4CQBA

The reaction mechanism of the n-isopropylammelide isopropylaminohydrolase atzc: insights from structural and mutagenesis studies
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
402
structure length
402
Chain Sequence
SKDFDLIIRNAYLSEKDSVYDIGIVGDRIIKIEAKIEGTVKDEIDAKGNLVSPGFVDAHTHMDKSFTSTGERLPKFWSRPYTRDAAIEDGLKYYKNATHEEIKRHVIEHAHMQVLHGTLYTRTHVDVDSVAKTKAVEAVLEAKEELKDLIDIQVVAFAQSGFFVDLESESLIRKSLDMGCDLVGGVDPATRENNVEGSLDLCFKLAKEYDVDIDYHIHDIGTVGVYSINRLAQKTIENGYKGRVTTSHAWCFADAPSEWLDEAIPLYKDSGMKFVTCFSSTPPTMPVIKLLEAGINLGCASDNIRDFWVPFGNGDMVQGALIETQRLELKTNRDLGLIWKMITSEGARVLGIEKNYGIEVGKKADLVVLNSLSPQWAIIDQAKRLCVIKNGRIIVKDEVIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE
publication title X-Ray Structure and Mutagenesis Studies of the N-Isopropylammelide Isopropylaminohydrolase, Atzc
pubmed doi rcsb
source organism Pseudomonas sp. adp
total genus 162
structure length 402
sequence length 402
chains with identical sequence B
ec nomenclature ec 3.5.4.42: N-isopropylammelide isopropylaminohydrolase.
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 4cqbA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4cqbA02
2VR2A 3A3WA 1FWGC 4CNUA 4RZBA 3URQA 4GY0A 4JOMA 1FWAC 3ICJA 1KRAC 4LAOA 1EZ2A 4KEZA 4DNMA 2E25A 4GX9A 4H9XA 1FWDC 5E5CA 2QPXA 2UBPC 3OQEA 4IFOA 2P9BA 1YBQA 4GX8A 4DZHA 3TN3A 4R85A 2P53A 3LU2A 4HJWA 2CZVA 3TN5A 4C6JA 4KF1A 2W9MA 3GIPA 3WYZA 3K4WA 3F2BA 4LCSA 2OOFA 4CNTA 1JGMA 3MDWA 1V77A 2DVUA 4MUPA 3RN6A 2WJEA 3FDKA 4IF2A 2G3FA 2Z29A 4C6KA 3LSBA 1GKQA 4AC7C 1W1IE 3D6NA 1ITUA 3PNZA 1J6OA 4C6CA 2Z2BA 4UB9A 3NQBA 4LAMA 3K2GA 1RK5A 4DI8A 3ITCA 1EJVC 1DPMA 1EYWA 3MVIA 4H9YA 2R1NA 4C6BA 3GIQA 4DO7A 4GOAA 2A3LA 5G4HC 4V1YA 1QXLA 3TN4A 2UZ9A 2DVXA 2Z2AA 3V7PA 4CQCA 2R1MA 2WJFA 1PB0A 3GU2A 1EJWC 1RA5A 3R0DA 3TNBA 4GYFA 4KEVA 4ERAA 4PE8A 1RJRA 4C6QA 1EJTC 2R1LA 3F2DA 3MTWA 4GY7A 4TQTA 3ISIX 2BGNE 3URNA 1A5LC 3SFWA 4EP8C 1BF6A 3GTHA 4DI9A 3DC8A 3OVGA 4IGMA 2OQLA 1FWBC 4LAKA 1A4LA 1ITQA 4P5UA 3SO7A 3O7UA 4GXWA 3AUOA 1FWJC 1KRMA 3RYSA 3S2NA 2VUNA 3FDGA 3LGDA 4ICMA 1S3TC 2PGRA 2XIOA 4EPEC 3NEHA 4RDYA 3PBMA 4IFKB 4PCPA 2EG7A 4H01A 1R9ZA 1FKWA 1XGEA 1A4MA 1NDYA 2GOKA 3WMLA 2PUZA 3AU2A 4XAFA 2I5GA 2FVMA 4E3TA 4XD4A 1WXZA 4J2MA 4IFRA 2I9UA 2HPIA 4LEFA 5HMEA 4CEXC 4LFYA 1EJUC 3GU9A 4WGXA 3IRSA 1WXYA 3GTFA 5CH9A 3UR5A 4L9XA 4G2DA 4IG2B 4HK5A 1V79A 2D2HA 4H00A 2PAJA 4C6EA 3AU6A 4KERA 2HPMA 2QS8A 2E1WA 2HBVA 4BY3A 1V4YA 3MVTA 3QY6A 4IFKA 4YIWA 3GGMA 2VC5A 2WJDA 4QTGA 4INFA 4NI8A 4GY1A 4KIRA 3LNPA 4H9VA 3S2MA 2F6KA 4ERGA 4C6FA 4QS5A 2AQVA 3QY8A 4C5YA 5HMFA 3E0FA 4WHBA 1R9YA 2HQAA 4R88A 4RDZA 3OOQA 4ZSUA 1E9ZB 2Z28A 1NDZA 4OFCA 3UF9A 4C6MA 3MPGA 2P50A 1RA0A 1E9YB 4B92A 2PLMA 1UIOA 3URBA 3E38A 2O4QA 3T81A 2BB0A 2IMRA 4QS6A 1UBPC 2ADAA 1M65A 1RK6A 1XWYA 2Z25A 1EF2A 3UR2A 4C6IA 1M7JA 3G77A 5HMDA 4M51A 3T8LA 1EJXC 4GK8A 1PO9A 4IQJA 1O5RA 4QROA 1V7AA 4EPDC 4ZSTA 3CS2A 3LA4A 3QGKC 2Z24A 2ZC1A 2AQOA 2RAGA 4KETA 2Z26A 4DLMA 2R1PA 4RDWA 4AQLA 1NDVA 3K5XA 1POKA 3BE7A 1ONXA 3S2LA 1YMYA 1FWIC 2WM1A 3IACA 3F2CA 1YRRA 4LCRA 3RHGA 2OB3A 2FFIA 4DIAA 3T1GA 1A5NC 2Z7GA 3E0LA 4H9MA 1O12A 2GWGA 1YNYA 3E2VA 4IH3A 4XAZA 2EG8A 1FKXA 4F0LA 1P6CA 3E3HA 3MDUA 1XRFA 1GKPA 4GZ7A 4C6PA 3MSRA 1EJRC 2FTYA 3LSCA 4V1XA 4BJHA 3MJMA 3C86A 3HPAA 4XAGA 1P1MA 3DUGA 3OODA 1NFGA 2O4MA 3KM8A 5AKQA 3EWCA 1FWEC 1KRCC 3HM7A 4XD5A 2YB4A 3HTWA 4KQNA 4XD6A 1KRBC 3A3XA 4KESA 1A5KC 4LANA 2YZ5A 3CJPA 3S4TA 4CQDA 2Z27A 3GTIA 1PTAA 3B0XA 2VC7A 1I0BA 1KCXA 3GRIA 1FWFC 3JZEA 1IE7C 1ONWA 3IPWA 1I0DA 2HNHA 1K6WA 4QSFA 2PGFA 4L6DA 3EGJA 1A5MC 3QGAC 3B40A 3ID7A 1R9XA 4CQBA 2AMXA 3DCPA 4J35A 4H9UA 3NURA 4B3ZA 4PCNA 1V51A 3UPMA 4ERIA 4GBDA 3LY0A 1PSCA 3TN6A 4I6VA 5A6TC 2Z4GA 4CEUC 4C6OA 4C60A 2D2GA 3CAKA 1HZYA 4PBFA 2QVNA 3O0FA 4IG2A 3GG7A 3IJ6A 3ORWA 2OODA 2ICSA 2YXOA 4PBEA 3PAOA 4G7EB 5FSDC 3F4DA 1VFLA 4F0SA 4B90A 2EG6A 4KEUA 2VHLA 2QT3A 1ZZMA 3GU1A 2YB1A 4C65A 2DVTA 4DYKA 3MKVA 3QY7A 2GSEA 3IGHX 4BKNA 5FSEC 1M68A 2Q01A 4NP7A 3LGGA 4J5NA 2R1KA 2FVKA 3N2CA 1FWHC 3IV8A 4F0RA 3A4JA 4EPKA 1K70A 4XD3A 2KAUC 4C6LA 2Q09A 4CNSA 3PNUA 4WVXA 2Y1HA 1FWCC 1J79A 2Z00A 1QW7A 4B91A 4R7WA 4DLFA 1RAKA 4QRNA 3IARA 3OJGA 4D8LA 2VM8A 1RJPA 4UBPC 4DZIA 3GTXA 3FEQA 4LCQA 1YIXA 5LXXA 1ADDA 2FTWA 3E74A 3PANA 4G7EA 3LS9A 3WZ0E 4HK7A 3OU8A 2D2JA 4EPBC 2GZXA 4LALA 1EJSC 1J5SA 4XAYA 1UIPA 4LH8A 2HBXA 4RDVA 1GKRA 1J6PA 4HK6A 3S2JA 1POJA 4C6DA 4I6KA 3EWDA 4H9ZA 1P6BA 4C5ZA 3URAA 1NDWA 1YBQB 2OGJA 2ANUA 4H9TA 4HA0A 4RE0A 4C6NA 3F4CA 2GWNA 3RCMA 4IGNA 1A5OC 1XRTA 3GUWA 4Z42C 3UBPC 1UMLA 1K1DA 4GC3A 3B0YA 4NG3A 1RJQA
chains in the Genus database with same CATH superfamily
