSA 2O9RA 2RGMA 3VI2A 4H6EA 2WMGA 3KEHA 4W87A 3W1UA 1GYLA 1C29A 4ZO7A 1J2WA 5BRQA 4JFSA 2WZMA 1C9WA 1BKHA 4IICA 3B0VC 2JK2A 3N12A 4HZ6A 4WVXA 4B90A 1AK5A 5CXPA 3OQEA 1NFGA 1H7XA 4GIYA 1DQXA 5JXQA 4NZFA 5KMYA 4DJDD 4E2BA 3B03A 3B4UA 1OQFA 4M8UA 1K6WA 1FWAC 1NQKA 2QIIA 3LDVA 2JALA 1VFHA 1Q4NX 4GZIA 5LA1A 1TCDA 3HG4A 3WQDA 2DFAA 4HNOA 1V3MA 4UTTC 4D6HA 1DWGM 4FR1A 3MVTA 4CKQA 3ZO9A 3VCNA 4LVDA 3S5YA 4ZTYA 2JEJA 1HFBA 3SBFA 4PUEA 1XYCA 3DBNA 3V4BA 4JL2A 5CZTA 1EQCA 4PMOA 3UWEA 1KBIA 3QR1A 4W7UA 3VDHA 1BXNA 4UR7A 2DDXA 2OLHA 3W7MA 2GJNA 4KCWA 3G1YA 2W6RA 2J7EA 2VP8A 3A4JA 4ZQOA 4DUVA 5DQIA 2EXOA 3FVDA 1V6YA 4HYVA 4DJFD 1H09A 2VFEA 2PU0A 3G0UA 1XKJA 3QPEA 1TPB1 3CC1A 1UR1A 4H7CA 5GNYA 5XIMA 1AL7A 3B04A 5DBTA 1DJNA 1UR0A 1RBLA 1QNSA 3QXBA 2A6LA 2EO7A 4UBPC 3UW6A 4B5UA 5AYZA 5LXXA 4H3DA 4PR4A 1OFOA 4DJEA 2JGYA 4REQA 2O9TA 5FF0A 3M9MB 3AS0A 1CEOA 3W7HA 2D2OA 3RMEA 2QV4A 1S2VA 3GE7A 3N14A 3TXZA 4C1KA 3H7UA 4WUIA 2ONEA 3JU2A 2YBTA 2IS7A 3GVWA 3GS6A 4GI6A 4DL4A 1QMLA 1W1YA 3W84A 1E55A 2O55A 3CV1A 3SCVA 4IFRA 3SM0A 4JYDA 4BWLA 1JZ3A 3WBWA 4NX0A 4FOJA 3W7NA 4Q4KA 1JCNA 3MUAA 4HN8A 3DBPA 4LQ1A 1HJQA 3LQGA 1L8NA 2BY2A 1US3A 2DZBA 4PEKA 1J0ZA 2QAFA 1WO2A 1BYAA 3N34A 3WNOA 4P7LA 4AVFA 3RBDA 3HGJA 1A3XA 2AGTA 1QPRA 3LG3A 5ECVA 1C92A 3OHIA 3T09A 3PZQA 2B7NA 3EA1A 3VINA 1EXPA 4O54A 3Q65A 4O1DA 1E6XM 2H8XA 2D23A 1ZFJA 1YDNA 4CQ9A 3MSRA 1T94A 1HGWA 3EDJA 4X2PA 2A1YA 3S6TA 4LC8A 4QW9A 1C8YA 4KCVA 3LB0A 1JUKA 3SRKA 3NVTA 4D6CA 1QW8A 1GKQA 3C4UA 3CT7A 2VQTA 2YCLA 4GNVA 4Y6GA 1BF2A 3W2KA 3MZ2A 4KWWA 1AQ0A 4QWEA 2OQLA 4TUFA 3P60A 4MUZA 4GOAA 3LCWA 2VCCA 2XH0A 2W8LA 1FX6A 1S5TA 1S5MA 5A5WA 2XVKA 5LZLA 3RITA 4HOXA 2VX6A 4UTUA 3VU2A 1WDPA 2ZWYA 3BLKA 4LTSA 4CU8A 1ADSA 4AHQA 1RQHA 2FH6A 5I24A 4QWCA 1WKDA 2ALZA 1WPCA 3RPTA 1XH0A 4Z2IA 5LHEA 2TAAA 3NZPA 2W63A 4IPPA 3G6MA 4NHVA 4YHGA 1BYBA 3MCOA 2YCEA 3MR5A 4XIAA 4YCOA 2WCAA 3AIWA 3UNDA 3NOYA 4NG3A 4HYRA 4ZFCA 1RYSA 4FX8A 3MKVA 4DZAA 3TQ1A 4W85A 4QDMA 4IP4A 