4CQBA

The reaction mechanism of the n-isopropylammelide isopropylaminohydrolase atzc: insights from structural and mutagenesis studies
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
402
structure length
402
Chain Sequence
SKDFDLIIRNAYLSEKDSVYDIGIVGDRIIKIEAKIEGTVKDEIDAKGNLVSPGFVDAHTHMDKSFTSTGERLPKFWSRPYTRDAAIEDGLKYYKNATHEEIKRHVIEHAHMQVLHGTLYTRTHVDVDSVAKTKAVEAVLEAKEELKDLIDIQVVAFAQSGFFVDLESESLIRKSLDMGCDLVGGVDPATRENNVEGSLDLCFKLAKEYDVDIDYHIHDIGTVGVYSINRLAQKTIENGYKGRVTTSHAWCFADAPSEWLDEAIPLYKDSGMKFVTCFSSTPPTMPVIKLLEAGINLGCASDNIRDFWVPFGNGDMVQGALIETQRLELKTNRDLGLIWKMITSEGARVLGIEKNYGIEVGKKADLVVLNSLSPQWAIIDQAKRLCVIKNGRIIVKDEVIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structure and Mutagenesis Studies of the N-Isopropylammelide Isopropylaminohydrolase, Atzc
pubmed doi rcsb
source organism Pseudomonas sp. adp
molecule tags Hydrolase
molecule keywords N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE
total genus 162
structure length 402
sequence length 402
chains with identical sequence B
ec nomenclature ec 3.5.4.42: N-isopropylammelide isopropylaminohydrolase.
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 4cqbA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4cqbA02
1RK6A 4G7EA 1A5KC 2GZXA 4ERGA 4QRNA 2Z4GA 1ADDA 1DPMA 4L6DA 1NDVA 1P6BA 4H9VA 4XAFA 2I9UA 3MPGA 4CQDA 3WZ0E 2I5GA 2EG6A 3A4JA 3E74A 1FKXA 4C5ZA 2R1KA 3ID7A 2WM1A 4QROA 4HK5A 3WMLA 3TNBA 1JGMA 1A4MA 3URBA 3MVIA 4QTGA 3V7PA 4C6IA 4BKNA 3S2JA 3TN3A 3F2DA 2WJDA 1J5SA 3PNZA 4LANA 4LCRA 3HPAA 3K4WA 2HPIA 4HK6A 3IGHX 1O5RA 3F2CA 4XD3A 4H9XA 4QS5A 1EJVC 3F4CA 4BJHA 4IGNA 1RJQA 2Z26A 1YBQA 2F6KA 4C6JA 4LALA 2DVXA 1QW7A 3GRIA 4F0SA 4CNSA 2OQLA 2UBPC 3AU6A 3DCPA 2XIOA 1FWJC 1EF2A 4F0RA 3PBMA 2QS8A 3QY6A 4J2MA 1XRFA 3LU2A 4PBFA 1I0DA 3E2VA 5HMDA 1A5OC 4QSFA 1FWDC 4H9YA 2HBXA 3HM7A 3GU2A 2ICSA 4F0LA 2AMXA 3GTFA 4E3TA 5HMFA 4OFCA 4C6BA 1R9XA 4ERIA 2W9MA 3BE7A 4C65A 4XAGA 4EPKA 3DC8A 4INFA 3EWCA 4Z42C 1EYWA 4PCNA 3QY8A 4EPBC 4KIRA 2HBVA 1V77A 4C6FA 2OGJA 1XWYA 4PCPA 3T81A 3OOQA 4IFKB 1ITUA 3AUOA 4DZIA 3LS9A 3S2LA 4LAOA 1UIPA 2FTWA 4P5UA 1ITQA 2Q01A 3GU9A 3PAOA 3LSBA 2Y1HA 4J35A 4V1XA 1EJRC 1K1DA 2FTYA 4KEUA 2Z28A 4RDWA 1YIXA 4UBPC 2Z24A 3GG7A 5E5CA 4NG3A 2Z7GA 1A5NC 4ICMA 4RDYA 1FWHC 2QT3A 3MDWA 4KEVA 4C6OA 4C6KA 4GXWA 2OOFA 4KESA 4H9TA 1YBQB 3LA4A 2BB0A 3C86A 3TN5A 2YB1A 4C6PA 1NDWA 1EJWC 3GGMA 1EZ2A 1IE7C 4G7EB 2GWNA 3URQA 2QVNA 2Z2BA 3F2BA 1EJUC 4C6MA 4DI9A 4BY3A 4LCSA 1RJRA 3URAA 4KERA 3PANA 3ORWA 4GX8A 4KEZA 3RYSA 1A5LC 4D8LA 4ZSTA 3UBPC 4RE0A 5CH9A 1ZZMA 3TN4A 4C60A 3IARA 1PTAA 2VHLA 1K70A 1POJA 4H00A 1V51A 1E9ZB 4EPDC 4C6LA 2KAUC 3MTWA 3LGDA 1EJTC 2E1WA 2VR2A 4RDVA 3B40A 2PAJA 1RA0A 4CQBA 3SFWA 4JOMA 2P9BA 4C5YA 1A4LA 2EG8A 1UIOA 2G3FA 2VM8A 4XAZA 4L9XA 3TN6A 3MDUA 3OODA 4HA0A 2WJFA 1KCXA 1KRBC 4LAMA 3OQEA 4IG2A 3IV8A 1ONXA 3IRSA 3S4TA 2QPXA 1BF6A 3LGGA 3CS2A 2FVKA 4GX9A 1PB0A 3IACA 1XRTA 1XGEA 1HZYA 1KRAC 3WYZA 1POKA 2GSEA 2PGFA 3S2MA 1V4YA 2A3LA 4CNTA 4AC7C 1GKPA 1S3TC 1YMYA 1KRCC 4KQNA 2CZVA 4GBDA 2R1NA 4ZSUA 4C6DA 3D6NA 3B0XA 4C6QA 3EGJA 4CEXC 1YRRA 3MKVA 4DLFA 1EJXC 3QY7A 5FSDC 4EPEC 2DVTA 3QGKC 1RK5A 3E0LA 2Z25A 1J6PA 4UB9A 5AKQA 3O7UA 4GYFA 1M65A 3LSCA 2VUNA 4M51A 1KRMA 1NFGA 1P1MA 4QS6A 3GTHA 4NI8A 3S2NA 3DUGA 1UBPC 2PUZA 4AQLA 4LEFA 3SO7A 4R7WA 2FFIA 4PE8A 1YNYA 2WJEA 1V7AA 2OB3A 3UF9A 3AU2A 3G77A 1WXYA 3RCMA 4H9ZA 3QGAC 4GY7A 1PO9A 3T8LA 3UR5A 3CAKA 3A3WA 4H9MA 1O12A 3IPWA 3GTIA 4NP7A 2GOKA 3OVGA 4GY1A 1WXZA 2YXOA 5FSEC 4DYKA 4LCQA 2HNHA 4HJWA 4KF1A 1ONWA 4XD6A 