4CQBA

The reaction mechanism of the n-isopropylammelide isopropylaminohydrolase atzc: insights from structural and mutagenesis studies
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
402
structure length
402
Chain Sequence
b'SKDFDLIIRNAYLSEKDSVYDIGIVGDRIIKIEAKIEGTVKDEIDAKGNLVSPGFVDAHTHMDKSFTSTGERLPKFWSRPYTRDAAIEDGLKYYKNATHEEIKRHVIEHAHMQVLHGTLYTRTHVDVDSVAKTKAVEAVLEAKEELKDLIDIQVVAFAQSGFFVDLESESLIRKSLDMGCDLVGGVDPATRENNVEGSLDLCFKLAKEYDVDIDYHIHDIGTVGVYSINRLAQKTIENGYKGRVTTSHAWCFADAPSEWLDEAIPLYKDSGMKFVTCFSSTPPTMPVIKLLEAGINLGCASDNIRDFWVPFGNGDMVQGALIETQRLELKTNRDLGLIWKMITSEGARVLGIEKNYGIEVGKKADLVVLNSLSPQWAIIDQAKRLCVIKNGRIIVKDEVIVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE
publication title X-Ray Structure and Mutagenesis Studies of the N-Isopropylammelide Isopropylaminohydrolase, Atzc
pubmed doi rcsb
source organism Pseudomonas sp. adp
molecule tags Hydrolase
total genus 162
structure length 402
sequence length 402
chains with identical sequence B
ec nomenclature ec 3.5.4.42: N-isopropylammelide isopropylaminohydrolase.
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 4cqbA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4cqbA02
3MSRA 4C6JA 1I0DA 2EG7A 1E9ZB 2OB3A 3MJMA 1PB0A 1RK6A 3AUOA 3S2LA 1M65A 4BKNA 3IV8A 2O4QA 4IFKB 3GIPA 4CNSA 3GIQA 3URNA 1V4YA 2Z25A 4C65A 4OFCA 5AKQA 3ORWA 4XD3A 1UBPC 4C5ZA 3CAKA 2OQLA 1WXZA 4LCSA 3F4DA 2R1MA 3NURA 1XWYA 2I9UA 4QS5A 3GGMA 1FWEC 3HTWA 3LU2A 2O4MA 2QS8A 4G7EA 3S2JA 4MUPA 4XAGA 4ICMA 1A5MC 3QY8A 4HK6A 4ERAA 4UB9A 3MDWA 2QT3A 3GU2A 3E74A 4IF2A 3EGJA 2HQAA 3S2NA 4XAZA 3TN5A 4GX8A 4L9XA 3FEQA 2P53A 4RDVA 2BB0A 3O7UA 4QTGA 4XD6A 4DIAA 4DZIA 1A5LC 2WM1A 4NG3A 4H9XA 2CZVA 4ERGA 4LCRA 3F2CA 4H9MA 2FVKA 3T8LA 3MTWA 3FDKA 3IPWA 4IFKA 1DPMA 1FWAC 2YB4A 3MVTA 4UBPC 1EZ2A 2Z2AA 3K2GA 4EP8C 4AQLA 3T81A 4EPBC 4BJHA 3GTHA 4RZBA 2HBXA 1PTAA 3RYSA 4H9UA 4QS6A 4C6BA 1A5NC 1RA0A 3QGAC 1RJRA 3HM7A 2E1WA 1IE7C 1VFLA 3CJPA 2UBPC 2PUZA 4DLMA 4B90A 4C6MA 1YIXA 3E0FA 4R85A 3ITCA 1O12A 1NDWA 4C6DA 4GY1A 4E3TA 1EYWA 3RHGA 3DC8A 3WYZA 3LSBA 2KAUC 2GZXA 2P9BA 3FDGA 4IGMA 3A3WA 2HNHA 4B92A 3LS9A 2P50A 3B0XA 3T1GA 4XAFA 1RK5A 2Z28A 3IACA 3MKVA 4IG2B 4C6QA 1FWCC 1FWGC 3SO7A 2HPMA 2D2HA 4GC3A 3ISIX 1BF6A 5G4HC 1V79A 1EJSC 3UBPC 2DVXA 1PSCA 4KETA 4KQNA 3UF9A 1ITQA 1XRFA 4KEZA 4RDYA 4LAMA 4WGXA 3LNPA 1V77A 5HMEA 4KEVA 2XIOA 3GTXA 3OOQA 4LEFA 4F0LA 1FKXA 1R9YA 4WHBA 4V1XA 3BE7A 3TN4A 1RA5A 4KF1A 2PLMA 4IFRA 2EG8A 1R9XA 2VR2A 5E5CA 4IFOA 4HK7A 4C6LA 4JOMA 1GKQA 2E25A 1EJVC 4ZSTA 1FWIC 4NP7A 1RJPA 1P6CA 4C60A 1WXYA 4C5YA 4CEUC 4RDWA 4IH3A 2FTYA 3E3HA 4L6DA 2HBVA 3LA4A 1YRRA 4IG2A 4PCNA 3LGDA 3QY7A 1A4MA 2VM8A 4G2DA 3OJGA 3C86A 2FVMA 1KRCC 4GY0A 1ONWA 2I5GA 3S2MA 1J6OA 3QGKC 3IRSA 3A3XA 1ADDA 5FSEC 2Z00A 3ID7A 4DLFA 5FSDC 1ITUA 3E0LA 1M68A 4CQBA 4RE0A 4ZSUA 1P6BA 2Q09A 3B0YA 1POJA 2VUNA 3RCMA 3GTIA 4KEUA 1EJRC 3PNUA 4CNUA 1FWBC 3IARA 3HPAA 3MPGA 3URAA 3ICJA 4DYKA 2OODA 4H01A 1QW7A 4IGNA 3LSCA 1W1IE 5A6TC 3EWDA 1J5SA 1HZYA 2YXOA 3PBMA 2QVNA 4PBFA 3KM8A 2YB1A 4GYFA 3UR5A 4INFA 4NI8A 4EPKA 3F4CA 4F0SA 3NQBA 2AQOA 5HMDA 4H9VA 4H9ZA 4I6KA 3TN6A 2WJDA 3OU8A 3IJ6A 3CS2A 3GUWA 2PAJA 4GK8A 4M51A 4HJWA 3EWCA 2W9MA 2R1LA 2VC7A 1A5KC 2D2GA 2Q01A 1NDYA 3DCPA 4GY7A 2GWNA 4KESA 3OODA 4GXWA 4CEXC 1YBQB 3E2VA 3PAOA 1FWHC 3LY0A 4C6PA 1KRMA 1K1DA 1EJWC 2HPIA 3GU1A 1O5RA 2R1NA 4IQJA 4YIWA 4C6FA 1RJQA 4XAYA 4B91A 3SFWA 2FFIA 3WZ0E 1YNYA 4P5UA 1JGMA 4DNMA 3R0DA 3OQEA 4HA0A 4J35A 4C6KA 1PO9A 3D6NA 1FWFC 2AQVA 2Y1HA 3A4JA 3LGGA 4R7WA 2F6KA 2BGNE 2Z4GA 3AU2A 1S3TC 1I0BA 1UMLA 4PE8A 2GOKA 4Z42C 2ANUA 2OGJA 2IMRA 3K5XA 4XD4A 3GG7A 4H9YA 4WVXA 2PGFA 4GBDA 1YMYA 1UIPA 2OOFA 4TQTA 4RDZA 1YBQA 4LANA 3MDUA 4CQDA 4C6NA 1K70A 3NEHA 3V7PA 2A3LA 1RAKA 3TNBA 1EJTC 3IGHX 4QROA 3WMLA 3GRIA 1GKPA 4R88A 1EJXC 3PANA 4LAKA 1A4LA 3GTFA 4KIRA 2D2JA 2Z24A 2G3FA 2UZ9A 3F2BA 4J2MA 4ERIA 2Z2BA 3PNZA 1XGEA 2PGRA 2Z26A 3E38A 3G77A 2R1KA 2YZ5A 2VC5A 4LAOA 4QSFA 3JZEA 3O0FA 3B40A 4KERA 1FWJC 1A5OC 2WJEA 1QXLA 2WJFA 4PCPA 4EPEC 3TN3A 4LH8A 4HK5A 5LXXA 1V7AA 1K6WA 4CNTA 4GOAA 1R9ZA 1ONXA 3N2CA 3K4WA 3UR2A 4C6OA 2EG6A 1J6PA 1UIOA 3S4TA 2DVUA 3GU9A 1ZZMA 2RAGA 4LCQA 4C6CA 1EF2A 1XRTA 2R1PA 5HMFA 1EJUC 2Z7GA 4DI8A 4J5NA 2QPXA 1KCXA 3MVIA 1NFGA 1FWDC 3AU6A 1FKWA 4XD5A 4EPDC 4GX9A 1NDZA 1J79A 3F2DA 2AMXA 2Z29A 4DI9A 1POKA 1NDVA 4H9TA 3URBA 1P1MA 3OVGA 4AC7C 4BY3A 3URQA 2ADAA 4LALA 2DVTA 4G7EB 4PBEA 4F0RA 2ICSA 4GZ7A 1M7JA 2GSEA 2Z27A 4C6IA 1E9YB 4D8LA 2FTWA 1V51A 1GKRA 4DZHA 4C6EA 1KRAC 4H00A 3RN6A 4V1YA 2VHLA 4LFYA 3UPMA 3DUGA 4I6VA 4QRNA 5CH9A 3QY6A 4CQCA 1KRBC 4DO7A 4B3ZA 2GWGA 2ZC1A
chains in the Genus database with same CATH superfamily