5FF4A 4QLLA 1Q6RA 5CSRA 5F2IA 5KG5A 3VM7A 3MMWA 4AZGA 1X38A 5KT3A 3QV9A 4JTLA 1KV5A 4JNZA 3NUKA 1LRTA 4H2HA 3CV7A 1Q2SA 1KFCA 3PPHA 1LWJA 1GYNA 5B7ZA 4YS1A 3BL3A 4UB9A 3RJXA 1TV8A 1TWZA 4NP7A 4IQEA 3RU6A 1QW7A 4IP7A 4Q8TA 4NNBA 1NEYA 2J6XA 4P7OA 3UWQA 3QRHA 4LVBA 2WM0A 4Z2LA 1JYWA 2G41A 3RDKA 1J12A 3COTA 3MV11 2WBGA 1V03A 3KHRA 1AD1A 2F6KA 2H3BA 2ATLA 2JIEA 1JYNA 3LTSA 4L80A 1JQVA 3PC0A 3ZR4A 4XZ9A 4HP5A 4XD6A 1VAHA 2FPTA 2GVLA 3M0VA 3HF3A 4JOMA 1IE7C 3GM8A 1JZ6A 2Z2BA 3OTRA 3KP1A 2V5DA 2GFTA 3LEPA 4LB4A 4W9TA 1AMYA 4D71A 4D8AA 1PJ9A 3SI8A 1NWTA 4QAWA 3RFAA 2EPOA 3LHVA 4GQBA 2DUAA 4V2XA 1JYVA 1N56A 2OMAA 3TCSA 1WDQA 5JIWA 2P5NA 3Q4DA 2C79A 3TDFA 3NTYA 3CL6A 3KM8A 3W82A 2QPXA 1ZZMA 5KFVA 3V0TA 2V2DA 1JYXA 4MF4A 2YZRA 1PE1A 1UJQA 5KFOA 1A5AA 1XM3A 2WMIB 1FCBA 3APTA 2PFHA 5G5IA 4KMQA 2FMOA 4XZHA 2DIKA 3M0IA 4ZVJA 4A8LA 4L9ZA 3N4FA 5IHRA 5C9XA 1TB3A 5FIPA 2W62A 2BFGA 3EX1A 1R9ZA 3VDCA 5FJUA 4IGNA 1GKRA 1XUZA 4O11A 5AC8A 4Q4RA 3WF1A 1L6GA 4Y9PA 2GVYA 4ED6A 1PSCA 1VYRA 3WUBA 2IKJA 2V5LA 1PKNA 5MF5A 3NPUA 1P6WA 1I2NA 1RPKA 3FIGA 3OPSA 4EBEA 1SO5A 1ZLPA 4MAZA 1Z32X 3BLPX 1WA3A 4PMZA 3LLFA 1BSIA 5HAOA 1DXFA 5G2IA 3F4DA 1W3IA 4KKXA 3VNYA 1OFBA 1S46A 5AZ1A 2GK1B 4UCFA 3VA8A 4OU1A 3P7YA 1TTJA 2QUUA 3MWCA 4M80A 4TTUA 2DZAA 5LIUX 4GJ1A 2L5HA 3B8WA 3WELA 4LC6A 1Q6EA 3PZ9A 3GH7A 2BZNA 5H8MA 4WSJA 4ZODA 4FLOA 1P6CA 1QFEA 3UD6A 3W7PA 3DH7A 2OEKA 3LPGA 4EACA 3WD4A 2A3HA 3GG1A 1QOXA 4BQ3A 3WEMA 1BSLA 1PCKA 4LUTB 2P53A 4NNAA 5DG8A 3C3UA 4HNTA 4PTMA 3PBWA 4Q32A 5I77A 3U2CA 1XJBA 3C8FA 4MPQA 1K77A 1JNEA 2YA2A 1UR4A 4JKLA 3LHZA 2DSZA 3RPDA 1A5LC 4Q4QA 4OOUA 5G4EA 4ERAA 4JUZA 3LHWA 1E15A 1T40A 3AYRA 2R82A 3P62A 3A22A 1GEQA 1UHVA 1X1OA 3NOEA 1NP2A 4KW2A 1S5NA 3WDHA 2VA2A 3GG8A 4FXSA 3VD4A 3NYDA 4FSAA 1M03A 3S3GA 3WEZA 3F2CA 7REQB 1TSIA 6A3HA 2X1UA 3W24A 3U4AA 5HJYA 1CZ1A 4S3AA 2C16A 1TPFA 2VC7A 3ANVA 2FZNA 3BJYA 1W1TA 2Y7GA 3PR5B 2J9XA 5E6ZA 4LY8A 4HK5A 5AFDA 2ESCA 1EWDA 3CHVA 3LS9A 4G56A 1FWFC 