3HTWA 4GK8A 4IFKA 3EWDA 3KM8A 2GWGA 1V79A 4RZBA 2D2HA 1W1IE 2HPMA 4C6EA 1FWGC 1NDYA 2HQAA 4YIWA 3URNA 4XAYA 2Q09A 2P53A 1RJPA 2ADAA 4DZHA 3B0YA 1I0BA 2Z00A 1M7JA 3K2GA 3GIQA 4B91A 4RDZA 3E0FA 4PBEA 4CEUC 2O4MA 3CJPA 2Z2AA 2ANUA 2OODA 4GC3A 4HK7A 2BGNE 3JZEA 4I6VA 4R88A 4R85A 1FWAC 2EG7A 1FWEC 3O0FA 2DVUA 3E3HA 3NEHA 4EP8C 3UR2A 3LY0A 1FWFC 4WGXA 1J6OA 2VC7A 3IJ6A 3LNPA 3GIPA 4B92A 3FDGA 2IMRA 4IG2B 4CQCA 4H9UA 2P50A 1GKRA 4DIAA 4DNMA 1EJSC 4G2DA 3ITCA 3OU8A 1E9YB 1K6WA 3RHGA 4XD4A 4B3ZA 2ZC1A 2YZ5A 4IGMA 2FVMA 3PNUA 1P6CA 4J5NA 1PSCA 5G4HC 4CNUA 3N2CA 2D2GA 4XD5A 4C6CA 3OJGA 2RAGA 3MSRA 1RA5A 1FWCC 3ICJA 4IQJA 4GZ7A 4C6NA 4IFRA 4IF2A 3MJMA 2D2JA 1NDZA 4LH8A 5LXXA 4ERAA 2PLMA 4MUPA 3E38A 2YB4A 2R1MA 4V1YA 2O4QA 1VFLA 2AQOA 1R9ZA 1UMLA 1J79A 3FDKA 3ISIX 4DLMA 4LFYA 1QXLA 2PGRA 3F4DA 4IFOA 4LAKA 5HMEA 1RAKA 2R1PA 3GUWA 3T1GA 4B90A 3NQBA 4DI8A 3K5XA 2E25A 4I6KA 3R0DA 1M68A 3GTXA 4WVXA 4WHBA 3UPMA 3A3XA 4TQTA 4IH3A 3GU1A 4DO7A 5A6TC 1FKWA 3FEQA 4GOAA 4GY0A 3NURA 2UZ9A 2R1LA 4KETA 1R9YA 1FWIC 1GKQA 2Z27A 4H01A 1A5MC 3RN6A 1FWBC 2Z29A 3MVTA 2VC5A 2AQVA
chains in the Genus database with same CATH superfamily
2HK1A 1GHRA 5XIMA 2VQTA 3P74A 4ZENA 1R5YA 4AYGA 3NPXA 1L6GA 5EMMA 1P6WA 3M16A 2GVJA 3W71A 1UR3M 1UROA 5H6HA 1VGAA 4CQDA 5D32A 1R3YA 5I3IA 4KWSA 4TU1A 3V0SA 3CZJA 4GACA 1JXKA 1V6UA 4F4WA 4XKYA 2HVMA 4D6HA 4GBUA 1FFRA 1V3MA 1NU5A 2V2HA 4LCRA 4DEZA 1PDZA 3GIMA 2CZDA 3K4WA 4FF5A 3O0KA 3T9PA 1LOSA 2RDXA 4ATDA 3KCLA 2UVUA 3TJXA 3W7PA 2FYMA 1E40A 4DXVA 3L9CA 3U5UA 4X0VA 4KKXA 1KTBA 4MAZA 3INPA 2P5NA 3PSVA 4TMBA 4CNSA 1QPRA 3B8IA 4RXFA 2UBPC 2EPMX 4QR6A 3DCPA 5LNRA 3TE9A 1JL8A 1QK2A 3B0UX 3AMCA 1L8NA 1H4PA 4LVDA 4IQLA 3S6DA 4H9YA 2HBXA 3M43A 3TMLA 3WK1A 4G9PA 4JQAA 2W9MA 4XAGA 2R8WA 3II1A 3I6RA 2AGQA 3CNYA 5KT5A 2AL2B 5DX7A 4HSOA 2NSOA 8CGTA 4D8ZA 4PCPA 3PW2A 3T81A 3WJSA 4IL0A 5DG8A 1V6YA 1ITUA 1SM9A 1UQYA 2CERA 3TSDA 2W3ZA 3PAOA 3LSBA 3T5HA 4Q32A 4CNNA 1HGYA 4Y9OA 4MFEA 3S2CA 4B16A 4KEUA 5LNVA 1B4EA 2DV0A 4X61A 1MZHA 4B2DD 5CAKA 1YIXA 2W9AA 5L1KA 1H1ZA 2VI0A 2V30A 3U48A 2P1FA 2GJXA 3IN5A 3RMJA 5DGAA 4MVAA 3CC1A 4K6AA 2OT1A 4PFMA 1BAGA 5C9WA 1G4SA 3QJAA 2PGWA 1YXCA 3O3RA 2E40A 2QVNA 1VD6A 4QNWA 4JYFA 3TC7A 1AW1A 3AMKA 2DIKA 3URAA 3W01A 3AJ7A 2V2CA 2EXOA 4L5ZA 4BS0A 1P1XA 1X98A 4DO5A 5FD0A 4ZQPA 1W0MA 4P2VA 1GW1A 1Q7ZA 3WD3A 3O6DA 1UD3A 3MUY1 4HCHA 2YX0A 3W6LA 3JZUA 1DOSA 1S2TA 3ZLHA 5D05A 2A6NA 4LGXA 4OBTA 4DN1A 5PTDA 3SY1A 4O16A 3CUXA 1F73A 4MY8A 1SJDA 2WWCA 3WMBA 3HFYA 4AAJA 4DHGA 3WBAA 3C2VA 3MFIA 3AIQA 1XIJA 1JI1A 3GC2A 4JIHA 1J96A 2NSXA 1W17A 1M01A 3EEZA 5BCAA 1JYWA 1HZYA 3SI8A 4F48A 3ABOA 5KG2A 4AC7C 1G1YA 2IS7A 4Z08A 1L6WA 5A8OA 1B9ZA 5HULA 1L2UA 5BNKA 3H4DA 4HSNA 1FCQA 2G5WA 3IJQA 2RGLA 5G1TA 5DANA 1WXJA 3GVVA 5BU6A 1XLAA 3N14A 1KFLA 3FGCA 4AZCA 4KCUA 2XJ7A 1OC6A 1UBPC 3U57A 2X1TA 3ZOAA 3QQ0A 3Q94A 4JNMA 3W7RA 3T5KA 4J9SA 4YS1A 4C7DA 2NX3A 4IPJA 1Q6DA 3R6IA 4O1AA 3CAKA 2V63A 4LUSB 2BXZA 1H41A 2GOKA 5ABGA 3MJYA 3MZ2A 4DYKA 2GYIA 1GVRA 3M47A 1ONWA 1KR0A 3AZRA 2J74A 3H7VA 4Q43A 2NQHA 3WJZA 2UVVA 1F3TA 2GLKA 4F4ZA 4DL5A 2BGQA 3URNA 1ESWA 1KQZA 1CTNA 2VA2A 2YXXA 4P7OA 2CZFA 4F66A 1GZ1A 3RR1A 3W7HA 1QASA 1E3ZA 4JYDA 1F6YA 2WLYA 4JGDA 3JZEA 4WJXA 4AZ6A 5H8PA 3Q37A 2DVUA 1VFHA 3AXKA 1D9EA 3KTCA 3FDGA 5LGXA 2YSWA 4E4UA 1VJIA 3OIXA 2GUBA 2W7OA 1UOKA 3GNRA 3QYSA 1WYIA 3M9MB 3M46A 3RCYA 4AZBA 2OMAA 1UC5A 3OIHA 3WK3A 4CVUA 2WKGA 5A6KA 2FVMA 3PNUA 3TYZA 4P61A 4REQB 4IRDA 1XPGA 3Q2DA 3CZ8A 1XUZA 5E1QA 4DZ5A 3PR4A 2P3EA 1Q3NA 2YL9A 1EOKA 5C8BB 5LXXA 1LYXA 4RZ6A 