4CQBA

The reaction mechanism of the n-isopropylammelide isopropylaminohydrolase atzc: insights from structural and mutagenesis studies
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
402
structure length
402
Chain Sequence
SKDFDLIIRNAYLSEKDSVYDIGIVGDRIIKIEAKIEGTVKDEIDAKGNLVSPGFVDAHTHMDKSFTSTGERLPKFWSRPYTRDAAIEDGLKYYKNATHEEIKRHVIEHAHMQVLHGTLYTRTHVDVDSVAKTKAVEAVLEAKEELKDLIDIQVVAFAQSGFFVDLESESLIRKSLDMGCDLVGGVDPATRENNVEGSLDLCFKLAKEYDVDIDYHIHDIGTVGVYSINRLAQKTIENGYKGRVTTSHAWCFADAPSEWLDEAIPLYKDSGMKFVTCFSSTPPTMPVIKLLEAGINLGCASDNIRDFWVPFGNGDMVQGALIETQRLELKTNRDLGLIWKMITSEGARVLGIEKNYGIEVGKKADLVVLNSLSPQWAIIDQAKRLCVIKNGRIIVKDEVIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE
publication title X-Ray Structure and Mutagenesis Studies of the N-Isopropylammelide Isopropylaminohydrolase, Atzc
pubmed doi rcsb
source organism Pseudomonas sp. adp
molecule tags Hydrolase
total genus 162
structure length 402
sequence length 402
chains with identical sequence B
ec nomenclature ec 3.5.4.42: N-isopropylammelide isopropylaminohydrolase.
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 4cqbA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4cqbA02
1PB0A 4IFKB 4PBFA 3URBA 3OU8A 1M65A 3OOQA 3PANA 2DVTA 2UZ9A 2EG8A 4B92A 4C6LA 2P9BA 1UMLA 2GWNA 2Z28A 4P5UA 3F4CA 4CNSA 1EJRC 2FVKA 4G7EB 2GOKA 4NP7A 1ONXA 4IFKA 3FDGA 5G4HC 4LFYA 3WMLA 3GTXA 3GTHA 2Z4GA 4AQLA 1YMYA 4DZIA 4KERA 5HMEA 1M68A 1FWEC 3WZ0E 3TN3A 3N2CA 4PCPA 2EG7A 1UIOA 2DVXA 4AC7C 4C6OA 2WJFA 4LH8A 3GIPA 2KAUC 1R9XA 4LCQA 1KRCC 4XAZA 3O0FA 4PBEA 1PO9A 4GX9A 3E74A 2GZXA 4QTGA 2YXOA 2A3LA 3OJGA 4BJHA 1FWDC 4KF1A 3RHGA 4QS5A 2PAJA 4LANA 3MVTA 4RDYA 3RCMA 4CQBA 3IGHX 4GC3A 2G3FA 3LGGA 3S4TA 3CJPA 1A4MA 1P6CA 3MDWA 4Z42C 1EJSC 2UBPC 2FFIA 1FWIC 4CQDA 2FVMA 4J5NA 4C6CA 1FWBC 1A5LC 3KM8A 3QY7A 2IMRA 3F2BA 2HPMA 2WJEA 1YBQB 4WGXA 3B40A 4B90A 2ZC1A 4GX8A 4IGMA 2R1PA 2FTWA 3CAKA 4H9YA 4H9MA 3K5XA 4WHBA 1EZ2A 4RDVA 3ITCA 4R88A 4ZSUA 2QT3A 2O4QA 3E0FA 4XD5A 1RK5A 4ERIA 3NURA 1PSCA 3NEHA 1XGEA 4H00A 3S2NA 1XRTA 1WXYA 3OQEA 1K1DA 3UPMA 4HK7A 1JGMA 1I0BA 3OODA 3IV8A 2HBVA 3F4DA 2YB4A 2R1KA 1V79A 3MVIA 3PAOA 4QS6A 1A5OC 4C5ZA 1YRRA 4I6KA 4HJWA 4C6BA 1VFLA 4R7WA 1GKPA 5A6TC 2BB0A 4PE8A 4C5YA 1WXZA 3K4WA 3ORWA 1NDYA 4GOAA 1R9YA 4XD6A 4LAKA 3MDUA 1K6WA 4KEVA 4IQJA 4KESA 4C6EA 2Z29A 1S3TC 2XIOA 2GWGA 3LSBA 2ADAA 4CEUC 4DO7A 2Z26A 5LXXA 4KETA 1RJPA 1XRFA 2HBXA 3V7PA 1EJWC 3DCPA 4MUPA 2ANUA 4H9UA 3S2LA 1HZYA 3GTIA 4LAMA 4DZHA 1RK6A 1ADDA 2I9UA 3SFWA 1RA5A 1E9YB 1V51A 4HA0A 1O12A 3O7UA 1NDWA 4GBDA 4C6JA 3QGAC 4BY3A 3LY0A 1IE7C 4TQTA 2YZ5A 3AU2A 2VUNA 4WVXA 4EPDC 4KIRA 2D2HA 2WM1A 4RE0A 3IRSA 2OQLA 4HK5A 1EJUC 1FWCC 4CNUA 4IG2B 1R9ZA 4G7EA 3IACA 3LA4A 3FDKA 2W9MA 4RDZA 3MPGA 2VM8A 4G2DA 2QVNA 3A3WA 1NFGA 4IH3A 1V7AA 3T1GA 1RJQA 5AKQA 2I5GA 3T8LA 4ICMA 1EF2A 2Z2AA 2E1WA 4F0SA 3S2JA 3IARA 3S2MA 1V77A 3A4JA 5E5CA 2ICSA 3PNZA 4GZ7A 2Z24A 3K2GA 1M7JA 1POJA 5CH9A 1P6BA 1EYWA 3QY8A 5FSDC 1DPMA 3URNA 3ISIX 3GUWA 2HPIA 4L6DA 1ITQA 1O5RA 3ICJA 2VHLA 4C6KA 3T81A 4D8LA 1YNYA 3AUOA 3TNBA 4LAOA 4C65A 4DLMA 3B0XA 3E38A 1P1MA 3TN5A 4XAGA 1YBQA 4PCNA 5FSEC 3LSCA 1XWYA 2EG6A 2FTYA 2D2JA 4HK6A 3MKVA 4IF2A 4J2MA 3ID7A 4XAFA 4UBPC 1A4LA 2DVUA 1KCXA 5HMFA 4ERAA 1FWHC 4LEFA 5HMDA 1UBPC 2E25A 4B3ZA 1QXLA 4GK8A 3NQBA 4IFOA 4H9VA 3D6NA 2QPXA 4GYFA 2RAGA 1FKXA 4YIWA 3E3HA 4C6IA 3SO7A 4QROA 3QY6A 4H9ZA 1ITUA 3MSRA 3HPAA 1RA0A 3IPWA 4GY1A 1FWAC 3UR2A 4INFA 2GSEA 3F2DA 1J5SA 3MTWA 4LCSA 3URAA 2VR2A 2BGNE 4IGNA 1ZZMA 1NDZA 2O4MA 4DYKA 1PTAA 4DNMA 2PLMA 4NI8A 2AQOA 3TN6A 4XAYA 4BKNA 3RN6A 3URQA 4QRNA 3CS2A 2VC7A 1FKWA 3HTWA 4XD3A 2P50A 2P53A 2Y1HA 3QGKC 3MJMA 4C6FA 1YIXA 3C86A 1POKA 4RZBA 3EGJA 3FEQA 1RAKA 3GRIA 1QW7A 1FWJC 4IG2A 3TN4A 2Z25A 1KRBC 2AQVA 3JZEA 4DLFA 4C6NA 2AMXA 4IFRA 4EP8C 3OVGA 4C6DA 3B0YA 4F0LA 2Q01A 3AU6A 4C6QA 3E2VA 4H9TA 3PBMA 1GKRA 1FWGC 3UF9A 1A5KC 3GU2A 4I6VA 4RDWA 3UBPC 1J79A 2OODA 1A5NC 3LGDA 2D2GA 4QSFA 3GGMA 1EJTC 4LCRA 3G77A 3EWDA 3A3XA 4DI9A 1NDVA 4E3TA 2R1MA 4EPBC 3DC8A 4C6MA 2Z27A 2Z2BA 1BF6A 1I0DA 4M51A 4XD4A 1A5MC 4R85A 2Z00A 4L9XA 3DUGA 2WJDA 4DIAA 2HNHA 3PNUA 4ERGA 3WYZA 2CZVA 4GXWA 4B91A 2OGJA 2YB1A 2HQAA 1GKQA 1KRMA 2OOFA 3LS9A 4JOMA 3UR5A 4C60A 3IJ6A 4CNTA 4ZSTA 1K70A 3EWCA 3LU2A 4UB9A 4CEXC 4H01A 4KEZA 3BE7A 4NG3A 1W1IE 2F6KA 4EPEC 2PUZA 2PGRA 4GY7A 1RJRA 4DI8A 1KRAC 2Z7GA 3R0DA 1E9ZB 4H9XA 1V4YA 4C6PA 4LALA 1EJVC 2QS8A 2R1LA 4KEUA 3LNPA 3GU9A 3F2CA 1J6PA 2R1NA 4GY0A 4J35A 2PGFA 4CQCA 3GG7A 3E0LA 4KQNA 1FWFC 2VC5A 4V1YA 1J6OA 3GU1A 4EPKA 1ONWA 1UIPA 4V1XA 2Q09A 1EJXC 3RYSA 4OFCA 2OB3A 3GIQA 3GTFA 4F0RA 3HM7A
chains in the Genus database with same CATH superfamily