2VR2A 3PG9A 4ORMA 1P0BA 4DJFC 2V38A 4XK2A 5TF0A 3N2XA 3ICJA 4A4AA 3KTCA 4Y8EA 4RZRA 2ODOA 3SN4A 3CV2A 1XDLA 3W7CA 2YL9A 1G0CA 3M0ZA 4GHRA 4IGHA 1TR9A 1KR1A 3CZLA 4DVOA 3O6CA 2DFAA 4JV2A 2AGKA 2NVDA 3ARZA 4ENLA 1G94A 5CSRA 3B4YA 3GHSA 1MW3A 1OWQA 2HVMA 1XLGA 2WKGA 3TN5A 3WYZA 3K4WA 1VENA 3PR5B 1VEOA 3M9OB 3PZQA 2DVUA 1LP6A 2HS6A 4PUWA 5FF0A 1I2PA 1K8CA 1KR0A 4JTTA 1I1WA 3GWQA 1AQFA 3CAVA 4M6VA 1K9TA 3VOGA 2CZFA 3GNPA 1TCDA 3N29A 2VDHA 5AB3A 1UR0A 3GIMA 1DPMA 1QI3A 1VLIA 1AA1B 5HJYA 2UVWA 1BVZA 2REQB 1P6WA 4NZJA 4O8RA 1ZAIA 4DNHA 1QXLA 4V28A 4ZO8A 2A0NA 4ZE5A 2XTKA 1XH0A 3QLDA 5K9CA 3WQCA 1WDQA 1JYWA 1Q8AA 1WKEA 3TYEA 3PW7A 4Q43A 3A4XA 4XZIA 3AALA 5CC7A 1NH6A 4EP8C 4J3ZA 2G97A 2WYSA 3TXZA 3SI9A 4GNJA 3ATZA 4P8UA 3G1HA 3H2MA 5I3IA 1L0PA 5LIUX 3GV8B 3PPGA 5KFXA 3NPUA 3P8IA 2PDIA 1JD7A 3NOEA 3QHNA 2H9AB 3CHFA 3KXQA 3UP8A 3S1WA 4REQA 4XBJA 2VEPA 5CG7A 3TFXA 4JHMA 1DQUA 3VU2A 4WJ8A 4L64A 2BQRA 3U2EA 4IFRA 1LM1A 4LEFA 5HMEA 2CW6A 4ZB5A 5KT7A 4ZEPA 1W31A 1X6UA 3OLEA 4G3IA 2FZNA 1YNPA 3UR5A 1GHSA 1H41A 3AZRA 4F9DA 4UFIA 1IT7A 2QS8A 3GXDA 3A9BA 1GOIA 3MP5A 1RSCA 4GKLA 3H23A 3PW4A 1V93A 4XZBA 1QO5A 3LQGA 4H9VA 2OZTA 4KRTA 4MAZA 3W6YA 1I9CB 1V08A 3E0FA 3KHLA 2XFYA 4YU1A 4ZENA 4DYEA 5DX7A 3TKFA 4O17A 2DH2A 3BAWA 2A1YA 3D47A 3MCNA 4H7ZA 3BLIA 3BL3A 4PA8A 3EX4A 5KEZA 4OT7A 1RK6A 1XWYA 4KEMA 5DF0A 2P5NA 3HJZA 2EJAA 3AMGA 4O13A 2G37A 5M1TA 1PKMA 5HULA 2OH2A 1SW7A 4M5PA 3E0WA 2YDSA 1C8VA 1NDVA 3M5ZA 2ZRXA 4A05A 2ZRUA 1SFJA 1W1YA 1PDZA 1WYIA 3UR7A 4NX0A 4LVGA 4O4WA 3F2CA 3P0WA 4OTKA 3T1GA 1W9PA 1H61A 4H2CA 4XISA 1XSJA 1EHNA 2W66A 1C29A 4HNVA 3UD6A 4I3GA 3WH6A 1GKPA 4MMWA 4RXFA 3MSRA 3LCFA 1ZJAA 4MB5A 4RLIA 8A3HA 3I3BA 1VJIA 3QKZA 3LRMA 4U7CA 3KHRA 5KFAA 4S38A 1V0NA 1CPUA 1Q2RA 3I68A 3VIGA 3T7VA 3VOHA 2YL8A 2V5JA 5DBUA 1Q4WA 3N6HA 3P2VA 2CLPA 3DFSA 1K9FA 4LS2A 3PR2A 3GG8A 1FQ0A 2OLAA 2PDUA 2VDGA 3RAXA 1BGAA 3KDNA 4CNNA 5BXTA 1VFMA 3WQOA 3GRIA 3AIUA 2X0YA 5LA2A 4AZHA 4GINA 2VVNA 2NQ9A 2VZOA 4IZGA 3BGJA 5A6SA 3LXCA 3OPSA 1OG0A 3N18A 5M2FX 1XW8A 5EMUA 4HSNA 2XM2A 3ID7A 4OKDA 5KETA 3B9DA 4KH2A 4IUGA 4DQWA 4H9UA 4ZFMA 4JN7A 4ZB2A 3HBLA 4I6VA 3OZPA 4ZOBA 2V2CA 3O0FA 5KITA 3NSMA 2ICSA 3BK0A 1XRSA 2W92A 3GH5A 5AC4A 1OC5A 1CGUA 5FD0A 3BCDA 1R38A 1ZZMA 3I10A 1SYTA 1XLHA 3ANVA 4HVXA 4GQGA 2YBVA 3SCSA 2QF7A 2C13A 1ONRA 3QMTA 4BKNA 1M68A 4B5NA 3EXTA 1US3A 3LGGA 5DT5A 3RG6A 1YXDA 3NZGA 1UZHA 2A6NA 1QBBA 4U2ZA 4CNSA 4DLFA 1BKSA 2CLIA 2H8ZA 1J12A 4JN6A 3OJGA 2CLLA 4IQEA 2A3BA 2W63A 4UBPC 1OYAA 4Y96A 5F1UA 5CKSA 4PGLA 3G22A 3CQJA 1QNRA 3LS9A 3OU8A 3GQYA 1OX4B 1DVJA 4AXKA 7ODCA 1D3HA 3KW3A 5HAOA 1DJZA 2Y88A 4LB4A 3VGBA 3CQIA 3RUBL 3TIMA 1TRIA 4GZEA 3GH7A 4NSBA 2PS2A 1KBLA 5GNZA 1UUMA 5EU9A 1I75A 3TDFA 3AWNA 4PEKA 4MZ8A 1AH0A 3TAOA 2YYTA 3P14A 1W3LA 3A21A 3GYCA 3CZGA 1LQ2A 1TFVA 3WSUA 1QWKA 1CCWB 1UWAA 2V0TA 1V3MA 3PZVA 3DH7A 1XLBA 5GVJA 1XGDA 3TQKA 4ZQOA 3SIMA 3ZSSA 2QPXA 5G1YA 3L9CA 4PCFA 3BGAA 1ZBCA 7XIMA 1A49A 4CNPA 2A3CA 2NSOA 4DB7A 4NJJA 5A94A 2V9DA 1WKYA 4QWBA 4A2RA 1XS2A 1M01A 3CHVA 3KRBA 3RN6A 2QCGA 5HDRA 4OECA 4X9SA 5D2WA 4N9DA 2G3FA 1M04A 1GKQA 4YQWA 4AD2A 4U31A 3D6NA 4ECTA 1DJXA 4MPQA 2OEJA 4JICA 5C7VA 1UWSA 3NQBA 3L4XA 5CGQA 3W37A 3WY1A 4B5SA 3W84A 5I24A 3PR4A 3K2GA 1KBJA 1EC9A 2ZE0A 3MBFA 1F73A 5A2AA 5G1MA 4JTUA 4PC8A 4F4WA 3POHA 3EX6A 4V1YA 3V16A 4WIWA 4NF7A 4FR1A 4DJED 1LDCA 1J11A 4UR8A 1GQIA 5I03A 2YPIA 3OLIA 1EYEA 3QLLA 3NZ1A 3EWXA 2DP3A 1A5CA 1QPOA 1DTUA 4L9YA 2J62A 4IGMA 1DXIA 4BI7A 1AODA 1ITQA 1E43A 3H26A 2QVHA 2C18A 1EEPA 3C52A 1EP1A 4TMBA 3RLUA 1NY1A 1KRMA 2EHHA 4ED0A 4Q8MA 1UC4A 3WNNA 1PTGA 3WQPA 1S3TC 5F1VA 4JKMA 4NJIA 4RUCA 2QF8A 3FIGA 7REQA 2BHUA 1ZHAA 2HE5A 4AVFA 1E4NA 3KL0A 4YWIA 4W8LA 4DX3A 3HGSA 1Q65A 4LV4A 1PX4A 5FAGA 3LYEA 3N04A 3N2BA 2GOKA 3I4EA 5KFZA 4CD6A 3AISA 3EKLA 1LTDA 1WXZA 2QJMA 4LOCA 1DJHA 1CGXA 4GQBA 1TZ9A 2XWEA 3QW4B 4M1BA 3IK2A 5FF4A 4TO8A 3WIJA 5LA1A 4H3DA 4AZCA 1EWEA 1I2OA 4KRZA 4FX7A 4Z1CA 4AUBA 1DE6A 3QSRA 3BZJA 1X1NA 5FF3A 4DUVA 3HZ3A 3HQPA 5KFCA 3O2LA 4ORIA 4INFA 4GY1A 1U1HA 1J2BA 5J5DA 4J9MA 3DC0A 4D6DA 5FEWA 4W8BA 3MQTA 5EMJA 1DWIM 1LL7A 4MHBA 2J6XA 3EDKA 3MHFA 4MWAB 3DHFA 4JKLA 1ZBKA 4WRHA 1O7AA 3G6MA 1W3HA 1DL3A 1NDZA 3GFZA 4K8GA 5HNUA 4MPKA 4LC6A 3VFLA 5A95A 2J7FA 1T40A 5HNNA 3P62A 1E0WA 3AXIA 4MJ4A 3GXMA 3GVGA 4P7OA 3PPHA 2CBJA 3QHMA 3VINA 3ZIZA 3UR2A 4F2UA 1G7UA 3GVVA 4JHZA 2AAMA 2EPHA 1XP3A 4AXNA 4LUIA 3H2AA 4EXBA 3WLRA 4A29A 4W4QA 4R34A 3UXLA 5KZEA 2Z26A 4FBUA 2QCEA 5DXXA 1T99A 1NWSA 3SDOA 2A21A 1R86A 3S2LA 3TJIA 2CWNA 3MR2A 3TFCA 1E4IA 1GW9A 3INPA 3IV3A 2W9BB 4Z2GA 4QG9A 4K3ZA 5E9AA 4DBUA 3HF3A 3FW6A 4DF1A 1IT0A 1LOLA 1ZJIA 5EYWA 3S9YA 3I7SA 3RDKA 4XTDA 2GJRA 1VGAA 2FZBA 1OIMA 5D9OA 1BRLA 1TPB1 4DEZA 1U30A 4C6PA 4NAFA 2PU1A 4O3NA 3PC0A 2OKTA 5FCZA 1UD2A 2DY3A 3PSWA 1GVRA 3LI0A 1BEUA 4JFVA 3HPZA 5LXEA 2J8FA 4GI6A 1LF1A 2FGLA 3BG9A 4FHAA 2WNZA 1JDDA 1KRCC 3N6JA 1V6XA 1R47A 1JVNA 4ZCWA 4JTCA 4LANA 5AC7A 3CJPA 1DYSA 1WV2A 3GYEA 4EAMA 5HR7A 3REQB 1WDRA 4Z0JA 3NZPA 2J78A 1KCXA 1BYCA 3BQ0A 1XHGA 3XINA 3R58A 3VVGA 1DHPA 2NX1A 3RGTA 1EDQA 2BFGA 3QMSA 4P8WA 4L6DA 4F4XA 1E1EA 1UWTA 1Z42A 3BSMA 3MKCA 1F6PA 3QH2A 1K1QA 3RAOA 3WFLA 2AMXA 3BAJA 3LV6A 3B9OA 4KIEA 2X09A 4GBDA 2OU4A 4IIHA 2QZRA 4MJZA 4XWUA 4KWWA 1HJSA 3KWXA 4FOJA 3M6DA 1LG1A 5KFGA 5DQIA 3RAQA 3CAKA 3F4VA 3WELA 3CTTA 1E6NA 4OVXA 3W02A 2AGQA 5TD4A 1U5HA 5KFOA 3PAOA 3S6OA 1K9DA 3QR0A 5IBXA 2V5LA 5DANA 5EPDA 5BXPA 2HVNA 4WDXA 2VELA 3PJTA 4RL3A 1TPC1 4GRSA 5HQEA 2WXDM 3COTA 2PDGA 3PZPA 2ATLA 2Q01A 3QYSA 1J93A 3N6QA 4NP7A 3N9RA 2WZEA 3SQMA 2E1DA 3DKJA 