5KFLA 5EMUA 1GVIA 1QBAA 4WIWA 1V02A 1QXLA 1MZRA 1ZLPA 1ICPA 2BQUA 3CTLA 4IP7A 3BH4A 3DBNA 5DRCA 2BOEX 3RAOA 2NX1A 4NNCA 3WD0A 2VZUA 2C0HA 1JRBA 4GUFA 4IH3A 4YL2A 1PZ2A 3P93A 4WF7A 3GU1A 1VBRA 2YLAA 2PRMA 1JCNA 3U2ZA 4F0HA 1FWIC 2Z27A 2CLEA 3EWZA 3BOLA 3AS2A 1W9BM 1DWAM 2EPHA 1XYCA 1C92A 4NUWA 3HG2A 4K37A 4S3GA 2QCGA 2QR6A 4L6DA 4BQ4A 2D1ZA 3BQ5A 5FAGA 3MA8A 3WZ0E 3N18A 3ZO9A 3LBOA 3S8HA 1WO2A 4HK5A 3AICA 3N3MA 2OLSA 3KHJA 3BG5A 2DPJA 3GK0A 5JQ9A 4OBRA 2QXWA 4MYAA 3KHLA 3RX2A 1DV7A 1JUBA 4R34A 3TOPA 1HL9A 4A6GA 4UNIA 1RQEA 5K2ZA 2FZMA 5I3HA 3MQTA 4B5UA 2DVXA 5F2GA 4FLOA 2PDJA 2XSAA 3LPPA 4EXBA 4FLRA 3ONCA 1Y65A 3GDBA 3BJSA 5FJPA 4AIUA 3PPCA 5DFAA 1V3HA 1F8IA 3RLUA 4MKSA 1AMYA 3VA8A 5D8ZA 5LIYX 3GKAA 4DF1A 3BAXA 5FA5A 3EA3A 4MYXA 4WXYA 4QJ1A 3GU2A 4E3TA 5I2UA 3NAVA 4C6BA 4PSRA 5CPLA 3FXYA 1KLYA 3J7HA 2H8ZA 3PBGA 5ECVA 2NQJA 3EWCA 4LXFA 4Z42C 1MXDA 4ED0A 3QY8A 1NH6A 5I79A 2PBOA 1E43A 2DDXA 1CXIA 2BR0A 4IRKA 3TUUA 3S2LA 3HPXA 4Q6JA 3WLLA 5D33A 4GJIA 1YE6A 2BBFA 5K7JA 5BMXA 1UR8A 3EX2A 4AWTA 1KV8A 3GHUA 1W8GA 2Z24A 3GG7A 3NQDA 3TU9A 2GDQA 2D23A 4NZFA 1PE1A 1E0UA 3VI2A 1S38A 1BYCA 3CUHA 4GVGA 3WY1A 2ZVIA 4AC1X 4NSBA 4Y6GA 4Z1CA 5CJMA 4O0ZA 4PH6A 1DVJA 4JTGA 1OFOA 1EZ2A 1ZBVA 4DJED 1QWKA 3WENA 4DI9A 3DX5A 4NZ3A 1HKMA 3IIXA 4JQ3A 2Z1VA 3PANA 3C0LA 4PEKA 3ORWA 1QCWA 1FHDA 1A5LC 2A3EA 1TO3A 5AZ0A 3EXTA 4RE0A 4JFTA 5FEZA 2OJPA 4Q8NA 3Q45A 1VCGA 2OU4A 1MFVA 2Y89A 3FVDA 4NAFA 5DY3A 2KAUC 1JJKA 2E1WA 3IV3A 3BXWA 4GIAA 3ZJ6A 1FH9A 3WLOA 5FIPA 4DYJA 5EFFA 2J77A 4G3IA 3NEVA 4BA0A 3N19B 3PTMA 2PDNA 4LAMA 3K4AA 4S3BA 3VYLA 3QM3A 5FI8A 1WDPA 4JX5A 1F2JA 3CS2A 4LW7A 1NWRA 1A0CA 5KFWA 2VENA 2ONEA 1QOPA 4MG4A 2GSJA 3MT1A 2A79A 4PMRA 5FJIA 5JBFA 3H12A 3V0TA 3OLEA 3O6AA 4WOQA 2WZTA 5TF0A 4QLLA 3WQWA 1C9WA 1T96A 4H2HA 3NUKA 3IUDA 4JTEA 3EGJA 1W3LA 3UWZA 1YRRA 1JQXA 5D30A 4EPEC 3R12A 5FESA 5CSRA 1CNVA 3EB3A 3B8SA 4PFHA 1NWSA 2ZWZA 2PI6A 5AHEA 1PWLA 5GJPA 4M51A 3AS0A 4E4PA 1XH0A 2PDKA 3OB8A 2XN0A 4CN1A 1VYPX 1G7VA 3TQVA 1DE5A 5G1MA 4QWBA 3R25A 1OINA 1RLCL 4R7WA 4KWUA 4QW9A 3O05A 3AQUA 5EYWA 2HXTA 4JCMA 2J7FA 1BYDA 3VOHA 4AZ7A 1O12A 2NW0A 1OEPA 1LP6A 2Y7DA 2YXOA 4E4FA 4Z1YA 5C7VA 1UB3A 2WBGA 1KCLA 4DX3A 4US5A 3IANA 4JTJA 2J7DA 3C2YA 1W1IE 3LTYA 4ZB2A 1NDYA 3NM3A 3AALA 2V68A 1WBHA 1S0NA 1BVNP 3KAOA 3KL5A 3W76A 5CBJA 3BICA 3R94A 4PTMA 4IJBA 1NOUA 4F2TA 1H60A 3WUGA 3RJXA 4M1RA 3E0FA 4MM1A 2QDGA 5ENLA 1ZJBA 2CLLA 7TIMA 3CJPA 2TAAA 2OH2A 4J3SA 4R88A 1GJUA 3POCA 4UFIA 5KFYA 2JGQA 2FHCA 1DHKA 1VPYA 3ZR5A 4S3FA 1E73M 4L6OA 2F8QA 4KCVA 3NZ1A 3G8EA 2ABAA 4GG9A 1G4PA 3KHRA 1THFD 3GFXA 4KEMA 1SUXA 2QF8A 3U2EA 1HKKA 4W87A 1O60A 4JV2A 2DEPA 1PKMA 2VL4A 4L65A 4RCXA 4U28A 3MJMA 3WFAA 1GG1A 1SFJA 4Q4OA 4ED1A 1MWOA 3E38A 3VD7A 3UG4A 1CXEA 2ZICA 3OZOA 5FF7A 1UR1A 3WSUA 4W8LA 4Q8FA 1R9ZA 2IMWP 3NSXA 1JUKA 1G69A 2ZRVA 4DI8A 3D3AA 1ENUA 1S0OA 2B81A 1H7RA 1ML1A 1CYGA 5FJRA 4HPGA 4JFVA 1UR9A 3EB2A 4HCLA 2WNZA 3ZJ8A 3KVJA 2C8NA 3WKZA 3NG3A 4IXXA 2VR5A 4ML9A 4A29A 1E70M 4UWMA 2PWFA 2VC5A 2WAGA 4NILA 1A5KC 1IEIA 1E56A 2HVNA 3MUXA 1CLKA 4N9EA 2OYLA 1MRAA 2C28A 3E5BA 4AWEA 4H9VA 3F5LA 4Q8UA 1R0MA 2Z1XA 2FIQA 3CT2A 5H8UA 3R8RA 2J13A 1KM3A 5A1AA 3W1RA 3H2AA 5CG7A 4X2PA 1J5SA 3W7GA 4E8DA 3CGTA 3GV5B 1O5RA 3D3FA 3DFSA 3WDIA 2DW6A 3I3DA 1YBQA 3QW4B 4YNGA 1OC5A 1QW7A 1SR0A 5D02A 1VPQA 1PX8A 3DENA 3PTKA 1ZJHA 3QY6A 1XQLA 4S39A 1BVWA 2EKGA 3AJXA 3FYYA 1Z89A 3K8KA 4IT1A 2GFTA 3NR0A 2Q6ZA 4PUNA 2AMXA 2ZXQA 3CAVA 2QCDA 4EPKA 3AHYA 1JVNA 5AVHA 4OWGA 5D8WA 4KIRA 1K9EA 3LYEA 3O2LA 1ZL1A 4F8XA 4MY1A 5I00A 1K8CA 5I07A 5XINA 