4K1WA 4IM4A 3LRMA 5CSRA 2HISA 4IIFA 1HP4A 1M1BA 3AS2A 5HXMA 1UQZA 1H7WA 4CNSA 4XKYA 3RNDA 1WOBA 1QOPA 3QV7A 1H61A 3WNMA 3PVXA 5FF0A 1GVIA 5A94A 3G0UA 1SZGA 3M6YA 5KT5A 4RCXA 1TB3A 2QF8A 3KCJA 4ZE5A 1MO0A 4PBEA 2PWFA 3PUOA 3LCGA 3ZMRA 4GHRA 4GUGA 2ZA3A 5CSSA 3BLDA 4H3DA 1X1OA 1EP2A 1TWWA 4RUAA 3DKLA 4J3UA 1DIDA 3EPNA 4XG1A 2JGYA 3C5QA 3EXRA 4RDYA 1AQ0A 5HQLA 2YA2A 4ECTA 1OYAA 3GXTA 2FGBA 2VDHA 3CHCA 2PC8A 3NYDA 4YWIA 1ZNNA 3CIWA 4Q8MA 2UBPC 2YXGA 3BQ5A 1QOQA 2OWXA 3FJ4A 3L4WA 5D38A 1W3IA 2E8ZA 4RNIA 3PTKA 1ZCOA 1TX0A 3UCCA 2DZSA 3U5YA 4GQRA 1SJBA 3ITCA 4IISA 3T6CA 1AVAA 1WP6A 4FOKA 1MFUA 4YTQA 5FJIA 4B5UA 2CLEA 3EX6A 4K36A 4H4IA 1DJGA 4MMWA 1X6LA 3KOWA 3G8EA 4JN6A 3XISA 4B5NA 4Q44A 1M04A 1XIIA 1W6TA 4PUWA 1HVXA 1VFLA 1GKPA 1KFLA 3PJTA 3PZGA 2EAWA 3WUGA 2IS7A 1WAUA 3WIJA 1BYAA 5CPLA 3WD3A 3QZ8A 3OHAA 3TZNA 3WH5A 4FNRA 3SDOA 2QMKA 5FL1A 3QW3A 4KESA 2ZYFA 4X2RA 3KBJA 1YW1A 3CEUA 4LWWA 3L0NA 4YR0A 1R7AA 1CYGA 3PBWA 3GHSA 2VGIA 4GC4A 1Q7ZA 2WMKA 1VJZA 1FY6A 1KXHA 5KITA 2ZICA 1ICPA 2I57A 3M0YA 4D1JA 3O07A 3GR7A 1TMHA 1WE5A 1KM1A 4NJGA 4TQTA 2R9RA 2WMIB 2W8LA 7REQA 4EPDC 1G69A 4IL2A 4AEFA 1SJDA 1TYGA 3GVQA 4JIIX 3BJFA 3LQLA 3TFXA 4TX9A 4DXVA 1QNRA 2RGLA 1KXQA 1TJ2A 2YYUA 4ED3A 4V33A 2RDXA 2JALA 4ADUA 1W8GA 3KHGA 3BGGA 4QE1A 1BHGA 1DJWA 5ABFB 4AY8A 5DN1A 4JIQA 4O10A 3FYYA 1LWIA 3BV7A 4HOXA 4OBTA 4O1BA 5CZTA 5DANA 3HGSA 2Y0FA 3W74A 4EBDA 2OEKA 2A7PA 3WUFA 4D6CA 1A49A 1HFBA 3MYOA 1XIFA 1EDTA 3XIMA 4PFMA 2NVAA 3NWRA 3Q58A 3ISIX 1SO3A 3EEGA 1KWKA 3UXAA 1JI2A 3DG7A 3TJ4A 2E6DA 3MUZ1 4D8LA 1E70M 3K46A 1SO5A 5I3IA 3OIHA 1P1MA 3VKCA 2XINA 3TN5A 5DFAA 2OOGA 3CZGA 1XWYA 1OG0A 3M9YA 5LIKX 3W1AA 3WH9A 1IWAA 3RUBL 3VNKA 1VBJA 4XAFA 3T0DA 3GXMA 1KFCA 4JTQA 3AHVA 1TA3A 2QMJA 1J0KA 1S2VA 3RB6A 1C8VA 1XICA 4U5KA 3PW5A 2VUYA 1R3SA 2PDGA 4EACA 4JFSA 5I3GA 3A23A 2INFA 1DTNA 2EF9A 3RGTA 5CPOA 2RAGA 3L68A 2VP8A 1Z42A 5I6SA 4IJCA 1EPXA 1ITUA 1XLGA 3T5KA 3WBWA 1MUWA 2YA0A 1E72M 1GVQA 1QI2A 4RUCA 2BGNE 2O4MA 3H26A 4DYKA 4GISA 3L65A 5H8UA 4DWSA 3ZLFA 2PLMA 4J9KA 2V5BA 4A3YA 1QASA 3AS3A 5XINA 4PTWA 4BWLC 1TKKA 3KCOA 1BVZA 4ECLA 2WPBA 1CGYA 1RYSA 3I4KA 3MZNA 1H1NA 4PMRA 4O1AA 2CZDA 3NO5A 1WBJA 3MJMA 1VRDA 1GVFA 3D46A 2J24A 4QX4A 4XX6A 4S3AA 4XBKA 2NSXA 1Q63A 2WBKA 5M2FX 3EGJA 3RX3A 3A4XA 2JEJA 4DXXA 1JCXA 3WQ4A 2Z6JA 1OFQA 4IFRA 3B0YA 4K68A 2QHAA 3ARTA 1EC7A 1F4HA 1TG7A 1WDRA 4O3RA 1EJTC 1SW7A 3MA8A 1NDVA 4QQ3A 2OKTA 3W23A 4J9LA 5CJ5A 3WQ5A 3M43A 2YSWA 3KHJA 4GYPA 4RV3A 1UUQA 1JCMP 2ZUTA 5CLTA 1XGDA 2PGEA 3H2MA 4NQ1A 3TIMA 3CWHA 1EB3A 1YNQA 2WYSA 1TZ7A 1UWTA 3W53A 4A3QA 1EO7A 1E6RA 4GJIA 1OFAA 3FIGA 3IJ6A 1JG9A 9CGTA 3MJYA 3IEBA 2PE4A 3LPGA 1GVEA 1O68A 4AVNA 3BK0A 4J27A 3PW0A 2OVLA 5GJNA 3S1UA 1OFOA 1VC4A 2G3MA 3M0VA 3T8QA 1XDLA 1EC8A 2X1IA 3N11A 3A4AA 4H9XA 3NVDA 3PP7A 2PZNA 3VCNA 2GJXA 2RGMA 1EJVC 4KEUA 1UD8A 3GW0A 3LNPA 3V1PA 2VZSA 5HUPA 2JFEX 4EXAA 4WDXA 3AXXA 3NQ2A 4AIEA 3W1NA 4TMBA 1PAMA 4W8LA 5F1UA 2VC5A 5KFVA 3N1AA 3CPGA 3MMDA 2E8YA 4OECA 1B54A 1H7XA 4JTIA 1XR2A 2CEQA 4NNCA 1T41A 3POCA 3ARSA 4B92A 3W7IA 7ENLA 3CUGA 1EYEA 1W54A 1MW0A 1NTHA 3IJ7A 4BI5A 2C91A 4KWSA 3CL6A 1AG1O 2GQ8A 3BSHA 2X42A 2OWWA 3N2CA 3KEHA 5KEZA 4ZENA 3BLOA 4GIAA 3TA6A 1GCYA 2TRSA 3EWYA 1UYQA 2OU4A 1ZETA 1QWKA 1MEIA 3SRDA 2NLYA 4ZBCA 2VEPA 4O11A 1TIMA 2NX9A 3C0LA 1K9TA 1C92A 4GD0A 1ZGDA 3LQGA 5T9BG 3SGUA 2VEMA 4PUDA 5KT6A 3K4AA 1HNYA 4US6A 4ICNA 1TTIA 2J8TA 1GHSA 4J9PA 2VOTA 2CLOA 2RJHA 2A3BA 3R11A 1V6XA 4ZSUA 3OZOA 3E0FA 1Y5VA 2CETA 1IR2A 3NURA 2JK2A 1KXTA 3NZGA 3OQEA 4OWGA 4XZIA 5LNWA 4HK7A 2OMAA 4IRKA 3S42A 3UW6A 3PAOA 2D20A 1CTNA 3ABXA 4LVAA 1WXZA 1Q6OA 1TR1A 2XGZA 2F6XA 1IEVA 2Y85A 3KUMA 4CQAA 4IQJA 3RX2A 2ADAA 1Q6GA 4DO7A 5LXXA 1KLYA 3ERPA 2W7OA 1H3GA 1V02A 4QAWA 4RUBA 1ADDA 2PU1A 4U2YA 3LPFA 4Y2WA 2XTKA 4AYGA 1K9DA 1MZRA 1PIGA 5D03A 1O12A 3AZTA 1Q66A 3VNZA 1W9VA 5KSWA 2CPUA 2RKXA 1E0TA 3HGOA 1A3WA 2QCEA 3LBMA 1CXIA 1NWTA 2VENA 4YHEA 4FX7A 3O8AA 1R9ZA 3W85A 4TR9A 3M9MB 2A7NA 3W37A 1P0KA 2X1RA 2R8GA 1C29A 2WK2A 1TQJA 2PDIA 3L9CA 1XLKA 2AU0A 1UWUA 3TWAA 4CVUA 4TU1A 2Z2AA 1TTJA 4MY1A 3AO0A 5AYBA 3IVTA 1JX4A 2YCLA 3GD6A 3CU2A 1FDYA 3POHA 4LQ1A 1KFJA 3CZLA 1EX5A 4NLGA 3ZR6A 4IMGA 1M7JA 1V6UA 3PTQA 4NL1A 8TIMA 4Q4SA 1NQ6A 1V5XA 4IWWA 2CXGA 3SCVA 1R38A 4O12A 4L6DA 1TV5A 4R3UA 3LEPA 3RXZA 3L66A 3H53A 2CHNA 3LPOA 3NJ3A 4HHHA 1QI4A 4IIBA 2NVDA 5MKGB 1GQNA 4PCNA 4A22A 4AZCA 3KOYA 4MB4A 3VIGA 1TE1A 1IEIA 3PPGA 1LJYA 2VX5A 5EMYA 4L80A 3STEA 3GNNA 2FMOA 3OA5A 1VB9A 4RE2A 3BJSA 4ZXOA 3N3MA 2JEPA 5K4ZA 5AZ1A 4O17A 1XI3A 2BXZA 3NM1A 4UZUA 4XZLX 4LW7A 3ITXA 5KFBA 2FJUB 5EMKA 1E9LA 1V0NA 5F2MA 4ZFMA 1O5KA 1B2YA 1GOOA 4F2UA 3VKKA 3S5OA 4E2DA 1N48A 2INEA 3URAA 4A4AA 3CYVA 1BTCA 2XN0A 3L2LA 3RRXA 1EH9A 1TMLA 4GKLA 1OIFA 1TUXA 1YXCA 5FJUA 1F3TA 3ZM8A 3LHYA 4QRNA 5DY2A 3WLIA 3EKZA 2P50A 3V0UA 2C22A 1KR1A 3ZR4A 3BUVA 3FEQA 1CGVA 5BWAA 4IG2A 3IJ8A 3RCNA 2X40A 1XSJA 3G0SA 1VCGA 4C6NA 5D05A 2IPJA 4WCJA 1SO4A 4F0LA 4RLIA 2Q01A 1OIMA 5DLCA 3M0XA 1ME9A 3ELFA 5U4NA 3UF9A 1Z6KA 4MB3A 1VFFA 1W2PA 3CQIA 1J79A 4PTXA 1MDLA 2AL1A 3OW1A 3VILA 3L0GA 5LYRA 3OBKA 4PUEA 3GO2A 3O3RA 3WO8A 3GZAA 2DSWA 4AZ6A 4GO9A 5A1AA 1XIEA 5KFIA 3BOXA 1RCOB 4ERGA 2Y7GA 2PI6A 1GW1A 3CZ8A 1U22A 1JAEA 3K1GA 4MLJA 1UKTA 3M46A 4AVOA 3ME3A 4F0HA 2DIJA 3N2OA 3FK4A 3UXKA 1TVLA 4JOMA 3MR3A 4C60A 4KPLA 5F2GA 4PULA 4CEXC 1IXOA 3GAYA 4GZJA 3UA4A 2V4QA 5FJOA 3SCPA 4GY7A 3DYOA 2WSPA 3W6MA 3PM6A 4FAMA 2V82A 2YCKX 2KZHA 4Q43A 4DJFD 5EMUA 4YVPA 2X1UA 4BF9A 2NSOA 4F50A 3SN4A 3F2CA 4W87A 3REQA 2QF7A 3Q94A 1TJPA 3EZ4A 4GC7A 3CUFA 