2V63A 5XIMA 3B0UX 4QEHA 4MADA 4QXIA 4QDWA 2J7EA 2Y1HA 5DMNA 2Z00A 1A5SA 3PTMA 2RDWA 3RXZA 5I6SA 4DZIA 3TW7A 1HNYA 2QUUA 3SRDA 1V6WA 2PTZA 1ADDA 3TXVA 3MMWA 1QI0A 1Z44A 1VYRA 3OGVA 4Q8EA 3B3DA 1GYLA 3DKLA 4ROQA 3W00A 4MKSA 1VRDA 1F3XA 1X38A 1M41A 1Z7AA 1YNQA 4I6KA 2DW6A 3OA5A 1S2VA 4RE0A 4O52A 4U3AA 2CKSA 4Z1DA 3EDFA 4KS0A 5JIWA 1UZ1A 4PMOA 3CT2A 3MUXA 1UMLA 4XVDA 2CLEA 2AL2A 3A12A 4JN8A 1PKLA 3SCVA 3JW7A 1P0KA 3URQA 4HPHA 3ITTA 3GDRA 4YLWA 4AH7A 1KGXA 2PDLA 2WSRA 1QO2A 3LZ3A 2ZKMX 5FJOA 1UD5A 4UIOA 4F0KA 1TQJA 4AHOA 5U4NA 1ZCCA 5H2ZA 3BSGA 2WKJA 2NQZA 2BG5A 3M46A 1L6SA 3TK7A 4G6CA 1LWHA 2PD5A 3PW2A 2W62A 4R85A 5H8PA 1Q6GA 1PS9A 3ARWA 4J27A 4FNUA 3BLFA 3WQVA 1H5YA 3GIPA 1U1UA 2XGQA 2A85A 2FPYA 3R25A 3F2BA 4LCSA 3N15A 1EH9A 1D2KA 1WDWA 1HKVA 3W1TA 2YLAA 3BW2A 3SCWA 3S9ZA 3NA8A 4HYRA 1S9FA 3NL6A 3BCFA 4GQRA 4G5DA 5ENLA 2WMIB 2QW5A 3BOFA 3FEMA 2XCPA 3L2LA 3W7EA 4I9JA 3MP4A 3CYVA 1E0TA 1Q63A 2A3LA 3JVAA 2UZ9A 1YPIA 1VH7A 3V7PA 4J9LA 3M07A 4MFDA 3FOKA 4X60A 5I3GA 1G01A 3DYOA 3OEXA 2ACUA 2QCFA 3OA3A 4PFHA 1DQXA 2ABBA 3E9AA 4G9PA 3FLUA 1X6LA 3S3GA 2ZZ1A 3SO7A 4GO8A 4DWSC 1H1NA 3ECQA 2V3GA 2E6DA 2VUNA 4UFJA 3LGDA 1YPFA 4PUDA 4UUIA 4EOUA 4ILSA 2WZIA 2YJQA 4RNFA 4UTKA 1S1RA 4RDYA 2C14A 1A0EA 4AFYA 2GGEA 1M6JA 4J9PA 1R9ZA 4GNVA 2YDQA 1NDYA 1XIDA 3G1DA 2NQ5A 3WMLA 3ZYZA 3T5KA 3CHEA 4BWLA 5FIPA 4FNSA 4CEXC 1F3TA 4JX6A 1UZDA 1AZ1A 1E51A 1LG2A 3L0GA 3W2MA 2PMQA 3IIPA 4HNTA 1G5AA 1YX1A 2NV1A 4OBSA 4HQVA 4Y2WA 2BY1A 4GFIA 2VFGA 4C6EA 5C54A 2VFEA 4KERA 3KTSA 3W86A 4FS1A 3W07A 1LLWA 3W7QA 2INEA 3GFYA 3RB0A 2WKLA 1UUQA 3TTQA 3KX6A 4M81A 4L1XA 4DEFA 1H1YA 3JRKA 1PZ3A 1SMDA 3HN3A 1GGOA 2WW5A 1XIIA 4QG8A 3NSNA 1E40A 3H53A 1ZPTA 1K4GA 2OSXA 2A79A 4HU3A 3WLOA 1E9ZB 1MUMA 4ONVA 1RA0A 3NNTA 4WF7A 1A5AA 4GZJA 2F38A 4ZTXA 1KM5A 1GK8A 4OZOA 2FJKA 2PCQA 4QR6A 2JGQA 3EPMA 3GX9A 4H19A 4EACA 3U48A 1EF2A 3P93A 3L21A 3T8LA 5IDZA 5GQBA 1R6WA 3LG3A 1LJYA 2PC4A 2VUYA 3L12A 2QGYA 1E6PA 3SUUA 3C8FA 1JG9A 3G2GA 1A3WA 1Y5VA 1DJWA 5D2VA 3NO5A 4YVVA 3WJYA 4XAPA 1I2QA 2ZA2A 2ISFA 1FCVA 3Q65A 2OB3A 5AHFA 4QW9A 3B97A 2CYGA 1NIUA 3E0LA 3GNRA 2ZCGA 2QR6A 2YCKX 1BSIA 4IH3A 2JF7A 4KWUA 3W1NA 4W7VA 3E3HA 3MDUA 1JAKA 1EUAA 3GV5B 4U6PA 1XIFA 2NX3A 3NZRA 2ZXQA 2XGIA 3O63A 3VGGA 4AY8A 3O0KA 4Q7BA 2GGIA 1HJWA 3LZ5A 2VT0A 3GXPA 5FESA 1E55A 4BR1A 2X8RA 5D02A 1W9XA 4LPCA 1O5QA 5HJXA 4CD7A 5IM51 3HTWA 3GIIA 2QUNA 4H8HA 1X8FA 3LHVA 3M0JA 4MKNA 1JDFA 2X05A 5I06A 1CDGA 5JH1A 2UY4A 2VWSA 3AS3A 3PFRA 5KMYA 4E2VA 1G9HA 1BTCA 1K6WA 2NT0A 4XZ9A 1XD1A 4GIRA 1NELA 3HA1A 2GQ3A 4G1NA 3BO9A 3M0LA 3KS6A 3TYBA 3TC6A 3QV6A 4KFOA 4DJFD 4NY2A 1REQA 4PCNA 1Q6LA 2AQ4A 1SJCA 2VEFA 2W0UA 3ZLHA 4ZMGA 3KEHA 2J4GA 4L6HA 4LB3A 2WQDA 4QJ3B 1I2RA 4IG2A 5FJRA 1GYNA 3AHXA 3ALGA 3OG3A 4QNWA 1J0YA 4Y8FA 4E8CA 3ZVIA 3VD3A 3KLKA 1KM2A 4ADTA 4J5NA 2BOGX 3SFKA 1DXFA 3BAKA 4NIRA 4XD3A 4C7FA 2DEPA 1KKRA 2J7HA 3HGOA 4PTNA 4PUEA 4BI5A 2PBGA 4JUZA 3BQ2A 2WM0A 1QOQA 2WVUA 4REQB 3GAKA 1I6NA 1UHVA 2VM8A 1CBGA 2QLYA 3LCWA 3PPFA 4F2TA 5FAJA 1MEWA 2XC9A 2YW3A 4FOKA 4ZO7A 2ISDA 4JEJA 4EPBC 2E5BA 3H2CA 3IUHA 3SUSA 1J5SA 3Q94A 1UIPA 2DUXA 4QX4A 3ABQA 5DCDA 4EYHB 5DT7A 3HURA 1NDWA 3KVKA 4ALDA 2PLCA 4J7RA 2CBUA 2CHNA 1JNEA 1OYBA 4GXPA 3OSNA 1XPGA 3ZT6A 1MYRA 4JXCA 1KXVA 2ZE3A 3OQ8A 1ZL1A 2EAWA 2V3EA 3L2IA 4CNUA 2J7CA 2FGBA 1TQXA 3WLKX 2PF0A 2VL4A 2XH0A 2P3EA 3DG3A 1RCQA 1UYQA 2DPIA 2YXXA 4KEZA 2W6RA 1BVWA 1TV7A 4FS2A 4H9XA 3GS6A 1T41A 3APGA 3NFUA 1W1A1 3PP7A 2IKHA 4DZHA 4Q4QA 3TN3A 2EBNA 3LU2A 4C1KA 2CZDA 2A6LA 1FWTA 2CCRA 4HP5A 4XBKA 3IAPA 2DIEA 3LCGA 4MUPA 1FH7A 5I3DA 3NQGA 4S3EA 4W86A 3CUIA 5DGAA 2B81A 4JDBA 1IM4A 1XR2A 2ZX6A 1ZB5A 5FKYA 3FNDA 1K6AA 3ATYA 2YW4A 3S5NA 1C8XA 1PHQA 3MVIA 2Z2UA 2XGZA 1J9YA 3BQ6A 2JEIA 1TTPA 4I5XA 4W84A 4HZ8A 1XBYA 2OJPA 4LS0A 3BJTA 3AJ7A 4ED3A 3P5ZA 3GW0A 3PTQA 3B05A 1M7OA 3VKCA 3SCRA 1R2RA 4A8RA 1IYXA 1IXNA 1G6CA 3A4AA 1W9BM 4TQSA 3V6HA 1T7LA 4B9ZA 1JAEA 4ZGYA 1TZZA 3GNOA 4C6QA 1FFRA 2R1LA 1A5UA 3MTWA 2J6UA 3ISIX 4MLJA 4HNLA 1XYBA 2NZLA 4LAKA 1HO4A 2ZQ0A 1S5WA 4KGJA 2DSUA 1KTCA 3EPNA 2F9RA 4NQ1A 4ZOCA 3T2PA 3V4BA 4PB5A 4EE9A 1W2PA 1AD1A 3T55A 1J96A 1JFXA 1AMKA 2PGRA 2XIOA 2TSYA 3WEMA 1XCWA 4ICNA 1CLXA 1DJNA 4ZOAA 2PZNA 1HVXA 2QUVA 1HJUA 4XIAA 1QT1A 2WLZA 3TX9A 1HX0A 2OZ3A 4HMNA 1T96A 4YVXA 1EJUC 4KKXA 1HP5A 4JIQA 1LCOA 1WXYA 2HMCA 3V0SA 3GILA 1DBTA 1JQXA 1PV8A 1JRCA 3LBMA 3SY8A 1V79A 1VFTA 4E38A 2NV2A 4QE4A 2J7DA 3K1GA 4O28A 2CIPA 3GGMA 2OO6A 3WBXA 7ENLA 2BSLA 1TJ0A 5DRIA 3AYTA 3W7OA 2O9OA 3ZJKA 4JTFA 1BG9A 1BGGA 3B8VA 4UQ9A 2X16A 2PTYA 4UTLA 1KXQA 2I7GA 2VGFA 4OUIA 4PB3A 3L4TA 2HQAA 4D8AA 1JZ4A 2QCMA 5DQPA 1IIHA 1UBSA 5DG7A 1GPWA 3CMGA 4EF9A 3UERA 4HOXA 3L7RA 2QCLA 4XKYB 2BB0A 3C8NA 4QS6A 3A47A 1M65A 4UTTA 3FVMA 5I7GA 3ZFHA 1UB3A 1HL2A 1H49A 2Y0FA 1NM9A 2PSNA 3S47A 3EMCA 2TRSA 3LPGA 3FA3A 4FIQA 5FF2A 5IDIA 1UG6A 4I90A 2VFDA 2OMAA 1XH2A 1SZFA 4GH3A 1XQLA 4PZVA 1JCNA 1LLZA 1EGVA 5BOEA 4AG0A 2PDPA 2QULA 4GZIA 4D2JA 2JF6A 4GPNA 4NZ5A 4DPPA 3QVQA 3IACA 2P10A 3DGBA 3TLQA 1RQHA 1A5NC 2YXGA 3ES8A 3N73A 1WBJA 3DFPA 1U33A 2J6TA 3R43A 3E2VA 2XIMA 3IVUA 3VILA 5T91A 3PBYA 3B9NA 2UVUA 2O56A 