4F4RA 3A23A 3RG6A 2CZEA 1G1YA 5C55A 5HBFA 4S39A 3ITLA 2FDSA 5I03A 4PB4A 4AHQA 4QQ3A 3IK4A 2V9DA 4DXXA 3GIPA 1RXOB 3N11A 1UWSA 3ORWA 1DHKA 3VKJA 5HWMA 1VLIA 1NQKA 3JS3A 1C29A 3OPSA 4BF9A 1PTDA 5KG1A 1XIGA 1C9WA 5KZMA 3EMZA 2PF8A 3EA3A 3DBNA 5I3DA 2PF0A 4CD8A 4YVVA 1KO0A 3S2NA 4F66A 3TN5A 1WPCA 4GFIA 4HHLA 2C22A 3E2QA 3QQ1A 4ATLA 3W7JA 2PP3A 3OBKA 5D02A 1JI1A 1DL3A 4U7CA 1W6TA 2WM1A 3UZJA 2DZWA 1XLBA 2XJ7A 1JDEA 4ZL1A 4IRKA 4NAEA 1E0WA 4JN7A 4L6OA 3T8LA 3MTWA 3N9RA 1I2NA 2EKGA 1RSCA 3RM9A 4JCLA 4KPLA 1JIHA 2Z2AA 3B9DA 4PUNA 2DIJA 5AVHA 5K4XA 4DAIA 3QPZA 3W2LA 3IJDA 1ISWA 3GTHA 3RYSA 3QPYA 3NNTA 5AC4A 1CDGA 1J8VA 1D8CA 3G1VA 4GINA 1RBAA 1A5NC 3FSTA 4FX7A 4LW7A 4B5UA 4DLMA 5FOOA 2X40A 1IGSA 3OHMB 2C1IA 2XYLA 5T14A 2GZXA 3GO2A 5TBOA 5GPRA 8TIMA 2P9BA 3UWQA 1XC6A 1PV8A 1CNVA 4H4IA 4QCFA 3RM4A 4A3QA 2XH4A 1JX4A 5LIYX 2XISA 3BSGA 4A4AA 1TJ0A 1VEOA 3RJYA 4E8DA 3UBPC 2Y7FA 1UJPA 2BX7A 4DAFA 1HJUA 3FKKA 4ASTA 1HJXA 3WEZA 4CQ8A 2YL8A 3R7MA 4O57A 2XPKA 4GVFA 2V5KA 3Q37A 2WVSA 4IFRA 3A13A 2VR2A 1VLWA 4O8AA 1JPMA 1GQJA 3NYDA 2CC0A 3LHUA 1BF2A 5EYWA 3L66A 3P8JA 1WCGA 4PA8A 3B3DA 1XLEA 2VDHA 3NPXA 1Z7AA 1AMKA 2C28A 1E5NA 1HFBA 4WUIA 3LV6A 4GH1A 1JQVA 4R8UA 5REQA 3A3XA 1ADOA 1FOBA 3M07A 2FMOA 4JN6A 4QR6A 1LLOA 1TPFA 3TXVA 5I06A 4DYKA 4H01A 4Z17A 1HJSA 4AD5A 2E9BA 1K1QA 1MUMA 3FXGA 3O15A 2BS9A 4LGXA 3SCQA 3NZQA 3Q67A 3POCA 4WD0A 5D8ZA 4ED7A 2J7CA 4YWIA 4XBKA 4PMNA 3NL6A 1JDFA 1JF5A 4MKNA 4MWAB 1FH8A 4WCJA 4OQVA 4M24A 3RF9A 2PODA 3V5CA 4AAJA 3AHXA 4N02A 3HZ3A 4ZOAA 3B0UX 1NEYA 4MKVA 3W7IA 1PHWA 4JX6A 3EWCA 2QJIA 1Q6LA 1FHVA 2DPEA 3NJ3A 3WMCA 1V0NA 3E9AA 2XFRA 4YHEA 1FWHC 3SEPA 4GBUA 1CXKA 4MKSA 4G3IA 4GC4A 4REQB 1EDQA 3VVGA 3DFYA 3WLJA 3SW6A 3G18A 4UQEA 1LG2A 3W27A 4GYKA 2CBJA 3KTXA 2QDEA 4M80A 4L65A 3EB2A 3IS4A 2CLPA 1W8SA 1R3RA 1KBKA 2ZX8A 3FJNA 1L6WA 3GFYA 2I56A 4F8XA 3DFSA 1PWLA 3UPWA 4HGXA 3C5QA 2YLLA 5M17A 1XYAA 1E9IA 3PWGA 2O9OA 2A3LA 3TNBA 2VGGA 3KRZA 4JY8A 3XIMA 1DIOA 5I77A 1A0EA 3W73A 2V5DA 4WJEA 4DF2A 4H6QA 2E09A 2AMGA 1LWHA 3E38A 3FV9A 2YZ5A 3BCJA 1V6UA 3SIMA 2C6QA 3P61A 3A47A 3TMLA 2WJFA 4EPEC 1C9DA 2G0WA 1FWTA 3DKLA 4Y8EA 1S2AA 4AH7A 1IEXA 3VD3A 2BGQA 3LV5A 2WC7A 4QE1A 4HU0A 4NSBA 1OK4A 2GJNA 3QQWA 1R3WA 3W71A 3GY1A 1F6KA 4J5NA 2PLJA 2YL9A 3H12A 3FGCB 2PDGA 4ZGYA 1FHDA 1PXGA 6REQA 2VWSA 4LUTB 2Z29A 1A5SA 4QLLA 3WNOA 2D3NA 4ES4A 1W8GA 1ZBVA 5G1MA 3H2FA 2DVTA 4EBEA 3E2RA 5ABFB 4UOQA 1EO5A 2E5CA 2YBTA 1E9YB 4E4UA 3G6LA 1ONEA 1GWJA 1HJVA 1KBIA 2I5QA 3RPTA 4V1YA 4J9RA 1X6LA 2A2IA 4ONVA 3VOFA 2E77A 4CCEA 3ZR6A 1C8XA 1A0DA 1J0ZA 5A6MA 4HSHA 4FLOA 3SY8A 4C6JA 3TKFA 4ZCWA 5M03A 1I75A 1E9ZB 3IEBA 1CLKA 2NQJA 3TV8A 4Q4KA 3S1UA 2ISFA 1JD7A 3CQIA 3SADA 3LX9A 1ZGDA 2YPIA 1W3LA 1B90A 1AQHA 4MIMA 3NQAA 2GUUA 3G0XA 5EFFA 3LDVA 1W32A 5KMYA 3O0KA 2R1MA 1BD0A 3F4NA 3NURA 1XWYA 2DH3A 2ZUUA 3G8RA 3SFKA 2CZDA 3LU2A 1GPFA 5CJMA 4XAGA 4ILSA 1UR4A 4IXXA 1BQCA 3VA8A 1TZ7A 1CLVA 2NX3A 5IM51 5FF4A 4R27A 5HNTA 5FACA 4HN4A 4HNVA 2P53A 3VOCA 3BAJA 2BB0A 4J3XA 5D9NA 3AHTA 2VZVA 3W84A 4H9XA 4DBWA 2X2GA 1GGOA 1AMYA 1UROA 2CZFA 3B9OA 2VRQA 1E0UA 3VTRA 4CNOA 3JU2A 4O3QA 4DNHA 2VD9A 1NU5A 4KEMA 3SCUA 2W9AA 4EPBC 4EXQA 4YP3A 6XIMA 1X1OA 3MU7A 2QCEA 1EC8A 3LLFA 3Q65A 2VEKA 2NQLA 4QG6A 2UBPC 3N6JA 1HXJA 3R2GA 4XSMA 1MW2A 3AIVA 3SCRA 2P3EA 2Z0IA 4XWUA 5I6SA 3AMGA 4QDWA 3QZEA 1KV8A 3A3WA 4W88A 5CPSA 1GYNA 5CSUA 2D69A 4K37A 3L68A 4JN8A 4NASA 3HPXA 2WMGA 1JCYA 3CGTA 2DY3A 4NZ5A 4JYDA 4AD0A 2VC9A 3M46A 4MNLA 1HL8A 5BOFA 4JQAA 1XGZA 3LHZA 4FX8A 4WK9A 4X63A 2Q8ZA 3UJRA 3N17A 3RB4A 1A3XA 3VKAA 4JL1A 3KZPA 3T5KA 1W2VA 2TPSA 2WMFA 3G6MA 1PKNA 2QJMA 4AZ5A 4WX2A 2X8RA 3UWEA 4RXGA 3RDKA 3CH0A 4HZMA 3GBEA 4AY8A 1C90A 2DV0A 3R79A 3H2EA 3ZLFA 3MUY1 2EAWA 3W3OA 1C8VA 3VNDA 4JYFA 3QH2A 4JZ5A 3QY7A 4KGLA 1OHLA 3VIMA 1AZ2A 3QR1A 1V3MA 1RP8A 4U31A 3EOOA 2R8KA 1HIZA 1H4PA 3GH7A 2PE4A 1UHVA 2J6XA 1UUOA 3U5YA 2WNZA 1UUMA 3EDJA 1TV7A 3T42A 1OBAA 5HDRA 1LYXA 3RU8X 1OFDA 3BW3A 5DMLA 5G5IA 3MPGA 3CUHA 4PEKA 5A94A 4YN5A 5KFAA 2YYUA 4W84A 4OV4A 5I7GA 1UMYA 3AS2A 3V0UA 3KDOA 3IN5A 2AU0A 5AC7A 1I8JA 1P0EA 3W2JA 3GV8B 4JTGA 1RH9A 2R82A 2PPGA 3RLUA 4NJKA 2JK2A 3V0TA 3UWZA 3V6KA 3CS2A 1UKTA 4Y90A 2A0NA 4M51A 2OGYA 5DXYA 2VZOA 2ISDA 5KFRA 5HULA 5DQHA 1H5YA 1ODZA 4FS9A 2P3ZA 3RGTA 3IJLA 1VFSA 4N6EA 5A2BA 4XBSA 2D2GA 5KT7A 3CZLA 3PPGA 4X60A 2OX4A 1D9EA 1XV8A 2GDVA 1AJ0A 4MADA 1Q5MA 5DN1A 5C9RA 3ABZA 1EJWC 1W1PA 3NPUA 2QUTA 3N18A 2B81A 1EDGA 3EOEA 4YIWA 1EBGA 2R24A 3W88A 1ELSA 1L8PA 3RO8A 2Y7EA 2PDWA 2BLEA 2BDQA 5FJRA 2G95A 2O7SA 2XCPA 3SN0A 3PW2A 3MI3A 3MANA 4KCUA 3B8VA 1JULA 1TTPA 3WK2A 3CH9A 4RUCA 3ZMRA 3F7JA 4LRSA 1TV5A 4Q8QA 5HXMA 4YYFA 2IMRA 2X09A 4X2RA 4GKTA 4GBDA 2J8FA 4KMQA 4TQTA 4OHQA 2ZA2A 2VCBA 4J9OA 3USZA 4W8LA 3VNKA 4YVXA 3W6MA 5G4WA 4IWWA 1RYSA 4AD4A 5LSMA 4REQA 3MT1A 3E96A 1R3SA 3ITOA 1KCKA 2FPYA 1KM3A 4TV5A 2Z2BA 1QNRA 2AGPA 2PWEA 4HU4A 1K7EA 3ARTA 4QSFA 1H7XA 1FWJC 1JCMP 3T4WA 1BHGA 3KCOA 1LG1A 4HK5A 2ABBA 1XYBA 4NVTA 4DZAA 1TIWA 5DELA 1ONXA 4O3NA 2J27A 1CB7B 4B5NA 4UNIA 2DVUA 3G6XA 1JPDX 4QE4A 5FESA 4DI8A 4CQAA 7TAAA 1EDTA 2VTFA 1FWDC 4B3LA 1GVEA 2VP8A 1J2BA 3WEOA 3HURA 4EPDC 2INFA 4XZNX 3WDRA 3BCFA 3ERPA 4AB4A 3WQPA 3URBA 1TMLA 4MDPA 1Y8BA 1GJUA 4S2CA 3LRKA 2VA2A 3N2OA 3AQUA 1BSLA 1LROA 3FIGA 1R47A 3BW4A 3ARQA 1XIMA 3VDAA 2W92A 1MZRA 2J6SA 3DIPA 1WO2A 4H00A 2PGWA 4MFDA 1W3TA 4LB3A 3WD3A 4BQ3A 9XIAA 1KRBC 5GJPA 3T78A 2IS7A 3I6TA 2A7RA 1E55A 1X7IA 3DYPA 4TUFA 4F9JA 1QO5A 1XG4A 3FGCA 4BKNA 2Z1VA 3IV8A 1ZJIA 2XDFA 3WNMA 4AWTA 1KXTA 3W83A 4O17A 3CAKA 4LUTA 1HT6A 4Q4QA 