4EOUA 3OHIA 5E70A 4UXDA 4CD8A 4PL1A 1B0IA 1XLCA 1NSJA 1OGSA 3EOEA 5XIMA 1XIJA 3D47A 4JV2A 3OU8A 1VH7A 3BW3A 4C6LA 3GYCA 3W7RA 3B8IA 3UXIA 3MBDA 1S2UA 5U7SA 1W3NA 1EJRC 2BV9A 3VVGA 3B9OA 1E6QM 1BXNA 4ADSA 4DZIA 2MANA 4J28A 1FWEC 1UC5A 1XYZA 4UOQA 5D8WA 3VE7A 4TVUA 2NX1A 4WDTA 1RPKA 1QNVA 2QCLA 2FH8A 3M0KA 4LCQA 3GR4A 1J0JA 4BQ4A 4AWSA 2E9BA 4ROPA 2ESCA 3BAYA 4LNCA 4HN8A 2CLMA 2WHMA 4JTTA 4K37A 4MWAA 3W75A 4ORIA 3LGGA 4X63A 4AD4A 4BZYA 3TC6A 1J9YA 3G0XA 3TW6A 3W1TA 3WLHA 1MZHA 4PEEA 4AD0A 2WCSA 3O15A 1XLIA 1FWBC 4HNLA 3IGXA 1FVPA 3PZOA 5AHEA 2G37A 4LVGA 2ISVA 2WSYA 2PD9A 3B40A 1GEHA 4JDYA 5D09A 5LNVA 3K5XA 4LVDA 4MZYA 4JV0A 5F7UA 1GQJA 4XD5A 1RVKA 2Z1XA 3RF9A 3QKZA 4CD5A 3KWXA 2OSXA 1N7KA 3UPMA 3N3TA 4LGXA 3JW7A 5CBJA 4CU8A 1OABA 4DO4A 1PKLA 3ALFA 2WW5A 2PDUA 1WZKA 1ZLPA 3ANUA 4WQ6A 5T8GA 4DYEA 3VDBA 4B5SA 1UZ4A 4O57A 1IWBA 1EFZA 1EOKA 1L2UA 1VCFA 4KETA 2V67A 1WYIA 2PWVA 4XZNX 1PJ9A 1ICQA 4JTGA 3RITA 1UD4A 2UY3A 3GDLA 1PVNA 5BXRA 1LBFA 3OG2A 1B31A 1KBBA 4M6PA 3P67A 2FHFA 5EYWA 3LNMA 3TYAA 4GO8A 1SFTA 4PTVA 1BLIA 3SUUA 3T55A 4NI3A 8XIMA 3LA4A 1CGUA 3SCSA 3KTCA 1HP5A 2WWCA 4A29A 3EX1A 4Z2HA 3FYPA 3I65A 3QC0A 2X0HA 4H8HA 5D9NA 4AMCA 2Z1VA 4PB4A 3G2GA 1J4EA 1OD0A 3RILA 4BK9A 2ZCGA 3RM8A 3UZXA 1U1JA 3U48A 1XL9A 3LYEA 4HZ6A 4XB3A 3VUPA 1ZY9A 1REQA 4RV8A 3V18A 2AAAA 4Y8FA 2VRJA 1O5RA 5BMXA 4C6KA 1DJQA 1VEPA 1QT1A 3TH6A 4ZMGA 1W37A 4ZXLA 3CHVA 1XLBA 3FHAA 3LUTA 4REQA 4J9NA 1UH3A 4V28A 2XU2A 4DBSA 1DTUA 3UA3A 2ABAA 1JZ5A 3W2NA 2EKCA 2ZUNA 2DT2A 5LIWX 1H5YA 4EAMA 3ABZA 1ZSXA 1PWMA 1FX6A 4H2HA 1F4AA 3H12A 4GACA 3G6XA 1PHQA 3BPWA 4LEFA 1VBHA 1E1CA 4O16A 4RPPA 1AODA 4B3ZA 2B4GA 2WM0A 2W9AA 3EOOA 4TQSA 2BGSA 3G1AA 1F9CA 2J62A 2Q6ZA 4C6IA 2ZRUA 3KBNA 4M29A 4XIMA 1SGJA 1UP3A 5JIPA 4PMNA 2VC9A 7XIMA 3OLGA 3F2DA 3EKGA 3HBLA 3AXMA 1B1YA 1KFBA 3VIPA 1HL9A 3ANYA 3P60A 4GH3A 1QWGA 1XDJA 4UTWC 5HA7A 3S2CA 2AQOA 3GG0A 3HQNA 3CIVA 4ACYA 1LT7A 3VD7A 4JFWA 3IIVA 1MUMA 4NVTA 3B8UA 1T3NA 3VIFA 1B3WA 1M6JA 4ML4A 4J2PA 4UFLA 1A5SA 3TN4A 4C7GA 2J6TA 4FHAA 4KW2A 2NUXA 4YXGA 4GG9A 5JU6A 4D6FA 4WK9A 1M03A 2PGWA 2V2HA 2HXTA 2D2OA 4E8DA 3RU6A 3OTRA 3U8GA 4I6VA 4JFTA 2OODA 4BI6A 1BKSA 4QSFA 4AZHA 4M6VA 5TF0A 1AK5A 4FZIA 3TMLA 5A8OA 1M41A 3DI0A 2XDFA 1WDPA 1HKWA 1HIZA 1LRNA 4PMYA 4AX7A 4M1RA 3ZYZA 2A5HA 1BVWA 3KS5A 1X97A 4B91A 1BG4A 1KM0A 5G5IA 2E67A 2HQAA 4FX6M 1GKQA 4NZFA 4M1BA 3ARPA 3FCPA 3QV8A 2D3LA 4PSPA 1UR8A 1Z9AA 1TPUA 4WKAA 3BCJA 3W25A 3KE0A 1H51A 2REQA 3GXDA 3LERA 4UFHA 4YYCA 4L1WA 4HYRA 3FA3A 4AG0A 1XFCA 2Z7GA 3LLXA 5H91A 2GDQA 3NSMA 4KGJA 4Q4QA 2AQWA 5A5WA 3AWNA 1NOFA 2HROA 2VJXA 3IJLA 3VOHA 4JYEA 2GLKA 1ZP3A 3W1PA 3GIJA 3H24A 4UNIA 2ASLA 3GG7A 5BRBA 2YW3A 4FX8A 1FWFC 4UTHA 2WKLA 5KT4A 3EOUA 1Y5WA 2D24A 4ROQA 1Q7MA 1CPUA 3VIKA 3TTOA 1EA9C 2DVTA 1W9BM 5KFTA 5ECVA 2F2KA 1EEXA 1ELSA 1ODZA 4ACZA 4GVGA 3NOYA 3F4CA 4G7EB 2I17A 3GKAA 3LOTA 4LFYA 5E0KA 3Q8RB 4JTHA 2DV0A 3C6CA 1JD9A 4FXFA 4AWEA 2CBJA 4E2VA 4W88A 2PU0A 5EA9A 3U0HA 1UIOA 5A3HA 2AL2A 3V16A 3GXPA 1MEWA 4G6CA 2XC9A 2QCHA 4IXHA 4S3FA 2G4FA 4D6EA 3WJZA 3DKJA 2XZ7A 3WF1A 2BHYA 4D72A 3ONBA 2PAJA 5HULA 3TYUA 3ZQ9A 2C2RA 4D71A 1RBAA 1CECA 4NUWA 1RSCA 3EMZA 4IZGA 2XH2A 4HHPA 3MR5A 4GX8A 5AZ0A 1M5WA 2YCIX 4WXZA 4WHBA 4RZRA 2VGGA 1HJXA 2ASHA 4IR1A 3M1ZA 1YE6A 4CKQA 3AUJA 2PTXA 1K3UA 3MI6A 3CXOA 1PWLA 5REQB 1LCOA 4DBWA 2ZA2A 1K1DA 3ZVIA 5BXSA 4AIOA 4MTVA 3QLLA 3F03K 1XX1A 2YB4A 4H19A 2FQIA 1UWSA 3LXAA 1UA7A 2BB0A 2BVTA 4PE8A 5LA1A 2YA1A 2IQDA 3ZT6A 2H8XA 3W28A 5BXTA 4LJ3A 1C93A 4O0ZA 4ED8A 5A6BA 5CZSA 1W3LA 1ME8A 4H7VA 3UWUA 1V6YA 5IRPA 6A3HA 1W9UA 1LQAA 2I5IA 4NZCA 4MNMA 2VA3A 4QNWA 2XFRA 3ABQA 1ZAJA 4AXKA 7REQB 2WVTA 1SM9A 3LG3A 3AHTA 4QWAA 3QH2A 1J11A 1RH9A 4MYXA 5L1IA 4LSBA 4OTKA 3AU2A 2HS6A 1PBGA 2JKAA 3LB0A 1SZRA 3VU2A 4Z0SA 1NFPA 1EKOA 2J47A 3VGHA 2QJGA 5FF7A 1O1ZA 1XM3A 4YHGA 2WWDA 3SCUA 1JRBA 5BNKA 2ONEA 2YFOA 4LVFA 3COTA 4NT0A 3VO0A 3BG5A 3UVIA 3T0TA 1DWGM 3NPWA 2HE8A 3WF0A 5D32A 4EEYA 4LV9A 1VP5A 3DHPA 3TTEA 2YR1A 4NAEB 1B3VA 3N2XA 3V1HA 1Q2RA 5CZ0A 4FO4A 4U3CA 3CASA 1VHCA 3W7PA 1G9HA 2HPIA 3L23A 3T08A 4B5VA 4DM1A 7A3HA 5HNRA 1T96A 3CAVA 2PURA 3T2QA 2GJPA 3BLPX 3DFQA 3CV6A 3QOMA 1RD5A 3VDGA 2I56A 1UROA 3PW7A 2YBTA 2IKIA 5FSEC 3MI2A 2D2JA 2XVGA 3R58A 2OZ8A 4U31A 4FI4A 4UQDA 3TC7A 1SFJA 3TW7A 2ZUWA 1J5TA 3MQTA 1HF6A 3TLQA 3FSTA 4OT7A 3I3DA 5CPTA 1E6SM 3LENA 5HMDA 3P0XA 3A4WA 3V0TA 3PBYA 4W4QA 2J75A 1PE1A 3WD1A 3C61A 1Q8AA 2W3ZA 4O52A 3UWEA 2W9BA 1T99A 3QHOA 2OXNA 4GZIA 3RX4A 1KTCA 3AISA 1X8CA 3ZJ6A 2ZTKA 1H11A 3MTWA 4J7RA 2ZWYA 2CZ5A 1S9FA 4PTNA 2VR2A 3RBEA 4L4PA 2G97A 3OLIA 3N18A 1QR7A 3LN3A 4HSHA 2W9CA 3TN6A 5KFCA 4GNKB 3DC0A 1YLVA 3INPA 3CB8A 2P0OA 3GVGA 4JFVA 3P82A 1AMYA 3NM3A 2A6NA 3CMJA 3T40A 3VNMA 3PG9A 3TTYA 3PR2A 2AQVA 1JQVA 3HMCA 3S9ZA 3BMWA 2HV5A 3DFYA 3WL1A 5L6UA 2DJXA 4OBSA 3S46A 1TPC1 3GU2A 3TQKA 1NM9A 2D2GA 1Q4WA 2VOMA 4FXSA 2OELA 3EWDA 3A3XA 3HJZA 1DQXA 5EB8A 5C71A 3G18A 2WLYA 3EAUA 3NXFA 3TZFA 1J10A 4W7UA 4IPJA 1ESWA 2CBIA 4HVXA 2A2IA 4Z2IA 4DL2A 4AB4A 4JY9A 4J9OA 4XBJA 3S6TA 1UW9A 4M3PA 5LA0A 3MZ2A 3PVFA 1SMDA 3PSWA 5BOEA 4QXIA 2GVYA 3R13A 1PKYA 2NQLA 1EGZA 