2EPOA 5C70A 2YA0A 4IX0A 1BFNA 1ME9A 5CBBA 1UR1A 3HG2A 3ZR6A 4US5A 3WNMA 3IJDA 2WSPA 3TR9A 4DBDA 1E70M 3QOMA 3N34A 3EWZA 5DXYA 1G4PA 5FJUA 4KCTA 3AYVA 1O1ZA 2GVGA 4WDUA 3NQ7A 5EB8A 2YB4A 5G2HA 3W1RA 3L0NA 3AYRA 1VFOA 3NGDA 2PDJA 1VEPA 1YYAA 1FHDA 1ZTVA 1FHLA 3B9AA 3VOIA 5L1JA 1ELSA 2WWCA 1JDCA 1GZGA 4QDMA 5DLCA 4NI3A 4EBCA 1PYFA 1J0HA 3IPWA 5TBOA 1TWZA 1C8YA 3H7UA 4HCLA 2QJGA 3GG0A 2BY0A 1U83A 2D1ZA 3BC9A 3WMCA 4IP7A 4TMCA 2A2IA 1Q6DA 3STGA 3DCPA 4FR6A 1QATA 2VR5A 2C0HA 1E6XM 3U57A 3DN5A 2D2GA 2W61A 1P1XA 3BPWA 2OODA 3G3DA 4GUJA 4LQ1A 4QE1A 3PUDA 2NQJA 1G4EA 4GKTA 4F66A 3BV7A 3EXRA 1SO3A 1O94A 3DZ1A 2EG6A 4BS0A 4KEUA 2J9XA 1EXPA 5A8PA 2VHLA 4NNCA 2V5BA 3VIFA 3O1NA 4DYKA 1UKPA 4LEQA 2GSEA 1TELA 4L4OA 2DQWA 1XPYA 5TAOA 4GCXA 1AVAA 3M16A 3WK1A 4F0RA 2O92A 3MUIA 2A7RA 4GVFA 1RY0A 3BOXA 3D46A 1FWCC 1KM0A 2FHFA 1O68A 7REQB 4BK9A 1IHIA 1TPWA 2YDAA 1UPMB 5LXXA 4BQ2A 2XUCA 3I7RA 1J0ZA 2QAPA 4UMCA 2C2DA 5HOSA 2NLIA 2V68A 3AAMA 4P7QA 4XUGA 3QRHA 4N02A 1X7FA 2WLYA 5T26A 1XX1A 3S2JA 3EWDA 4U4MA 2PP1A 2QGHA 2X1TA 3STFA 4EVZA 3CAWA 4FNRA 4RNMA 4H9TA 4P2VA 2QXWA 4S3KA 2J7GA 5JUVA 4R27A 2NX9A 4JFWA 5LIKX 1XRTA 4QW8A 4Z42C 3WLNA 3VMPA 4GC3A 3BJFA 3B0YA 2W79A 3VZXA 4FLOA 1A0CA 2E9LA 3VABA 3BG5A 1EIBA 2YR1A 4RZBA 3B8WA 5F4XA 4JFUA 3IGSA 3F7JA 2E8YA 3G6YA 4DO4A 3ABOA 1B54A 2ZFAA 2GPTA 2VENA 1PDYA 3BLLA 4WZHA 4S1FA 2Y5SA 2VYOA 1X97A 4YTSA 4PYSA 5C9WA 4GX8A 3WQDA 4GNKB 2D22A 1F4AA 5CZJA 3RPDA 1SZRA 1L6GA 3BLOA 1E1FA 1F07A 1V77A 4B2DA 2PD9A 1W9DM 3RCNA 5GJPA 4AYGA 3TVAA 4O1AA 2CU0A 3BZGA 4W85A 2GJNA 3LTPA 2PP0A 3OW1A 3W7GA 3VM7A 4MB4A 2G5WA 2UY3A 4BF5A 4AD0A 4J9JA 5L1LA 3NTYA 2VQTA 1RK5A 3AZTA 4WOZA 4Z08A 2I17A 2DZSA 2YCLA 1M7XA 3CM4A 3W1LA 4C6BA 4US6A 2BMBA 3UWWA 2Y8KA 2ZUNA 1HF6A 2BZNA 3FAWA 4JTHA 2W91A 1AQ0A 3FV9A 3PUGA 1TMHA 3U4AA 5I09A 2WNWA 5F4SA 5E1QA 2XVNA 3UQNA 3IUIA 1ODUA 3QW3A 5GPRA 2VX5A 3P67A 3OBAA 4A22A 4F48A 3KHGA 1IR2A 1H7NA 1VBUA 1W91A 2TODA 3VD9A 3OVGA 3LN3A 3TSDA 3S5OA 3WX7A 3RO6A 3SCNA 1G4TA 2RKXA 4K37A 2RJGA 3ZR4A 2QPUA 1JNDA 4GXWA 1VYSX 1WP6A 3W82A 1VKFA 3W1MA 2REQA 4FIRA 2XJ7A 4R5EA 4FF7A 2VFHA 3GR4A 5CG0A 2H8XA 2EG7A 1QNOA 1QK2A 4WCJA 3JUGA 4LUJA 2YGYA 3VUSA 3W26A 1X98A 1MZHA 3PBUA 4ECRA 2CEQA 3KL3A 1UOZA 4WY0F 2EKCA 1ZY9A 2X41A 4IPNB 3GKAA 2B0MA 4O57A 3CASA 1W1VA 4PUMA 4GJ1A 3I6TA 3WK0A 4ECXA 4JQ2A 5PTDA 3Q37A 1LRTA 3FHAA 1CT5A 1ZU8A 4BY3A 2H9AA 3CZ8A 3CHCA 5KT3A 4WEVX 2FLNA 1I60A 4J3SA 1PPIA 4FOUA 5CQ1A 2P1FA 2JGYA 4L6OA 3BAXA 3S2MA 1JPDX 1RVGA 3S8HA 2OGYA 2J79A 4O8AA 4CKQA 1R9YA 4Y9NA 3CC1A 2FH6A 1B2YA 4ZSUA 3UJEA 3RU8X 1HW6A 5AC6A 5MF5A 2DPJA 2TPSA 1F4HA 2PGEA 3TA6A 3URBA 4UZSA 1UBPC 3W7PA 4FNTA 4TR9A 2FZMA 4U28A 4M51A 1SO4A 4HT3A 4EPDC 2WVTA 1EO5A 2OELA 1NWRA 2W7OA 1JR1A 3CL6A 2QDHA 5D9NA 4LNCA 3RBEA 3NQAA 1OQFA 4H6QA 4O53A 4O54A 3TTEA 4J3UA 3UXDA 3QZ8A 3PSVA 4LS1A 3MSGA 4UCGA 3UY7A 4H8UA 1KC7A 4O1EA 3XISA 1LUCB 3IN5A 4IMDA 3DXIA 1OB0A 1E5NA 3HFTA 4JX4A 4RNIA 4UCFA 3LB0A 4ZE4A 1IXQA 4TX6A 3VO0A 4X0VA 1V3LA 4J3WA 2P8BA 3RR4A 2CBVA 3DYPA 4ZQPA 3FJ6A 1VFHA 2VTFA 1XIJA 4J3XA 3SRFA 1NP2A 3TOPA 1F3WA 4Q8UA 4AZ5A 1JCLA 3M0XA 4WJXA 3VCNA 5EGRA 1T6MA 3SGUA 1EFZA 2J66A 4UOZA 4F50A 2HE8A 1LBFA 2A3AA 2OKOA 3EGJA 1QMLA 3EPOA 4IMEA 2PEVA 3N4EA 4OV4A 3EBVA 3PY2A 4PMUA 4J35A 3V1HA 2HS8A 2YZRA 1V51A 3UZJA 4ERIA 1XKJA 5D32A 1VCGA 2Z4GA 4CEUC 3O3RA 5EFDA 2PLKA 1HZYA 4OQVA 3S0CA 1HJVA 4ATDA 4FA3A 5FSDC 1VFLA 4EXQA 9XIMA 4LAZA 1VYPX 3HO8A 4GI4A 1ZFJA 4BEUA 4NRSA 3L2MA 4I7UA 1T5AA 4I8YA 3AMLA 3PF3A 1Y0EA 4MY1A 1S5MA 4EEYA 1YXCA 3BW4A 3W72A 1OFOA 2Q09A 1W5OA 3R8RA 3AROA 3SJ3A 3C0QA 4LF1A 1LOQA 1TV4A 1TPEA 3FHQA 3WBEA 4JTQA 5HWNA 1FWRA 1CEOA 3W38A 2D2JA 2E6YA 4XO6A 2Y7FA 3CUHA 3T0TA 4AD4A 1CIUA 1WOAA 1C3FA 1SMAA 3WLMA 2YL6A 4RZ6A 5DMLA 2TAAA 5KT2A 5D38A 1VC4A 4FXFA 3AYSA 1MI3A 2IUZA 1YBQB 2ZX9A 4C6NA 4IPPA 5FEPA 1CTNA 3MWCA 4C1LA 4AZGA 3L4YA 3AXKA 5F2MA 3P0XA 4LU0A 2XN2A 1V6TA 1JXJA 3OO2A 5KFKA 1KRAC 2R6OA 4TIMA 7TAAA 1Q7MA 4DWSD 3SY5A 1R2TA 2GYIA 3U5YA 4LWWA 1FWDC 4B3LA 5E5CA 2DZWA 2UBPC 4TX8A 4MJ2A 1XG3A 6ALDA 4BF9A 4XQ6A 2VD8A 4Q8QA 1KLYA 4IICA 5A6MA 2A5HA 3KRUA 1WAWA 1ZJBA 1GEHA 4LY4A 4GYPA 2E7FA 5DN1A 1P7TB 2NVAA 3U7BA 3TP4A 4YR3A 2FTPA 4HCHA 3VNMA 1CI1A 4OOUA 4DBSA 2E28A 3WEOA 3DIPA 3EX3A 3VE9A 4PTMA 1SW0A 2D3LA 2D3NA 1F74A 3F4WA 2GQ9A 3KZPA 4R33A 3GIQA 3E5PA 2A3EA 1RHCA 4HTYA 5C7HA 5D9MA 2X1IA 2Q6ZA 1CENA 2PDNA 3MCOA 2F6XA 4NLGA 3P5YA 1H7XA 2C3ZA 3JR2A 4NJGA 4H2HA 4NYUA 1GWJA 5LNRA 4GISA 3M43A 2IW0A 3WK3A 1A4LA 1B3YA 3RM4A 3W2LA 1W3TA 4QE5A 4LBSA 3PUOA 2XZ9A 4W89A 3RYSA 3STEA 4GJJA 1IZKA 3G6XA 2ATSA 1XGZA 1EIXA 1DIKA 5LNSA 4AZ7A 3PBMA 4L5ZA 1PKNA 4OE7A 2L5HA 4I9AA 4H01A 2XVKA 2F7FA 2R94A 1JXLA 4F4RA 1J5TA 1A4MA 1WZKA 2PZ0A 1TX0A 3L5LA 4QWCA 4E6MA 3J7HA 3MZ2A 1REQB 2NLYA 4JIHA 4HPXA 4QGCA 1PIGA 1AQMA 1V6VA 3M6YA 4Q3MA 2GDUA 3IWPA 4IG2B 5D9PA 2YKKA 4Q8VA 2JEJA 2V82A 2I56A 4XZLX 3G1FA 4W93A 4PTXA 2DZAA 4UTWC 1QRQA 1C7TA 2YYUA 2TYSA 4NHVA 5C0QA 3MVTA 4UQAA 3QY6A 1H7PA 4YIWA 2OQHA 1LT7A 1XIGA 4D6HA 3DOPA 2XINA 4UMBA 1EB3A 4U2YA 4ECWA 4Q4KA 2XFRA 4NX5A 5M17A 3KBSA 5A8QA 1C8QA 4GYKA 3SN1A 3QY8A 1DJIA 4Y9OA 1TVPA 