1A5NC 2CZFA 4EYHB 1ESWA 2FLIA 3HB9A 2RDJA 2DT3A 1I2PA 1JZ4A 1ZTVA 2ZUUA 3UY7A 1HN1A 1W5MA 5HANA 7CGTA 3MZNA 2J6TA 1W9BM 1LZOA 1IF2A 1ONRA 3G1XA 4MAVA 5C9UA 4HMDA 3S47A 1ZJIA 1W31A 3A24A 3KBWA 3RHGA 2B81A 1OSEA 4IIHA 4R27A 1O7AA 5HNTA 4LANA 4KEZA 1LYXA 1CWYA 4FX6M 1UWAA 2R9RA 1LWHA 3V5FA 3VKDA 3M5YA 4BI7A 3VGEA 4RU9A 5G4HC 5C7HA 1OJXA 2WQDA 2Q3RA 4I90A 3NZQA 2TMDA 3BG5A 5HNRA 3C6CA 3M0MA 4XSMA 3LXCA 5KG7A 2WSQA 1R3VA 5TNVA 3E2SA 2ZUTA 1DTUA 1CXIA 2FZ9A 4BFAA 3MHUA 2GOKA 3A3HA 3HGOA 3AO0A 2G5WA 2VDGA 2VR2A 4EBCA 3D3AA 4Y9OA 4MZ8A 5HA7A 2WB5A 2NLYA 4PTNA 2VKZG 3TTOA 4N9DA 4TVDA 4LB3A 5LIXX 1HKMA 3WF0A 1J4EA 4Y90A 4MMWA 5A8OA 1UD5A 3GW0A 1B3VA 5EWGA 1KCKA 5BCAA 2VWTA 5CBBA 1HJXA 1V8EA 3F4CA 4PL1A 4HQVA 2RUSA 3U3HA 1JI1A 2QS8A 3RB4A 2BHZA 3EWUA 3TVAA 4Q8EA 1F7BA 4XB3A 2PP3A 5H1WA 1IEQA 3R7MA 4J9PA 1QI4A 1BG4A 5T9CE 5I03A 1XC6A 3VE9A 2ZZ4A 4QITA 3PBVA 1Q6OA 4AMCA 2X16A 1Q5MA 1PYMA 2WQPA 3YPIA 2QDEA 3SCRA 5HBFA 4WY0B 1THFD 3LK6A 3ABSA 1GJWA 1Z44A 4DWSA 3LRLA 3FAXA 2PGWA 1AUSL 1DVJA 3T05A 2D3NA 3ARWA 1CGUA 4L65A 5BXRA 5D05A 4NYUA 4LV4A 3WQ6A 4GI9A 1LT7A 2X1TA 1XUUA 1R3RA 1PO9A 5DCDA 2QF8A 3UWUA 2HJPA 4CNSA 3PK7A 3B8UA 2UBPC 1SR9A 3GR4A 2V9WA 3HU7A 3ITYA 5DCEA 3I68A 4HPNA 3SSZA 3BG9A 3LBOA 1Q4WA 4ZQNA 3ZLHA 4F3HA 2YLLA 4JCMA 1LDCA 3DG7A 1W3KA 4JPGA 1UQYA 3EPOA 4B5TA 4AIEA 2P3ZA 1QCWA 1EZ2A 4FOUA 3TQPA 3JRKA 4M81A 1CIUA 4JTAA 1JQXA 3KP0A 2QXWA 3KCLA 3PJUA 3E9AA 3T78A 4NRSA 4UNKA 4IJRA 3PZOA 3WLOA 1VD6A 2OYKA 2YSWA 2AU0A 2Y88A 4E8DA 2VCAA 1L8PA 4URIA 2J62A 4LY4A 3LZ5A 4C1NB 2WZIA 5KT5A 1N8WA 2EPKX 4FXJA 4UTHA 3NQDA 3PNZA 3QV7A 3ZM8A 3HQOA 3ALFA 4G7EB 2V69A 4Q7IA 1BWVA 1EJWC 3WH8A 3ARPA 3SCNA 1V3HA 3KDNA 4BCEA 2E9BA 4GY0A 4NJGA 3KRZA 1VC4A 1I1WA 2ANUA 4IGMA 1R0MA 1RD5A 2ZADA 4E8CA 3P0XA 5TIMA 4IIEA 4MYAA 4UZSA 1G7VA 4GK8A 3T4WA 3ABQA 4GINA 1F6YA 1JAEA 3MHFA 1TE6A 3AFBA 2WPBA 3EEZA 4RZBA 3AUOA 1SVDA 5E5CA 4OHQA 3GRIA 3WLIA 2QGYA 4EP8C 4M0XA 3B8IA 3RLHA 3OIHA 3L23A 2BMBA 2PI6A 1ZHAA 