5SWUA 1XUZA 4MWAD 1BXCA 4FXRA 2W62A 3KW3A 2JF6A 4Q4PA 3V5CA 1YE4A 1OSEA 1TTPA 1XIDA 4JNMA 1YQ2A 4RZ5A 4DI8A 3W81A 3BLKA 1DWJM 1QATA 4HNOA 2HVMA 5DX7A 3EA2A 3R0DA 1TMQA 1V0MA 4XSLA 5CG0A 1A53A 3CWOX 4DJEA 2IPFA 4D2JA 1XYAA 3VCRA 4QAIA 4H7CA 2QS8A 2CLPA 3MSDA 1TPVA 3SGGA 4JNYA 2RJGA 3KZPA 4LF1A 2OLAA 4LAZA 4CQCA 2IXVA 5DF0A 3TSBA 3M07A 1CXKA 2EPMX 4V1YA 1EGMA 4B5XA 1HGWA 5A69A 3AIWA 1W0MA 2WCAA 5BW6A 1CT5A 3TOPA 4ATDA 1R8LA 1D7FA 3SZ8A 4MF4A 1M65A 2UZ9A 3MCOA 4IXXA 4XTDA 4L6HA 4ECYA 5JBFA 3P14A 2GOKA 1ONXA 1U5HA 1LORA 5I3DA 4B15A 4N0RA 4JTLA 1K8YA 3SY1A 2IPWA 3AOFA 3BO9A 2NQJA 1GJPA 3WD0A 2WC3A 2YCJA 3NYZA 5KFFA 3HG5A 1HUVA 4XO7A 3MI3A 1UUOA 1FWDC 1SR9A 4OKDA 2P10A 3H2NA 1TVPA 4ZOEA 3U9IA 3UT0A 3RCMA 1G67A 1FFQA 2Y7EA 4GC3A 4UTTC 4DUOA 4IICA 4QW8A 1H62A 2H9AB 1P6CA 2H6RA 4TUFA 1PS9A 2OYKA 8CGTA 3T0AA 1JCTA 2FVMA 5JQ9A 3G6VA 4JZ5A 4ZQOA 1FA2A 3JU2A 2C13A 1FWNA 3F2BA 2CNCA 4FS2A 1YXDA 2GVLA 3CTLA 4XZHA 2QIWA 3QKEA 3KLKA 1E51A 5HMSA 3CAKA 2FTWA 4ZR8A 3W2KA 1VPQA 4ZGYA 3NO1A 3BMVA 1S46A 5H6HA 2IA6A 4LYPA 4HTBA 1LWJA 1MVYA 1IHIA 1ZU8A 2A4AA 3T07A 3NPUA 4A6GA 1ISZA 1C8XA 5C0QA 1PTGA 2QR6A 1WUEA 5D04C 2WOQA 3VOGA 1RYRA 3ZVHB 1F6KA 4QS6A 3CTTA 3UNTA 5EWGA 3O16A 2WQPA 4L4OA 5D9OA 2PBOA 1EEPA 5CPNA 3MWCA 1GYNA 4MVAA 7CGTA 3NL5A 1KGUA 4Q4KA 4F4YA 4JX6A 4ED0A 3M16A 2C2DA 1GZGA 1QOXA 3WFLA 4AUBA 4NZJA 1FHVA 2VTFA 4NJJA 3KRZA 1IR1A 4KEMA 4J3WA 3F4VA 3SFWA 2YLAA 3ZLGA 1GYMA 3F5JA 3LX9A 5EBAA 3WJXA 3O7UA 1KC7A 2PWGA 3IJ9A 1QRQA 5D2YA 1ZBKA 2WM1A 2D2HA 4RE0A 3CEPA 3IRSA 4HHLA 2OQLA 1EJUC 2PP3A 3BAJA 5I07A 3PB2A 1NFGA 3RO8A 1J8VA 3OLDA 4PMQA 1XC6A 2I5GA 4HCHA 1TRIA 2NXGA 1FWTA 3AAMA 1E6NA 3GY1A 3S2JA 1JQXA 2DH2A 3WF3A 1P7TA 4K39A 5E5CA 1NY1A 3DIPA 4YR2A 2BY3A 1PDZA 4YTSA 5CJNA 3IK4A 3VZZA 2WCGA 3K2GA 3A22A 3HPZA 3N04A 1P6BA 3L4UA 2TODA 1XLDA 1JYXA 3R10A 3QLDA 2PZ0A 3GDKA 1G0CA 4LUSA 3E0WA 2DJLA 1HL2A 1ITQA 1LWHA 1DIOA 4RJEA 4YN5A 5E09A 1BVNP 2J7DA 4BWLA 3Q8QB 4LUTA 1KNWA 5KETA 4GI6A 4R9OA 1QHOA 4W5UA 4FOUA 4G8TA 2HDJA 2J7BA 2GGGA 5IDIA 1PL9A 3R1ZA 1V6VA 4UIOA 4IRCA 4LS1A 3IUIA 2VI0A 4YJ5A 4I7UA 4LBSA 5KT7A 3NQBA 2BOFX 4R5EA 5JUMA 4P7RA 1Y65A 2RHGA 3AHYA 1RUSA 4JYDA 1JCJA 4NXSA 1FKXA 4YIWA 3R6IA 3NQGA 3WUBA 3IPWA 5GNYA 5CC6A 1CB2A 3IUHA 1ZJIA 4HGXA 4Y9OA 2ZX6A 4M24A 1RY8A 3A9IA 3EWZA 4IMAA 4ORMA 1T0OA 3W76A 1HKJA 7PTDA 4NHVA 4E2BA 1PX3A 3QPZA 3EPOA 2X1TA 1OINA 3H54A 2ZQ0A 5ABGA 2FB3A 3CL7A 2W7PA 4Q4RA 3RRAA 4C1KA 1H0IA 4XD3A 3HTWA 2ALRA 5CGMA 1LDCA 1XLMA 3M47A 4NZ1A 4DL6A 1F8MA 1I8JA 3Q45A 1B30A 5TQLA 1J93A 1KM4A 3ZZ1A 2ZRWA 1DV7A 4HZ8A 1M7PA 5DO8A 1VJSA 4W85A 5EKYA 5I09A 1HKKA 1VFTA 2E40A 3ABOA 3VKDA 2D0HA 4AWUA 5FL0A 4CD6A 3KHRA 3MMTA 5CXPA 4DF2A 3C56A 3SRHA 3C0JA 1RV8A 3BLFA 1RBOB 2Z27A 1E1FA 4M51A 2YDQA 1I75A 3N2BA 4ALDA 4L9XA 4LC8A 4YNGA 3CUHA 3RB3A 2GJNA 4AY7A 4FLQA 3W2UA 2FZ8A 5LA2A 3M0IA 2YB1A 2ASJA 5GNZA 1FCUA 3T5JA 1S97A 1ZQ5A 4HB7A 5C9WA 3UR5A 4P61A 1DXEA 3DGRA 4QBXA 3LU2A 4CGTA 2GVGA 2YOCA 1SR0A 1S5WA 1E0VA 5I3JA 4KKXA 1FXPA 1F3EA 2MNRA 1A3XA 2ZUSA 4HU8A 4IGSA 2JE8A 3W29A 3BQ6A 5A2CA 3CM4A 1KCZA 4PR4A 5F2IA 2WZHA 1JNEA 3NDYA 4RR4A 3LTPA 1J0YA 1RLCL 4DB7A 5AHLA 1Q8JA 1LL6A 4UC5A 2PCEA 4CD7A 4H2CA 1Y5XA 1E5NA 4KRUA 1VFOA 2BODX 4MUZA 1JPIA 3BSMA 1PYFA 3RB4A 4M19A 1M01A 2WV8A 3DHFA 3LLDA 3E2RA 3WFAA 3OOQA 3IJQA 2ZOXA 4MDPA 2IBKA 3TR2A 2BOEX 5F4WA 4IFKA 2C15A 2GSJA 1ZAHA 4ZB5A 1FUYA 2VO5A 3LHVA 3B8TA 3GC5A 4ED7A 5A6BD 3WSUA 4LPCA 4IX2A 4H83A 4N6FA 1YHTA 7TIMA 4JTRA 1HQTA 3NEVA 4MWAB 3W2MA 4C1NA 4HA1A 3W9ZA 1G4SA 4B16A 1S5VA 3KHLA 4GXMA 5DMMA 3QYQA 3MVTA 2OLSA 3F5KA 4B9YA 1JXKA 3G1SA 1EJSC 1VEMA 1O6IA 1H1ZA 3QY7A 1UKSA 2DIKA 2DZXA 3S1VA 3WDIA 2HPMA 1JF5A 3BVJA 4QQUA 3LHZA 2V5CA 3SI8A 3ONCA 5A6AA 1GOQA 1AJZA 4XVDA 4J1OA 2X30A 1KQYA 1I2RA 2QT3A 1PZ2A 3VMNA 2VR4A 1PSCA 1V0LA 2YDRA 3C8NA 3G1RA 2OG9A 2Z1BA 4E3VA 2JKPA 2DW6A 2NT0A 3GIYA 3THQA 4H41A 4HJWA 1C9WA 4DYJA 3E02A 3JS3A 3T9PA 3QQ0A 6XIAA 3QQWA 1GT8A 2OX1A 4JR5A 3MDUA 3RAOA 2PP1A 3A47A 2NQ9A 3SB0A 4C6EA 1KM6A 2R8JA 1SVDA 4ICCX 3UCQA 3A3HA 4H8VA 1R7OA 1VEOA 3Q2DA 1OCJA 1DWHM 1UH2A 3NAVA 1Z69A 3TSMA 1C3FA 3CLMA 2RDJA 1AZ1A 3M64A 1ZBVA 2VUNA 1CIUA 4KS0A 2GUUA 4RNHA 1W9PA 4HK5A 3H6OA 1FWCC 2PTYA 1S0MA 3MPGA 1DJYA 3FOKA 9RUBA 2R14A 1V7AA 4DAFA 2ZZ6A 4IT1A 3T8LA 3WQEA 5A8NA 3P6LA 1GPFA 2QCDA 2XIJA 1QPQA 3KZSA 2W79A 1ZHAA 3LGEA 1I4NA 3C2RA 3E1F1 1T94A 4MB5A 2AGTA 1ME7A 5CH9A 2ACQA 3WCZA 4WKFA 1GQKA 4UCGA 3TSDA 2EXOA 4QWEA 4O1DA 1J18A 3QEZA 1YDNA 4REQB 3HIJA 4LRSA 3WQFA 3APTA 3C2YA 3CLWA 4PB3A 5BOFA 1X1ZA 2O9PA 3SR7A 2QGHA 3QMTA 3OSNA 2DZWA 3RMEA 3E6EA 4KCTA 1H5VA 2ZC8A 4M81A 3SJNA 2GVJA 2XCAA 4HU0A 4BF5A 3ES7A 3W84A 4ZL1A 5C9XA 3E12A 5I24A 3AZSA 3BICA 3K8MA 1OADA 4J40A 3WK0A 2JGQA 3OVPA 5IFPA 3WDHA 3STCA 3N6JA 5KG6A 4ERAA 4NYUA 3ES8A 4S3CA 1OCQA 2G5WA 2ATMA 2VEIA 1S2CA 4D6DA 3W07A 1OVDA 4BFAA 4A3RA 3CYJA 4IFOA 3CUJA 3WELA 1J12A 1XYCA 3QY6A 1JAKA 3MSRA 2P8BA 1QI0A 2ZIDA 1U1UA 1CGWA 1FCBA 3PFMA 3WQGA 2QUTA 5KFYA 1RD6A 1EF3A 3NQDA 1XP3A 4DJFC 3GUGA 1XSKA 3NNTA 3CZEA 3EX4A 4JQ1A 4NX5A 4P7OA 1V03A 4LY4A 3UZ5A 3G5EA 1JZ6A 4ZEPA 1W3JA 2J7CA 4DJED 1SYTA 3SUWA 2WANA 1QI5A 1GW9A 