1PEZA 4WHBA 1EBHA 4S3BA 2BS9A 4HA3A 1SW3A 4OBTA 3UF9A 4C6MA 1C90A 2P50A 1Q6CA 5AC5A 3UJ2A 4TOQA 4E4PA 1TPDA 3EWUA 1BVNP 4CVUA 1L2UA 1UQZA 4WKFA 3IRDA 1W0MA 4O0KA 1M1BA 3WF3A 4U10A 2AGTA 4XBSA 6REQB 4UFHA 1X7IA 1V7AA 1WZAA 4ZSTA 5KZMA 4EANA 4GC7A 4W87A 3W6LA 3THDA 1UASA 3IJIA 2P88A 1YTEA 4MWAA 4YNGA 1BXNA 4YXGA 2J88A 3DAQA 1JEZA 1NF7A 2INFA 1OM0A 4WGHA 4ECUA 4I7VA 1B90A 3WH7A 4MAVA 1VIWA 4K39A 3UYCA 3GDLA 4Q7IA 2NXHA 3I6EA 3W1UA 3CQKA 1Y8BA 4JTAA 4UQBA 4MZYA 4R7OA 2B7NA 2VRKA 2XDFA 3U3HA 4F0LA 2Y85A 3GC5A 3A24A 3W01A 4BJHA 4HN8A 5I0DA 1VEMA 1MZRA 1E1CA 2CZEA 2HWGA 2F6UA 1YHTA 1NOWA 3L4ZA 4OV9A 3OYZA 4L65A 2YCJA 4O0QA 2VX7A 2YA2A 2ZZ7A 4CLMA 3W0KA 1EA9C 4ECVA 2YCEA 5H1WA 4UOQA 3A3XA 2C2RA 4LUSA 5DQGA 4XO7A 3VZZA 5L6UA 4V2XA 4YYFA 4PTWA 5E09A 4QSFA 4LAUA 1W8GA 4LY8A 3W1AA 1YADA 3KP0A 3IVSA 5DRCA 1UJQA 1EOKA 2CETA 3G8EA 2A7NA 4K68A 1O1HA 4L4MA 2QCHA 3MWAA 2WQPA 1ML1A 1R9XA 4JQ3A 2UVVA 1LYXA 3K1DA 2WSYA 2H3BA 4D6IA 4QCFA 3W23A 1XJBA 3T4CA 2J74A 3UPWA 3LLXA 2ZXAA 3UEQA 1EA0A 3M0MA 4WKHA 3TWAA 2ZRWA 3F4DA 4N2YA 2GVEA 2UY5A 1FHUA 2ZZ6A 4WQ6A 3UWYA 5EA9A 3BSHA 2DVTA 4JYEA 4PTVA 1B57A 3CTLA 1MO0A 4P7LA 2CHOA 3H24A 1LORA 1ZP3A 3ARXA 4H8VA 1MFUA 2QKFA 4ECLA 2PWDA 3I7QA 4CD8A 1N82A 1OGBA 2ZA1A 3BMWA 4B91A 3EB3A 1RAKA 1E71M 1K3UA 2MANA 4CCZA 3WF0A 3E12A 1BWVA 5I78A 2Y4SA 4TVCA 4WSHA 3P3BA 4FZIA 4L61A 5CZ0A 4S23A 1H3GA 5BRQA 1MUCA 4JCMA 2SFPA 1UD8A 4O16A 2C1HA 1EGMA 3TR2A 1BWLA 3TCSA 1OD0A 2NT1A 3DEQA 1LLOA 3WDRA 3E1F1 1POJA 2ASDA 1JYXA 1TV3A 4J9SA 3FFSA 2PI6A 4HA0A 3KOFA 3OLDA 4RUAA 3W7RA 1FRBA 3UYIA 3WD3A 4F4YA 2X40A 3W6MA 3CPRA 4JR5A 2ALZA 1DP0A 2IQTA 4GQ0A 1PE1A 1XH1A 3ANYA 3KL5A 5FL1A 4PULA 4JNYA 1EX1A 1BF2A 1JXKA 1ICSA 3ZS4A 5CGTA 3VK5A 1GVOA 1U5JA 4RE3A 4MSSA 3VGFA 3CPUA 5CC6A 4K8HA 1JF6A 5KFDA 4AW7A 5ECVA 1PUDA 3O6DA 5CPNA 3TZNA 3RNDA 2O0TA 4TV5A 3IJ9A 3A64A 2C7FA 2OLSA 1EPXA 4S2BA 3W71A 3QPYA 3PWIA 1ODZA 2VFIA 3R0UA 3KTXA 1ICQA 3QZAA 4QP0A 4JFTA 1DQWA 2V67A 5H91A 1H51A 5LSMA 4LAMA 3R4IA 2PWFA 1YDYA 3A6OA 1QNVA 2BX7A 2XSBA 3TAKA 4MUZA 3H55A 4JTRA 3WBWA 4DJDA 2PTDA 3W27A 4MIMA 1GG1A 3F03K 3PWGA 4O15A 1XSIA 1BTMA 2VP8A 1UD4A 3V5FA 2QAFA 1O6IA 2ZOXA 3TNBA 5I3JA 1FTXA 1HL8A 3ITGA 1XBVA 1CXIA 4GLEA 1JUEA 1IEXA 1M3UA 4ZQNA 4DI9A 8XIAA 4BEQA 1XLIA 3OZMA 3V0TA 5LNVA 2ATMA 4PR4A 3BQ1A 1FWJC 3BWWA 5D04C 3W9ZA 1A3XA 5KG5A 4ZR8A 4QWAA 3NYZA 1TTIA 2RHGA 4W5UA 1YE4A 4GACA 4CCEA 3AU2A 3LNMA 2I5GA 1EQCA 3WLPA 2HPIA 1R87A 2NV9A 3ZLGA 1B0IA 5MKGB 4OOZA 4JQ1A 3W74A 1CWYA 2OT1A 2PDBA 3UXKA 4FK9A 1J0KA 2CZ5A 3M0IA 3AMDA 3PG8A 1A53A 3B8SA 1XUUA 2E40A 4GD0A 1IEQA 2ZDRA 3MHGA 2OQYA 5LYRA 3R11A 2PURA 3WDHA 3BMVA 1E6RA 3Q8RB 3I65A 2W7PA 3UWEA 4CD5A 2F84A 5DGBA 4S3DA 2CBIA 1GVEA 1Q6FA 2ZA3A 4DJDC 1WAUA 5HMFA 2DT2A 3QMRA 4ZOEA 1MWOA 3MPGA 1WKFA 3DENA 1V3IA 2JQXA 2D24A 4GA8A 3P8JA 3E38A 5EBUA 3ZO9A 3GTNA 1OABA 1A80A 1TWWA 2NUWA 3LRKA 1EDGA 2C1IA 5HMDA 1XYZA 5DMYA 3GW3A 1Q6RA 3N3TA 2XM1A 2ZC1A 2AQOA 1K7EA 1XYLA 2HK1A 1C9WA 4PCSA 2R1PA 3H21A 3VIMA 3CIWA 1TIMA 1UA7A 2VRQA 1ONXA 2WM1A 5DLFA 1FCBA 2IPGA 4MZ1A 3G0UA 2ZXDA 5CJNA 1UD6A 4DIAA 5KFLA 3IANA 2Z7GA 3WQWA 3K8KA 3QFEA 3OTRA 4A2SA 3UZZA 3V75A 3ZOAA 1RPKA 4XAZA 2EG8A 4H04A 3RX4A 3AXMA 3PK7A 3R94A 4U5IA 4ZBCA 2E67A 2BVYA 3A23A 2FQIA 3SQLA 4FBTA 4EAYA 3WUGA 1EUNA 3L0KA 2O7SA 2ISWA 3U2OA 1E9LA 2QV4A 1B3WA 1C93A 4H41A 3O15A 4MNJA 3MBDA 4JPGA 5H8UA 2VURA 4HPNA 5C2CA 5GNXA 3AS0A 4QJ1A 4XD5A 5HNRA 3T9PA 1SFSA 2PWGA 4AY7A 3KBMA 2NVCA 2B7PA 4JHOA 4H83A 3MMUA 3RPTA 1I0BA 3G6VA 1OFBA 4HZ7A 5KG7A 1X6NA 2V8ZA 3AXXA 3KVJA 4GI9A 1F2JA 4UC5A 1A5MC 3CMJA 4IJBA 4E4UA 2YCLB 4IL2A 2GQ8A 4TTGA 2R91A 5IHSA 3G1RA 4UQCA 5E6ZA 2OEKA 4F4ZA 1E5JA 3FYYA 2JKPA 1V5XA 1OEPA 2XIJA 3B8IA 5KT5A 3GG7A 2IQDA 2VQUA 2X7VA 1XLJA 2WBKA 4M19A 1S39A 3TV8A 5AYBA 5CJMA 3SIZA 2Z0IA 3H40A 1MNZA 4RU9A 1IIGA 5A8GA 3BARA 2V9WA 1J18A 1SO5A 1X96A 4A3QA 2BP1A 3KHDA 5BU9A 5KG3A 1JCYA 4OWGA 5K4ZA 3CB3A 4RE4A 5HA7A 5HWMA 2ASLA 4EXAA 1MEIA 3PNUA 4GH1A 1AW2A 3MY9A 1QW7A 3NGJA 4QRNA 2VWTA 1XD0A 3CAQA 3EB4A 5BOFA 3ZJ7A 3RB3A 3DHDA 3GDMA 2GGJA 1WZLA 5K9DA 3E74A 4NU7A 4UNIA 3V5OA 3WZ0E 2ABAA 1W8SA 3QZ7A 1ZGDA 1TYGA 4FLRA 4Y7EA 1BHGA 4RDVA 5JIPA 4JGDA 1VF8A 3GR8A 4YYCA 5ABFA 5AYIA 2ANUA 3F4CA 3G1SA 1QPKA 3T0DA 1FXPA 2FJUB 3AIBA 3WD0A 1KXTA 4FB7A 3L67A 2EPMX 4E4FA 1FWGC 3KOYA 2R82A 4DN1A 4JOMA 4JIRA 1TWDA 3L65A 1JIHA 2PDWA 3SURA 1E9IA 3PTKA 4YPJA 4IRKA 3DECA 3O05A 5G4EA 3UT0A 2ZZ4A 3W7DA 1TB3A 5TQLA 1K03A 3CL7A 1V0KA 3R8HA 1QTWA 1MXDA 3USBA 1TMLA 2Q3RA 2OZ8A 3QN3A 1FDJA 4Y9AA 3ELFA 3PWAA 4C6JA 4XUYA 5A5WA 1E0UA 4DZ5A 4Z1AA 3ZM8A 3NG3A 3NQCA 1BD0A 3G1VA 4XZHA 3LHTA 4R9OA 2I5QA 3D5HA 2IMWP 1DWAM 4HTBA 4NVTA 2DPEA 3U7VA 4O10A 1TA3A 3OB8A 3WUEA 4E8GA 3UCCA 3ARUA 3M9YA 4C6CA 3B8TA 4GI8A 3TUUA 5KFUA 1EJVC 3LPOA 2J8GA 1FHVA 5C5YA 5A2CA 5IFTA 1B3XA 3F1QA 1O95A 4J3VA 4HU8A 4NUWA 2R8GA 4GIYA 2Z1BA 4HOWA 2ZUSA 1S2TA 3RCYA 1OBAA 2GVJA 4AZIA 4AEOA 1EJWC 1FH8A 4J9NA 4GYFA 2RDUA 1EJTC 5I5RA 1K77A 5TNVA 3GTHA 3DC8A 4Z1BA 1ZRQA 4AEFA 2G3NA 3ABXA 2PDQA 4QDPA 5BXSA 1YKWA 5KG4A 1GQJA 4UQDA 5JBFA 3USZA 1F6KA 3E02A 3HV9A 4QJ5B 3O8AA 1MQQA 2XU2A 3VKJA 3NEHA 4UTIA 1RP9A 