4NYYA 3GBEA 2W27A 3W7JA 5CAHA 2VEFA 3L68A 2WMJA 1GZJA 2ZA3A 1S2WA 3S1XA 1IWAA 2VD9A 4S3BA 3UJRA 4CD7A 3INPA 3OZPA 1FDYA 2ACRA 2GUBA 5CJMA 3L4XA 3UJ2A 4R33A 1WQ5A 3B9EA 5IXEA 4WKAA 3ARQA 4PE8A 3FGCA 3LERA 2JQXA 4XD5A 4RZRA 5I07A 2HZGA 1DL3A 1X1NA 2DW7A 2V63A 3WNNA 3MW7A 1OD0A 4J7RA 3SCPA 4IIBA 4U33A 3W1XA 3N25A 4BK9A 1VHCA 8TIMA 2AQVA 4U31A 5C54A 3W1TA 3P84A 5K4ZA 3BO9A 1IGSA 1B9BA 1F6KA 4RNJA 4XKYB 1TIWA 3K46A 4L5ZA 3FKKA 3GIJA 4QE1A 3W27A 1SO6A 3VIHA 4YQWA 2PDJA 2CLFA 3THCA 1I45A 2J8FA 2CLIA 1O1ZA 3VIGA 2E5DA 3P80A 3NQMA 1MEHA 4AEOA 1Q2RA 3IJQA 4L6OA 4YTQA 2J6SA 5A94A 3IAPA 5CZ0A 5FACA 1B4KA 2WWDA 3THQA 1H0GA 3MJYA 2HTMA 2EJAA 4UFMA 5C5JA 2E67A 4R5EA 3ZJ7A 5K3VA 5KT7A 1JZ7A 3HPAA 3VNJA 3BLEA 4PUMA 4P7QA 5LNUA 4JQAA 1H7OA 1UWRA 1BVNP 3LMYA 3WLHA 1E51A 4K2SA 2WAGA 3FY1A 1RXOB 4J4KA 4K6AA 3WLQA 3UESA 2DSUA 1O1HA 4IMEA 2XIJA 3FA3A 1PDYA 3QZEA 1CI1A 5LNWA 4AD4A 1CGTA 3BAXA 1W9XA 1JIHA 5U4NA 2WZHA 3AZTA 2QCDA 2F84A 1OM0A 1Q6LA 5CAKA 1S1RA 3OLDA 1TV5A 1WE5A 1XYLA 4IX0A 2V2CA 3N2BA 1AL8A 5EMUA 3KFTA 4DLMA 1NF0A 1MQRA 2J7GA 4B5WA 1KRCC 4H19A 4NJKA 1UZDA 5LKYA 2C7FA 3AXHA 2F7FA 3R2GA 3IGUA 1TMQA 4GI8A 2DGAA 3B8TA 4O3QA 3TONA 4KFOA 4O0QA 3RNDA 3W7OA 4GH3A 4I9MA 2VRKA 4Z1DA 4BF5A 1EL3A 5D2TA 2F38A 1IV8A 2DZPA 4AF0B 1ZAIA 2ZX5A 4KCTA 4HJFA 4PRTA 2OR2A 3M41A 2QUNA 2HVNA 4I7VA 3G1FA 1H49A 3AIBA 2B7QA 5KFHA 5CPQA 3ITTA 4DF2A 3C2VA 2QCEA 3EWZA 1E70M 1V6XA 2WKLA 3MSDA 3IK4A 3LPOA 4MKNA 4AAJA 1VFMA 1NP0A 4RPQA 3HQNA 3UCQA 5K9DA 4TMCA 1U83A 3BCDA 4CU7A 2XH7A 3AU6A 4U2ZA 4PYSA 3RLVA 4GD0A 4O1CA 4ECUA 4O17A 3HMJG 4NF7A 2DZTA 4QQ3A 5BRBA 3WDRA 2F61A 1W6TA 3RRAA 3RILA 3S2JA 1WKEA 1K8YA 3BVJA 1MZRA 1ITXA 5LNVA 2CLPA 1A0EA 1V0NA 4O10A 3AZRA 5IBXC 5HQLA 1V3IA 1JL8A 5HWJA 4DJED 1MQQA 3KTCA 3NPXA 4HA1A 3WQFA 1LG1A 1GJUA 2Z28A 1Z3NA 2AKZA 3H6OA 4D9PA 1YEYA 1DIOA 1UROA 2AKMA 3QHMA 4YP3A 4N0RA 3EWDA 5A6LA 3S2CA 3PVXA 3WJZA 1ENUA 3STFA 3PZPA 1OF8A 3G6XA 4YVVA 4IWWA 4D6GA 3W2UA 2OSWA 3ARSA 1JCXA 1SMDA 5EWEA 