1FH9A 1T41A 4LYPA 3KTCA 1DVJA 1KW1A 1TPDA 3GGMA 3GQCA 2C0HA 4CNPA 2J7DA 4MUPA 4ZQRA 5C71A 3GDLA 3H24A 4ICMA 4DL3A 5ABFA 2WCSA 1WQ5A 4N7QA 3R89A 4AZCB 2CW6A 2F84A 3ZXWA 5F4SA 1Q8AA 1F76A 4M8UA 2X0YA 5K9DA 1UUQA 3AHVA 3B8UA 4NG3A 3APTA 3C0JA 4K7VA 4E4PA 2BY2A 4MJZA 2PC8A 2DZUA 3SGZA 4PMRA 4TQRA 2YB4A 4O0KA 4PUUA 4DRSA 5K9CA 5ENLA 3K1GA 4W5UA 1LLWA 3T81A 1J93A 4CD4A 2A5HA 2QXWA 4ADTA 5EA9A 4FNPA 4GGBA 2V5JA 1K02A 4CU7A 3HM7A 1IE7C 4GJ1A 1VFLA 4Q8TA 1VAHA 1B4KA 2HISA 4O50A 2XN0A 5E9AA 1J4EA 3LSBA 1B0IA 3AJ7A 3ZLHA 4LUSB 1JZ7A 4MY9A 4TX9A 4UR7A 3AWOA 3UWWA 2Z1BA 4OGZA 3CV6A 3R43A 3WDHA 2ZVRA 4J9SA 2IMWP 3COTA 1MQQA 2YJQA 3SIZA 1FWRA 3WIJA 3TJ4A 2Q71A 4KEZA 3AXKA 4YR2A 5EB8A 1FKXA 1K77A 4ZOCA 3HV9A 1RCXB 1OADA 1N8FA 5AB3A 2X0SA 2UWFA 3MFHA 2D73A 4L5ZA 1SZEA 4C1KA 2GGJA 3FK4A 4UTWC 4JIHA 3BQ5A 2DT3A 1XYMA 5AY7A 4JNMA 4JQ2A 1S0NA 1XDJA 4IR9A 4OU1A 2CESA 5CC7A 2XG9A 2VCAA 3VNIA 1QPOA 4A2RA 4DEZA 3GVVA 3W2KA 1EKOA 4HPJA 3QGKC 5TQLA 3EEZA 1XDMA 3H4WA 4GUIA 2ASJA 1GJPA 1WX0A 1HJQA 3UETA 3OGRA 4RE0A 4ZSUA 3CZGA 1CXIA 2R91A 4UTMA 4KGJA 3U5UA 1GHRA 4NRRA 4KFPA 1GK8A 3TQ0A 1E3XA 4KKXA 5LA0A 4ECWA 2FZMA 1ML1A 4GNKB 3BSHA 1HZYA 4TX8A 3PUDA 1J0IA 3GB6A 3WBYA 4A8IA 1Q6GA 5XIAA 3MMTA 3AWNA 2GSHA 2QCCA 3PUEA 2WJDA 1SJBA 3IJ6A 3UG5A 1VRDA 3W72A 1EP3A 2FQIA 3VZZA 3C56A 1LBFA 1OF6A 5EMKA 5DMYA 2V5LA 2QF7A 4J9LA 2VQUA 1CXLA 4C7GA 2WHJA 2C71A 4GY7A 3CL8A 4NU7A 3L5LA 3U8GA 1IM4A 4QISA 2A79A 3FYYA 5CPMA 1XIFA 1MXDA 2R1NA 4DJFC 2O56A 3QXBA 1RVGA 1YLVA 2CYGA 4IQDA 4Z2GA 4ZQNA 1E73M 4CVUA 4DNMA 3S2CA 3OZPA 3BJYA 4KH2A 1GHSA 4JHMA 4WJXA 3AFBA 2QUMA 3GM8A 3P62A 1OYAA 1LL7A 3UWUA 3WLTA 4TV6A 1X1NA 5CZJA 4A3YA 1I0BA 1M7OA 4OBTA 4S1FA 5AYBA 2HE8A 3EB4A 4GUHA 3WLRA 5CPLA 3KLKA 2A4AA 3H6OA 5I23A 2HK0A 1UD6A 4MF4A 4JDBA 3VX0A 1OFAA 2QCMA 5KFVA 1XUUA 2CHNA 2F6XA 3KWXA 1YDVA 2GDUA 5LZLA 4FMVA 3WG6A 4OTKA 4O11A 1BWLA 1AD1A 4EAMA 4GACA 3RBEA 1FWNA 3L9CA 3TTSA 3K8LA 2D2JA 3DXIA 4L64A 3PNZA 3PW5A 1OB0A 2H90A 3L65A 2QIWA 4E0CA 5DQPA 4H83A 4IL0A 1Z9AA 1GUVA 3G24A 5AHEA 3VZYA 3OLGA 3NQVA 2XZ7A 4CNTA 3NQGA 3N2CA 1KFEA 4DYJA 3UJEA 3IRDA 3UVIA 4LBRA 1DQUA 4RL3A 3TFXA 3W86A 3P74A 2R1PA 3QZ8A 1NFBA 3S6TA 6A3HA 3UZXA 3MMWA 1V3JA 1IEIA 1R86A 4HPGA 1O68A 2X41A 2B0MA 4GX9A 1XBVA 1EPXA 1NDZA 3W28A 1ZQ5A 3F2DA 2CU0A 2VFHA 3L4VA 3N13A 1RP9A 1BWKA 4AC7C 2ADAA 2CCRA 1LT7A 3PZVA 5BOEA 1M7JA 4GVGA 2HXUA 1VFHA 5U7SA 1FWSA 2WPGA 2DZBA 5CSYA 4FALA 2O92A 4L4OA 4ZTYA 4XO7A 2VHLA 1VBUA 1L6GA 2CERA 4GUFA 2ACQA 3THQA 2YFNA 3MV01 2Y89A 2PZ0A 3MJMA 1IYXA 5G2IA 3EXRA 2O4QA 4UMCA 4MM1A 4EAYA 3ITVA 1V4YA 1S5TA 3S0CA 3WKZA 1ECQA 1T3NA 1CIUA 2AGOA 4IPJA 3NM3A 2OT0A 3W7PA 2AOSA 4P8UA 2D2OA 5LKYA 3TR2A 3ME3A 2A85A 3OTRA 1XLGA 1TG7A 4PMUA 2J74A 2A3HA 2B7NA 4PH6A 4NZ3A 1NIUA 4PB5A 1UP2A 4UZUA 2RDUA 3MDWA 4H8VA 2RJHA 1GW9A 3N1AA 3WJYA 4IMDA 1PCWA 1C91A 2PDKA 1JFXA 2J13A 1W2PA 4JTCA 3H70A 2Y8UA 5A6BA 3WBEA 4IPPA 3C8FA 4CQ9A 3CL7A 3F2CA 3G6VA 3UQNA 1TB3A 4BQ2A 3IPWA 3QZAA 4F4ZA 4WRHA 2ONEA 3O16A 5EMJA 1J96A 2SFPA 3FHQA 1PTAA 4EWND 1WUFA 3FNDA 4K8EA 2E1WA 4ZTXA 3B8SA 3T2QA 1DQXA 4C6MA 4AZCA 1ITCA 4R85A 3TQPA 5DCBA 3TONA 2KAUC 1NVMA 3DU0A 4GD0A 2RUSA 2X2YA 5EPDA 5L6UA 2PDFA 2HPMA 2EQDA 1LWIA 3BOFA 1UOZA 5D2YA 4RE4A 3TTYA 2JEPA 2MANA 3FYPA 1EP1A 3LERA 4KETA 2VGBA 3CUIA 5HR7A 3OLEA 2V69A 4LAMA 3UNTA 4LYKA 5XIMA 4TR9A 2XVPA 1N82A 3HGJA 4JV0A 1Z48A 2ACSA 1XLDA 1QVBA 4LVGA 4A8LA 2V2CA 1XLFA 2JKEA 4GO9A 2TMDA 2TYSA 4JCMA 3BO9A 5TNVA 4TX6A 2IUZA 1OJXA 4LUSA 4HP5A 4I9JA 4UFMA 3LCIA 4ED3A 3FVDA 1HUVA 2CNCA 2EO7A 3MBDA 4NT0A 3WNLA 5CJNA 2VVSA 3IUIA 4P2VA 3SN1A 3EXSA 1AQMA 3S2MA 1IXPA 3CQJA 5EL1A 1J6OA 4M0XA 2GJRA 1ADDA 1J2WA 2PA6A 1QTWA 3GS6A 5FSDC 4Y9NA 2Q09A 2VUNA 1KFCA 4NQ1A 3A12A 3WLSA 1AJZA 3MUXA 4FNSA 3UR8A 3U4AA 3GK0A 4A21A 2PTXA 3IARA 5LNRA 1SMDA 1S10A 3DFTA 3A21A 4ED6A 2BFGA 5A6TC 1EFZA 1BYBA 4LAUA 1JZ2A 4K2SA 2Q8LA 5AZ1A 4BS0A 2WO5A 4M81A 3EOUA 1E6SM 1V0MA 3HGSA 2GYIA 4L4LA 1TWZA 3M0ZA 3B04A 3BQ0A 5BOOA 3GW3A 1EO7A 2NX1A 3AUJA 3PTDA 3KOXA 2XZ9A 1VR6A 2IKIA 3HF3A 3QYQA 4PTWA 1A5KC 3RMEA 1OIFA 5B7YA 4PUKA 3K30A 3KXQA 1BEUA 3GDMA 5HJYA 2F61A 3STCA 1ZHAA 1OZQA 5JUVA 1G7UA 1YBQB 4MVAA 4ECXA 1FDZA 2BBFA 3OGSA 2XGBA 3MJYA 1NP0A 4GPNA 2H3BA 1DWJM 1JXKA 2EBNA 2QCDB 1RJQA 3KW3A 5D2WA 3DZ1A 4K1WA 3R5EA 1U2YA 2VWTA 4CN4A 1XISA 3APYA 1QOPA 4ML9A 1U22A 1PO9A 3GG1A 3GHUA 2Y1HA 1DJYA 4DF0A 1WB0A 2XIQA 3WQGA 4DJEC 4AWEA 4Y8FA 2ZIDA 1V08A 4XX6A 1QNSA 4LOCA 3H26A 1UH3A 3IAQA 4IUOA 1OG0A 3N3MA 1TWDA 1IEVA 1GQLA 3WFLA 3R4IA 1PTGA 4A05A 4NNBA 3WMLA 4P8WA 3KZSA 1HO4A 3W82A 1MW1A 2Z24A 4MB4A 1GT8A 1QMLA 3N9SA 1OEPA 3HMJG 1ICPA 3JZEA 4NXKA 2DORA 4WSJA 4IICA 3MUZ1 1E1FA 3E2SA 5LXXA 2E5BA 1K6WA 3LCGA 3WQ8A 4I8YA 3STPA 1BAGA 2OO6A 4MJ2A 5DT5A 4OT7A 1XCWA 1BXCA 2VR5A 4JFSA 4LCQA 5FJPA 2VUYA 4YR3A 1EJUC 2WWCA 1J10A 1EGZA 3ZM8A 1Q65A 3SAZA 3CIWA 2A3CA 2P8CA 3I7SA 1JDCA 4CCCA 1CEOA 3BQ6A 3REQB 5IOBA 2WZMA 5TD4A 3BW2A 2VDGA 4P7RA 3MO7A 5D9MA 1XR2A 3SBFA 1PYFA 1W9DM 3RB6A 3UXDA 2CLFA 1CGVA 3S9IA 4LALA 4XTDA 4MUZA 4K38A 1RY8A 1ESWA 4CD7A 3BPWA 4LWWA 1Z8AA 2I14A 3CTLA 1EXPA 1QWGA 4RNOA 1UR8A 4YLWA 3HGOA 1O7AA 1WZMA 3DUGA 