4FA3A 2X8RA 2QCFA 4WIWA 3AC0A 1JEZA 1U30A 2B0MA 3WF4A 3ARQA 4UTIA 4BA0A 2ZRXA 1NF0A 4J9JA 3ABRA 4Q22A 1EDGA 5IXEA 1XD0A 4K7VA 3NQ6A 2CU0A 2GQ9A 3E96A 4RDWA 1JULA 1PXGA 1VPYA 1UR4A 4U4MA 4XISA 1J0ZA 3UG8A 3HB9A 4BCEA 1E71M 1OJXA 2R1MA 2W66A 1GOIA 4MJZA 1B3ZA 4QHRA 1K8ZA 4JTUA 1I0DA 4AEEA 3H4XA 3TYZA 1EIXA 2YBUA 4LF2A 3TJIA 1C9DA 5DGAA 2WJDA 4OJYA 2XVKA 4KRTA 1WZAA 1F2JA 4GXWA 3R8GA 4DWDA 2WNWA 1NWRA 3N19B 3GDBA 5L1JA 1FH9A 4ECQA 2GOUA 2PWDA 1C91A 1X1NA 3FW6A 3I7SA 3SAZA 4MKNA 3GSMA 4Y8EA 4J3ZA 3W88A 3DH7A 5E9XA 1UKPA 2XYLA 5AC7A 2ZRYA 2YL9A 3SQMA 6REQB 3H23A 4GCAA 1NH6A 3GNXA 4CCDA 3PZMA 3TC3A 2E77A 4QWCA 4UUIA 3GU9A 1XKYA 3HMJG 2R1NA 4LYQA 2QUMA 4KCUA 4M6QA 4G3IA 3HN3A 1QPRA 3L4VA 5C8BB 3L4XA 4TO8A 1WNOA 3T2PA 5LIUX 1NWUA 1GTEA 2X41A 1UP0A 1PB0A 1GVOA 1L6GA 5ENLA 4BEUA 1F6YA 4Q8NA 1S3HA 2GWNA 3LPPA 3GBDA 4G1KA 2AL2B 4E38A 4RW3A 4GQQA 3B05A 4QR6A 2NV9A 2YGYA 2NUYA 3SCQA 1JZ8A 4TV6A 1E6XM 1AQFA 1EXBA 1YDVA 3CUIA 4MSSA 1JZ7A 1KRCC 2BLEA 4O18A 3PR4A 2E6AA 3H2FA 4YL2A 4GI8A 2Y4SA 3GC2A 4UOJA 2HNEA 4TQRA 3FA5A 2WVVA 1CGTA 1V0KA 3DU0A 4I7VA 4IIEA 4Z42C 2ZZ3A 1QHPA 1UKQA 4C6CA 1D3GA 3SGZA 4NRRA 3FEMA 5JIWA 2DSUA 3PULA 3RG6A 5HOSA 1RP8A 1AJ0A 3VX0A 4P7LA 4FP1A 1S10A 3LLFA 2Z1KA 3EWXA 3UGVA 2VCBA 3KRUA 2DSKA 3PUDA 4ZOBA 5DMLA 4WOQA 2ZX7A 2PDQA 3BC9A 1AZ2A 1BWVA 1RK5A 1K7FA 1CX9A 3EEZA 3O6DA 3NEHA 3P81A 2CYGA 1B9BA 1KBKA 2BQ3A 1KCLA 4JX4A 2QDDA 3EXSA 3NCOA 3H70A 4FIQA 2HBVA 4JL2A 1WDSA 5T26A 2BG5A 4C6BA 5LIXX 1DJHA 5A6TC 4F9DA 1AQHA 3DZ1A 1HO1A 2V3DA 3WQPA 4E8CA 4DQWA 3PJUA 3N15A 4NF7A 4V15A 2A1YA 2B7PA 4Q33A 1QW8A 1NIUA 4N9DA 3LSBA 4GZEA 4JX5A 1RBLA 4O3QA 4R33A 1LLZA 1BPLB 4NNBA 1QO5A 3GLCA 5IOBA 1HJWA 2VEKA 3CO8A 4F2BA 4HYVA 2EPNA 2V69A 5I3FA 2P8CA 4CN1A 3CUXA 4WUIA 4AISA 3HFYA 2GDVA 4O1EA 1IE7C 2Y8KA 3C3NA 2VA2A 2CERA 1KD0A 4EAYA 3THAA 4QEHA 2NV1A 1OC6A 3E49A 1GOMA 4C7FA 4RDZA 4GXPA 3SUSA 5HR7A 3O9NA 4IH3A 3R89A 4BQ5A 1W1TA 2NX3A 3WMSA 1EF2A 4ZO6A 3ZSSA 4DUWA 2ZX5A 5JXQA 1F73A 3NQVA 3A64A 1LBMA 3H40A 1A47A 1AUSL 5GJPA 2Q8XA 3SW6A 1UQYA 3W86A 1VFSA 3BAKA 5KZDA 5LNUA 1A0DA 1TPEA 4HP5A 3GNPA 4UR8A 2PRLA 5FSDC 3HU7A 4EBCA 4I5UA 1JRCA 4UTWA 2O9TA 3UXDA 1HJVA 3ARVA 3UERA 3QPYA 3LRKA 1L6FA 4N9CA 3UPWA 1H41A 4NJKA 1GK8A 3N6QA 3VDAA 8A3HA 1AJ2A 4GVIA 1CI1A 1H63A 2E5BA 3OGRA 3I6EA 3S9IA 4HIBA 2BASA 2O9RA 3KOXA 4JQ2A 2PDWA 1Q6LA 2A3AA 3F5LA 3L7RA 1W5QA 4TX6A 2Y2WA 1EUAA 4M6UA 2XGPA 4RNNA 2FJKA 1CBGA 4Y9PA 3L0KA 3RLHA 1VYPX 3EA1A 2O92A 3W87A 1A50A 3NSXA 1FWAC 1V3LA 4AHPA 3U7VA 3H2CA 4EF9A 1DJNA 3OP2A 3WLTA 1PTAA 1VHNA 4Q6JA 5KT2A 2PDKA 4ZE4A 3W2JA 1LL7A 3CC1A 2D69A 2R6OA 4C91A 3PWAA 2X0YA 4JTFA 2OSYA 2BDQA 4W8AA 1FKWA 4BS0A 3T44A 2WMIA 1XQKA 3O63A 5DELA 3PTDA 1CXHA 3UU0A 3QJAA 4F66A 5M03A 3T78A 2P1FA 3TXVA 4F4ZA 1OX5A 4DLFA 3MT1A 3AS1A 3OVGA 2G0WA 3H55A 3R25A 4L6OA 1UR3M 1A3HA 4OQVA 5ABFA 1Q85A 3LDVA 3OSPA 1GKRA 1EC9A 3S47A 1KWGA 1A5KC 3R0UA 1LRQA 5GPRA 4ZZ9A 4ZVJA 2JEIA 4R53A 3CT7A 3AZRA 1E15A 1OY0A 1UKOA 1JPDX 4DXKA 5I0DA 3FV9A 3BLLA 3C4UA 3AICA 4EYIB 2EKGA 3VNIA 3UEQA 3TYBA 2JEGA 5DBUA 3U57A 3KVLA 3UG5A 3V0SA 1KXVA 4FNTA 4V2XA 4HKPA 1KR0A 5AHNA 2JKEA 5FJPA 3TX9A 2I16A 3U2ZA 3P62A 5D4YA 4QP0A 3GNRA 1Y0EA 4MFDA 2HSAA 4GIYA 5F4XA 1FCQA 2FLNA 3VIIA 3DAQA 2BY2A 5F1VA 3UR7A 1R3WA 2R94A 3RLGA 2MUCA 1IIHA 2AQ4A 1VS1A 4AWTA 1TWZA 1LL4A 1D9EA 1V3HA 1TPH1 5A6KA 3N14A 4DNHA 1T8XA 3HG3A 3TQ0A 4LUIA 5M17A 3MANA 4AXNA 2PGFA 3T05A 1EWEA 1OFEA 1ZAIA 5FACA 1OFBA 2PRHA 4PBFA 1O66A 4O0KA 1JDCA 3G1DA 1SZEA 3KRSA 3P3BA 2J25A 2VX7A 2YL5A 4DHGA 4TVCA 1S0NA 1C7TA 4FEZA 1KBJA 1GWJA 1EGVA 4JTSA 3MC5A 4TTGA 5HJYA 5HMEA 3W38A 2AGOA 1OK6A 3QPEA 1XIHA 3GDRA 4HTYA 4ADTA 1O94A 4AC7C 4LH8A 1ITCA 2BOGX 4PMUA 1W17A 2IQ0A 1VQTA 5EU9A 3IN5A 3HZ3A 1PO9A 3N25A 4GX9A 3S83A 2VRQA 3WEZA 4EKJA 2PDBA 3BJYA 1XCWA 4W5ZA 1MQQA 2W63A 5JBDA 4AD5A 2DZVA 4WDWA 1D3HA 2RDWA 3H2AA 4JKMA 4P2VA 1QPKA 5IFTA 4HN4A 2PS2A 1R30A 2Y7DA 3EDJA 3KLLA 3QHMA 3W73A 5L1LA 3CB3A 4YLWA 2ZRVA 1S2AA 3VC5A 1H2JA 1RR2A 4WGXA 2ZBTA 4HMCA 3AIVA 4EXQA 4GIRA 3PY2A 4S1FA 2C2EA 1F3XA 4KFNA 3RPDA 1XGEA 2YJQA 5I77A 3U5UA 3NFUA 3D5HA 3W7CA 3MYPA 5TIMA 4DELA 4C5ZA 4US5A 1VYRA 3PZNA 4IPNB 2WXDM 1HKVA 1E40A 1TV8A 3VA8A 1XPGA 1VIZA 2ASDA 4G5DA 4HSNA 3VX1A 2QAFA 4GE8A 3VGGA 3S5YA 3W0KA 3W7DA 1UC4A 1RJPA 1QPOA 1UG6A 1WPCA 3DCPA 1HKIA 4H9UA 2DQXA 1Z89A 4GQ0A 2OT0A 3DFSA 2ZUMA 1R47A 1WDQA 2CITA 4GVFA 1O60A 3NUKA 3M7WA 3AJ7A 3LV5A 1JCYA 3QFWA 4N7QA 4F3HA 2V81A 1LYXA 4JCLA 4FBTA 3VGEA 4WRHA 3TJXA 3FDKA 3KVKA 4JEQA 4R9XA 3A3WA 3W82A 3MMUA 1NU5A 3W1LA 4IPIA 1SJAA 4UQ9A 4GFSA 4ICMA 1GJUA 1ISXA 1I2QA 3A4JA 4XKMA 1TV2A 3NGDA 1F3WA 3WQ6A 4BR1A 1NP0A 4A05A 2QUVA 1OX4B 1K02A 4DRSA 4Q45A 3CIXA 1OWQA 4GA8A 5FD0A 3DX5A 1XKJA 3UGRA 1POJA 3QY8A 1CZ1A 3TAKA 3B06A 3S8HA 3A13A 3MB9A 4WJXA 4L7ZA 2DZUA 1K03A 3EYPA 3T0CA 4POCA 3GVWA 3U2CA 2R8KA 5EDWA 4PUNA 3AUOA 1LLWA 3EOLA 4LAOA 1D8CA 2IXUA 1ONEA 4M5PA 1WV2A 1WO2A 5KZMA 2XJ7A 1VPXA 1GQLA 3WQDA 3G1YA 5FEXA 1W5MA 2LLEA 5HAOA 3C2OA 3VE9A 1TZZA 4D6GA 1PKNA 3E0VA 2WZMA 1XD1A 1GONA 1JD7A 2QVHA 2AGQA 1N82A 4DL7A 3QBUA 1BKHA 3IS4A 3I3BA 3I68A 1DKWA 1F74A 4Y9AA 4GUHA 1VGAA 1MWOA 1OGGA 