3W7IA 1VCVA 1CGVA 4AX7A 4YTTA 3V6JA 5DG8A 2GJLA 4K7VA 1QHOA 2FVMA 9CGTA 5H8MA 2VEIA 2JKEA 3Q67A 4J2MA 2YFNA 4YTRA 4DZAA 1P48A 3BUVA 4NYYA 4W7WA 3HQNA 1E6ZA 4LVFA 3E2SA 1O60A 3TW9A 3OHAA 3BVJA 3P7YA 2PAJA 1GOMA 3I3EA 2J8TA 1GVQA 4AHQA 1LOSA 2IXUA 2ZUUA 3IIXA 1ZALA 3E5BA 2WJDA 3NQEA 5HUPA 2W8KA 3LHWA 4HU4A 2MNRA 4R3UA 5KFNA 1GZ1A 4IQDA 3A9IA 3LCHA 4EBEA 4DUOA 5C2GA 3GHRA 4GVIA 3E0VA 4PMXA 2ZUMA 1ZETA 2VOMA 3QV8A 3NQDA 1CECA 1JJKA 1KM1A 1R3TA 3ZJ8A 1T94A 2OYLA 3LCXA 1I45A 3CYJA 3VX0A 1M7PA 1J0IA 4TV6A 5T14A 1KFEA 3G3MA 5A3HA 3T81A 1MVYA 3GUGA 5CJ5A 1K4HA 3WDIA 5BWFA 4DJEA 2X1RA 4QFUA 3MR3A 5BYWA 1PO9A 1E0XA 1KD0A 5HMSA 1M03A 5DLGA 4C7DA 4L1WA 5CAHA 3QPEA 5FI8A 3WJZA 4DLMA 2EJ1A 3NQVA 3QSTA 3L68A 3UXAA 4FI4A 4LCRA 3ZZ1A 3IEBA 3S42A 1ZLPA 3CGTA 4C7GA 3TW6A 4JX5A 4XKYA 1N55A 1R0MA 3FDSA 4MJMA 3QJAA 5BNKA 4J9KA 2V3FA 3DYMA 4H6KA 4MFEA 4XB3A 1S2UA 4PUJA 2CPUA 5F2GA 1OFEA 3IJLA 2FTYA 1C91A 1GOQA 4CN1A 5HK4A 1EO7A 2AOSA 2BVDA 3G24A 3M5VA 4OUEA 3NO3A 2Z1VA 2GQAA 3SRKA 1RUSA 3VC6A 2QUMA 3HM7A 1ZENA 2QIIA 3ITOA 4FXRA 5F9NA 4KESA 3RB4A 2VA3A 1VHNA 1QOPA 1PTAA 4MKVA 5FF7A 4AHPA 3G1AA 5DCBA 3ERPA 4PODA 4NJHA 5J04A 1OIFA 2JK2A 3PUEA 3OBEA 1N8IA 1PIFA 1QI4A 3UXIA 3ZMRA 3ARSA 1EP3A 3C0SA 3VIKA 3LX9A 5LNWA 3GBDA 3GC2A 4L80A 3WFZA 4JEQA 4E8DA 4NZCA 1OGSA 2BY2A 1ZJHA 4A8IA 3WCZA 4AIUA 3CV7A 2FLIA 1L8PA 3N13A 3B04A 4AMAA 2FMOA 5AVHA 2IKIA 2E4TA 4YL2A 3MFIA 4KGLA 3TTYA 5DFAA 3OHIA 3VKAA 1KQYA 3OZYA 3P81A 4F8XA 1Q8JA 1S5TA 3RB6A 3ITYA 1RYSA 4UNLA 4FXSA 3W2KA 3NOYA 2DZXA 5M3WA 3A5VA 2KAUC 3FXGA 4O3QA 3KVLA 5BU6A 3TQ0A 1DWFM 2C22A 1AD4A 4GJIA 4E2DA 1J79A 4R7WA 4QIUA 2WMFA 3GTXA 3UETA 4JTJA 1FVPA 1NAL1 1DEDA 2FLLA 2HRWA 4ECQA 1QU4A 3WJXA 3H7RA 2BGSA 1CGTA 4JKKA 1EXBA 3N11A 1RQBA 3QGVA 3URAA 2ZTKA 3FXYA 1GJPA 1A5OC 4E0CA 1WX0A 1KFBA 1ENUA 1QJWA 3VNIA 4DXKA 2G41A 3FYPA 3N17A 2FMNA 1H4PA 4GY0A 4Q4MA 3VNKA 3C5QA 4HMCA 3CHDA 1XLLA 4OGZA 4LAOA 2TMDA 2WMJA 3C2EA 4JBRA 5IHRA 2GFTA 3AQUA 4JTSA 3ZT5A 4JTEA 3TJ4A 1VLWA 2V3DA 4JY9A 3ONCA 3MP3A 6A3HA 3VDAA 4MB1A 3FA4A 2OFJA 2G3MA 3S83A 1BPLB 4ECZA 1Z9AA 3ZVHA 3M4HA 4QNEA 2ZX5A 3SGGA 3V35A 1IEVA 1OF8A 4UTUA 3K13A 4MNKA 1VJZA 3N2MA 4GVGA 1KBKA 1J6OA 3UG8A 5CXPA 3WNOA 2Z2BA 4GYJA 3IJ7A 2J9ZA 1R5YA 3C6CA 1P43A 3RU6A 1GOXA 3CV1A 3WH9A 4HHHA 2VX4A 2NSXA 1P5BA 2R1NA 2DT1A 1QFEA 3GHTA 3KCJA 3NPVA 5AYZA 4Q8WA 1AW1A 1PZ0A 5G4HC 3WQFA 1DORA 1L6YA 2CXEA 2GL5A 4EBDA 2Z2AA 1KXHA 1Y5WA 4IT1A 3R0DA 4UR9A 1E1CB 2WV8A 4AVOA 4QLJA 4FPSA 3UY8A 4AC1X 2Y7EA 3F2DA 1TV2A 3ITLA 1JQVA 3IGXA 4GGBA 4LV9A 1KM4A 3UCQA 4LUSB 1HKIA 1JYNA 1MMFA 7TIMA 3PAJA 4X22A 3UWQA 4LBUA 4ICMA 3KBJA 1A3HA 5AVNA 3H70A 3UG5A 3VUPA 5KFBA 4N6FA 1GJUA 5LZLA 1IGSA 3QR3A 1FKWA 1MSSA 1WO2A 3QF0A 3K30A 4UFMA 3I6RA 1Q4NX 3WN6A 4E3TA 1GVFA 1H2JA 1UH3A 3QC3A 1JDEA 4BQ3A 4AWUA 4WGXA 1KWKA 3CUFA 5DMMA 5CPQA 1E56A 4MY9A 5HWJA 3LOTA 1HKMA 2JEPA 3T07A 4L9XA 2F8QA 3P82A 3QC0A 1OX5A 3S9IA 1CXEA 1H7OA 5HPOA 2HPMA 2GDVA 2E1WA 4BHYA 4Z2HA 1W1B1 3QZEA 2BVWA 1XBZA 4GG9A 4Q32A 1RBAA 1ICPA 4NI8A 1QBAA 3PULA 4HNCA 1NQKA 4A3YA 1XM3A 1N8WA 4EK7A 1XC4A 4C5YA 3GXTA 1Q5MA 3MMTA 4UQEA 3GVRA 3TYZA 4B4FA 3MI2A 4EIVA 1OHLA 1RALA 1UP2A 4LYQA 3CU2A 4JYFA 3MR5A 3N3MA 3VNDA 1VCFA 1K9EA 4I5RA 3KZSA 3UA3A 1NF0A 1EJXC 2PDCA 4ROPA 3LMYA 1AJ0A 4JTLA 3RLVA 1MXGA 3BGGA 4YJ5A 3W85A 3LXAA 2AGPA 4PSRA 4AQLA 1H50A 1POKA 2FVLA 5E0CA 3TMQA 3M0HA 1PJ9A 2OYMA 3LPFA 4V27A 1D3GA 2FFIA 3HFYA 3VDGA 1OZMA 2PDFA 4L4LA 3NXLA 5G4WA 4FS9A 3V0UA 3H12A 3T0CA 4PEEA 2BQ3A 1O12A 3VX1A 4CU8A 2FPVA 4IQLA 1DE5A 3W81A 2UY2A 2NXIA 1FKXA 3F5KA 1A47A 1ZP4A 1UROA 2B31A 3ITVA 2ZYFA 1VD6A 3QV7A 4D71A 4V1XA 4QG6A 3NDZA 3HPAA 3L4UA 1SSDA 1KTNA 2VRJA 3LHYA 4XAGA 1XYFA 3DUGA 4PUKA 4JZ5A 3OODA 2O4MA 1S10A 4WSKA 3KM8A 3V5CA 4IMCA 3GM8A 1TO3A 2VFFA 3TZFA 1SGJA 4DAIA 4XD6A 1LUCA 3OZOA 2VGGA 4ZB0A 5EWGA 3C4UA 5IFPA 3ABRA 2VC7A 4YS1A 3CUGA 5AFDA 1TE6A 2XH7A 4JQ4A 3MMDA 2RDJA 3CQ0A 4IIGA 1MNSA 2PDKA 4LUTB 1OCJA 4D8ZA 3Q8QB 1KCKA 3MC5A 3ABZA 1MDLA 3C0JA 4LUYA 5E0FA 1QUMA 2D0GA 3FJNA 2O9TA 5IBXC 1XIBA 4B3ZA 1Y65A 3IUDA 5A6JA 2JALA 2G4FA 4P8XA 5CPOA 4C60A 1OX6A 4AWEA 2J24A 3KOZA 4G7EB 1AZ2A 2WAGA 4ED7A 5LIXX 2PDXA 4TQRA 1WDSA 1JDAA 4IPJA 3UG4A 4ZA0A 4IUOA 3MKVA 1QPNA 4AY1A 1IV8A 5FSEC 3QHOA 4GO9A 4FLQA 3NM1A 3WG6A 1T3NA 2R1KA 3RF9A 5ABHA 5M03A 4W7UA 2CWXA 4EWJA 3WQ5A 4C6LA 2CKRA 4XIMA 2GUUA 3LI1A 3W88A 3IAQA 1W5QA 3S6DA 2FFCA 2C6QA 3GD6A 4BF7A 3UZ5A 3WH8A 2X2YA 1E0VA 1V3KA 2WC3A 3DG6A 3GG1A 4XAYA 1GOOA 3PB2A 1J6PA 1Q7QA 3ME3A 2O55A 1TCMA 2R8IA 1P6BA 1W37A 5KT4A 5CEWA 4J2PA 3PBVA 4DHGA 3N25A 9RUBA 1PVNA 1XLDA 1EWDA 3GC4A 1N2VA 2Z6JA 3SAZA 1NEYA 4YP3A 2JBMA 2BBFA 3IIZA 4M7SA 2DZPA 4QLKA 2G0WA 1VBHA 4P7NA 3STPA 3WLIA 4DJFA 3QPZA 3POCA 1YBQA 2VMFA 3NVTA 3CL8A 4DF0A 4HJWA 1NFBA 1XCXA 3W53A 2RGLA 3MV11 4IXHA 4TX9A 4WR3A 3BLEA 1XG4A 5C2XA 4URIA 2D73A 3S5YA 5F2IA 3SQSA 2DSZA 3BV4A 3RBDA 5K3VA 1NJJA 4GWEA 4PMZA 4PUNA 1E4LA 1LQ0A 3CWOX 3NQ6A 4D6FA 5BW6A 3TQPA 1CB2A 3IGUA 3KCOA 3ZSTA 1US0A 5JBEA 3RMEA 4UB9A 2PCEA 1TX2A 4PTDA 1OY0A 3CZJA 4IHCA 2GJXA 4IISA 2B4GA 4ED6A 3WQ4A 1EYWA 2VXNA 4UTJA 3OGSA 3UWVA 1W9UA 4Q8OA 4HNNA 1EL3A 1XLMA 