3VIGA 2WK2A 2PLKA 2BXYA 2WW5A 4I8YA 3AMDA 1SPQA 4JTAA 2AQ4A 4A05A 3XINA 4S3EA 4Y9AA 4Q8EA 4A21A 5K4ZA 3H2OA 3VE9A 2NVAA 1KFBA 4C6OA 2NQ5A 5HWMA 2JE8A 3SIZA 4AIBA 2W9CA 2YB1A 4K7YA 3M6YA 1A80A 4HMCA 2ODOA 2XSXA 4G7EB 1PTGA 2W67A 2ZZ6A 1ZU8A 2Z2BA 4Q4RA 1X8CA 1NAL1 3RG6A 2J9XA 3SADA 3W1AA 4GX8A 1O7AA 3BSHA 4A8IA 1XLEA 4Q33A 3FN9A 5KFEA 4K39A 4ZSTA 4R53A 4NY2A 4RPPA 5CH9A 3OLDA 3LLFA 1B5TA 4M3PA 1VENA 2Y63A 3OBKA 3MR3A 4MTVA 3BLOA 3U4FA 3IJ8A 5XIAA 1A50A 5CPSA 3OHBA 4J3VA 4RDVA 2DSWA 4YCOA 1AFSA 5A8NA 7REQB 1W54A 4RNFA 1K1SA 2P9BA 4AXKA 4JX4A 5KSWA 2J25A 2X16A 4PMQA 2PZ0A 4G6CA 3M0XA 2CITA 3GX9A 2ZWYA 5HQMA 2ASJA 3M7WA 1QW9A 2QPXA 4EKJA 4GZIA 1MVYA 3WF4A 3IACA 1XRTA 2PDPA 2CHNA 2V38A 5HDRA 1OVDA 3W7EA 3SUWA 3C3NA 3A4XA 4IIBA 3RB3A 4E2VA 4LBSA 3W70A 4AHPA 4GBDA 4D1IA 4JHMA 3B0XA 2VUYA 4U33A 2Z1BA 2FZBA 3GXNA 4C6QA 3NO3A 2AGTA 4CEXC 4MWAB 4DLFA 4S3CA 3L5LA 1TZ7A 1EDTA 2BV9A 4I90A 5HATA 3LLDA 1KRMA 1WKFA 2H9AB 4O1DA 2J6SA 3MCNA 4JHOA 3M0KA 2X1UA 2WJEA 3WBYA 2W63A 3RCMA 3PZIA 2PDWA 1OIFA 3VOCA 3BMXA 4FS9A 3UR5A 1T3NA 1X6UA 1EP3A 1OGSA 4ZO7A 3UJ2A 3OVGA 3V16A 4D9PA 3PR2A 3RM8A 5U4NA 1B31A 4JCLA 2QPSA 4KF1A 1OD0A 4KS0A 3WF1A 1VKFA 3CLMA 3KS5A 4UTIA 5BOOA 3T2QA 3ZJ7A 1GT8A 1TPH1 3CIXA 3WQVA 3CV1A 4GHRA 3FVMA 2HPMA 1IR1A 2Y88A 1JYVA 1XR2A 1LT8A 3T55A 3NQ8A 3GD6A 3QF0A 2Q8ZA 2INZA 4UUIA 4GD0A 3MMDA 4YMZA 4MB5A 3FGCB 4AZCB 4ZO6A 2CBIA 5EB8A 2QQ6A 4HU0A 1TV8A 2OKTA 5KFKA 1WQ5A 4GO8A 2X41A 4EP8C 4YWIA 3GV8B 2HS6A 5EWGA 4YTTA 1I2NA 3W1LA 4RK8A 2IKIA 1Y8BA 1BGAA 1NOWA 1RCQA 1R6WA 3PFMA 2CWNA 3LBMA 4WKFA 4G2DA 3KLKA 3RFAA 3PULA 2PC4A 3P14A 4YYFA 1TV4A 4GQQA 1KA9F 5EWFA 1SZEA 4QE5A 2R8GA 1ZBKA 2VO5A 4JTDA 1FH7A 4HPJA 1QRQA 1HQTA 2YB4A 1O94A 3APTA 4NX5A 3PVFA 3WLRA 2ZUNA 3UA4A 4AISA 4L7ZA 4ACZB 1CCWB 1V7YA 1AUSL 5C5JA 4FK9A 4KRZA 1V6XA 1A5CA 3H7RA 3VKAA 2PWDA 3F7JA 3TTOA 4KIEA 2RDIA 5E6ZA 4QDPA 4J9OA 1ITXA 4ED7A 4WVXA 3KZSA 4HZ8A 2ZA3A 2DT3A 4XG1A 1M53A 2ATSA 4D6CA 3BANA 1QNOA 5K3VA 2AMGA 1T0OA 4F50A 2DT0A 4Y9PA 4Y96A 3AISA 1OGGA 3ATZA 2A7NA 4AZGA 1RK6A 2WANA 3UGVA 2BVWA 3W1QA 4UMBA 2REQB 1ADDA 2X7WA 3WQPA 2NWSA 5I03A 3G1SA 3MPGA 3N4FA 5KG1A 3SW6A 1TVLA 2PDFA 5I3FA 3ENLA 5FKYA 5DGBA 2C1HA 3PFRA 4C5ZA 2NV1A 4WSHA 3QPYA 3HGOA 4WDWA 3M4HA 4GI9A 3BGAA 3K1GA 4B5XA 4JY8A 2JEGA 3Q8RB 4UQBA 3ZWTA 4FNPA 1KNWA 3WL0A 3GFYA 2FPTA 5IOBA 2WC4A 1F6PA 2J8GA 4M56A 1I45A 1TPB1 3BQ6A 4FAMA 4URIA 1HJXA 5KFCA 4GI8A 1E6RA 5L9FA 3GRIA 3NQ6A 1HX0A 3PAJA 5AY7A 3SGGA 5LIUX 4LU0A 4O54A 5C54A 2HZGA 1JIHA 4IX0A 3IVSA 1JCYA 4PYSA 4FNQA 2G3IA 5HMDA 3SRKA 3S5SA 4QSFA 2AKMA 1XD0A 4H8UA 4YR0A 3BE7A 3ARTA 4RNMA 3WQGA 4JS3A 4R8UB 1RBOB 5LSMA 3QHOA 3PG9A 1K7FA 1R2RA 1DKWA 3QC0A 1E9IA 3BSMA 3KW3A 1CGWA 1EC7A 3O6YX 3TQKA 3EWBX 3NSMA 4MAVA 1RBAA 3UFYA 4I7VA 1EHAA 4E5TA 3KHGA 1C8YA 2QPUA 2XPKA 3AIBA 2VEGA 4KRUA 4UIOA 3WLMA 3L2LA 4MZ1A 3MSDA 2WOQA 1XIDA 4ZE5A 4HYKA 5LKYA 4Z0SA 1GHSA 3M64A 5HNUA 1NDWA 1GONA 1L9WA 3I3BA 4S1FA 2J8TA 1HUVA 3WELA 3R89A 1EHNA 4JTSA 5AHIA 2XFYA 2VEMA 1NFPA 4QAWA 4KEZA 1ICQA 3F4NA 3IIZA 3GY1A 5I02A 2YPIA 4N9BA 1SMDA 1MW1A 5DBTA 4RL3A 2PZNA 2J7GA 3FNDA 2G0WA 1IEXA 5BW6A 4S3DA 1UHVA 4WKHA 3L68A 2IPWA 4JYEA 4R9OA 2QCHA 3OG2A 4UMAA 4GVHA 1E5NA 1BFNA 3ZSSA 3W24A 1CDGA 3IK2A 3RLHA 9XIMA 3T4WA 2OLAA 3VIKA 3U8GA 3V1HA 4PMZA 3G6VA 1MEHA 1G94A 2X09A 5L6UA 3SEPA 2DW7A 4I5UA 1QI2A 3DERA 3LGGA 2O9RA 2Y8KA 2Y5EA 4HN4A 4CD7A 4IJCA 4H2CA 2TRSA 1VP5A 3FFSA 3WYZA 1S5WA 4JX6A 3H6OA 2GSEA 2ZX5A 4PB4A 4DM2A 1XG3A 3FJ6A 2WSQA 3H53A 1ISWA 4L80A 1XYLA 3UR8A 3Q8PB 5FJOA 3H23A 1V6VA 3SY5A 3UU0A 4JPGA 2VOTA 