4DVOA 1OM0A 2C0AA 5K9XA 4B9ZA 2NV2A 5IHRA 2VFHA 2FHCA 1ZBCA 2ZX9A 3GV5B 3HPSA 4N9BA 4MOZA 4MWAC 4H9ZA 2HVNA 3A9BA 1RA0A 5J5RA 3GXIA 4INFA 1C8QA 3CL8A 5FCZA 4M0XA 3RBDA 4DO5A 2R91A 3GDMA 3DFTA 4A8IA 1D8WA 2NQHA 1BYBA 2ZXDA 4U5IA 3G1FA 3URQA 3CS2A 3N2MA 3K13A 3ZT7A 5C55A 2OQHA 4O4VA 4NNAA 4ZOAA 4K3ZA 1BSIA 1FBAA 4RPQA 3JZEA 5M3WA 4D6JA 2XFFA 3Q37A 5C9RA 2NW0A 4GC6A 1XH1A 2W92A 4C6DA 3L5AA 3FS2A 5CG7A 3D0CA 4E2OA 1S38A 3QV9A 4PMDA 4LYKA 2BZNA 1JJKA 1QK0A 2J6XA 5DCDA 1BGAA 2J9XA 5FAGA 4E3TA 1WQ5A 4EPBC 3LBOA 2VYOA 3AXIA 4AVFA 1XJBA 5LXEA 3QV6A 1IWPA 3T42A 2VZUA 2Y5JA 3BG9A 2O7QA 2HVOA 2B7NA 3SUVA 3KWSA 3HV9A 4W93A 3VOFA 2RDTA 1G4TA 5K2ZA 3W7KA 1ITXA 2FZBA 3RR4A 3B0PA 3II1A 4R7JA 3EWCA 1O5QA 2E5DA 1Q2SA 1JZ4A 4EXBA 5CCZA 2WHKA 1YYAA 4HZMA 4MJ2A 3VMPA 3DDMA 2C19A 3E0IA 1ZUAX 4GI9A 3HF3A 2PD5A 5L9FA 2PDYA 5KFDA 1WB0A 3G6YA 2DPJA 4AD2A 1DEDA 1G5AA 1TO3A 2WO5A 4J4KA 2V2CA 4QFUA 5DQPA 1TPFA 3TYDA 4AD3A 5LGZA 4YMZA 3VGDA 1UJPA 3MCNA 2F38A 4FSAA 1J01A 3R8HA 4AEOA 2QJNA 1RPXA 1S1PA 5D2VA 1X6UA 5D9MA 3HM7A 3DG3A 3RB0A 1PHWA 4IFKB 2W0UA 2DU2A 2IPGA 3A5VA 5LIYX 2EG8A 1FQ0A 2VCAA 3H4DA 3RK8A 4X3ZA 3WN6A 3AMCA 1R85A 4XTIA 4NP7A 1WZMA 3PR5B 3APGA 3WBEA 5KMYA 4FS1A 1JDDA 3I7QA 5J8LA 1I2PA 1WDWA 1U2YA 4YCOA 1BQCA 1MQPA 2VELA 4JBRA 4WY0F 1R9XA 1WX0A 1UASA 4MPKA 2VD9A 3VD3A 4IGHA 2GZXA 3NDZA 3WLLA 3OJGA 5I79A 1J2WA 4BJHA 3RHGA 3ZLHA 1UHVA 3KTXA 1OYCA 4Y96A 1W3KA 1FP9A 4ENLA 4FK9A 5A95A 3L12A 3CV2A 3VIJA 4CQDA 3UPBA 3KM8A 3AMGA 4GABA 3UQNA 2X16A 1TTQA 1W8SA 1TX2A 1Z48A 4B90A 1PYMA 3NGJA 4AZGA 3MO7A 1OF8A 2JIWA 4OOUA 1X39A 4WSJA 3KL0A 3CO4A 1P48A 2OO6A 3PWGA 2WHLA 1XW8A 4PCFA 3Q8PB 5CPSA 2C14A 2XSAA 4DF0A 2TYSA 2WMJA 4H00A 5H1WA 3SIZA 2GJRA 4KWUA 2GL5A 5E93A 3AALA 2HZGA 1A80A 1WZLA 4YPJA 4ED6A 1V79A 4PODA 4QNEA 1U5VA 3T5LA 3LHTA 2FKPA 1SQ7A 3K4WA 3L5LA 4CCEA 1AH0A 4CUCA 4GOAA 4HNNA 1RALA 4LAKA 3QFEA 2BS9A 2G95A 3OBEA 2OTDA 3EA3A 3IAQA 4JHMA 4PFHA 1E43A 4LUYA 3ZIZA 2GGIA 3FJ6A 4L1GA 4YWSA 1D3CA 4GI4A 2Z26A 2CHOA 3HA1A 1UR0A 4OUEA 1GZ1A 1SJCA 3PPHA 1HJSA 2FYMA 3HPFA 4L61A 1HZYA 3ZWSA 4LAMA 3PBUA 4JV1A 1ZL1A 3W1MA 1FH7A 1V51A 2P0IA 4M7TA 3MBFA 2OZ3A 3USZA 3LY0A 1Z3NA 1KA9F 5E0FA 2O9OA 2NWSA 2YZ5A 2W8KA 2X1SA 1UPMB 3GFXA 3UVAA 3BOFA 2W9MA 2VM8A 1PIFA 1I60A 3NL3A 5A8MA 3RMJA 3SN0A 4F9JA 3EPGA 6ENLA 1V6TA 1EHAA 4NIRA 2ZE3A 3PC0A 2YCEA 3QGVA 3ABSA 1OK4A 4MGGA 5L1KA 3PZTA 1DL3A 1RQEA 4UTJA 3VUSA 1XRSA 1EQCA 1E0XA 5KG0A 3N73A 1W2VA 4JTJA 4A8LA 1AH4A 4IQLA 4U10A 5HJXA 2V9WA 3VIOA 2QZRA 5ABHA 2XGBA 1UBSA 4NU7A 3WX7A 3EWBX 2V0TA 4MAZA 2FIQA 3D3FA 1MXGA 2C28A 1PZ3A 4HD5A 4B3LA 2WVUA 4HQVA 4CNNA 3VKBA 4ZB2A 4XAGA 3QC3A 2BBFA 2EG6A 2VQUA 1KM3A 3R0KA 1Q6EA 3BCDA 2HRWA 3CMFA 5DMYA 2XVPA 3NQ8A 2A3CA 4O15A 2OO0A 3PF3A 3U2EA 2IUZA 2ZVIA 4AF0B 1TVNA 1W1B1 2Z7KA 2HS8A 2Y63A 1U1HA 1QBBA 5FJJA 3VAVA 1V6WA 4H9VA 4IP5A 4UQEA 2J79A 4D8AA 2IMWP 1Q6CA 3IGUA 3QVQA 2O56A 4N4PA 2BTMA 5FJTA 3ITYA 3HPAA 2PCQA 2QJMA 1R2RA 3OHBA 3GK0A 1S2WA 2J7FA 1E4IA 2Q8LA 4B4FA 1Y7VA 3GR8A 4Q8FA 1LTDA 3HFTA 1ZZMA 1VFUA 1H0GA 2W6RA 2H90A 5FI8A 4R8UB 1O1HA 3JZUA 3WQ8A 4K1GA 3N29A 5FIPA 1C7SA 4DPPA 1P0NA 2VC7A 8RUCA 4C6FA 4CNOA 2J7GA 2C8NA 2FPYA 5AYXA 3GRIA 6XIMA 2EGZA 4FBUA 4ECWA 3W83A 3WMCA 4A8NA 4CLMA 4GCXA 3GG1A 2BSLA 2VFDA 1HX0A 1ADOA 5CSUA 5HINA 1KTBA 1PZ0A 3LCLA 3DXIA 1C90A 5I03A 2AKMA 4O53A 1Q45A 1VRXA 3ZOAA 3EMCA 2HWGA 4MZ8A 3RM9A 4UTFA 5HATA 5KG7A 1VBRA 3U6WA 4ECRA 1BRLB 3W4RA 5BXPA 3L2MA 1HO4A 4OBRA 1MNSA 3F4NA 2PP0A 1S0OA 1JVNA 2RH9A 3FSUA 2YW4A 1RZMA 7TAAA 1JPMA 4O3SA 3LHUA 3T2OA 5E1QA 1KRMA 4I5XA 2PDCA 4UMCA 4CNTA 4E8GA 2FVLA 4NAFB 4UB9A 4FMVA 4L65A 1GG0A 2R8HA 5JBEA 5K3VA 2IW0A 3CT2A 3GHUA 4N02A 4ECXA 2P76A 5H8MA 1L2QA 4JL1A 1UP2A 3U7BA 4UTKA 3CHEA 3FFSA 1XISA 2C1HA 1GG1A 3THUA 2XGQA 2ZDRA 4FS9A 3IIPA 3W3OA 2HMCA 4IX0A 1MW1A 3DEQA 3EOSA 1GPWA 1PKMA 2QJIA 1B3OA 4AC1X 4A2RA 1UIPA 2E9LA 1W1A1 3CV7A 4C90A 1BQGA 2VT0A 3WK3A 2TSYA 1DE6A 3KL3A 1TWIA 4L56A 2CKSA 2VKZG 1Z44A 2ACUA 1UMLA 1WXJA 5DY3A 2Z28A 3EDEA 1TPWA 2QW5A 3GH4A 1FDZA 3FGCB 3SSZA 1YNPA 3ZFHA 4Z2KA 1JFXA 2VGFA 3D3AA 4KERA 3WDQA 1M68A 4WSKA 3AROA 1JPHA 1OBAA 1LUCA 3GIPA 4GNVA 3SQLA 1MDRA 2BHUA 3DBPA 2KAUC 3R94A 2EEXA 4YYFA 5CC5A 1G01A 1JIBA 4EYHB 2VZTA 1Q13A 5I3KA 5C9UA 1EJ7L 4LANA 4DWSD 4Z2GA 4CQBA 5ABTA 4GYKA 5FEZA 2G3FA 1XG4A 3S4TA 3CJPA 1R2SA 1R87A 3LXBA 3WKZA 2PDHA 4QJ1A 1CXLA 1XCFA 4WR3A 3FXYA 2FDMA 2QDHA 2DZTA 4RK8A 3BQ2A 3WH7A 2PBGA 1YBQB 3ZSTA 2UVWA 1TREA 3ARZA 4PUKA 3ITOA 2YYTA 1X96A 4F0KA 2FLIA 1DOSA 4JCMA 5C2CA 1ADSA 2XG9A 3CMGA 4DM2A 3PZ9A 4J9QA 1UMYA 3FKKA 2J6SA 4ERIA 3P93A 2C3ZA 6TAAA 5AC5A 3WJSA 4FNPA 5C5YA 1NARA 4EK7A 1KB3A 4O1FA 5I23A 1OZMA 5G1TA 3FDSA 4JQ4A 2PLKA 4E0CA 3DI1A 3PZVA 4JN7A 6TIMA 1XBVA 1XYLA 2HCVA 1A0EA 3UYCA 3MP5A 2E09A 3PW4A 1I1XA 1QU4A 4Q7BA 2UVUA 3VYLA 4CN4A 2RUSA 3C3UA 3QTPA 1NELA 3WBAA 3V7PA 1WKDA 4MHBA 1EJWC 3VGFA 4MUPA 4QISA 4D6HA 5B80A 1MXDA 4UCFA 1S5TA 4A8RA 2I7GA 3GTIA 4U3AA 3B0UX 2F2HA 4AIUA 5H2ZA 3V3WA 1AD4A 4Q4OA 3VZXA 3NQAA 1BEUA 4HA0A 4MFEA 3OGVA 2OX4A 4ECSA 3W02A 2FB2A 4PMJA 2WZTA 4HNVA 3N4FA 2WKGA 5KFJA 4PGLA 4ZQNA 3E2QA 3MS8A 3DYMA 4ZA0A 1ZB5A 3LTYA 1WBHA 