1PBGA 1ALDA 1AJ2A 1CGUA 3IJ8A 4DB7A 4IL2A 3VDCA 3PJWA 4FI4A 4ORIA 4AFYA 2J24A 3P0WA 4HYWA 2GSJA 1C7SA 1R87A 1CWYA 3WQVA 4HMEA 3WL0A 3I65A 4NHVA 2EF9A 3R12A 3OHAA 2DPJA 3DN5A 3LZ3A 4NZ1A 2GK1B 4WDXA 1UWAA 2RGLA 4IXHA 1BKHA 4UIOA 4XG1A 3HG3A 4PMZA 4A8RA 2HQAA 5JUMA 1TWSA 4KRZA 3O7UA 3H2NA 4JYEA 1A5LC 1IWBA 5C9WA 1K6AA 2TRSA 2RH9A 3GVWA 3K1DA 5KITA 2ZUMA 1BG9A 4E3VA 2A3AA 1UQZA 1I4NA 1JPKA 1YW1A 1WA3A 2ZZ3A 4HIBA 4PTXA 1GOKA 7ENLA 1SGJA 3UCQA 1EB3A 3U2OA 3U57A 3L5AA 9CGTA 5F1UA 3DDMA 4RNIA 3EX4A 5CPOA 3N12A 5HA7A 3ZYZA 1U33A 3BLIA 1H61A 1EUAA 3N4AA 1W5MA 3QHMA 4HA4A 3WLLA 1I1XA 1AD4A 1TV4A 3RITA 1G6CA 4F2TA 3LYEA 2X42A 3UP8A 5EDWA 4ZB2A 1IEWA 2NLIA 2ZADA 2B7PA 3IACA 4V33A 3UY8A 1CPUA 5LIXX 3MFIA 2PU1A 4IHCA 2J9ZA 4LF2A 4J40A 4NLGA 4KCTA 4B15A 1H0GA 4F50A 2DEPA 1RLCL 3Q8QB 4N9DA 2XIBA 1LWJA 4JX5A 3T05A 2FKPA 7PTDA 3NL3A 3WNNA 4RDYA 3GC4A 3C2YA 1EHAA 4QG9A 5E0CA 1DJXA 1OF8A 6ALDA 2HRWA 1Q4WA 3BE7A 3T0TA 1RD6A 4AMAA 3O1NA 4C6LA 4ZO9A 3QR0A 4ALDA 3ARZA 3W53A 1O94A 5D30A 4MNJA 3AOFA 1GYMA 2NV2A 3EKZA 1NAL1 5B7ZA 4XISA 1BFNA 3LCWA 2J8TA 2NLYA 4NAFB 4GE8A 3MYPA 4RDWA 5K7JA 4MJMA 2FTYA 2HBVA 2A7NA 1ZJHA 2XGZA 4PTDA 1OGGA 5DBUA 3NQDA 1D2KA 4P7QA 1DXFA 1WDRA 5KG4A 2IW0A 5DY3A 3SRDA 3QC3A 1SFTA 2G8ZA 5E09A 3GIYA 4QM1A 1POJA 3LB0A 1R30A 1RALA 3RB3A 1EEPA 3WLMA 2NT0A 3GD6A 1K9FA 1QHPA 2VYOA 3HPAA 2D0GA 5A2AA 3HFTA 4IGNA 2WVVB 4DWSB 5FF2A 3UY7A 3NA8A 3CLMA 2XINA 4RXFA 4IIEA 4HQVA 3NGDA 3GX9A 1HP5A 2UVUA 4H9VA 4UC5A 3TJLA 3CZEA 4WGHA 1W3NA 1TPH1 3C61A 3QM3A 3WQOA 5CKSA 3U7VA 1BKSA 3SJNA 1E5JA 3G3MA 1E6NA 1SW0A 4UMAA 1TVNA 3CAQA 3B05A 1VCFA 1SPQA 2AQ4A 2F2KA 1TTQA 2FHFA 2QAPA 3AYRA 3AXHA 2HVNA 2YDRA 3EBVA 1OT2A 1MDRA 4GIRA 4LF1A 5CEWA 3OODA 2DQWA 2HDJA 4AU0A 3O6AA 1DEDA 3E2VA 1YYAA 4JIQA 1U5HA 1TTIA 1E6PA 3OZOA 4LY8A 4JNZA 1OC7A 3ZR4A 4GQ0A 2NXHA 4GFSA 4IIBA 4L7ZA 3H2AA 3EDFA 4PL2A 3NPVA 4HA0A 2WSQA 4AZ7A 3D6NA 4NXSA 1G94A 3MO4A 2REQB 3C8NA 4L4PA 2HJPA 3H55A 2OU4A 3UZ5A 2J7EA 2BWGA 4XZHA 4U10A 2ZDSA 3CHDA 1YBQA 4DBUA 1SVDA 2ZZ7A 3KOFA 3PTKA 5BXRA 1RAKA 1R7OA 1C92A 4QROA 4WLCA 3N2BA 5HQEA 3T0BA 3WQ4A 4JNYA 1O5XA 1A0CA 1GG0A 1VZWA 2CFFA 3VCRA 1AL7A 1OY0A 1FCUA 3VGBA 4X9SA 4BI7A 4NJJA 1S2CA 4ICCX 2VC5A 4D6IA 4JQ3A 1VYRA 1E15A 1UZ1A 3B40A 5BNKA 4ED0A 4I7UA 4O1FA 2ATMA 4Q7IA 1HL9A 4PCPA 2E5DA 5FJIA 1LOLA 2C18A 2BVTA 5IFTA 1VQTA 5HK4A 3B9NA 3QGVA 3UJFA 1PDYA 1E4NA 1OX4A 3NO1A 3W7DA 2DSZA 5KFPA 3F4WA 1H51A 3P67A 4LBSA 1BTMA 3CUGA 2WVTA 1V5XA 5CG7A 1AVAA 1QHOA 2ZUVA 3QYSA 4B5SA 3PJUA 2E7FA 2BP1A 1TPVA 2A7PA 2E4TA 3N3TA 3B0PA 5KZDA 4PBEA 5AECA 5KG7A 4PBGA 3VIJA 1X8CA 4WKAA 1L2QA 1GOWA 3WBWA 2I17A 4D8LA 4DZHA 1FCQA 3OP2A 5A1AA 4C6EA 1KRAC 2DW6A 3CV1A 1WBJA 1JUBA 5A8GA 4KRTA 1ZJAA 5KT3A 3B97A 4JHOA 4DO7A 2GWGA 3H2OA 3DYOA 3H4XA 4PMOA 5C9XA 2BODX 1XH0A 1M65A 1DJQA 4GQRA 4IFKB 2PCQA 3CHVA 2Z1KA 3REQA 4GLEA 3UGVA 4D8AA 2A1YA 2HEJA 1M6JA 1E4LA 1P1XA 3RFAA 4J9PA 1EH9A 2AGKA 3A9BA 2I9UA 2B7OA 3GR8A 4DO6A 4BWLA 3S2JA 1Q2RA 3IIOA 5D4YA 3S3GA 2FZBA 3WF0A 1ZBWA 1CT5A 2CBIA 4E2DA 2Q02A 3GFZA 3W6YA 2IXUA 3II1A 4MG4A 4HYVA 1GEQA 1CXHA 1E1CB 4I5XA 4QW8A 4F40A 4H7CA 4B9ZA 3FS2A 1EXBA 1WAWA 3KE0A 3N4FA 2ZE3A 3TUUA 4JUZA 2PDYA 5F2GA 2WZTA 2QR6A 3AMLA 3DHPA 1OABA 5C5YA 1P48A 2Z6JA 4XO6A 2QNEA 4HCDA 5HNRA 1DPMA 4UTKA 3MVTA 1V93A 5KINA 1Y0EA 5KFBA 1EQCA 2GK1A 4H9UA 1ZS2A 3PFMA 1VFMA 2OELA 3DGBA 3C0SA 4NZJA 3MKKA 3RILA 4Q4OA 1YX1A 1H1NA 1W3KA 1HP4A 2XWEA 3HG5A 4RPQA 5H8PA 3RHGA 4IMCA 3NL5A 4JFVA 3T09A 4O8RA 2WZIA 2HNHA 3WQCA 5FF0A 2HMCA 2E8YA 5I07A 2OSWA 4RW3A 1FWCC 3U3HA 1RBLA 3T2OA 3AYTA 4FXJA 1MRQA 2QCLA 1ZSXA 2VZSA 4WJ8A 3PWAA 2DVXA 1VYPX 3IGXA 4G56A 4BCEA 9RUBA 5HWNA 3LNPA 2NQ9A 4ATWA 2ZX9A 4GMEA 1XI3A 4MB1A 2ASHA 4LUYA 2ZXQA 4WHBA 3AMCA 4R9OA 4JTTA 1R9XA 3CTTA 4JOMA 1GKQA 4YTQA 2EPKX 1QR7A 4UQAA 3EB3A 1WDPA 1J0YA 2NUXA 3KL0A 3AICA 3K46A 5MHBA 2V5BA 1WXYA 3MA8A 1RLDA 3M5XA 1ZJBA 1BGGA 3TK7A 1WV2A 1CI1A 4PCNA 1ZTVA 3VIGA 4G2DA 2I5GA 1KFLA 2CETA 1KKRA 3M5YA 2OH2A 3SQMA 4I90A 4UCGA 3B0YA 4QDPA 4FF5A 2R8WA 2VKZG 4KEUA 4AY1A 1G01A 1VCVA 3FOKA 2AL2B 3EWDA 4NZCA 5JIPA 3NOYA 4R34A 3CT2A 5A6SA 3UR5A 1F6PA 2FLLA 4NAFA 2A3BA 1C7TA 3NQBA 3LTPA 4FZIA 1H41A 4PUMA 4LRTA 1DE5A 1FDYA 3DG7A 3VINA 1GOXA 1SO5A 3IIZA 1JYNA 1NF0A 5KG6A 3TVAA 1HQTA 4JAWA 4QHRA 4XKYB 1BYAA 1PS9A 2R94A 1GNXA 5F7UA 2V82A 2O55A 5A69A 1VHNA 1AH3A 3MR5A 3GILA 4ECZA 1NWTA 2P5NA 4PULA 3PAOA 1UA7A 4C6PA 2WVVA 4DWSA 1ONRA 5FJTA 1VPQA 1TZ9A 3NIYA 2C2RA 3ANVA 3QOMA 4F0KA 3WUBA 2YKKA 3I4KA 3TC6A 3BV4A 4O1BA 1H11A 3S1GA 3R8RA 4B5WA 3O6DA 4KFNA 4LU0A 4MMWA 3LHWA 2R8HA 3RM8A 5C54A 2QPSA 3EZ4A 1XLJA 4BA0A 4Z42C 3W7LA 3BQ2A 1YXYA 3RPMA 4PR4A 4NJHA 1HKMA 2Y8VA 3FSUA 4XD4A 2VOTA 1WKDA 1T94A 2VEGA 4JHZA 4FR6A 4U5IA 3LOTA 1K70A 3WQDA 2QQ6A 3WK1A 1VD6A 5AYZA 4M6PA 2BOFX 1DQWA 1UD8A 2LLEA 4MDOA 4ZZ9A 1GTEA 3WF3A 1AA1B 5BWAA 5GJNA 1K7XA 3UCDA 2HE5A 1BRLB 1LJYA 2L5HA 4XZIA 4B4FA 4O18A 3NR0A 4DF1A 5GVJA 3D5HA 4GA8A 2ACRA 1DE6A 1YNQA 2XIJA 3QHNA 1WZLA 3C3NA 4IMEA 2X1UA 4W7UA 2WJEA 3RNDA 3VFCA 3IJ7A 3WBXA 3STGA 3KRSA 2REQA 4UTTC 4ECLA 2X7WA 4EYHB 4HZ6A 4C6OA 4ECSA 3QLDA 3I4EA 3SY1A 2EEXA 1AODA 2I16A 1QK2A 2P10A 