1KBIA 2IQ0A 3PM6A 4DRSA 2F38A 5KFTA 3CT7A 1R87A 4UTFA 2ISDA 1CGUA 1GQLA 4J9JA 3P5YA 1AH3A 3MW7A 4MNLA 4BF5A 2J88A 2NUXA 1CGTA 2NV9A 1YDOA 3UPWA 3RUBL 2RH9A 3SUSA 1OK4A 2NWRA 4H9ZA 4YTSA 1K9FA 4GY7A 3GHSA 4ECSA 3C8FA 2QAFA 2CLHA 1BVZA 5EY5A 5IRPA 5M3WA 4J3ZA 2GDVA 3DFNA 3KOYA 1GEHA 1M7XA 3GW0A 5CSUA 2W9BB 4D6GA 1Z7AA 1B3WA 3B4YA 3N9SA 4QWDA 1PZ1A 1R3RA 3NGFA 1QK0A 3LQLA 3W25A 1S5VA 3MY9A 3W27A 5F2LA 4HOXA 3UWUA 4ED6A 3NL3A 4O8RA 3C0QA 4XK2A 3ABXA 2VJXA 3MYPA 1XGDA 3KRBA 3DI0A 2GJRA 4QAIA 3M5XA 3K2GA 4JNYA 1K6AA 2VOMA 3N4EA 2V82A 2J75A 2V5LA 4NXKA 1VF8A 3FA3A 2V3GA 3DFTA 1ITCA 1OABA 4HK7A 1Q63A 3T40A 3SCSA 4WGXA 2G3MA 1A49A 3CHVA 4DYEA 1MW0A 4XZWA 3FKKA 1W1PA 1DIOA 1I9CB 3TIMA 1LQ0A 4LWWA 4AHQA 4RUAA 2QIIA 4HNOA 3WEZA 3GC4A 2OWWA 3AHZA 5CGQA 2D0HA 4S3AA 2HMCA 1GQIA 1P6CA 3R7MA 4CNUA 2D2GA 2A3AA 5F1VA 4C6CA 4ICNA 2PDIA 4Q22A 2PDGA 4WLCA 4ATLA 1OX4B 1XDLA 3IEBA 3CV7A 4C6NA 4IF2A 4M1BA 1LLZA 3W87A 2JGYA 1V93A 2WZMA 1NELA 1MQPA 4MPKA 2QGYA 3BMWA 2PLCA 2FH6A 4IFOA 4M6UA 1H09A 5DCDA 3BLLA 2WNWA 1Y7VA 1R85A 2X42A 4FXJA 1M68A 3AXHA 3GTXA 4AD0A 3EDFA 4JTLA 2QULA 3GBEA 4EYHB 1UC4A 2F61A 5A6TC 2ZXBA 4W7WA 2YW4A 2VC6A 3RAQA 3C8NA 1PZ3A 4F0MA 3S1WA 1EGMA 2Y85A 2GGIA 3LTPA 4LQ1A 3CZKA 3MR2A 1JFXA 1S39A 2AQVA 4C91A 4QEEA 4G7EA 1C91A 2UVRA 3BOXA 5HR7A 1XRSA 3STEA 4ERGA 1SW3A 5F4WA 4UR9A 2QUUA 3N1AA 2QCFA 1CPUA 1TA3A 5K4XA 3TZFA 3E74A 1AL7A 1TJPA 4IIEA 2DORA 1NQ6A 1D8WA 1SO3A 3MMTA 1XINA 3LQGA 1BSIA 2QW5A 3VD5A 1S5TA 5CZKA 2YA2A 1IZCA 3LMYA 4F4XA 1FDYA 4PA8A 4O17A 3PY2A 4GVFA 2C13A 5H2ZA 1H3GA 4IGNA 2QZRA 1HVXA 1SJBA 4ZFMA 1RYRA 3TX9A 4J27A 2JIWA 2ATLA 1GYNA 4PUDA 3VD3A 5D2YA 2PWHA 3F5JA 1SQ7A 1H5VA 1FWJC 3SRHA 1TELA 4C1LA 2R24A 2POZA 1RXOB 3FEMA 4LF1A 2WTFA 4QJ3B 3BMVA 1UWIA 1J10A 1FWDC 3PTDA 2VFHA 1SMAA 4BI6A 2SFPA 2CNCA 4ERIA 2JEPA 4JTCA 1UP2A 1KXHA 1VEOA 2WZIA 4IMDA 1F5ZA 5AOUA 4EPBC 5FJTA 3VINA 2OGJA 2ASHA 4HJFA 1TR1A 3EA2A 2FMOA 1HP4A 3DYMA 2ZUTA 1KTNA 4LAOA 1U5JA 1J2WA 3TK7A 1C90A 3GU9A 2IKJA 4L4OA 1CT5A 2W27A 1DIEA 3NQAA 3ZJKA 4AD1A 3LI1A 3AS1A 3TEVA 3P62A 1AL8A 4HGXA 3AYVA 4AX7A 2G37A 1E0XA 5BMWA 3CMJA 4NZ1A 3DIPA 1XDJA 5AHFA 1FWHC 2GVYA 3QTGA 3BGGA 4AMCA 4KWVA 2PSNA 3VCCA 1OJXA 4DAIA 2DZVA 2YFOA 3P60A 5A6AA 2G95A 4DEFA 1OF6A 3W1UA 5KETA 4AMAA 4GQ0A 1PDYA 4GISA 1Q7QA 2WMHA 3N6QA 3GXPA 4BQ3A 2GWNA 1XIMA 4MZYA 2B31A 4DJEC 1QPKA 3KOFA 2BNJA 4XZNX 4M0XA 3AXXA 1DE6A 1RZMA 1SSGA 3NNTA 3E6EA 3PBWA 4HYVA 1D8CA 1QNSA 4HTYA 2XH4A 3IS4A 2CBJA 2EQDA 1VBHA 3EOOA 1KV5A 1T7LA 5FF4A 3WUBA 3ARZA 3R13A 2W8KA 2IKHA 2ZZ7A 5CCZA 1GOWA 1TE1A 1KXQA 3VU2A 1L6SA 1TX2A 1HFBA 3LGDA 3W6MA 4NZ5A 3W4RA 5BZAA 4F9DA 1M41A 4F2UA 2H9AA 4GMEA 3SFWA 4JOMA 3T7VA 1VLWA 1W1YA 1YX1A 2O92A 1W5PA 2BHZA 2XIMA 2R8KA 4J3UA 4WZHA 4LV9A 2WJFA 3USBA 3S0CA 1ONXA 2CBUA 1LL6A 3OG3A 3GDMA 1PUDA 3P0WA 3UZWA 1BTCA 4JIIX 2WWDA 2ZUMA 3S5NA 2R8IA 1POKA 4DJDA 3S2MA 2YZRA 5DLFA 3DOPA 4DZAA 3G22A 3S5ZA 3TKFA 4JN6A 2XTKA 4LAZA 3S9IA 3ABZA 5IFTA 3LRKA 3LDVA 3QY7A 1ZSXA 4IIHA 1E0WA 1H5YA 1J6PA 4IL2A 3TMQA 4LC8A 2PS2A 5CPNA 4O3QA 2NX9A 3NO1A 2JEQA 4IMFA 1DJYA 3G2GA 1KFEA 2QJIA 2EKCA 2PB1A 4XQ6A 5FF0A 4XWUA 5M2FX 4EBEA 1XKJA 4JDBA 1UH4A 3CZEA 3R58A 4UTKA 1EXPA 4LYPA 1JZ7A 3CUIA 4PZVA 3VZXA 5CQ1A 4XBJA 3UZYA 2Q3OA 5K9CA 1EPXA 4ZZ9A 1O5KA 1TQXA 1S46A 1OD8A 4GIYA 1EEPA 1TVNA 1DWHM 2GOUA 3IJIA 3HN3A 2RKXA 2F7FA 2VC9A 4C6EA 3H70A 2CXEA 2HQAA 3CU2A 3H24A 1ZJIA 5GJNA 2ZUVA 3PN8A 2ZZ1A 5LNUA 3CM4A 1OADA 4NNAA 4EACA 2XVGA 2ADAA 2FLIA 2WZHA 4JTRA 1W9PA 4B91A 2E6FA 2E6DA 3L7RA 5KT4A 3AWOA 4PBEA 2A3HA 3KVLA 3O0FA 5DQPA 4XX6A 1KXTA 