3W6LA 3T09A 3GFYA 5I5RA 4RE4A 3NZQA 4FALA 4G7EA 2VXNA 2J27A 1XYFA 4DJDA 4G2DA 4HPGA 4JTDA 1AH3A 5KFMA 1OX6A 4I9JA 3LHWA 1PIIA 1S39A 1E0WA 1I1WA 2QPSA 4PZVA 2XIBA 1V77A 2GFTA 1LP6A 3CHFA 3FKRA 4JQ3A 4DJEC 4ATWA 5AC6A 2JF7A 3GC4A 4OOZA 2YL6A 1Q5MA 1Q6RA 5I00A 2ZZ2A 3WDJA 2VVSA 4DJFA 4PA8A 3SIMA 5G2WA 3BW2A 1GNXA 1X98A 4DX3A 3BQ0A 1DHKA 1YNYA 2BQUA 1XQLA 1JUBA 2CKRA 4RZ6A 4DLMA 2VDGA 2VWTA 4AZIA 3OYZA 2ZWZA 4LU0A 5FKYA 3FXGA 3PBGA 4LT9A 2XUCA 2NQ5A 3NPXA 2C0HA 2OZTA 2QNEA 1N56A 3GHTA 3S1XA 3UY8A 3UWVA 5REQA 3F7JA 3W1XA 1N2VA 1VCVA 2EBNA 2CBVA 5B7ZA 5C70A 5DCEA 4XQ6A 2WC4A 1X38A 3H4WA 5DT7A 3HPXA 2QCMA 2FTPA 4O3PA 4FNSA 1P0BA 5IM51 4RL3A 3GTNA 3SCNA 3ZT5A 1RCXB 1PCWA 4FPSA 4IGNA 2VMFA 4RNOA 1XIMA 3TA9A 2GJLA 4FR1A 3IWPA 4CNPA 5FF3A 1DXIA 4XAYA 4XKYB 4GMEA 2GVEA 1YDYA 1PZ1A 1ZS2A 3OYXA 4XZ9A 1W9XA 3M5ZA 4YR3A 3ARRA 2R24A 1Z8AA 3WD4A 2QCNA 1JYWA 1PEZA 1D2KA 5BOOA 1LM1A 3WEOA 5F4SA 1QMLA 2Z25A 1QTWA 4Z1BA 3W7HA 2VWSA 3TE9A 1DIKA 2A85A 4DBDA 4DAIA 5KFAA 3NSNA 3XINA 2F8QA 1MXSA 1VENA 3MO4A 4PTDA 2YDSA 3ARWA 3RJXA 2Z1WA 4AAJA 5ABEA 1OYBA 5LKYA 1A5NC 3LGDA 4WXYA 3S5ZA 2CESA 3GG8A 1Y8BA 4D8ZA 1EDQA 2GSHA 5KFOA 4LCRA 4GVHA 1TCDA 3G77A 4X0NA 2EHHA 2BWGA 1UWRA 1Q6FA 2CLLA 3QTGA 4J3VA 4NAEA 1F76A 5HWJA 3UWWA 2XIQA 4XZMX 5F2LA 4F4RA 4F79A 3GM8A 4N2YA 4PTMA 2FZ9A 1LG2A 4UFJA 4YTRA 4WGHA 3OPSA 4LOCA 2OGJA 1TWSA 1ZBWA 3HQPA 3MFIA 3TYEA 3EMQA 8XIAA 4JHOA 2A0NA 2E1DA 4WJEA 4GJJA 4P8UA 4X9SA 3KL5A 1DHPA 3V5OA 4IRDA 3AWOA 3W26A 1W9DM 3GX9A 5FEWA 3PSVA 2PB1A 3FHQA 3VD9A 1DQWA 4PMVA 1E56A 1KRAC 3AS0A 1IT7A 2V6AA 1LZOA 2DGAA 3M0JA 3IGSA 1E9ZB 3RPMA 3R4IA 3L4YA 1XSIA 3U2OA 4IMFA 2DZPA 1YEYA 2DW7A 1TJ0A 3RO6A 1CENA 1CGXA 3B4UA 3LM7A 1FCVA 2BVDA 1KQZA 3VTRA 4DUVA 1OB0A 1UUMA 1WKFA 1XC4A 4B5TA 4V1XA 5K4XA 4EIVA 1V08A 1VZWA 3OZPA 3GTFA 4HPJA 3URBA 3Q67A 1MYRA 1CW2A 2W91A 2DPEA 1H1YA 2P9BA 2GK1A 1BYCA 1LBLA 1H60A 4BI7A 3PUEA 2FVKA 2WHJA 3FDGA 3GTXA 1ISWA 2CHRA 1YXYA 1EA0A 3VKJA 2VQTA 3TUUA 2CBUA 3TEVA 3OLEA 4PN2A 5IBXA 3THDA 4IPPA 2H3BA 1T40A 2P3EA 4IJBA 3O0FA 4S23A 3CQJA 4QITA 4IP7A 4WY0A 1SZNA 5HNUA 2A7RA 3SRFA 4HOZA 1S2TA 1MUCA 1FWIC 1A5LC 4HYWA 2YL8A 3UR8A 1D7KA 1BYDA 2HTMA 1E4LA 3CUZA 4L1XA 1SSGA 4PCSA 1AW2A 2XIMA 4Q8UA 2V5KA 2W67A 4H9YA 5T91A 5HQEA 1MMFA 2XSXA 3CPUA 2WZEA 4YVVA 1XHGA 2PWEA 2ZA1A 2E68A 4KRZA 3H22A 4TIMA 1TA3B 3I3EA 1IZKA 2CWNA 3GH7A 3VOIA 4HU4A 3LCXA 1UH4A 3L4TA 3S2NA 4NX0A 1TPB1 1R2TA 3EDFA 1NAL1 3M7SA 4O28A 3KAOA 3ARXA 1XYBA 2PTWA 3UZZA 3LXCA 2J9YA 4G1NA 4F40A 3E5PA 2GWGA 1JDFA 4IJRA 1DORA 1E55A 1W32A 1XRFA 2D0GA 4DWSB 4KCWA 2DZBA 2PLJA 2X0SA 1NF7A 3W71A 4DZHA 5HBFA 3FN9A 3BW4A 1KW1A 4TVDA 1L8PA 5DCBA 3TYCA 4QGCA 1V3IA 3M9OB 1UD5A 3NZ1A 3QGAC 5EFDA 4FXJA 5LGXA 5KFGA 2CC0A 2CFFA 1XPYA 4KBXA 5FA5A 4Z1YA 3SN1A 3BV4A 2D0FA 4YTTA 1UA3A 4B2DA 2QV5A 1R3VA 2R82A 1V02E 1TFVA 1GGOA 4FNUA 4NZ5A 1M7OA 3EPMA 2ZUUA 5A6MA 1K1SA 3ALGA 4CQ9A 2Z1SA 2VCCA 1E6PA 4Z2JA 1W1PA 3QM3A 4OVXA 3TTQA 2ZFAA 1Z7AA 1K6AA 4MNJA 5F9LA 2WJZA 3CAQA 7ODCA 2H9AA 2OZ0A 2EJAA 3RM4A 4LTSA 1WAWA 4C7DA 3THCA 1B3YA 4GFIA 5CQ1A 5KFXA 3IJDA 3GKFA 1PDYA 3WENA 1FWSA 3V6JA 1NQKA 5HNTA 3W7QA 3GVVA 3C0QA 3LSCA 3BSGA 2G8ZA 3MUAA 4HK6A 3MKVA 3STFA 3W70A 1SUXA 4H7ZA 3CHDA 3ID7A 1JZ2A 1DWFM 2E9MA 4PH6A 4I8YA 3B4YA 1YTEA 3UZYA 1U33A 3OG3A 1KFEA 3LV6A 1JCLA 3UD6A 2OFJA 4U2ZA 3O6AA 1OFRA 5EY5A 4M56A 4RNJA 1WKYA 3BAXA 1A5CA 4UFMA 3ZVHA 2CZFA 4GYFA 2GJXB 3U4FA 3P5YA 4QE5A 3RAQA 3EX3A 3B03A 1IGSA 2Y5EA 5CLWA 3WK1A 2GSEA 4ED2A 1US2A 3MUY1 1OT2A 2NT1A 4N42A 4PUUA 2AOSA 4GPNA 3NPVA 1GQIA 1W5OA 1JL8A 1UD6A 5KFEA 1XF0A 1UPPA 4QCEA 4R7OA 1E0UA 3QZEA 3N9KA 1X6NA 4DL5A 5EGRA 3RN6A 3OIXA 1PX4A 3UXLA 1V3JA 1OC5A 1HT6A 2XVNA 3C86A 3QHNA 3W7EA 3BJTA 2XH4A 3BL3A 3TWBA 1MRAA 4K38A 1F5ZA 3TK7A 1J2BA 4S2BA 4JEJA 2WSQA 1CCWB 4S39A 3SADA 3OGSA 2E4TA 1DJXA 1DWIM 4JFUA 4FLSA 3WEMA 1GTHA 1OC7A 4X22A 4JY8A 1E4NA 2I14A 3MKCA 2ON3A 4Q6XA 1OCNA 3BH4A 4MJMA 3S3GA 2G4JA 3NVTA 5HR6A 4LS2A 1QNSA 2A21A 1LOSA 4S3EA 2ISDA 5HWNA 3DUGA 3G1XA 4JTKA 3R2GA 5G1MA 3MCMA 3B8DA 2ZRZA 4FLOA 2HNHA 5KZ6A 1TELA 1MI3A 4S38A 5AC4A 5CZKA 2UY2A 3OA3A 3AYSA 4GIEA 2BMBA 4HYKA 1YDOA 1HW6A 4YP3A 4MB1A 4ZSTA 4QWBA 4P7NA 4Q3MA 4CVWA 2OYLA 3H2EA 4WF7A 3IAPA 1W1IE 2V63A 4EPEC 1I45A 2PUZA 3BZGA 1NWSA 2F7FA 5AVHA 2D3NA 3IV3A 4Q8TA 1PCKA 1EXPA 4UR9A 4PYSA 2FGLA 3LRLA 3ZJKA 2Y62A 3TVAA 3C52A 3LM3A 4CN6A 1ZPTA 4K6AA 3G6LA 4IOTA 3HURA 5KG5A 1Q6QA 5G4WA 3W22A 1YTKA 1N8WA 2NUWA 1JXJA 4QJ3B 3N4AA 1AD1A 3A24A 2XVLA 3K8LA 3BURA 4MY9A 1GEQA 1A5AA 3WDRA 2ZXQA 4GWEA 3V6HA 1DQUA 1ONWA 1XDMA 4EPKA 3J7HA 1IEXA 2Y89A 4Y90A 4TXEA 4JGDA 4U7CA 5DMNA 4NYYA 4HA3A 4AY1A 1FRBA 5GQBA 2DUZA 3UJRA 4UWMA 3PAJA 5DGBA 3KP0A 5FJRA 3HGJA 3WZ0E 2F6UA 3H8AA 3LCFA 3MUCA 2GQAA 4S3DA 3UZJA 3KOZA 2Z0IA 2D73A 3DFNA 2A3HA 2YCLB 3EBVA 3VGBA 1AQMA 4XAZA 3DN5A 4GRSA 2PF8A 4GYJA 3MY9A 1ENUA 2I5QA 4YS1A 4Y9NA 2YXOA 1GOKA 4A3HA 4Q8WA 1R5YA 4PRTA 2FH6A 3RCYA 4HCDA 1X7FA 3ZWTA 5EWFA 2WNQA 2PMQA 5IDZA 2V68A 2FFIA 1E6ZA 1UD3A 1P4CA 1XBYA 3PUGA 2GUBA 1RVGA 4HZ7A 3O0KA 3M0ZA 4DJDD 1XV8A 2IMRA 2WMHA 3PJWA 2GGJA 1EBHA 3GZ3A 1E4MM 1IT8A 3G1HA 4QJ4B 4IGMA 2R1PA 4BEQA 3UG3A 3V6KA 