5JBFA 1S2WA 3GDKA 1OZMA 2MNRA 4A29A 2Z7KA 4G8TA 1TFVA 4IIFA 2WB5A 4O4WA 1L0PA 4FAMA 3M47A 4YQWA 3W2NA 2AQWA 4HYKA 3NYZA 1JZ5A 8XIAA 4PTMA 1XLLA 2VO5A 3PR4A 1B2YA 1NDVA 4HHPA 5H2ZA 2CPUA 3NQEA 5KT5A 5I2UA 1H62A 1V02A 2PWGA 2W6RA 3W9ZA 5A6BD 3BLKA 2W61A 3W76A 4HHMA 1GVRA 3UA4A 2GQ9A 4JFWA 5KFCA 2DFAA 3A64A 4Q6JA 1IT7A 3PJTA 1NF7A 4NYYA 3ABQA 4JPGA 4E2VA 2YA1A 2C0AA 4UQ9A 4FOKA 3QY6A 2A6LA 2ZC1A 3KFTA 4K36A 5C9UA 1P4CA 1I1WA 3FDSA 4HBKA 1XM3A 2D20A 4GZJA 4JQ4A 4BF7A 2PZNA 4ZOEA 2FH8A 1H1YA 4MPQA 2WHKA 4O3PA 2QULA 3W7GA 1GEHA 2WNQA 1QK0A 1UBPC 4GNVA 5C7VA 4UOZA 3TR9A 3FAXA 4Q8EA 3ALFA 2WSYA 1WXJA 3ABOA 4XV0A 2QS8A 4LT9A 3KVJA 1Y5XA 4XVDA 1LORA 8CGTA 1A5MC 5FJUA 5KG3A 2PTDA 1BYCA 1XBYA 2G3JA 2QT3A 1OFEA 3CB3A 3KDNA 3E74A 2ZBTA 1VBRA 1CYGA 4FHAA 3SRHA 2V38A 4FS1A 4IP4A 2QDGA 1QJWA 4M56A 5A8PA 3GXNA 4A3UA 4TVDA 1F4HA 1KGWA 4IP7A 3C2EA 3QR3A 2V81A 2GJXB 1B9ZA 3GVRA 4IFKA 2VEMA 4AVNA 5DQIA 3FXYA 3TQVA 1XBXA 1Y7VA 1LRQA 3TZNA 1QNQA 1JF6A 3UXAA 2XGQA 4WDWA 2WMKA 3PZ9A 4M1BA 3TIMA 2I9EA 5DLGA 4MGGA 3MB9A 3WDIA 1S97A 2B31A 1QBAA 4U2ZA 3E0FA 3TQ1A 4RPPA 4GY1A 2ISVA 3CEPA 4PN2A 3AIRA 1E1CA 4LUIA 4PMQA 1E4MM 2BSLA 2C15A 1GPWA 4FBTA 1SUXA 7REQA 1XYFA 3APGA 5G4HC 4ED8A 3WD4A 1E70M 1JYWA 5LNVA 4UQCA 1XC4A 1CZ1A 3UF9A 1XLAA 1XRFA 2CZ5A 2PCEA 4EANA 2DPIA 4X0VA 2XIOA 3ABRA 3E5PA 3W02A 4LEFA 2V2HA 4ZE5A 2PB1A 1QNPA 4Y96A 1UD4A 2W4XA 2ZRYA 4KFOA 2QUUA 3N34A 4O53A 3H7RA 4I7WA 3ARWA 1EJVC 3DFNA 4CN1A 4IJBA 4JQ1A 1Z32X 5DRCA 4GC7A 3EA1A 4CEUC 1LM1A 3I7RA 1Q7ZA 4TMBA 3LA4A 4EE9A 5CCZA 1Q13A 1SJCA 3LCLA 3MP5A 3GTNA 2UY2A 4IZGA 3VC6A 4LSBA 2NT1A 3TNOA 7XIMA 3OYZA 1ONWA 3M5ZA 1BXBA 3R25A 2XIMA 3IVTA 2R14A 2WNWA 2JF7A 1DIEA 4EYIB 3GR4A 1KM6A 1OCQA 3BG5A 1ITUA 4J3WA 3AYSA 2E6DA 3EMCA 3G1DA 3V18A 4PFHA 1VF8A 2XH2A 3MR2A 3G8EA 4AC1X 2VGFA 3PNUA 5FF7A 3HJZA 2WBKA 3OHBA 1UH4A 1MUWA 1F61A 3T6CA 3GIIA 3W7NA 2DJXA 3PBMA 2QVNA 5CLTA 1B5TA 4MYXA 4F2BA 3MUIA 1M7PA 4F3HA 1SO6A 4GYFA 2OT1A 4PYSA 5AFDA 3KRUA 2ZICA 2XCAA 3EKLA 2J9YA 3GC5A 5BMWA 4H9ZA 3W6LA 2PAJA 3B4YA 1R5YA 1QATA 2PD9A 1QPRA 1A49A 3NL2A 4ECQA 2D3LA 3AO0A 3G6YA 3D46A 4M6VA 1CTNA 2Q01A 5I02A 1H3GA 5CBBA 1WDSA 4KESA 3M6DA 2YCKX 4Z2IA 2OKOA 1ISYA 5KFWA 4KRUA 1P0BA 2AL2A 4O13A 2FGZA 5K2ZA 1I2OA 2OKTA 2J7BA 3E0IA 1V3LA 1W9XA 2OX1A 3OG3A 2FFIA 2E0PA 3WLKX 2OSXA 5EWEA 1KCZA 4GXMA 1FXPA 1TCDA 2XN2A 2BGNE 5KTLA 5J5DA 4XKYA 4IISA 4MAZA 1QO2A 2FGBA 4S38A 3PPCA 4L1XA 1ZP4A 1EL3A 2OYKA 3FA3A 3GXIA 3K4AA 3LXCA 2XIIA 4H9YA 2PGFA 2R8IA 2JKPA 1UIPA 1VCGA 4AZHA 1VFTA 4POCA 1EGVA 4S3JA 4K8HA 3BLPX 3GFXA 3GV7B 1UA3A 4R88A 4FX6M 4LAKA 3PANA 4IOTA 3ANYA 4FR1A 1Z42A 4YYCA 2VC6A 4AIUA 3QV7A 4RUAA 2HS6A 3F2BA 3PZIA 2BG5A 4J27A 1GZJA 4KCVA 1XGEA 3B9AA 3SZ8A 3BUVA 3G77A 1F6YA 2XU2A 3H2CA 1F5ZA 3UW6A 3GNNA 2A6NA 3K13A 3UXLA 1W9VA 1SZGA 1U5VA 3QMSA 5AC5A 4CN6A 1OFBA 4L6HA 2WSRA 3K4WA 1A3HA 1H49A 3EAUA 3GXPA 1ZZMA 3UJSA 1IEQA 2DW7A 4JEQA 4C6CA 5CZTA 2FPVA 4HNOA 4QJ5B 3HB9A 3IJIA 4Q44A 3NG3A 4OV9A 4O0ZA 3RAQA 1W1B1 4DI9A 1BRLA 4J3SA 2WC3A 4H9TA 3RUBL 3PSWA 3BGGA 4FBUA 3GBDA 3SCTA 3EDDA 5BXSA 3UG3A 3KOYA 4XKMA 3EX3A 4FF7A 3CIVA 3GDTA 1P43A 5LA2A 5JBEA 3EX2A 4CU6A 3CEUA 2WSPA 1PWMA 3ARSA 1G4PA 2DZXA 5BRQA 2D1ZA 3BARA 5CBJA 4W87A 3A5FA 3TYAA 3PBWA 4U3CA 2YOCA 4Y9PA 1KFWA 3CZ8A 4BI5A 3DENA 3M16A 1SZRA 5MF5A 2BZNA 2HXTA 3QW3A 4IUGA 1I9CB 3W7OA 3CO8A 2XFFA 1QRQA 1D3GA 4QS5A 4DJED 5C5JA 1YNPA 4PB3A 4TU1A 3G1YA 4UOJA 4Y9OA 4MAVA 4D72A 2XH7A 1NWUA 4ED2A 2PSNA 3GC2A 4IF2A 1QDSA 4XAZA 5DLFA 3PZUA 3GNRA 4Z0JA 7ODCA 4O12A 5DGBA 1G5AA 1MO0A 3VUSA 4ERGA 2RGMA 3INPA 1G7VA 4H9MA 1G69A 2EPLX 3AMDA 1MDLA 1NSJA 1FWAC 2P88A 4Z1DA 4UBPC 3IUHA 1MW3A 1EGMA 2O0TA 1RQEA 4MZ1A 1YE6A 1SM9A 2OZ3A 4D6GA 4O15A 2RKXA 3T0DA 1XQLA 3QSRA 3LMYA 1MYRA 3PN8A 2H9AB 1EP2A 4Q8OA 1CXEA 4H7VA 3G1SA 5KFIA 4PTVA 3MP4A 3PY2A 1LLZA 4IGMA 3ZT7A 1KLZA 2R8JA 4YTUA 3RR4A 1GVOA 3LS9A 2CKRA 4XAFA 3DAQA 4P8XA 1LF1A 3MKVA 1XSIA 4C6QA 1QAPA 1NM9A 2GJXA 3FW6A 4WOQA 5BXTA 4JBRA 2JFEX 4JV1A 3FAWA 4H6KA 4AY7A 3AHZA 2ZRXA 5E1QA 2QV5A 1RZMA 4DL6A 3KOWA 1J12A 4ZA0A 1UP3A 3TP4A 5FJJA 5J8LA 5A3HA 3TW7A 5K4ZA 2C8NA 1TJ1A 2CWXA 5CPQA 1JYXA 1E51A 5CBIA 3BLDA 3MWAA 2CLOA 2QJNA 3VKCA 2BVYA 2E25A 1AL8A 1RY0A 1OK6A 3ZWTA 1LOQA 3P0XA 1IZKA 4E8CA 3HIJA 4C60A 2VZUA 3VD7A 1AW5A 1B3XA 4ZEPA 3TYZA 1YRRA 2V3EA 4QX4A 3ZSSA 2GGHA 3VC5A 2QCNA 1OSEA 3OJGA 3W01A 1KRCC 3LTYA 1A53A 4B2DA 4W4QA 1DBTA 1SFJA 1FFQA 1JL8A 2WWDA 3ZVHB 4Q33A 1H09A 4HOXA 5AHIA 2Z1SA 3WD2A 4D6FA 2IQDA 4DPPA 4ZR8A 1XICA 1U1JA 1JRCA 1T7LA 5D09A 2OODA 3WJSA 1VFFA 2QIIA 1W1IE 4GI8A 1J5SA 5LYRA 3VILA 4LPCA 4PBFA 2VENA 2XGIA 2WCGA 4LB4A 3ITGA 2AKZA 3AZSA 3H8AA 3WK3A 2F9RA 2NW0A 4OECA 1Q6CA 4Q8PA 1WOBA 3TN6A 4B5TA 3WSUA 3ZS4A 2YDSA 3S42A 1N8IA 1VP5A 4MNKA 2ZA3A 1S38A 4N42A 1NDYA 4GI6A 4IMFA 2DSUA 4HVXA 4TIMA 2WJZA 3ZVIA 4ZB0A 3V6JA 3G1XA 4XVEA 4M19A 2RDIA 1KFBA 2X1IA 1UKQA 1TPWA 3L4XA 2WOQA 2X05A 3L4WA 4I3GA 4N4PA 4EWJA 7A3HA 2IQTA 3AZRA 1FWFC 5T9CE 3GG0A 1JZ4A 4RR4A 3LGGA 1W1TA 2Z4GA 3KHDA 3UERA 3FCPA 1QPKA 5IRPA 2ASDA 3GG7A 5ABGA 1K7FA 1YMYA 2QJHA 3TYDA 2WQPA 3CV7A 2XSAA 5FF3A 1GVYA 2PDJA 3MDUA 3GHSA 1PEZA 1W0MA 3MSGA 4JFUA 