1XBYA 3UR2A 2Y7FA 3BAKA 2DU2A 1KKRA 2J24A 1SFLA 2ZXAA 4O1CA 1TUXA 4YR2A 3MFHA 1QAPA 2XVKA 3VNLA 3CWOX 4MJZA 3NDOA 4QNEA 3KRUA 2BP1A 2I5IA 2Y7EA 3VDAA 4ZGYA 2IQDA 4PMOA 1B3XA 2PD5A 1D7KA 2C2RA 4AEFA 1ME8A 4LH8A 4MUPA 2WSRA 3M0IA 3S6OA 4BF9A 1TIMA 4V1YA 2A6LA 4PMJA 4B9ZA 3KBWA 1OYBA 5A6MA 4DLMA 1Q4NX 1LQ2A 1WOBA 2PGRA 1RUSA 3N2BA 1H50A 4TR9A 4OU1A 1FH8A 4HSHA 3Q58A 4WHBA 4H04A 4BI7A 1LOLA 4GH3A 4A4AA 1FP9A 1GOOA 1F74A 3FEQA 1PHWA 4H6KA 4R9XA 2E68A 1M3UA 1AJ2A 1B3ZA 1CLVA 4BR1A 1A0EA 3GDRA 4NZJA 1U33A 3KHDA 2I17A 4LAUA 3VIMA 3OZYA 3KUMA 3HGSA 3MBDA 5MHBA 3LPOA 4WX2A 3WH5A 1C29A 1OBAA 3T42A 5D38A 2ZTJA 1GQJA 3COTA 4KFOA 1HGWA 3LERA 4M80A 1K3UA 3DG7A 2GVLA 2R1KA 4B5WA 2WM1A 3BWWA 3V36A 4D8AA 3W0KA 4UQ9A 3E02A 3H7UA 4PMUA 1IXQA 4DVOA 3QBUA 3RILA 3KBJA 8A3HA 3TTEA 5LZLA 2YYTA 3T2PA 4YVPA 4C90A 4DO4A 3RR4A 1JF6A 1TPUA 3E49A 3SCTA 4L9ZA 3E2RA 3ZR6A 3ARWA 1EC8A 5E6YA 4LV4A 4Y90A 5I0DA 2F6KA 3TAOA 1RCXB 1XYBA 2QJHA 4W86A 1W9XA 1CI1A 1WOAA 2OZTA 1RLDA 5M17A 1EA0A 3LHVA 4DBDA 2ZFAA 3FJNA 5KG5A 3VUPA 3SQLA 3PZOA 4F0RA 2B7NA 4IGSA 1KLZA 1J0ZA 2VRKA 5L1JA 4N6FA 5G4EA 1QNVA 1TV3A 4XVDA 2A5HA 3GTFA 2IQTA 4C65A 1DJHA 1FWNA 1LRTA 2Y62A 3WO8A 3PZUA 3KHHA 3K8MA 1MEWA 2E9MA 3QPZA 5EMLA 1RR2A 4C6FA 1R2SA 3N9KA 3B05A 1XIFA 3S42A 3RLVA 3PPGA 4ORIA 1NSJA 3FSUA 2ZDSA 3HJEA 1F07A 1P0BA 3GNXA 4WEVX 4Q7IA 2A21A 2VGGA 4FOKA 1BKHA 1TJ0A 3LZ5A 4V1XA 1K1DA 3L0NA 2IUZA 3VNJA 4HZMA 4J3TA 4OHQA 3BJYA 2CKRA 1XG4A 1VFSA 4M6QA 2ZRUA 4UFHA 5CSSA 1S2UA 3R1ZA 4LC6A 3NA8A 5C0QA 2EF9A 2V69A 1HKVA 3LA4A 4NRRA 1ZPTA 4RE3A 4WR3A 2Y24A 3NFUA 3OEXA 4A3UA 4IIDA 2XYLA 3PZVA 3W00A 1MMFA 4W88A 1IE7C 2AGPA 3WNOA 2VCAA 3DZ1A 3SCPA 4NQ1A 1QO5A 3M0ZA 5CLWA 4QWCA 1XDMA 2I16A 3O15A 2MANA 1UOZA 4BEQA 3ES7A 3PZNA 1X7IA 3BW2A 3QZ6A 5A8MA 5D4YA 1LG2A 1BRLB 1XHGA 1H49A 2BFGA 3M9NB 2YBUA 3BQ1A 4CU8A 3MTWA 2BXVA 1WBJA 3NCOA 1Q7MA 1FA2A 2BLEA 1UJPA 3DYPA 4NL1A 4LS1A 3W88A 4JAWA 5AFDA 1IEQA 2Q71A 1W1ZA 3OPSA 4OV9A 3T4CA 2G3FA 2ZZ2A 1QNPA 1ZBCA 1LTDA 2OPJA 2DZTA 3CAWA 1O68A 4A35A 3W7MA 5CC7A 1X38A 1OX4A 1V08A 1UH3A 2RDWA 1MQRA 1KRBC 1ISYA 2ZXDA 3EOEA 1TTPA 5KZDA 4IUGA 1G9HA 1QU4A 3SUUA 3ARVA 3TLLA 1MRQA 1XLHA 4QIUA 5JUMA 1X97A 1UKQA 3UA3A 1YMYA 1S3TC 3M07A 1MUWA 5A2BA 1Z44A 4HMEA 3BUVA 3VDBA 2XISA 2V5KA 4YQWA 3SCOA 1H1NA 4O1EA 1VLIA 4O3OA 4JNZA 2IXVA 3UG3A 4TX9A 4QQUA 1ZCOA 3B9EA 2W0UA 3ABSA 1JCTA 4B2DA 1I1WA 1TRIA 4HHHA 3BG3A 3LSCA 1P1MA 3S2NA 3MMUA 3GO2A 1TTQA 3GDLA 2ZA2A 4PMDA 5EWEA 3WJXA 4LEFA 5JH1A 3SO7A 3PWIA 4KFNA 2CEQA 3QMRA 1YNYA 3GAYA 4DUVA 4QE4A 1UZ4A 1Q6LA 1XIHA 1YTKA 4Q8TA 1Q2RA 4RUBA 4WSKA 1VIWA 1UKSA 1UQZA 2CLKA 3KE0A 4TVUA 2CZEA 3VFLA 5A8QA 3N2XA 1CEOA 2HWGA 2NLYA 4MNJA 3GUGA 3U4AA 1XIEA 1W5QA 5DQGA 3NPWA 3TSBA 2ZRYA 5T26A 1UKPA 8RUCA 2D2HA 3PHAA 4RXGA 4KH2A 1W3KA 2Q8LA 5DBUA 4DWSC 4W9TA 5HUPA 3IJ9A 4NAFB 2BHYA 1IYXA 3TFXA 4AWUA 4XAYA 1QFEA 4K8HA 2HEJA 1PBGA 2X1SA 3K1DA 1BQGA 4AD5A 4AXNA 3BLKA 3VUSA 1ZCCA 2PE4A 5FAJA 4MMWA 5TIMA 1JCMP 2PP3A 4UQEA 3BC9A 3FA5A 2Z2AA 4TV5A 2CFFA 4C7FA 1XX1A 3SN0A 3UZZA 3CV6A 2CKSA 1WKDA 3GIPA 4JFUA 4JV0A 4MWAA 4Y2WA 3VIFA 1LWHA 4WGHA 1MI3A 4GE8A 5IDZA 3W7IA 1HJQA 1H7XA 3WUFA 4TOQA 3H21A 3MHGA 3CQIA 1Z69A 3WLJA 1LBLA 4L6HA 1VYRA 1HT6A 3CUGA 1Q6GA 2REQA 3SIMA 3DU0A 3RMEA 2JK2A 4N02A 4D6EA 4ERAA 3DBPA 2QCCA 3M41A 5HNNA 2AQOA 3MB9A 3MYOA 4M7SA 2RUSA 3SRFA 5CPTA 5DELA 4LAKA 5HMEA 2V67A 2C19A 2ATMA 2ALRA 1UP3A 2V9DA 3ITGA 4KRTA 4S23A 4CNOA 1PCKA 2OXNA 4LNYA 1FHUA 5CGTA 4YP3A 4TQTA 1NWTA 2C79A 2V81A 2Z2UA 1FHVA 4KMQA 4PCTA 6ALDA 1XYZA 1EUAA 4YVXA 4ROPA 2DZBA 4Q7BA 2GJXB 3RN6A 