3CUGA 1L6SA 3KCOA 1W1PA 2NWSA 3W1RA 3G8EA 3I3EA 5DQGA 2C6QA 2ATSA 5HULA 3W71A 3QMTA 3VZXA 1X39A 4XAPA 4DO5A 2E1DA 4MTVA 3QZ7A 1EJRC 5FKYA 1E4LA 3MA8A 4LBRA 1GVYA 5MKGB 1HIZA 1HL2A 2V0TA 5A6AA 1RCQA 3DGRA 3SUUA 1R38A 3WDQA 1XBZA 3B4YA 2Y89A 1JZ8A 5F9NA 1PPIA 5A8PA 4GYPC 1ECQA 5REQA 4US5A 3A47A 2OO6A 3G6YA 2W92A 1FP9A 3JZUA 4LEQA 1EHAA 4B5VA 1J01A 2E4TA 1A5MC 1DWIM 1G4TA 2NQ9A 4MNLA 2PD9A 2PBGA 3PW2A 2Z1VA 3AWOA 2GGHA 1KTNA 2Y1HA 1POKA 3UYIA 4QXIA 5XIAA 2ON3A 2ZVRA 4PCSA 3IIPA 1D3HA 3VIMA 1EOMA 4QS5A 5D2YA 5KFIA 2BP1A 3QFEA 3WD0A 5SWUA 3AALA 5I78A 3NGJA 3GLCA 1GVEA 2WCSA 5F4SA 3TIMA 1V0MA 1G4SA 2UY2A 2G97A 5GNXA 2C2DA 4U5IA 4JIRA 2C14A 2IPGA 2WK2A 1NWRA 3DG6A 1ITUA 1LJYA 4C65A 2CZDA 4LW7A 3BG3A 3VUSA 4F2TA 1MW0A 4LYQA 4JIHA 2G0WA 3EPNA 4CCZA 1SJCA 3STCA 4DI9A 1ZRQA 4J3ZA 1G5AA 2WZTA 3GXDA 5HR6A 1VF8A 5D9MA 4ATWA 1JCYA 3VM5A 1CDGA 2VXNA 1VFOA 2ALRA 3PANA 1TJ0A 3PZMA 1RLCL 4NX5A 3TWBA 2Y4SA 3MJMA 4MNMA 5HUOA 1E4IA 4QJ4B 4S3JA 4UTKA 2EG7A 2UY4A 3CWNA 4MM1A 2OOGA 5CGQA 1M7XA 4UWMA 4WF7A 1V6WA 5CGTA 2QDHA 1Q6QA 1E71M 3G8RA 5I09A 2E3ZA 1OT2A 1KRBC 1XR2A 2DZUA 3SSJA 3T1GA 1BVZA 5GVJA 3CYVA 4V33A 1XPYA 2KAUC 5KFEA 1DV7A 2VDHA 3HV8A 3AQUA 3LSCA 4P7RA 4TXEA 1UUMA 1SMAA 3GKFA 2OB3A 2C19A 2YLAA 2D2GA 4GI4A 4U3AA 4IX2A 4C7FA 1YPXA 4I7UA 4AZ7A 1RCOB 3NGDA 3PW0A 1XX1A 4C6MA 5ABEA 5IFTA 4ZSUA 1HGYA 3CXOA 1LUCB 2X42A 3HJEA 3H54A 1P0NA 5F7UA 5KT6A 2QULA 3URNA 3AOFA 1PX8A 2Y24A 3LENA 2BXZA 1TJRA 5FJIA 2H8ZA 2BOEX 2VFIA 2DVXA 4QG6A 3NZ1A 2TRSA 2Z1KA 1ZSXA 2IA6A 3CS2A 4R7JA 4LCRA 2A3EA 3QMSA 3BJSA 2Y70A 2WJEA 3NG3A 1JCMP 5IM51 1JPIA 2YZ5A 4OBSA 4JTRA 2PMQA 2W8KA 3URAA 4TX9A 3H12A 2CLEA 4FLSA 1PWMA 5DMLA 2DORA 1LORA 2Z24A 4MKVA 4ZQPA 3UXLA 4RR4A 1X8FA 2V4RA 3TN4A 1CYGA 4XG1A 1VFSA 3EAUA 4J3VA 3T5KA 1TELA 4NZ5A 2INEA 1JNDA 1GOXA 4N6FA 3MWAA 2J25A 4X0VA 1XW8A 3AXXA 3FV9A 3VKAA 1DWHM 1EC8A 4BEQA 2DIEA 3BOLA 3W22A 3WO8A 3GV7B 3GDLA 3NDZA 4A8RA 3XIMA 4KIRA 5E0KA 4AZCB 4Y9MA 4QSFA 3H4WA 4M6PA 5CPNA 