1G67A 4QG8A 2OYLA 1Z3NA 3NZ1A 5FCZA 4V28A 3AAMA 1A4LA 2WKGA 2C2DA 2WYSA 3KAOA 4I7VA 4ZQCA 1H7NA 4MWAC 3D0CA 1OCBA 2PDPA 2VXNA 3OIXA 1SR0A 3ARXA 1E6XM 1PUDA 4N2YA 5IHRA 1YPXA 2VFDA 4HKPA 1XIEA 3UT0A 2ZKMX 1QNOA 3SY5A 1JAEA 4ROPA 3UR2A 2HNEA 1E6QM 3A22A 1J6PA 3GU9A 1DWAM 1LP6A 4IPIA 4AISA 2WMIB 1YTEA 5CSRA 1G4EA 5HNNA 2ASLA 3LPOA 2VFEA 1MEIA 3H4DA 4X2PA 1FCVA 3V36A 4PUWA 3S5NA 3G1HA 2YX0A 5LA1A 4LTSA 2OEKA 3GVGA 1D7KA 1LRNA 3PW4A 3P8IA 2ZZ1A 2XVKA 3DEQA 2BQ3A 3NQ8A 2AAAA 2V8ZA 4GQGA 1V8EA 3KBJA 4PRRA 3OVGA 1CGTA 3M0JA 4E6MA 3URQA 3NWRA 2E9LA 1UC4A 3H23A 2VELA 3ZFHA 2XSBA 2ICSA 4GZ7A 3AS0A 3CM4A 2FTWA 1UW9A 2XVNA 3RN6A 2EPMX 3AMKA 4Q8MA 4I6VA 5KZEA 1G0CA 3PR5B 2CLIA 1QI3A 3HO8A 5D2XA 3MWCA 4RW5A 2YDAA 3L4UA 4LJ3A 4DXVA 1HKVA 2IPFA 3LG3A 3ONBA 1W1ZA 2ZUNA 2OYMA 3NQ7A 4J3UA 2PDCA 1A47A 2NVDA 5A6AA 2J8GA 1TUXA 3HG4A 2G37A 2V6AA 4GI9A 2WAGA 1E4IA 2X1SA 1ZL1A 3A6OA 5KFGA 5D04C 3HV8A 4XZWA 4FNQA 3EWXA 3CUZA 3SUUA 3EGJA 4RV8A 3WELA 1B3VA 3LQLA 1OIMA 3CIXA 3BMVA 4RDVA 4QTGA 2IXVA 4NY2A 2JIWA 3GNXA 1XFCA 4XD6A 2W9BB 1NQ6A 3NZPA 4H6EA 4LNYA 1NY1A 2Z2UA 3EXTA 3TQKA 3TTQA 3WLNA 1E43A 2ALRA 1PHQA 4J9NA 2XHYA 3LLDA 1Z41A 3EX6A 3M9MB 3FDKA 4Q4PA 3M5VA 5EKYA 1RHCA 2VMFA 5CC3A 4GQBA 1OCNA 4J1OA 5K9XA 3K2GA 2DT2A 4UQDA 4RZBA 4QDMA 3W7CA 3GKFA 4E2BA 2CXEA 4RNMA 4XAPA 4ZO8A 5A95A 4A3HA 1UR9A 4QE5A 2E3ZA 1B9BA 1JD9A 3FA4A 5I09A 3VKKA 1CB2A 3ITCA 3SDOA 3S1XA 1AUSL 3EX1A 1O5KA 1I6NA 4WXZA 4QAIA 1F8MA 1PX8A 3ZT5A 2P50A 3T1GA 3TDFA 4BEQA 2E6YA 3BK0A 4DXKA 4GWEA 4AD1A 4GC3A 1NOUA 1Q7QA 1R3TA 2G97A 3CAVA 4XZBA 1JEZA 1OG6A 4GIEA 2RDTA 4PMVA 9XIMA 3O06A 1WNOA 1RCOB 1VKFA 3GTXA 3VCCA 1XPYA 1R9YA 5KFXA 3T9PA 1F3TA 4UFHA 5G1TA 2H9AA 2GQAA 4X9YA 3TN4A 4JTJA 1CBGA 4MWAA 1EIXA 1NWSA 5U4NA 3LCXA 4IFOA 3KBNA 4C91A 3WUFA 5KFJA 2OG9A 4M6QA 4QNWA 1RVKA 4G1NA 3D3FA 1RJPA 4Q8WA 3EPOA 1ZPTA 4NNCA 4MOZA 3B06A 3IJQA 1BVZA 3QMTA 4OOZA 3ZT6A 4JICA 4TQSA 3WD1A 4Z2HA 4FLQA 4L1GA 3ZOAA 5A6KA 4P7LA 3OSPA 3A5VA 4Y9AA 5DF0A 4YR0A 1CXFA 2NZLA 3DI1A 3N2TA 4H1ZA 2Z00A 3GDBA 3NPWA 4GYPA 1HX0A 1ISVA 5BROA 1VFOA 1XHGA 2QUNA 5B80A 4CNUA 5JMUA 4JTAA 3O63A 2UVVA 1UYQA 1SO4A 3PZQA 3EWYA 3VGHA 1MXGA 1HKKA 2Z1XA 3W7EA 1MEWA 3MYOA 3LENA 3KM8A 4ZQMA 2R6OA 3SCOA 5AVNA 3LUTA 1RQHA 4JEJA 1EEXA 4EXAA 4UMBA 4EPKA 3T07A 3PUGA 4H8UA 2EKCA 1W31A 1FX6A 2W63A 3WDPP 2OWXA 1XIDA 1XPGA 1MSSA 3VK5A 1SYTA 1QT1A 4QWEA 1H7WA 1GCYA 3C4UA 3ZVHA 3UCCA 3F4VA 3M44A 4DJDA 3DHDA 2Y7DA 2VC7A 4US5A 1QI4A 4M1RA 1Z69A 4H19A 1DKWA 1XGDA 1Q63A 2C2EA 4WKFA 4LVBA 1LT8A 1US2A 5AHMA 5H8MA 1TUFA 4LVDA 2HPIA 4J9QA 1ZALA 3UEQA 1MI3A 5KFFA 5LIUX 4PUJA 4BQ5A 3BWWA 4J35A 4C6KA 3FLUA 3PPFA 3QW4B 4BQ4A 3CUJA 2AQVA 1V6XA 1M01A 3WUGA 3M64A 3AU2A 4XSLA 2C91A 2PWHA 1M53A 3A4WA 3AI0A 1S3TC 2ZUWA 1SJAA 3UXKA 4ACZB 3GIKA 4FOJA 2P0OA 2ZRWA 2W79A 3CV2A 4QJ4B 2IPGA 3CASA 5CPTA 3ES8A 4WVXA 3T7VA 1EYEA 2C19A 3SI9A 1TJ2A 1VEMA 4AD3A 4XIMA 3VDBA 2CBUA 5C6MA 2Y24A 2V30A 3F03K 2PD5A 3WF4A 4N0RA 2NUWA 3QN3A 2BR0A 3AS3A 2WXDM 1YDOA 1GQIA 1C8QA 3M9NB 1VIZA 2PGRA 1AW2A 2Z26A 3OBAA 2PDBA 3U2ZA 3RRAA 4U6PA 2GQ3A 4UNLA 4A8NA 3O07A 1P5BA 5HQMA 3EEGA 1D8WA 3N25A 2VL4A 4Q8UA 3QJAA 2QKFA 4NX0A 1R9ZA 6CGTA 1BSIA 5MKGB 3NXFA 4U4MA 3STFA 1YADA 3QBUA 1JAKA 5C70A 2FJUB 1UD3A 4JTLA 4DBEA 4M5PA 5BU6A 3TOPA 3VE9A 3SI8A 1KGXA 2J88A 3C3UA 3TSDA 4X0NA 1NFGA 2H8ZA 3AU6A 2FDMA 1UWIA 2PDIA 2YGYA 2EJ1A 1LZOA 2F7FA 4QLKA 4IQEA 2Y2WA 1J79A 1I45A 3OHIA 3C0QA 1QNVA 3UGRA 1TKKA 4EK7A 1B30A 3CZJA 5BW6A 3TYBA 4G7EB 1NELA 5DMMA 2FPTA 1CGXA 1JPIA 3VYLA 1RYRA 2BOGX 5CH9A 1EZWA 2PURA 2BGSA 4AYSA 3WNKA 4ACYA 2FVLA 4TTUA 3PBUA 1XRSA 2G96A 4AHPA 2CEQA 3ATZA 2WMIA 2D0FA 4C7DA 4HN8A 3VNYA 3TFCA 1RK6A 5F9LA 2P76A 3HG2A 1F3XA 2W62A 4W8AA 4IR1A 3JZUA 4FSAA 3WH9A 3TC7A 4AIOA 4C5ZA 1WDQA 2W3ZA 2GUYA 3F4DA 3W7MA 3EOLA 1RBOB 4FNUA 3BG3A 2EHHA 5KEZA 1SFSA 1US3A 3KVLA 2CHRA 3A4AA 2JE8A 2G41A 4NIRA 4NILA 6REQB 5F1VA 1PDZA 4ZXLA 1XL9A 3QV6A 2OPJA 2C7FA 4C90A 3A4XA 3ES7A 3TE9A 1FHUA 1KFKA 1OFOA 2J77A 2OMAA 3HFYA 3GIMA 3C2VA 3VFLA 3E1F1 1YKWA 4LCRA 1VHCA 5GQBA 1TV3A 4QNEA 3FFSA 3N2XA 4F2UA 3VGFA 4AF0B 1FRBA 5DCDA 3TOYA 3U48A 5EBAA 5FEWA 1G4TA 5E70A 4PC8A 1S2TA 2HBXA 2OFJA 3D3AA 4FLRA 1HGYA 2GVEA 1HL2A 2IA6A 1X97A 4XUYA 4C6BA 3WY1A 4LYRA 3L0KA 2J66A 2DSKA 2BV9A 2QW5A 2ZTKA 3UPBA 8XIMA 4Q45A 3BCDA 3GWQA 5HINA 1H2JA 3EOSA 2YBVA 1S5WA 5FL1A 1FTXA 4WDUA 1XQKA 4HPNA 1F74A 3MZ2A 2W9BA 4MYAA 1TPEA 1EC9A 3VGDA 4N6FA 2ZQ0A 3WCZA 5I78A 1AZ1A 3AIBA 1MUCA 1PPIA 3GZAA 5EMMA 5E0KA 4DYEA 2D2HA 1PZ2A 5CJ5A 1V79A 4PTNA 3WD0A 1XFBA 1FQ0A 3LM3A 4HSOA 3U4FA 2Y7GA 4Q4SA 2V2DA 4UFKA 4B5XA 4KEVA 5KFYA 2EPOA 1PAMA 3L0NA 2J78A 3PZMA 4RZ5A 3Q4DA 4LS1A 3GG8A 1ME8A 3OG2A 4FOUA 3U9IA 3W7HA 4UXDA 2PLMA 5E5CA 4HK7A 3NUKA 1Z44A 1QPQA 4KWSA 2CLEA 4ZBCA 1FWWA 5L1JA 3HQNA 4O1DA 2ZUTA 4F0MA 1RPXA 2ZTJA 3E3HA 3N4EA 8A3HA 1Q2SA 5IXEA 3LGDA 4JTIA 4LS2A 5BU9A 3C86A 2FVMA 3TU9A 2YXXA 3CAWA 3QF0A 2JQXA 2OLAA 5DT7A 4AW7A 2A21A 3BMXA 1EWDA 2RFGA 3ZIZA 1O66A 2O9RA 1ZNNA 4OKDA 3RCMA 3GTIA 4HMNA 3QKZA 3V35A 3L67A 1PZ1A 4O1AA 3W38A 2PI6A 3C2FA 3RLHA 4ZENA 4J3ZA 4W5ZA 3N6HA 4S3DA 1RV8A 3CNYA 3VMNA 1KXHA 4W9TA 4C1NB 3LBMA 1EOMA 