5E70A 3U0HA 4B3KA 4PMYA 3U9IA 6TIMA 4QWEA 3PZQA 2GZXA 2Y7GA 3WQFA 3K4DA 1CXKA 3MS8A 5EMJA 1ICSA 4IPPA 3H2MA 4QISA 5J5DA 3B8WA 3LN3A 2GQ8A 3OGVA 1FKXA 1JZ4A 3RDKA 5ABHA 1GZJA 3SQMA 1H61A 2P10A 3HQOA 4GYJA 1IXNA 4Q4PA 2IA6A 2ZYFA 1TWZA 2V0TA 4HPXA 1I2OA 5C9RA 3FAWA 2FH8A 2H3BA 3C0SA 3KCJA 3F1QA 4O8AA 2A2IA 4GKTA 2OX1A 1ZP4A 4REQA 3FHAA 2FDSA 2I14A 3P3BA 3GZ3A 2Z26A 1YNPA 2VX5A 3EEGA 3VX0A 3W7LA 1AQFA 3W2UA 2CHOA 4FO4A 2W61A 4FS2A 3I7SA 1TWDA 2H90A 2OQLA 4WDTA 3W86A 3EX1A 3MUIA 3N4AA 3LU2A 1MW2A 1VB9A 4HP5A 1GQKA 2OVLA 2UV8G 3G6YA 4NYYA 5REQA 2XFFA 2V5BA 3W2NA 1OQFA 3P6LA 3C2OA 3DC8A 1X1NA 4CQAA 3ELFA 1RVGA 1EYWA 2OLHA 4QCEA 3HMCA 2VELA 2YCLA 3GQCA 2Y8VA 4M81A 1VHNA 3O1NA 5TQLA 5AHLA 3VGBA 2YYUA 3OA5A 4XBKA 1N8WA 3UCDA 5DCBA 2XN1A 3RM9A 4B9YA 2EHHA 4IMAA 2XM1A 1ADSA 5HA7A 4O3SA 4J35A 1AA1B 3HA1A 4D6IA 3OLGA 3NQFA 2G3JA 1J5TA 1DORA 1QUMA 2EJ1A 3TFCA 2PRLA 2IKGA 4MFDA 4G7FA 1XH2A 2GGHA 3HO8A 1S5NA 4GA8A 4GQBA 1D3GA 2QT3A 1SW0A 5AYYA 1TTIA 3CYVA 4JTKA 3EKGA 4FS1A 3S47A 4ZQOA 3EOLA 1FWWA 1WZAA 4MB3A 1O6IA 1OCNA 3TSMA 1S2VA 1WKEA 3VM7A 4NJKA 1DEDA 1N55A 4JIRA 3W7NA 3N11A 4RNHA 1PWMA 3EX3A 4PTNA 2EO7A 3NM1A 3TYUA 1ISXA 3ARQA 1FDZA 4Y8FA 3WD1A 4O4WA 2XUCA 2QLYA 4F0KA 2YL8A 4EIVA 2YL5A 4C60A 3PVXA 4DAFA 4QWAA 3LV6A 5HPCA 1DJGA 1M7OA 4TX6A 3O16A 4W7UA 1XIBA 2ZRZA 3H2FA 1H7PA 1ME7A 1CENA 3ALFA 4U6PA 3B40A 3DFOA 1VCVA 3QMTA 6XIMA 1E6ZA 2EG8A 4H1ZA 4NKCA 4AD3A 2WV8A 3FK4A 2ZUSA 3OODA 2PBGA 3EZ4A 4GXMA 4XZBA 4R27A 2PTYA 4A2RA 1MDRA 2L5HA 3W2KA 5KT2A 4PUKA 3H40A 3AS3A 3L0KA 4MPQA 4L56A 3N25A 2YCLB 1GJPA 4CVWA 3L2MA 2G4JA 4JTTA 3PTQA 1GKPA 5KFFA 1ZENA 3DHFA 1GG0A 2R1NA 3UZ5A 1R3WA 2VYOA 4IR9A 3WNMA 2ZDRA 3GXIA 2BQ3A 1B30A 3ITLA 1EP2A 2AAAA 3VKKA 3AYSA 7ENLA 3UY7A 3W26A 4DBEA 4UB9A 1XLBA 3L5AA 3O7UA 3WQOA 4DBWA 2VUNA 1TPDA 2DUZA 4PGLA 5DN1A 3F5KA 5I77A 1TJ1A 3N04A 1P4CA 5HQEA 4WRHA 1SZRA 5DT5A 1I1XA 3QHMA 4ACYA 3L4UA 1AW2A 1R7OA 3OO2A 4O11A 1VQTA 4DUWA 1ODUA 5MKGA 2MNRA 1IZJA 2VT0A 4UTTC 5HAOA 4U10A 4AG0A 3EWUA 3CXOA 1XLIA 1E55A 4S2BA 3QZ7A 2EBNA 1XPYA 4EYIB 2X8RA 4GABA 1VFOA 3LG3A 3TTYA 4RZBA 1Z32X 2DT1A 1KKOA 1G67A 1M5WA 5DT7A 3UXKA 5FEXA 3E0IA 3ZS4A 1VFFA 3S46A 2V5DA 2Y5JA 2VWSA 2WB5A 3H22A 5DO8A 3C52A 2I9EA 4QJ4B 1I0BA 5A8PA 4M8UA 1I4NA 3E2SA 2VMFA 3DGRA 4GC3A 3HF3A 5LGZA 3BZJA 3E3HA 1NARA 2NZLA 2ZZ4A 4U5KA 2E67A 3BW4A 3E0WA 5K9XA 5BRQA 4LOCA 4GNJA 2RJHA 1TV5A 4DNMA 2VURA 2J9YA 3ITCA 1ZBWA 4PMNA 2HRWA 4NAEB 5L1IA 2QCLA 4HD5A 1JYXA 1KCZA 3KVKA 2Z1SA 1RA5A 3E0VA 3A22A 3C61A 2DP3A 3TYBA 1VRDA 4S38A 2XSBA 2V5JA 4ES4A 3AIRA 3PBUA 3M9OB 1VFLA 2B0MA 3TZNA 1KTCA 3G3DA 1KGXA 4N4QA 7TAAA 4PCFA 2QUTA 3T05A 5IHRA 1SZFA 4ED2A 1AJZA 1Q65A 2QV4A 3AWNA 3QSTA 4LRTA 3KEHA 4EK7A 1F6KA 1GOQA 5F7UA 2YBVA 4CU7A 3FIGA 4AH7A 5EPDA 4GZJA 3QFEA 4DO7A 2YOCA 1W1B1 3SAZA 1CIUA 2GUYA 1XSKA 3NURA 4MJ2A 4XTDA 1BF2A 5E0KA 4QCFA 3U3HA 3IK4A 1DXFA 2OKOA 1O66A 1GKQA 1W1VA 2VX6A 3OA3A 3WBEA 1AD1A 5CZJA 4UCFA 1NFBA 2OZ8A 1TUFA 1DWGM 4EBCA 4XIAA 3UEQA 4J40A 2PMQA 4F40A 1JPKA 3H4XA 5KZ6A 4GIEA 1BRLA 2Z4GA 1IQ8A 4XZLX 3SSJA 5KINA 3IIOA 4OV4A 1H7WA 3UESA 3G1XA 2W9CB 1C8XA 3SJ3A 1A4MA 5A8GA 4FXSA 3MVIA 4W8BA 3FY1A 1GVQA 4X9YA 2BASA 4MIMA 3W07A 3C2EA 2GUUA 1TJRA 3L4XA 2YL6A 3RB4A 3SUTA 2GQ3A 3M0HA 3ZWSA 5JIWA 1A5SA 1V3JA 1JG9A 4XD3A 2WHMA 4IR1A 3GVRA 4O14A 1RJQA 1GVFA 1P0DA 2D22A 4YXGA 1YNQA 1VJZA 3UG5A 4TQRA 1W3JA 5FEPA 1QNRA 1LZOA 1HTIA 3FYOA 4F0SA 1ZETA 1E9LA 2VRJA 3UJSA 3BG9A 1SU5A 2WSYA 5A69A 4U2ZA 1KBLA 3VCNA 4A3RA 4MWAE 5G2WA 1I6NA 3CTTA 2PDCA 4EXAA 2FQIA 1K7XA 1TWSA 4B15A 1J11A 4OZOA 2PTWA 5IBXC 