4AZCB 3WLRA 3WY1A 2WAGA 4R88A 3K1DA 1KM5A 1BWKA 3GWQA 4OV4A 3S5NA 3NG3A 4MWAE 1EUNA 2VEFA 1ZFJA 3RAXA 3SQSA 3BG3A 1XRTA 3IVUA 5DLGA 3NA8A 2X05A 5KFPA 3GDTA 3QF0A 3FYOA 1KM2A 1YRRA 3KVMA 3QYSA 4RZ4A 1OGBA 1VIWA 3VKAA 4KWOA 3FNDA 3DFPA 3RPTA 1NDYA 2VZVA 4XD6A 1TWDA 1M7XA 4MJ4A 1DJIA 3WLPA 2YZRA 3T4CA 1K6WA 3AHZA 4DBEA 2DT0A 1G4EA 4JNZA 2Y88A 5DT5A 2NXIA 4JPGA 2V5JA 5AVNA 4ZQCA 2VVNA 1B5TA 3WLNA 1BTMA 2OKOA 5DXYA 5AB3A 1BG9A 4GBDA 1P0DA 5CBIA 1EPVA 3HV8A 3KHHA 4ONVA 5DQGA 2EQDA 1O95A 1AL8A 4NY2A 4IG2B 4QE4A 5DBTA 1WDDA 4E4PA 4Z0JA 3CBWA 3VOJA 4L5ZA 3SFKA 1IF2A 3GH5A 3AIBA 4RNFA 5AKQA 1VR6A 4F0MA 3TXZA 4QSHA 4A2SA 5MF5A 1TIWA 5HNNA 1QNPA 2ICSA 4B3KA 3FVMA 2PTZA 4PCTA 2UV8G 3ZO9A 4E6MA 1IXNA 4S3KA 3W7OA 3B97A 5AY7A 2QLYA 1PV8A 4XBSA 2CLKA 3PZUA 3CQKA 4WZHA 1OFPA 4IP4A 5TNVA 3PZIA 5G1YA 1E1EA 3WLQA 3M0LA 5C7VA 5D9PA 4XO6A 1QBAA 2EPOA 2VFIA 3BGAA 3TNOA 5AYYA 3ENLA 3OEXA 1JZ3A 2OSWA 2E3ZA 4HNCA 2V30A 1XLLA 3TAOA 4ZCWA 1A4LA 1KCXA 5HMFA 4QDWA 1L6SA 3UJ2A 4H8UA 1UBPC 3MHUA 1XLFA 5DQHA 2OLHA 2QDGA 1YADA 2OR2A 2AMGA 3UESA 1FP8A 1IXPA 3H7RA 1LG1A 1JYVA 3D6NA 6ALDA 3QR0A 2QPXA 4FLRA 5D33A 5A2AA 1YKWA 1QO2A 4GNJA 1GOWA 4QROA 4WDUA 3REQB 1J0HA 4IUOA 2J8FA 3OZYA 2FPTA 3QN3A 1J5SA 2CLFA 5DG9A 3MMWA 2FZDA 3KP1A 2DY3A 3LCIA 3MHGA 3QOKA 1NDZA 3LD5A 1DXFA 2DUXA 4EWND 4UNLA 2FPVA 4DY1A 4M7SA 2XWDA 5C6MA 3GW3A 3AXKA 3LCHA 4MNKA 5KFUA 3TLLA 3S5SA 3CZKA 3M0HA 4HMNA 4J3XA 2OEMA 2IKJA 3P0WA 1F61A 2WVSA 3K30A 1XRVA 4YQWA 1ZENA 4ECUA 3MUIA 4NXKA 4E4FA 3W7NA 3P5ZA 2VURA 4TV5A 1JDEA 1E9IA 3I6TA 1FWJC 1ISVA 2FLPA 4ZFCA 3S1WA 1T5AA 5JMUA 3W00A 2BVWA 3SY8A 5CEWA 5KTLA 4GINA 3PBMA 4QDMA 2XISA 3O06A 2X7WA 3SRKA 4GGHA 4HOWA 5A6JA 4I9MA 3LK6A 2XWEA 4RKAA 4PRRA 5DLFA 4N9EA 4MG4A 5KFNA 3JUGA 3GVRA 3LMYA 2O55A 3RLVA 5DXXA 1ZJHA 4DIAA 1L9WA 4H8NA 3WYZA 3G3MA 3PHAA 3UJEA 2DT3A 4IR9A 1F8IA 4Y9MA 3P8JA 4DEFA 2OOFA 3LS9A 4S3JA 3PW2A 3NIYA 3MP3A 1HTIA 2PF0A 4JHZA 1UWAA 3IJIA 4KEZA 3HGRA 1AW5A 3B9EA 1RXOB 2V3EA 2PGRA 3UFYA 4LYRA 3NDOA 3MR6A 4QW9A 3M44A 2FZMA 5G2IA 1IT0A 1M53A 4UTLA 3WMBA 3APYA 1XH2A 1VFMA 4AMAA 1RP9A 4WOZA 4A35A 4JN8A 2D1ZA 2UVRA 3DYPA 3SCTA 5AHFA 3HJEA 5I06A 2VFEA 4XK2A 4J35A 3WDPP 1UD2A 1R86A 1EO5A 4GQGA 3L67A 5CJMA 1NJJA 5CSYA 4FNQA 5AC8A 3QQ1A 5A2BA 1GORA 1YTDA 4K8GA 2F9RA 3KHDA 4AX6A 4Y7EA 4Q32A 1L0PA 4XIAA 2V8ZA 3CWNA 3BLIA 4L9ZA 5DRCA 1LUCB 2Z2UA 3CH0A 3SUTA 2V3GA 3CGTA 1HJUA 4JDBA 1US0A 3AFBA 4MIMA 4UTUA 2GUYA 3T7VA 5L9XA 4C6OA 2ALZA 2FGZA 4QLJA 4QWDA 1CLXA 2NZLA 4H6QA 4XUYA 4LRTA 1QPNA 3E74A 4AU0A 1QUMA 2XH7A 4QTGA 3CV1A 6CGTA 2VR5A 4KF1A 1O4UA 3KDOA 2R8WA 5FF2A 1REQB 3IGHX 2FHBA 1P1XA 1A4MA 1ECQA 1T7LA 3H7UA 1XG3A 3GAKA 3BDKA 3QW4B 3BGJA 2ODOA 1L6YA 3QSRA 2ISSA 3VIMA 3AIRA 5G2HA 4D6IA 3HQ1A 4HMEA 4B2DD 5FOOA 4X2PA 4PBGA 5C9ZA 1TV4A 2ZC1A 3R43A 1BF2A 3UY7A 5KFWA 4RDVA 3STPA 1FHUA 4AD1A 1BGGA 3ATZA 3RU8X 4DEZA 5I78A 1E1CB 3WLSA 1UR2A 4XAPA 2PTDA 1KBIA 1R3QA 4Z1CA 3TR9A 3IV8A 1F05A 1KFWA 1EX1A 4MM1A 1G4PA 3IIXA 3USBA 3MSYA 1TUFA 3KBMA 5D8ZA 3NZPA 6REQA 2DSVA 3PPFA 3GILA 3SSJA 1F07A 4ES4A 1S3TC 4XSMA 2YX0A 4FB7A 2QEZA 1B57A 1K8CA 2VZOA 4LAUA 9XIMA 2PRMA 4NASA 4OU1A 3W01A 3A6OA 3SCWA 2JEQA 6PTDA 3PZQA 1E9YB 2W5FA 1V3MA 1JPKA 3EKLA 1FDJA 2OWCA 1X7IA 3IIOA 4C6JA 4XZWA 1AW1A 3LI0A 5LNRA 4QG8A 4U6PA 1G6CA 1W5NA 4CNUA 4KFOA 4X60A 3PWIA 3UNDA 3QXBA 5XIAA 3WG6A 2HXUA 1K9EA 5BRPA 5KFKA 5JVLA 3RFAA 1K4HA 5DRIA 1YX1A 2E1WA 4F0SA 2BX7A 4GBUA 2FFCA 3QZ6A 1V3KA 3W2LA 2XPKA 3GQYA 4AZ7A 2R8IA 3AQUA 3SI9A 1LRTA 4O8AA 2WSRA 2B7QA 4AYSA 1UWQA 5GVJA 3HG4A 5BU9A 5F9NA 4PC8A 5EMLA 1YPXA 3P74A 4LX4A 3I10A 1GVRA 5HPOA 1QFEA 1EOMA 2ZX8A 3TNBA 5CAKA 4C65A 2ATLA 3ARYA 1W3TA 3ITLA 2YPIA 3AJXA 1XLAA 1P6WA 2QAPA 1J96A 1U5JA 4IF2A 4J2MA 1FOBA 3WBYA 2ZDSA 2XFYA 4JD4A 3V5FA 1NOWA 3T5HA 3GNDA 3N13A 2REQB 2DVUA 1H09A 1UZDA 4RX0A 2J4GA 4IUGA 3F4WA 1RLDA 2C1GA 3M5VA 4Z1AA 1QXLA 1WCGA 2J8GA 1ECEA 1AFSA 4Y6GA 2V4RA 3TQ1A 2SFPA 3MFHA 4I3GA 3KBVA 3GE7A 3TTSA 3DFHA 4QLLA 3B04A 2P3ZA 2TAAA 2F61A 4ZO9A 2PODA 1WOAA 4KGLA 2WBGA 3TCSA 1ZJBA 1UOKA 2D23A 3TP4A 3UWYA 3WK2A 1OQFA 4MKVA 3ZJ8A 3TFCA 2UWFA 3B9AA 4QLKA 1UR1A 4ACZB 3AHXA 5C7HA 4H6EA 4K7YA 1SW3A 1O5XA 4CD4A 4ATLA 3WL0A 2QQ6A 1LOQA 2P53A 2Y1HA 2J78A 1UOZA 3WJWA 4GH1A 3O05A 3FJLA 1QW7A 2PDFA 1AA1B 3A12A 4O3NA 1W1VA 3WD2A 1SMAA 5LSMA 3P61A 2AMXA 1TPDA 4JTAA 4S3GA 4LNYA 1GYLA 1QK2A 3TQPA 4H9TA 3QMSA 3DGBA 3QR3A 3UBPC 4BF7A 3GV8B 5BROA 4O13A 4DI9A 5KFLA 4ECVA 4OUIA 2G41A 1FXQA 2ZVRA 3MU7A 1EQPA 4R85A 2CLHA 4MYAA 2Z00A 4QCFA 2WLZA 3BMXA 4O50A 1DIEA 3PNUA 5EMMA 4DWSC 2CZVA 3FVDA 4IIDA 4UQBA 1IYXA 3N4EA 1O7AA 4R27A 4K8EA 2E5CA 2BQRA 1CLKA 3MV11 2Y6ZA 3PG8A 1S5MA 4XV0A 1NVMA 5C5JA 1SU5A 4IIGA 3CH9A 3MR2A 3OHMB 1EL3A 2V5LA 2BFGA 1E73M 1W3HA 3C2EA 2OEJA 2F6KA 1DBTA 1BXBA 3WQCA 3AMDA 3DG6A 1Q7QA 1RJRA 4UOZA 4CCZA 4H04A 2Q3RA 2V9DA 5T14A 1LOLA 4HBKA 5FESA 3RIKA 2JIEA 2HE5A 4UNKA 4PRWA 5AHMA 2W61A 3VFLA 4C6PA 4DF1A 3QZ7A 3N17A 3VIHA 1KKRA 3P84A 4IIHA 4ZODA 3V35A 4KQNA 5LZLA 3N34A 3GU1A 3R8RA 3O1NA 4WEVX 1CXEA 2GK1B 3G8RA 4GYPC 3GIQA 4F0RA 3T1GA 2Y5SA 3PANA 1T8QA 2VFFA 4U28A 4AH7A 3B8SA 4Z1DA 1S1RA 4J3SA 2OGYA 3N6HA 4GJ1A 3GHRA