5ABTA 4QTGA 1Z6KA 4I5RA 4EXAA 3QQ0A 3PG9A 1X96A 4HHHA 4XO7A 4H8UA 1VFLA 1WUEA 4KWSA 3BQ1A 3PZUA 2MANA 3LV5A 5EFDA 3S5OA 4JIIX 3KX6A 2VZSA 5BOFA 3OHBA 4E6MA 1A49A 2FJUB 4LNYA 4PBFA 2F6UA 3GTHA 2JKEA 5FF7A 3CGTA 3ZR6A 3UZXA 4ZBCA 1KB3A 2ZX6A 4DEFA 3TWAA 4UR9A 3KRBA 3BCFA 3N2CA 1BEUA 1B4EA 4FF5A 4GO8A 2ICSA 2H9AB 1UASA 4XIMA 1E0UA 2JIWA 4Q44A 1XDJA 4LS2A 4DJEC 1G4PA 2BQUA 1V6TA 1AQHA 3ZT6A 1C7TA 1WKFA 1ZS2A 2WMIA 1A53A 3GILA 2XGQA 2Z7KA 1IT0A 4EWND 4LVGA 3EX6A 3SCUA 4ADTA 4AXKA 2WHMA 3KWSA 3L2IA 3TNBA 2CNCA 2FPYA 3S6DA 3OZOA 1UP3A 1TMLA 5HPOA 2ZUNA 4GVIA 1MZHA 4EVZA 1OYAA 2Q8XA 1PX4A 4DLFA 4KQNA 3I10A 4PMXA 4WKFA 1DJGA 3KL3A 4Y9NA 1NSJA 1CLVA 2YDRA 3C2RA 2P88A 5KZMA 4NJIA 3UZ5A 3GW3A 3DC0A 1EB3A 1R5YA 2GJXB 1JF5A 1H0IA 3MKKA 5G1TA 3UZWA 4N2YA 4Z1YA 1QK2A 4N9BA 3TR2A 2NV9A 3LSBA 2GK1A 1KFKA 2PP0A 1SSDA 1OGBA 4W5UA 1UZHA 2YL8A 3CQIA 2HS8A 4Z2KA 1TYGA 4A3UA 2I1OA 4IHCA 3M9YA 3WLMA 5D2WA 5IDIA 1M04A 3IVTA 5L1IA 1QTWA 4IFOA 1HKJA 3TTSA 2VO5A 3PTMA 5F2GA 2H90A 2CZEA 1H51A 1JDFA 2EEXA 3USZA 3FXGA 1XPGA 1AH0A 7PTDA 2D2HA 1IYXA 1WCGA 3FDKA 1K9TA 5I79A 4LUTA 2GVJA 3OVGA 1CXKA 3SN0A 5D2XA 3U2EA 3L9CA 5KG0A 1W1A1 3VMPA 1EDQA 5FJPA 1EEXA 1J11A 3WD2A 3VMNA 1OC6A 3W86A 1OFEA 3KRUA 3RRXA 4FNSA 2PWDA 4ECXA 2HS6A 5HK4A 2NUXA 4JTSA 1JPMA 1DE5A 1QI0A 1E6SM 3HO8A 4QS6A 3CM4A 3CUFA 1KGWA 5FEZA 2V3DA 3LXAA 5A8NA 3W81A 4GGBA 3UZZA 3CWOX 5B7YA 1FOBA 1EH9A 3NL5A 2WTFA 3V3WA 4MOZA 5I5RA 4J9OA 7REQA 1CLKA 1YKWA 3N73A 3VXGA 4JIPA 2VGFA 3W72A 2EKCA 1L2UA 1DJZA 2J7CA 5AC5A 1OGSA 3CUXA 3EX3A 4KGLA 2BSLA 3H24A 3PB2A 2NQJA 2GGIA 2VZUA 2VC6A 3IIVA 4IFKB 3QOKA 1XIMA 2INFA 1Q7QA 4H9ZA 4MB3A 4DJDA 4JQ4A 1F3XA 1E4NA 2D20A 4N6EA 2ZICA 4A4AA 3GYCA 4RNHA 3NURA 5G2HA 3AHXA 1Q65A 4FNQA 3GXFA 4GUGA 1S3HA 4AW7A 3SY1A 4R88A 1RJRA 1GHRA 5I3KA 1WUFA 5BOEA 2WMHA 1VS1A 3O06A 3EDEA 3DYMA 4US6A 4B9YA 4LAKA 4MDPA 2D73A 4G8TA 1A5BA 1X1ZA 1K9DA 4L9YA 4KEMA 1EYEA 4HCLA 3WFZA 3PTQA 1TE1A 5RUBA 3TW9A 1SSGA 3L21A 1VLWA 1EA0A 2NVAA 