1RCXB 2VNCA 3KOXA 3VD4A 3RM9A 3CUJA 4Z2LA 1SJAA 5D03A 3U8GA 3OG2A 3T08A 4MG4A 2R1MA 3SSZA 4WKAA 5C5JA 4N7QA 2GVLA 4RE2A 4ERAA 2DSWA 1RJRA 1Q2SA 1P7TA 3AIRA 1SJBA 4TQTA 3UA4A 4LJ3A 2NWSA 1W1PA 1HKKA 4QLLA 5IOBA 3RIKA 1CGYA 1WPCA 1E72M 3WL0A 4F40A 2BWGA 3NSXA 4AX6A 1ISZA 4BWLC 2I1OA 1SSGA 4JV1A 4EPEC 1RLDA 1TE1A 3EB2A 4KT2A 3S1VA 3B03A 1QNSA 5TIMA 2B7QA 4MWAE 3C2VA 1UR4A 1EDTA 2E9MA 3CUZA 3KLLA 4RV8A 1GCYA 4N9CA 3MYPA 4NJKA 2GVYA 2DUZA 4LFYA 2A7PA 2E8ZA 1ISYA 2I16A 2JEQA 3IRSA 1K8XA 1J0JA 3WBAA 2V5CA 2G8ZA 3GTFA 1JCMP 1QI2A 4V33A 4XV0A 4JL2A 1SJDA 3NZQA 2GDQA 1OC7A 2P76A 4H00A 3AU6A 2IPJA 3P61A 1V4YA 3TE9A 3O16A 3STCA 1TPFA 2BV9A 1H7RA 2ISSA 1Y7VA 3UU0A 4DO5A 4WD0A 3RLHA 4TUFA 1CW2A 4R7JA 1E6SM 3KRZA 5JVLA 1DOSA 3LERA 2WNNA 3CH0A 1DWJM 2F6KA 4ZQRA 4B9YA 2XCAA 1CXHA 2AKMA 3BQ5A 2VO5A 4A8NA 1GQNA 4NILA 5KG0A 4AD3A 4IJRA 4WUIA 3R12A 3NDYA 3WQ8A 3R13A 3LTSA 1BQCA 2JE8A 4CGTA 3AMCA 3H8AA 3ARRA 3TTOA 3EMZA 1WUFA 5AOUA 2G96A 2BNJA 2X30A 2VA2A 2Y63A 5K9XA 2EKGA 2PWUA 2DGAA 3TC3A 1HL9A 1G67A 4DWDA 5ABFB 3LA4A 2W9CA 1D3CA 1JPIA 5FJPA 2XFWA 2ZWZA 1TV8A 5I07A 3CIVA 5I77A 3W3OA 3WNLA 1OC6A 5KFIA 4O12A 2NUXA 4H9MA 1MEHA 4FSAA 3S2CA 1GUVA 3VC5A 4IGSA 2C1GA 3SSJA 1JX4A 3FAXA 3G1YA 3TYAA 3M9NB 1Z89A 6CGTA 6REQA 1AJ2A 1NSJA 3FSUA 3M1ZA 3LSCA 3CLWA 3VD7A 4ES4A 1D7FA 1OFRA 4AAJA 4JTKA 3D3AA 4WY0A 2AU0A 5AKQA 3MI6A 2XZ7A 3O06A 1QPQA 2X7WA 3FS2A 2FLPA 4MNMA 4UXDA 2GJPA 3QTGA 4KWVA 4AEEA 1UKTA 4HPGA 3GTIA 4FNQA 3B0XA 4IXXA 2EQDA 2HNEA 1TA3B 1VFSA 1QR7A 2PB1A 4ML4A 1AJZA 2HEJA 1R7OA 2BGQA 5GJNA 1HGWA 1J10A 4J9RA 5JXQA 2XPKA 3GY1A 3MUCA 3SCTA 2HZGA 2JEGA 4IOTA 4LTSA 2VEMA 7CGTA 3QYQA 4Z1YA 3H22A 3DFHA 1DIEA 1BXBA 3TOYA 3WF2A 6XIMA 3IJ6A 5C55A 2YXOA 6TAAA 4PUUA 1WDPA 4F0SA 2PRMA 4NL1A 3CZKA 1KTBA 1A0DA 1EEXA 3S46A 1RCOB 4DUXA 2EPKX 2PE4A 1L8NA 2PGWA 2WZMA 3TMLA 4RXGA 3CLMA 3N2CA 3VGDA 5CC3A 3SEPA 1W56A 3QR1A 1QW9A 4G8TA 3MUZ1 3RILA 5CC5A 3D0CA 2OTDA 2OOGA 4D8LA 1MW1A 4LCQA 1PX8A 3HG3A 3W4RA 2J6VA 4M3PA 1GONA 1PHWA 1V7YA 2WBGA 4KWSA 1C92A 2VVSA 1ME7A 1GKRA 1GOWA 4RK8A 2BDQA 3VMOA 1ITCA 2QMJA 5LIYX 4KFNA 3TEVA 1EJ7L 4GUGA 2E09A 1HXJA 1GHRA 2XFFA 2INZA 1KFJA 3CBWA 1ZNNA 4J40A 4KMQA 4C1NB 5HNTA 1B3OA 4LT9A 1CB7B 3HG5A 4O1DA 1JYVA 5DBTA 1K7FA 1TIWA 2WHKA 2E77A 3AIEA 3VGHA 4DL5A 1MRQA 3PZIA 4LRSA 4YHEA 2W9AA 3NDOA 5EBAA 1HTIA 2EPNA 1OGGA 3G6LA 2FHCA 3T6CA 2ACSA 3THAA 2V6AA 4CQAA 1PCWA 3II1A 2CZVA 4HHPA 2BHZA 5ABGA 4NAEA 4AVNA 2NW0A 4UMAA 5GJMA 4LRTA 2X1UA 1TVNA 1WZMA 1F3EA 3KFTA 1I4NA 4G56A 5D09A 2BR0A 3BJYA 4AZ6A 4ZVJA 3LSBA 1V02E 5HXMA 4RUBA 1W1IE 5D05A 1XL9A 4AIOA 4IIBA 1ITUA 3T05A 3AHTA 1J4EA 2IBKA 3DG7A 4G1KA 4Z2IA 3PB0A 2D0HA 4FAMA 4MNLA 2HSAA 2J27A 4W88A 5JQ9A 4LW7A 3AHYA 4CCCA 4LC8A 4K2SA 4OJYA 4DL2A 3GLCA 4XVEA 2ZRYA 5FEXA 4IRDA 2D0FA 4J1OA 1WDDA 4CUCA 2ALDA 2V81A 2BLEA 1JCXA 4S3FA 3D3FA 4NKCA 2ZX8A 2WJFA 3U6WA 3UJRA 1PB0A 4GVHA 5KT6A 1YLVA 3QXBA 2DZVA 3EYPA 2ZC8A 3EDJA 4QSHA 3EA1A 5CSYA 3VYLA 5I02A 1BF6A 2CITA 1OT1A 3MZNA 2ONEA 5KSWA 1Q66A 4HA1A 3TCEA 4MDOA 1TV5A 4FP1A 3KRSA 3WQGA 1FP8A 1JZ3A 4MLRA 1R3SA 3IJQA 1JZ8A 3E2RA 3HU7A 2Y89A 3KWSA 3Q2DA 1TUFA 5AYYA 3NQMA 2OWXA 3PJUA 4FX6M 5G5IA 1HKWA 2GLKA 3UWZA 2FKPA 1UR2A 2X2GA 3DX5A 4JV0A 1GJWA 2Y7GA 1LL6A 3KDOA 1W5NA 3U2CA 5F9LA 2VDIA 3M64A 4XAFA 4K38A 4XD4A 2ZRZA 5FACA 1UWQA 5EMYA 3SRHA 2AAAA 4Q4RA 5FA5A 3UESA 5C6MA 4XX6A 1HIZA 4LVBA 3SCPA 3MFHA 5J5RA 3GNNA 1EOMA 2AMGA 2G4JA 4M24A 2F2KA 4UOJA 2NUYA 1BXCA 3T2QA 8CGTA 1Q85A 1VFUA 1KV8A 3Q8SB 2A3HA 3RRAA 2Y7DA 3LNPA 4PN2A 4UTTC 3H54A 3PFMA 2ZXBA 3DFYA 4ADUA 5MKGA 2UWFA 1GQLA 3FGCB 4AD5A 3VIOA 3UZYA 4GFSA 1MW2A 4OFCA 2EGZA 1R3VA 3F4NA 2GK1A 3A22A 2ZUTA 1ESWA 1I8JA 2Z1XA 4GQQA 3UVAA 2X0HA 7A3HA 1XV8A 2Z25A 3FX4A 4IJCA 1XBXA 4C6IA 3CQHA 4GK8A 2WB5A 4N6EA 4IPLA 5HR6A 4J9QA 3T0BA 3P6LA 1ZAJA 5AZ0A 4BCEA 3WK2A 4IWWA 1YDOA 4RR4A 4X61A 4RDWA 4D9PA 5JH2A 4BA0A 3HOJA 1PYMA 1D8WA 2QNEA 2GSJA 3TU9A 5LGXA 3WNPA 1KFWA 1S2WA 2QJJA 1T0OA 1RXOB 4RCXA 1RR2A 3JS3A 3QEZA 4QHRA 3E0IA 1IEWA 1BAGA 2X0SA 2UV8G 4QBXA 4JY8A 3C86A 1AFSA 3R6IA 3GSMA 3VXGA 1RP8A 3C61A 4AD1A 2C91A 1CGWA 1HQTA 3ZVHB 1H09A 4O3OA 3LHUA 1EPVA 4MGGA 4JYDA 4GBUA 4IPIA 4DL6A 2XISA 1KRBC 1W3KA 3M5YA 4DL3A 3V36A 1KGWA 1P0DA 2WK2A 3LBCA 3EWYA 3DESA 2AL1A 3UPBA 3GH4A 2HROA 1WA3A 3FY1A 3HMJG 1ONWA 1R85A 4ZXLA 2PGFA 3MO4A 2WO5A 2WCAA 5ABTA 3R79A 3BAYA 5KFVA 4HNOA 3VDBA 1AK5A 2C28A 4DM2A 2Z6IA 1XKYA 2BASA 2IPWA 3N9SA 3LTYA 3TN6A 3EX1A 3U5UA 3WF4A 1PWLA 3RJYA 3VNYA 5I3FA 1TPH1 4YCPA 1FA2A 2QVNA 3MB9A 3BMXA 3GAYA 4M1RA 2VZVA 4PBEA 5BCAA 3FSTA 3MR6A 5AHNA 3W1QA 5LGZA 1US2A 2PDMA 3B06A 4WSJA 4PH6A 3SUWA 3MV01 1WQ5A 4B15A 3OGRA 5KG1A 4X63A 3VKKA 1RBLA 3KUMA 4BI6A 3DFOA 1SO6A 4R53A 1JUBA 3MUAA 4AISA 3BTNA 2QYGA 1HJQA 3KVMA 2ZBTA 1PAMA 3IV8A 3A4JA 4EPKA 1O66A 1AL7A 1DHKA 2GGGA 1XI3A 1PZ2A 3WDJA 4WVXA 2XN1A 3LXBA 2Z1KA 1K02A 4M6UA 5KINA 4PSPA 2OPJA 1JI2A 5F4WA 5A8NA 4E5TA 2HISA 2FYMA 1E3ZA 4JFSA 2RDXA 4RW5A 3VAVA 4LALA 4UFLA 1TZ7A 2I5IA 4Z17A 4F2BA 2BOEX 2ZX7A 4HK6A 4C6DA 3HB9A 4AZBA 4CQ9A 4PL1A 1WB0A 2ALRA 3C2RA 4IP4A 3FVDA 1GTHA 3NWRA 1GW1A 4ACZA 3WLLA 4X3ZA 2OGJA 3WNKA 1QK0A 2WCGA 3THUA 