3AXXA 3WFAA 3P5YA 3VNJA 2QJGA 3W29A 3WJWA 1ME9A 4EIVA 3V75A 3OW1A 4EKJA 2AQOA 3FY1A 1OFQA 4MHBA 1H7RA 4EX4A 3KX6A 1K03A 3LGEA 4F4YA 3W70A 4QW9A 4CNNA 2E8ZA 4HJWA 3T5HA 4ROQA 2PWVA 3HA1A 3NQ6A 1QW8A 4JKMA 3M0MA 3GZ3A 3BQ1A 4ADSA 2PGEA 1VJSA 3B0VC 3DG3A 1F3EA 4IRDA 1KRMA 5CGQA 1MW0A 2ZZ6A 3Q45A 4XUGA 2YW3A 2EPHA 2W5FA 5KFDA 3VIHA 1R6WA 1ZAJA 1B1YA 2BXZA 4B5VA 4O16A 4O10A 1BGAA 3R0DA 3OQEA 1W3IA 1MWOA 5FJOA 1SSGA 1HG3A 1X8FA 5FEPA 2IBKA 2C13A 1XCXA 1AQ0A 1GZ1A 4GIAA 1YXDA 4XZLX 3GXDA 3SURA 4J4KA 4FK9A 4I9AA 4HHHA 2GOKA 3NGJA 5M2FX 2ANUA 4CVWA 1P6WA 1WUEA 5F9NA 1A3WA 5KFEA 4M3PA 1BG4A 3SM0A 1NOWA 2I5IA 4JTQA 2YBUA 5AZ0A 3IGHX 2VQTA 4D6JA 1ZB5A 1YTKA 2VFIA 1RPKA 4UTHA 1GORA 2QDDA 2DIEA 4YJ5A 1SFLA 2PDXA 4JTKA 3OIHA 4CLMA 4B4HA 4ERIA 2PP0A 4UTLA 3DYMA 3BAXA 3KL3A 3W00A 3VOGA 3O0FA 4IT1A 1M5WA 1S39A 1W5PA 1TIMA 5CZKA 4D6DA 2OQHA 5G2HA 3TN3A 4LH8A 1DXEA 4KW2A 4ACZA 4GOAA 1LDCA 4MTVA 1H7OA 2JF6A 3L12A 4PMXA 1E6ZA 4IJRA 4WKHA 3SCVA 3NDZA 4ECYA 3M7WA 3SSJA 2DP3A 5FEZA 1ZUAX 3VI2A 3L4YA 1S5NA 4IPNB 3WDJA 4E2OA 4O4VA 2QPXA 3H4GA 1P0NA 1FY6A 4XB3A 3NDYA 1TV2A 3B8DA 2ZRUA 4WEVX 3Q58A 4U33A 1Q66A 4YL2A 3BANA 3TX9A 1Y5WA 2V4RA 4LX4A 4BY3A 2ZUSA 4HNUA 1TRIA 4XZ9A 3TJIA 1K8CA 5LHEA 1RQBA 3KHJA 3TW9A 4GJIA 1RR2A 2WHLA 1J0HA 3KVKA 2F38A 1E0TA 4XZMX 5MKGA 2YLAA 2XGPA 2VRKA 4B3KA 3YPIA 3G1FA 2JKAA 3EPNA 1PYMA 5KG0A 2E67A 2JEQA 2OLSA 3FEMA 2W7OA 4PUDA 3B4UA 3DHFA 3EWZA 2FB2A 4TO8A 1T5AA 3GV5B 3VCNA 1KTNA 4MZ8A 3VXGA 3KHRA 3VOHA 6TIMA 4XD3A 3FJ6A 3PB2A 2XC9A 2QGHA 5DG9A 5K3VA 4G7EA 2ZCGA 4R5EA 2V9WA 1CECA 4ZQPA 1DTUA 5AC8A 1TRDA 4QQUA 3ALGA 4L9XA 3FEQA 1YXCA 1IQ8A 2WZEA 4DUWA 3ABXA 4KCWA 3LBCA 5JIWA 1VBJA 4DZIA 2ZC8A 1MEHA 3LEPA 1C3FA 4RJEA 4DWDA 2J7HA 2EXOA 4HZ8A 3L7RA 3TCEA 4GRSA 3N14A 4RK8A 5C2CA 2VCCA 3M9OB 4NF7A 4UFJA 2JBMA 1H50A 1JXJA 4AQLA 5KFOA 1S46A 3VNLA 1M7XA 5A8QA 2OVLA 1F4AA 1KBLA 4QS6A 3OO2A 3MSDA 2A3EA 4TMCA 1RJRA 1SO3A 3ONCA 4B90A 2W27A 2DDXA 1KR1A 3GW0A 4GNJA 4B2DD 3WYZA 2VT0A 3NZGA 4Q4MA 4MZYA 3FDGA 3IJ9A 1KR0A 3Q94A 4FIQA 4TTGA 1V03A 4GXPA 4TOQA 3ZQ9A 1RK5A 3W07A 3RCYA 2QLYA 1XD0A 1FWGC 3SO7A 1R3VA 3SRKA 3ISIX 4OBSA 1K9DA 4AF0A 2GJLA 5CG0A 3P81A 4NNAA 3UU0A 1J0JA 1EA9C 4WGXA 3PK7A 1EX5A 2DQXA 2BMBA 1F3WA 2Y0FA 2HWGA 1QW9A 2Z1WA 3OOQA 4K6AA 3K8MA 3M0HA 4GVIA 1MRAA 5CZ0A 4MPKA 2PDLA 3VM5A 1JCNA 3OSNA 1XLHA 1RD5A 5RUBA 1XDLA 2DGAA 1YE4A 4ZSTA 3GVQA 5M3WA 5LGZA 3S83A 3PW7A 3BZJA 3EYPA 3W7KA 2CLHA 4ZQOA 2YIHA 3SSZA 1DJGA 3VNZA 3PVFA 1QI5A 1XD1A 1WAUA 5M5DA 1XH2A 2PDQA 2WNNA 4EBDA 5G1YA 1EUNA 1GTHA 4BK9A 3WENA 3W2UA 4R9XA 1TE1A 4MFEA 3V3WA 1QWKA 4U5KA 4CQBA 4Q6XA 4QBXA 3VGGA 4FA3A 4GUJA 3RMJA 4K1GA 4O54A 2OO0A 4HZ7A 1W5OA 1FP8A 4JTFA 3PZTA 3QFWA 5KFTA 4UCFA 5EBUA 4H04A 1VFUA 5GNYA 2H8XA 4CGTA 3IWPA 3NDOA 5HMDA 1MNSA 3BMWA 4I6KA 3TTEA 4N9CA 3V4BA 1CGYA 3VABA 4F48A 3A9IA 3KP1A 3P3BA 3OA5A 4G5DA 3CHFA 3SCPA 1IXOA 1YEYA 4LC6A 3KWSA 3ZO9A 3T5LA 1BTCA 3SQLA 2Y4SA 3GXTA 2IQ0A 4YVPA 2Y88A 3H7VA 3MQTA 3KCLA 5HJXA 3CQHA 5KFUA 4RNJA 2GWNA 3VOIA 3M7SA 3SCWA 4GXWA 3MUCA 5H91A 4A2SA 2WHMA 3E0VA 2HV5A 5DY2A 3GIJA 4QGCA 3WEMA 4C1NA 2W8LA 1MQPA 1Y65A 4MWAE 3NEVA 3T0AA 1D3CA 3DKJA 4J28A 2BHUA 1HVQA 3OBEA 3ARUA 4AEEA 3PP7A 3V1PA 1SSDA 3BG9A 4XBJA 1ZENA 3HJEA 4M82A 2VFGA 4H2CA 5KFHA 4Z1CA 4IJCA 4ML4A 1FXQA 4PE8A 4R7JA 4IGSA 4MB5A 1TV8A 2GJPA 2TSYA 3RX4A 3DESA 4IQLA 5FA5A 5HJLA 1CLXA 4Z1AA 4UQBA 3R0UA 2OOFA 3R13A 3ZJ6A 1IHIA 3NXLA 2RDWA 3NEHA 5H1WA 2JEIA 1YQ2A 4AWSA 1EJTC 2JGQA 1X38A 4OZOA 3DHUA 3KS5A 1GOMA 4ECTA 3S9YA 2NQ5A 1KV5A 2Y5SA 5E93A 2B7QA 3PF3A 5C0QA 2DT1A 4KIRA 1UD5A 1ZP3A 3Q8PB 1S2UA 3C6CA 2HTMA 2PTWA 1FVPA 4Z08A 4D6HA 5FEXA 3LCHA 4ZO6A 4Z2JA 3S5OA 3N15A 2R1KA 3HQ1A 2PDMA 4NZFA 4DBDA 2WZHA 2ATSA 3GHTA 5XINA 4V27A 2FZ9A 4ECVA 4I9MA 4ZB5A 1QXLA 3GNPA 1VRXA 1V7AA 3QRHA 3H40A 3R11A 4X61A 4W85A 4NI3A 2ISSA 2EG6A 4JTRA 5KSWA 3B03A 1F05A 4UUIA 3PR2A 1AH0A 1DP0A 3H2MA 2J25A 5HMFA 1K4HA 1MFVA 5EMYA 5EY5A 3L5MA 4J9MA 3PUOA 1J18A 1DIKA 4ZXOA 2IKJA 2J6VA 1TE6A 1JPHA 2FB3A 3QV8A 5JU6A 1QBBA 2J7FA 4M7TA 1POKA 4WQ6A 1SW3A 3FHAA 5LNSA 1XW8A 1L6FA 1KTBA 3VIPA 1IIGA 1ZETA 2NUYA 1P0DA 1ISXA 1QASA 2QDHA 3L2MA 3THAA 3BAIA 5CPNA 1JCJA 4S3KA 3VIFA 4HU3A 4BI6A 4A3RA 3W1MA 2E1DA 5HWJA 4LQ1A 3TAKA 4Y7EA 1KNWA 2H6RA 4ADUA 3W1RA 2DUZA 2V68A 3UA3A 3RJXA 2OCZA 1O4UA 2OQYA 2BVDA 3IK2A 5AN7A 3S2LA 4CNSA 3GIQA 1GVIA 1XUZA 1JZ8A 1J11A 1XBZA 3CQ0A 1WDWA 3LMZA 2WKJA 4LCSA 2XN1A 2J6TA 3T08A 4NKCA 5KFLA 1Q6EA 1MNZA 2VX7A 4IX2A 1OC5A 4GJJA 1JXLA 4FNTA 4ERAA 1VPXA 2PRMA 2VRJA 4IIGA 3MMUA 1JNEA 3OA3A 2EJAA 2WM0A 3M1ZA 3ABSA 4NX5A 2OOGA 1ME7A 4EOUA 4QWCA 4QXIA 4I5RA 3I7QA 3TCSA 2ZZ2A 1EJ7L 2CZVA 2DZPA 3M0IA 3LHYA 3UNDA 1E0VA 1VJIA 3MHUA 4FP1A 5I5RA 1QOQA 4L56A 2O7QA 3IIXA 3NFUA 4WSKA 1OYCA 4C7FA 4JY9A 2VX4A 4MWAD 3PBVA 4L9YA 3V1HA 1KXQA 3ITTA 3S8HA 2POTA 1QPNA 4BWLC 3E0WA 5DGAA 1V6VA 1JZ3A 1XS2A 1DJNA 1GYLA 1TVPA 3BC9A 2DZVA 4DQWA 4LVFA 1EOKA 2QCFA 1NTHA 4AIBA 2YCLB 2FTPA 2XTKA 4FXSA 1TCMA 3FN9A 4NUWA 4JTHA 3HPFA 2BY0A 1T6MA 4UTJA 3ZJ8A 4XIAA 1OVDA 4IMGA 1DV7A 2BY1A 3S5SA 3BH4A 1J0KA 4JTEA 1W17A 5I00A 2HCVA 1R0MA 5ECUA 5FKYA 3U2CA 1EJSC 1GOQA 1ITQA 5CGTA 3QZ7A 