3GHUA 2XSAA 1SO3A 2ASJA 3ELFA 3FLUA 3GG0A 2WC3A 4IISA 3O9NA 1NDVA 4UR8A 3ATYA 4Q4SA 5DANA 2OVLA 3RGTA 4IOTA 5D09A 4DWSD 1F3EA 1R85A 4DJFA 3QGVA 4S3DA 3B0XA 3PP7A 2QKFA 2AQWA 5CC5A 3G1SA 4A3YA 1A4LA 1XISA 1MEIA 4O3SA 1PZ1A 3OO2A 2BNJA 2GDUA 1EBHA 1DP0A 3B97A 3MUXA 4C6LA 1TPDA 1BWKA 1MI3A 2JEIA 2PTWA 4UQ9A 4W93A 1XQLA 3G1AA 4EAMA 1PKYA 4HBKA 3IV3A 4P5UA 3BQ2A 1RALA 1FY6A 1I4NA 3GAKA 2ZRYA 3SECA 4ED2A 4YWSA 3VDAA 1R86A 4UC5A 3IVUA 2W61A 3WK2A 3SIMA 4BF7A 2ZXBA 2XGPA 1KO0A 4FF7A 3LCFA 3ZXWA 2NX3A 1Q6GA 5EDWA 1UKSA 1E1CB 3IJIA 3UXKA 4ATLA 4HOZA 2X1IA 1O5KA 4LH8A 1T96A 4GFSA 2ACSA 2XUCA 2QYGA 1O66A 4F4XA 3HBLA 4AX7A 2ODOA 4MJMA 1E5JA 2E6FA 1S5WA 4QLKA 1KM3A 5ABFA 3C61A 2CLLA 2ATMA 1SW3A 1TV3A 1DJYA 1UD8A 4E3TA 4QP0A 1TX2A 1FWNA 1R2RA 1UCWA 3WF4A 2V82A 1EIBA 3KRSA 1LL7A 2WPGA 3G1VA 4E38A 3SB0A 1D2KA 3LCHA 1DJQA 2FHCA 2C28A 3D5HA 5KETA 5CBIA 1GHSA 4S3EA 2Z1SA 5H2ZA 6XIMA 3GIPA 3RX3A 4G6CA 3WG6A 1XP3A 4HSNA 2P9BA 2BQRA 4Z0JA 1NY1A 1TWSA 5D38A 1XFCA 3W7GA 3CYJA 5C71A 1NFBA 3G6LA 1FHVA 1FWEC 3ITXA 3GHRA 1LROA 1G67A 4CD5A 1O5XA 3EOLA 2G95A 3H2MA 4ZXLA 1BF6A 4Q8VA 4GIEA 3W2NA 1GYMA 3EPMA 7TIMA 1LLOA 4WGXA 3K4AA 1FH7A 1M5WA 3M46A 4OFCA 5KSWA 1RQBA 3ITLA 3VGFA 1FXPA 4IIGA 2J6VA 3W00A 2B4GA 3MUY1 3PBYA 4HK6A 4IXXA 3P0WA 4NILA 1H5VA 3RB6A 1CT5A 2BWGA 1OFDA 1OYCA 4PODA 4ZFMA 1GPWA 1H3GA 5A6MA 3AC0A 3D3FA 1QO2A 4BI6A 3BLFA 1FWJC 1TWWA 5DO8A 1JZ2A 5DRCA 2ZTJA 4ZMGA 1LWIA 1TA3B 1V93A 1FWWA 3L66A 4GZJA 2CITA 1EF2A 4AHOA 1DXIA 3F5LA 5D2VA 1WV2A 3CUIA 4LAOA 4OUIA 1ZU8A 3HFTA 3NAVA 4C6QA 2GUYA 2BVWA 1KD0A 5C5YA 3O6YX 2D69A 2VR4A 4B3KA 5MHBA 3UXIA 2C22A 3PSVA 3OYXA 4H7VA 1EDGA 4CNOA 1FWHC 1QT1A 1XLEA 1OHLA 5EL1A 3KHGA 4O52A 3UT0A 2C1GA 4PB4A 3MI2A 3MUZ1 2OELA 4C5YA 4WCJA 2Z2UA 2ADAA 4OBTA 2DUZA 3GNRA 3N3MA 1KKOA 5BWFA 2BR0A 1QHOA 2J9YA 3MSGA 2PGEA 3TJIA 1XDLA 1JGIA 1V79A 2XISA 4F0HA 1G6CA 3T2QA 4LUIA 4HTYA 4PB5A 4YPJA 3H2OA 1S2AA 4DBWA 2OSYA 3EA2A 4J3UA 1TTIA 1X6UA 2PDCA 2P3EA 2XIBA 1UQZA 3T0AA 6XIAA 