3EDEA 3UGVA 1QNPA 1U1JA 4LX4A 5C9UA 3ARVA 3TA9A 3W2UA 3DI1A 4TVUA 3W7HA 3H2NA 3LLFA 1KNWA 4DYJA 4H4IA 3U9IA 4NXKA 1BWKA 4ECYA 5EMMA 3M0KA 3M5XA 2RFGA 1ECQA 4Q8PA 3BAIA 4M8UA 3AFBA 1SU5A 3HPSA 4E2BA 3M44A 2QDEA 1SPQA 1FBAA 1H0GA 1EZ2A 1W5PA 3THCA 3O9NA 4FXJA 3EMQA 4MOZA 3SZ8A 1XCFA 2DT3A 3UG3A 3AXHA 5RUBA 4U5KA 3MI3A 3H4XA 1E4MM 1UP3A 3EA2A 1KFCA 5T8GA 1MQPA 2JFEX 5CCZA 5B80A 3HQ1A 4N9BA 4QWDA 1SFLA 5CBIA 3EWBX 1WE5A 2OXNA 3M9MB 3FDKA 4ATWA 3QBUA 2Z29A 4GMEA 3A3HA 5AN7A 3NIYA 1HG3A 1JI1A 4NZ3A 5A8MA 1AMYA 1Z6KA 5BROA 3DGRA 2EF9A 4AMCA 4B5TA 2F61A 4DI8A 3R5EA 4WXYA 3B9EA 3NL5A 2ZWYA 3CT7A 3GFXA 1MQRA 2Q8ZA 1SR9A 5CSUA 2Q02A 4ICCX 3KBVA 4J9OA 4CD4A 1YE6A 5L1IA 4CN6A 1TJPA 3ZR5A 3SCQA 3E2QA 3GVWA 3ARYA 1JUKA 2PDHA 1F76A 3WENA 5KFWA 5G2WA 3W70A 5CZTA 2DZUA 1S2CA 4DBWA 1A5LC 5E0KA 1OSEA 3GO2A 4MM1A 3LMZA 3W22A 5C9ZA 2OQLA 1MDRA 4MY8A 2CLHA 4HPJA 1FP9A 5D2YA 3O7UA 3SI8A 3MCMA 3CXOA 3V18A 3AUOA 3CEUA 7PTDA 2I57A 3PZMA 1AG1O 1ALDA 2I14A 4AYSA 3VNLA 3WQEA 4ECSA 5DCEA 4IFKB 3H7VA 4I7WA 2C71A 2VEGA 2Z7KA 8RUCA 3H2EA 3SJNA 2FZ9A 3MS8A 4PCTA 3U4FA 1DKWA 1TR1A 3W24A 4DWSA 4LF2A 4BQ5A 1TTQA 3L5AA 4R9XA 4D1IA 1HVQA 5K7JA 1OJXA 1HN1A 2VCBA 3NQFA 5D2XA 3MJYA 4RW3A 5DQHA 1NQ6A 3G5EA 1XSKA 1JGIA 5IXEA 2HJPA 3QQ0A 3SGZA 3BDKA 3PZUA 1JZ6A 1RYRA 1GQKA 3CEPA 3PN8A 1SZNA 1V03A 2QIWA 2VC5A 5HBFA 4QTGA 1LT8A 1N7KA 4EWND 2GUYA 3HJEA 1XIMA 3L4VA 5AC8A 3AC0A 3AS2A 1B1YA 5SWUA 4C6FA 2WHLA 3OVQA 3NR0A 1UKQA 3G0SA 1ONEA 1O4UA 5XIAA 1D8CA 1GEQA 1M5WA 3RK8A 3VFCA 1ZSXA 4GIEA 1LL4A 4UNKA 4S3AA 5CZKA 1TWSA 3UFYA 4F0HA 2OCZA 1UIOA 3W1XA 2QUTA 1E3XA 2C0AA 2O4QA 5DG9A 5A69A 3F5LA 3GDBA 1FWSA 2POZA 1OVDA 1LQAA 4JDYA 4IM4A 2Y2WA 3BJSA 3RLGA 5K2ZA 3EX2A 1VPQA 1XUZA 2QMKA 3LUTA 1SUXA 2BVTA 5CSSA 4UZUA 3BLPX 1KM6A 3UW6A 3EOSA 1B9ZA 1CNVA 2YOCA 1MW0A 3NAVA 1IEIA 3QQ1A 4QAWA 2E3ZA 3Q45A 1XIEA 2PWVA 2OLHA 6ENLA 1Y5XA 4O1FA 3NGFA 4HKPA 3R89A 4AF0B 4S39A 1EC8A 5KFSA 1LROA 1UKSA 1IXPA 1JCTA 3LQLA 3ZLFA 2DQXA 1SM9A 3BURA 4ED2A 3GXFA 2RDIA 1Q6EA 1YQ2A 2PC8A 1MXSA 3LGEA 1NFGA 1PBGA 1AW5A 4RNJA 5I3HA 3N1AA 4JD4A 1VQTA 3FN9A 3CWNA 3S4TA 3NQ8A 3QTPA 3SN0A 5E6YA 3FA5A 1KWGA 3LV5A 1Z69A 2QCDA 2CFFA 3VI2A 1QDSA 2GUBA 3IK4A 3DDMA 3KHHA 2GJXB 1T8XA 3ZJ6A 3QGAC 3WLHA 5D8WA 2H3DA 1UP0A 1R3RA 2DU2A 3L23A 1M53A 4A3HA 2RUSA 1TMQA 3V6KA 3EDDA 4DXXA 3EAUA 3SM0A 2H6RA 3OIXA 3ES7A 3RRXA 5EWFA 2YBTA 3WQ6A 1GVIA 4FLSA 4IMFA 3JU2A 3NL3A 3GU1A 2UVRA 4C65A 1OCBA 2YA1A 2ASHA 4OIFA 1IXOA 4ZXOA 3RX2A 4PMJA 4DL4A 4A8LA 4JTGA 3T42A 5EDWA 4CVWA 4O19A 1K70A 1CX9A 3SW6A 1TWIA 1ITXA 4LYKA 3QM3A 1XLCA 3N2OA 3I4KA 3GIJA 4DBEA 2PF8A 3EWWA 1R30A 1RLCL 2QV5A 3TONA 3MU7A 1W1TA 3R10A 4HK7A 1X39A 4HYKA 1Q6OA 4ACYA 2NXGA 3PM6A 1DTNA 1EJSC 5BOOA 2EEXA 1QVBA 4HMEA 2WOQA 5CZSA 1WXJA 1OADA 1W17A 4GXMA 4YTQA 1TTJA 2PDYA 4B16A 2GWNA 3LLDA 1EQPA 5AECA 2WMHA 1UA3A 3GR7A 3UBPC 1HUVA 2IQ0A 2FB3A 3VNJA 1FDZA 1YXYA 1XLEA 4NG3A 3QV9A 1XXXA 3A3WA 1CZ1A 1LZOA 5J8LA 5LKYA 2WZTA 4NNAA 2J7BA 1ZBVA 1H7WA 2VC9A 4BQ4A 3GK0A 2FDSA 3G18A 1U5VA 4R8UA 2HCVA 2Y62A 1TJ2A 4GX9A 3LD5A 3DU0A 2BXVA 5LIWX 4JAWA 4YWSA 3SY1A 4GYPC 2Q71A 3S5ZA 3R0KA 1EZWA 3SBFA 2OOFA 3WLSA 3TQVA 3GBEA 1FUYA 2ZZ3A 3CIXA 1NWTA 3NUKA 3MDWA 1VIZA 1UOKA 4N42A 2W9CB 4D6EA 1ZAHA 3CUXA 4F3HA 5EY5A 3SCOA 1S1PA 4C6KA 2D20A 3WEZA 5H6HA 3ALFA 4DO6A 1UH2A 3VTRA 1R7AA 1JZ2A 3KP1A 1TREA 1YPXA 5HPCA 3K8LA 3NCOA 3ARPA 2OEMA 5E93A 4S2CA 2YLLA 1FOBA 4DO7A 4Z0SA 1ZCOA 2CC0A 4U3CA 2XYLA 5EWEA 4FEZA 3T8QA 1UZ4A 3OVPA 1UWIA 3HGRA 3UJSA 3W2JA 2Z1SA 5DO8A 4GUFA 5JBDA 4O0ZA 1ZUAX 2E6AA 4LYRA 4PE8A 1B5TA 2XGPA 5D30A 1XC6A 1ZQ5A 4WY0B 2BGNE 2WPBA 5EFFA 3VD5A 4IMAA 1OFAA 2P0OA 1DJQA 3MKKA 1G7VA 2WTFA 2CLFA 4QJ4B 5XINA 1EC7A 1UUOA 3MSDA 4M82A 1XLFA 4M29A 1XYMA 3W2NA 2J6SA 4RPPA 2C16A 4OBRA 1DV7A 1Z48A 4N4PA 1XF0A 3EPIA 3S1XA 1HO1A 5AHEA 3OHBA 2ESCA 3W7LA 1GG0A 2Y5JA 1XGEA 2X42A 3M0VA 3MHUA 2W3ZA 2DIKA 3VOCA 2G95A 3PZOA 3UNDA 3V3WA 1CXFA 2I9UA 4DUWA 1H60A 2ISVA 4QISA 3QOKA 1NOFA 5HANA 4I9TA 1H11A 4HJFA 2BXZA 2V30A 2D2HA 3MT1A 1OD8A 2ON3A 1W54A 4DL7A 1XIHA 2ZRVA 2DZBA 2WHMA 4RX0A 3VNZA 1BYBA 4JCLA 4RV3A 3E96A 1GT8A 3W7JA 4TTUA 3C2YA 2ZTJA 4PMDA 2R8HA 4QS5A 4FMVA 4AB4A 4O14A 2WMKA 5CPMA 4QITA 3OOQA 1FDYA 4K1GA 1E9YB 4B92A 3EZ4A 3C56A 2OZ0A 4K7YA 3FYOA 3BW3A 3IIOA 2PTWA 4MWAC 2RGMA 4NASA 3CO8A 4MVAA 5AHLA 1TVLA 3QFWA 4NXSA 3WUFA 3NQ2A 1O5RA 3CS2A 2VR4A 2WMGA 3WMSA 3QGKC 2POTA 1XLKA 3CWHA 2Z24A 1FY6A 1U22A 2BY3A 1KQZA 5A8OA 1G1YA 2QJIA 1OZQA 4M56A 5DY3A 4GCAA 1FWIC 3NJ3A 3RHGA 1K1SA 5AHMA 2BOFX 1VZWA 3MA8A 1RD5A 4IIEA 2QCCA 9XIAA 2CNCA 4KRUA 2P0IA 2QEZA 3W87A 2WPGA 5C9RA 1RVKA 4X0NA 4PL2A 1BG4A 2V2HA 4FO4A 3Q8PB 2J9YA 3MJMA 2W8LA 1VS1A 4J4KA 3GDTA 3TSMA 3AOFA 3GXIA 4AU0A 1JULA 5M5DA 3OHMB 1UPPA 2A4AA 2FZDA 2RDTA 4NAEB 4PMNA 3NVDA 2HTMA 2PFHA 3YPIA 1F05A 1FCQA 5KFQA 1LWIA 1N48A 2KZHA 5DY2A 1X1OA 3W25A 4ED1A 2YFOA 3VIPA 2E9BA 3F5JA 3TSBA 4CQDA 2HXTA 4NRRA 4A35A 1I0DA 4Q6XA 1NWUA 4JNZA 1QASA 3CV6A 1PZ1A 2PTXA 1BLIA 1EGZA 3PTDA 3MSYA 2XGBA 4ATLA 5HINA 4HYWA 4D6JA 2ZADA 1OK6A 3LEPA 8TIMA 1V3JA 3WJSA 1BYAA 2YL5A 4MTVA 3UPMA 1WNOA 1YTKA 2VOTA 4K8EA 4HYVA 3S5SA 4LYPA 2CERA 2QQ6A 1S97A