4KWOA 4HA1A 1VYSX 4F0LA 1W5QA 3MR3A 5C7HA 2KZHA 2NSXA 4BEUA 3FVMA 2YCJA 3NSNA 2GGGA 4BZYA 3MCMA 1XLCA 2W0UA 5KT6A 4Q43A 2Y70A 4OWGA 3O6YX 3RRXA 2ESCA 4ZOBA 4NP7A 3BL3A 5FD0A 3SRFA 3LD5A 2CIPA 4DJDD 3QSTA 4US5D 3BOXA 3N6QA 1G9HA 3GNDA 4K39A 1FH7A 3CPRA 3T8QA 3W22A 4EBCA 1X6UA 5A6LA 4LS0A 3IIVA 3I3EA 3DERA 1PIGA 2YL6A 4PUEA 3ZR5A 1U30A 1EX1A 1TELA 5F4XA 1KWGA 1ICQA 1GJWA 4W93A 5DCEA 2QCDA 4CCZA 5CXPA 4MSSA 4PFMA 1Q6RA 3GR7A 1VPYA 2PDHA 3WUEA 2KX9A 3PW0A 3GYEA 3FYOA 5BWFA 3LSCA 1MVYA 3DFOA 5TF0A 3RAXA 5TAOA 3IVUA 2YB1A 1N7KA 2YYTA 5EFDA 2DT0A 3HN3A 3F4CA 3BSMA 4G1KA 4G7FA 2J75A 3PZGA 4S3EA 3CLWA 3GH5A 1K9TA 4JDYA 2X30A 3GLCA 2UY3A 2OZTA 1UBSA 4O1EA 5LHFA 1LL4A 1E6RA 2EPNA 5FAGA 1PZ0A 4KS0A 3DCPA 3PBGA 1M3UA 4R53A 1TYGA 1QOXA 3RIKA 2DJLA 3BJFA 2RDJA 1HO1A 2NQZA 4JD4A 1S5VA 3G2GA 5L9XA 4FB7A 2G4FA 2VEIA 1XLMA 1FUYA 4IQJA 3S6OA 4HA3A 4B91A 2X1TA 5HPOA 1LOSA 2E9MA 2QHAA 2Y8KA 3SFWA 2PLKA 1UOKA 2V67A 3HQOA 1R2SA 4PZVA 3TYUA 4AEFA 1QI2A 3LBOA 4JIEA 1QHZA 2Y85A 1LCOA 1JGIA 4LVAA 1ITXA 3B8TA 4RCXA 2NV1A 3Q8RB 4D1IA 5HUPA 1GQKA 3CHEA 1KQYA 4X22A 3VAVA 3SUWA 3R0KA 3S5YA 4YCPA 4AX7A 4C6NA 4CQDA 1WKYA 4DWSC 2PC4A 2XFYA 4QITA 3H22A 2VX6A 3AC0A 1F9CA 1KGUA 3I10A 1X7FA 1UASA 1HTIA 3F1QA 2MUCA 3I6RA 3WLIA 4D6EA 1W1YA 4KWVA 3TYEA 2DUXA 7TIMA 3DC0A 5KETA 4LAOA 3GUGA 3VOJA 5GJMA 3SB0A 4MJ4A 4J7RA 2J6UA 1A5OC 3ZLGA 5AOUA 3SR7A 3N2MA 1FBAA 1AG1O 4CD6A 3UZWA 2QZRA 4F9DA 3XINA 1GOIA 3BAKA 3PAJA 1Y5VA 5I3IA 3VE7A 4PMYA 2V4QA 3WFZA 4AWUA 3WQ5A 3DFHA 4P8VA 4A22A 1XSKA 1ZY9A 3W1XA 1V6YA 4XD5A 1UD2A 4D9PA 4K8GA 4UTFA 1Q4NX 5DQGA 3W1AA 3KP0A 4GQQA 3TWAA 3QHOA 4I9TA 4LXFA 1XG3A 3RX2A 3RPDA 5AHLA 1MMFA 4GKLA 1PVNA 4GO8A 1S5MA 2ODOA 2FYMA 3ARYA 2GFTA 1V51A 2PWDA 4RUBA 4LFYA 1TSIA 3BLFA 2WPBA 1J9YA 3ENLA 2C79A 3FA5A 3P2VA 3SCNA 3P6LA 2EG7A 4QCEA 3KEHA 3IVSA 2IPWA 3TA6A 1W1VA 1TPUA 5EWFA 1PB0A 3U7BA 3AUOA 2G3IA 3PBYA 1W5NA 2C16A 2INEA 1PE1A 3EKGA 2NX9A 2X16A 3TEVA 3URNA 1E72M 3TJXA 2CLKA 1TREA 3XISA 3GKAA 3VDGA 2E68A 5D33A 2ON3A 2OJPA 4YTRA 5JXQA 2V5CA 3WLQA 3LI0A 1GQNA 1IT0A 3CWNA 2IPJA 1OFRA 2F6UA 2QF8A 3HTWA 3WLHA 1DWGM 3QY8A 3TZFA 5E9XA 2GVJA 4UB9A 2J7GA 1LQ2A 3U6WA 4R33A 3QOKA 3P60A 3QMRA 4GX8A 3LK6A 1K3UA 4KT2A 5ABTA 4DIAA 2BXVA 2ZXDA 2WW5A 4LEQA 1G4SA 2PWFA 3LRLA 1JDAA 3R1ZA 2GGIA 1UR1A 1XIJA 3GSMA 4YMZA 2BNJA 4E4FA 4ATDA 3IAPA 1CX9A 3UFYA 4DX3A 1KM1A 1XXXA 2R9RA 1EZ2A 1OD0A 1JVNA 3VKDA 4IMAA 4NZ4A 4EP8C 4EVZA 3T0CA 1HJWA 2X7VA 3L2IA 1QI0A 1A5UA 4DL7A 1UPMB 1ZCCA 5CLWA 3WMSA 2H3DA 2GLKA 1XLKA 4GISA 1LTDA 5KFMA 3OVRA 2Y5JA 4GGHA 4GIYA 5FI8A 2PUZA 2FJKA 3BV7A 3DBPA 2NXIA 1YHTA 1XRVA 1YIXA 3S46A 5SWUA 2PP1A 3BJTA 3MY9A 1VJZA 1LUCB 4UTWA 3RLVA 5LNUA 2WC4A 5A8MA 2ABAA 1L8NA 4DL4A 1W91A 2FIQA 4TVUA 4RE2A 2XM2A 3B8WA 2JGYA 4QEHA 4MNMA 4P61A 3W74A 1Z89A 3UWVA 2NV9A 1WKEA 3ARVA 4CD5A 3W1UA 1EQPA 4JTDA 3TLQA 5HOSA 1ODUA 1S1RA 3CT7A 5HANA 2YR1A 1XIHA 4AX6A 1QFEA 5BRPA 1CCWB 5AYIA 5JBDA 5KFKA 4O1CA 1KB3A 1ECEA 2YCLA 1KM2A 2NQHA 1KBJA 4RNHA 3BDKA 3NVTA 1I2RA 3SGGA 4C1LA 3PHAA 2YXGA 4MY1A 1DWFM 1PZ3A 3O05A 3N29A 1ZRQA 3J7HA 4HJFA 4JTUA 4IH3A 4E38A 2WANA 3QLLA 2BASA 4HCLA 2UVWA 1JIBA 1LQAA 3LXAA 3QV9A 4ORMA 1ICSA 4RV3A 2XSXA 1U1HA 5D05A 1Q7MA 4L1WA 4MLRA 4DO5A 4O52A 3MKCA 3MI6A 3WJXA 3L4TA 1PKLA 4Z2LA 4Y2WA 3CMJA 3H54A 2W8KA 1TA3B 5LIWX 1LBMA 4ICNA 1M1BA 1F7BA 2INZA 3CQKA 4RZRA 2FHCA 5HR6A 3ICJA 4UR8A 1DYSA 3IV3A 3BAYA 3NQ2A 4KIEA 2XH0A 4LBUA 2YXOA 4PSPA 3WH7A 3VKBA 3KRBA 2V3DA 1TZZA 3R6IA 4DJFA 3EPGA 4J2PA 4RLIA 4MB3A 3M9YA 3W7RA 1CW2A 2O9PA 2OXNA 2JALA 2VEPA 1M03A 3C2RA 3KHHA 2UVRA 1F8IA 3DI0A 3NTYA 4OE7A 4S3GA 3Q2DA 4WOZA 5C9ZA 1T96A 3P93A 5CZSA 3VNMA 4HMDA 4V15A 3AS1A 2ZDRA 4Z1BA 4AMCA 2ZRZA 4R3UA 1UWUA 5CGMA 2W9MA 3QTPA 5F2MA 3TTOA 2GOUA 5BXPA 2YSWA 3AALA 5JH2A 1JJKA 3KCJA 4AUBA 4CEXC 1OGBA 1WDDA 4DL2A 2C1GA 3R8HA 1IR2A 3GU1A 4FEZA 1O5RA 5KT2A 1V3KA 1J01A 5DFAA 3T44A 2ACUA 5D9OA 1HW6A 3PVXA 3PPHA 5HQLA 4GH3A 2V63A 3MMDA 3PS7A 3WJZA 4DBSA 2RDXA 2TODA 1WYIA 5JQ9A 1I2PA 1L2UA 1OT1A 3PZOA 4PSRA 1Q8JA 4R7WA 3WDQA 3G5EA 3BLLA 4IRCA 2CWNA 4QIUA 4FS2A 4OBRA 4URIA 4JIPA 3SN4A 3NM1A 1XX1A 2YA2A 3THCA 2NXGA 1PIIA 1JZ6A 4F0HA 5T91A 1ISZA 3VIOA 4LANA 5KFZA 2HZGA 2TAAA 3VZXA 3V16A 1JYVA 3AXMA 5J04A 2HVOA 1PCKA 4NL1A 1GKPA 2FMNA 4AVFA 4AZ6A 3ITYA 3GTFA 1V3IA 5A8NA 2UZ9A 3OVPA 3DECA 3UWYA 5IDIA 3M0XA 2VA3A 3WLPA 5D32A 2ZX7A 4N4QA 2VURA 4ZO7A 5TIMA 5IDZA 3MHGA 1V7YA 1E9LA 4IP5A 2CLMA 5H8UA 3UYIA 4YS1A 4IX0A 4H8NA 4WR3A 2J62A 3MV11 3S4TA 2CLLA 4UTIA 4XK2A 2I1OA 3W1LA 4QLJA 4WY0F 3P82A 4QP0A 1FA2A 3K4DA 2PWUA 3VIIA 2HK1A 4AXKA 1OD8A 2AKMA 4MY8A 3MHFA 2OWWA 3KTSA 4HNTA 3PTQA 2P1FA 2YA0A 1DXIA 4DVOA 3S6DA 1TMQA 1P1MA 5DG7A 3JVAA 1AK5A 1WZAA 3SQSA 4X3ZA 4H41A 5HMSA 1US0A 2JIEA 5C2XA 2Z27A 2BVWA 1U1UA 1GKRA 4Q8NA 3JR2A 4K3ZA 4L9ZA 3TSBA 4PODA 3S9ZA 4B3ZA 2D23A 4HNLA 1XYZA 2ZWYA 4BHYA 3CUXA 1I0DA 2VNCA 2BHZA 1SU5A 4QAWA 4EF9A 1W9BM 3A24A 2E6FA 3KS6A 1ADSA 2D0HA 4GYJA 4JR5A 1OWQA 3I3BA 1HKWA 2PBOA 2Z25A 4C65A 1MFUA 5JVLA 2Q3RA 1OX4B 2OQLA 1KM4A 3WLOA 1E56A 4RZ4A 1C93A 3EPMA 4U3AA 3NZRA 3E49A 4HNCA 1KCLA 4G9PA 1QUMA 1MZHA 4GZEA 2ZXBA 4GCXA 1R8LA 4JIRA 3GAKA 1M9HA