3E02A 2Z29A 1Z89A 2ZA1A 5F4XA 4PTWA 4D8LA 5AHMA 1JRBA 3M0XA 4JQ2A 1DE6A 1CTNA 4GC3A 1GZ1A 3GX9A 3KLKA 2XVGA 3NL6A 2IXUA 3U5UA 3WJWA 1XSKA 2XIOA 3CPRA 3L4YA 1XLDA 2A0NA 1XYBA 1Z7AA 3V0SA 1U2YA 2YL9A 3M16A 2GJLA 4EXQA 1RPXA 1SQ7A 5JUVA 3WQPA 2EPMX 4UUIA 6REQB 1YXDA 3EB4A 4MGGA 3GH5A 1P0KA 2OSXA 3BGAA 4AD3A 5HWMA 1QNOA 3O6AA 4EF9A 4MFDA 4H01A 3QJAA 4E5TA 4MVAA 4NUWA 3VUPA 3L0KA 1H7PA 1ZBWA 4KERA 3W2MA 1PWLA 4AIBA 1XIDA 1L2QA 1AJZA 1E0VA 4UZUA 7ODCA 3UERA 2Z25A 3P5ZA 2VJXA 3OIXA 3LA4A 3URQA 2VTFA 2W7OA 5BNKA 5E1QA 3AMCA 2QCNA 1W0MA 1XYAA 3VD7A 4BKNA 1OB0A 4L4LA 3EZ4A 2OKTA 3THDA 3MCNA 3GO2A 5HUPA 1ZAJA 2Y5EA 8RUCA 4JTJA 3GTNA 1IIGA 3OVQA 4ENLA 3P81A 3CMGA 2NX1A 4W7WA 4LGXA 4GRSA 1M7OA 1DOSA 3W53A 3D6NA 4DXVA 4FHAA 3W7QA 3CL8A 4CD8A 4FS2A 3BE7A 4ECTA 4J2MA 2E6YA 1AH3A 1KBBA 4J9SA 1JDDA 2Y63A 4AF0A 3IRSA 3VD9A 3A4WA 4MKSA 3NQ8A 4AC1X 4JTDA 3UGRA 1QUMA 2XN2A 1ZPTA 1GORA 4JN7A 2OQYA 4JN6A 4MB4A 3HIJA 3WQGA 4ZQRA 4M5PA 1SR0A 1VCGA 1UD3A 1PAMA 1VP5A 4I6KA 5CPTA 5AECA 3PUGA 3B9NA 3WBEA 4A2SA 4WRHA 3M5XA 5KT2A 2X1RA 3S1WA 3LHYA 2CEQA 2WCGA 2P0IA 1VQTA 4QEHA 4O3PA 1T41A 2PUZA 2OKOA 4PB3A 2Q02A 4ZO8A 5A6BD 4IG2B 1FHLA 1HQTA 3GR8A 2PTDA 4PN2A 4WJEA 1UB3A 4G7FA 4UOZA 5EA9A 2Z2AA 1S10A 3ISIX 2I57A 3AHTA 4MJ2A 4QIUA 3QEZA 4RK8A 5HOSA 1KBLA 4ZTXA 5BXSA 2VD8A 1J0KA 1OCNA 5KG2A 1XDMA 4U4MA 3TFCA 1UOKA 4RV8A 2HWGA 2XZ7A 3UG4A 4US5D 2J27A 4Q8PA 3QYSA 4HYWA 3N6HA 3RO6A 1RJPA 3ARRA 1VZWA 3FCPA 3OLGA 3H21A 4OZOA 1W8SA 1HVQA 2V5BA 4TQRA 3S9YA 4CVUA 3S42A 1AZ2A 3BLLA 3G3MA 4RXFA 3C2EA 3SCTA 1UA7A 1JPHA 1LF1A 2OX4A 3FJ6A 4AVOA 4AIUA 1YYAA 4N02A 3SO7A 1JEZA 4IGHA 5EB8A 4OBRA 1KC7A 2RKXA 2BY0A 5KFCA 3TSBA 5K9XA 5DG7A 4UMAA 4RZ6A 1YDYA 4I6VA 3H26A 1ECEA 2WV8A 1M6JA 3CQHA 1EPXA 2DVUA 1YXCA 1UWIA 4YLWA 1RJQA 1I2QA 1MNZA 3ME3A 2HPIA 3EEGA 5KFFA 4Z42C 1A4MA 1NELA 4PFHA 2NUWA 4PFMA 1R3TA 3HPXA 3TYCA 5A6TC 2CC0A 3ZT5A 5DMNA 5EYWA 1W5QA 2PF8A 1MWOA 4BI5A 4CN6A 1SFJA 5C2XA 2W9MA 5IOBA 1KCZA 2BOGX 3MV01 2I56A