1HL2A 4IJRA 4AUBA 3WLKX 4PCNA 1U2YA 2CZ5A 2GDUA 1ZP3A 5E0CA 2NXIA 1FFQA 2XIBA 1CW2A 4F4RA 3VDCA 3LK6A 4QGCA 1ITQA 3MCMA 5DMMA 1HG3A 4QM1A 3EAUA 4NASA 1F4HA 2WSPA 1XYAA 1W5NA 3LB0A 3FX4A 4OOUA 2IXUA 3T44A 5E0FA 1MFUA 4M6VA 3TW9A 3FOKA 4UTWC 1XI3A 5FOOA 4KEVA 5CJNA 3OHAA 3NQ7A 5I3DA 3M5ZA 4H9TA 5CJ5A 2BB0A 2HDJA 3CV2A 1KM0A 3C86A 3TQ0A 3N13A 3GIJA 2J6XA 2KZHA 3EPNA 1FVPA 3LRMA 1IT8A 1QVBA 1S0MA 3ZFHA 2NVCA 3OGSA 2JALA 3TYCA 5KTLA 5KFXA 5C5YA 2WBKA 1ONRA 1WPCA 2BS9A 4ECTA 2X7VA 4FZIA 1DXIA 1DJNA 2FTPA 3W1TA 3UY8A 4H00A 4AF0A 2WMIB 3CQHA 3QRHA 3U6WA 3EBVA 5T14A 2J7BA 1CWYA 5HMSA 2XH0A 3NYDA 1FHLA 2XCPA 4FNRA 4B5TA 3THQA 1JUEA 4GUJA 2DSKA 4JQ2A 2DZAA 3GG0A 3P8IA 3NDYA 3V1PA 4C7GA 2GJPA 4XISA 4DB7A 2FZNA 2IPJA 4JEQA 1M03A 2FMNA 4E3VA 2E8YA 5D9NA 4MNKA 5CC6A 1OX5A 1D3CA 3A9BA 1EX1A 1NP0A 4GGBA 4CNTA 3CZLA 2DJXA 4PTXA 5LA1A 4KQNA 3HQNA 3V4BA 2BG5A 2BGSA 3O8AA 4O1FA 4YHGA 3AZTA 1YXYA 3MKCA 4R3UA 7CGTA 2WMGA 2YIHA 3UZJA 3QGVA 3DH7A 3BO9A 5EU9A 2WO5A 1XSIA 1KR1A 4QS6A 1JCXA 2JKPA 4GFSA 5GNXA 3SFKA 3TQPA 2OOGA 3W72A 1YTDA 2WZEA 3N6JA 3M0VA 3A64A 3TR2A 4J28A 1E1CA 4HYWA 1V7AA 2OGYA 4WY0A 1KBKA 5DXXA 3JR2A 5MKGB 2A3BA 3A3WA 1GOXA 2NQ9A 3IPWA 5IXEA 4GY1A 2JEFA 5FF3A 1TG7A 3DYOA 3NPVA 4B3LA 2FDMA 4GK8A 1XQKA 3EWDA 1JGIA 2GWGA 5LNSA 3ARSA 3DFYA 1B9BA 1V79A 5I24A 3UJRA 2XZ9A 2UVWA 2QJGA 2D3NA 3W1PA 5JBEA 4LVAA 4AF0B 3NXLA 1UD2A 2DIEA 4R5EA 4QXIA 1QI3A 5HOSA 1MEIA 4UXDA 5KFOA 3B0YA 1SO6A 3P84A 4OT7A 4RDZA 2YBTA 4DXXA 3GR7A 2V9WA 2I56A 1VBGA 4QDWA 1FWAC 2R8JA 4IZGA 5KFAA 3UJFA 3VMNA 4ZOEA 3NEHA 3QTPA 1J6OA 5EBAA 4RZ4A 5GNZA 3SGUA 2H3DA 2WM0A 4C1KA 4Y9MA 2IMRA 3GNNA 2R91A 4X9SA 3IJDA 4K1GA 2P50A 3BAJA 3E5PA 1R47A 1EJSC 4GC4A 4KGJA 4AVNA 4LJ3A 2E1DA 3GNOA 4Z1DA 1TKKA 1GVOA 1AZ2A 2HCVA 3MC5A 1XYMA 4MZ8A 4PB5A 3RPDA 1VH7A 5AYXA 1K03A 3R0UA 4GZ7A 2Y70A 4WQ6A 3HG5A 3W1NA 4UZSA 1RD6A 1J79A 1TCDA 1JULA 5C2XA 2R1PA 2DY3A 3GDTA 3CHEA 1TTJA 2HE5A 4HNCA 1XLCA 1EH9A 2XVNA 3W83A 3MKKA 1W9UA 2TPSA 2VZSA 3L5MA 3QR0A 3MWCA 2NUWA 5JH2A 4ZL1A 1GK8A 3QZEA 1PKLA 4JFWA 1M04A 1FBAA 2ASDA 4D6JA 3SCUA 3STFA 1OCBA 1F61A 3NGDA 2ACRA 2YGYA 2YLLA 2WCAA 2VDHA 4UOZA 8TIMA 1P6BA 4W85A 3TTSA 4MJ4A 3RITA 3GVWA 1E4IA 1QI5A 2VGIA 3KL3A 2C1IA 2AL2A 3W2LA 1JQVA 3DI1A 4QJ5B 4BHYA 5C55A 2RDTA 3EDJA 3M5YA 4FF7A 4JTFA 3WDRA 1GCYA 3C2RA 4NJGA 1JPMA 3EPOA 4EVZA 1TR9A 4FBTA 3WFLA 2HROA 1YDVA 4H9XA 4QS5A 2J6UA 3F4CA 2VZVA 1B54A 1AG1O 2FFCA 2W62A 1VAHA 1CGXA 1DTUA 4ZFCA 2PEVA 2YCJA 1OFPA 1EXBA 1EZWA 4QP0A 3I4KA 4GVIA 2GGJA 5A6BA 4XTIA 4J9LA 1T99A 3AU6A 1WZMA 2XIOA 2VFGA 3GH7A 1VYSX 3EB4A 2WMIA 1EF2A 4W93A 1MO0A 1PAMA 3PBMA 3KDOA 3GB6A 5HPOA 2PA6A 2YKKA 3ZZ1A 4M24A 2V8ZA 2C2DA 2E77A 4JR5A 3TWBA 1PKYA 4ECQA 1JF5A 1MNSA 2ISVA 4RZRA 5G2IA 4J9NA 4INFA 4F4YA 2PTDA 4ROQA 1Z48A 2HBVA 2JEJA 1AMKA 2ZUUA 2PDXA 3WFZA 4S2CA 3LEPA 2G4FA 8XIMA 3MZNA 4DZIA 4JD4A 3GC5A 4DL2A 4P5UA 1WUFA 5KFIA 3B8VA 4AB4A 2CW6A 4Z2KA 1V0MA 3BAWA 3D46A 5F4SA 4RNOA 2Z28A 4FMVA 2DQXA 2YDAA 4RDYA 1I2PA 2VFDA 4FEZA 3PWGA 3N15A 1A3HA 3MDWA 3VNYA 4C6KA 4GXWA 4Z2LA 3WNPA 4Q8PA 3N6HA 5A5WA 1XFCA 2VZTA 3F2BA 4TXEA 2CCRA 2Y0FA 1W3NA 1W8SA 2QVHA 4B4FA 1TIWA 1WDQA 5EBUA 3MWAA 4GYKA 2G97A 2XM2A 3IJ7A 3SR7A 3CQJA 1UPMB 3APYA 4RZ5A 3KWSA 5KZEA 4ED3A 1EIBA 2WHKA 1N82A 1U22A 3IARA 1CXFA 3H26A 3DHDA 3AFBA 3OZPA 2QCEA 3GAKA 4ZQRA 2W66A 3VNMA 2E9BA 5D9OA 3P80A 3ZMRA 1RPKA 3I4EA 1I8JA 1IIHA 4H7ZA 3PUDA 1H63A 4GGHA 2FLPA 3VM5A 1LBFA 5KFPA 5KFJA 1OYAA 3FLUA 3B8DA 3ZQ9A 1OCJA 5KG6A 2PP1A 3TN6A 2ZQ0A 1UBSA 3IUHA 1EDQA 1CXLA 1ZS2A 1Z6KA 2RDUA 3MANA 1ZGDA 4NJIA 5TAOA 5AHNA 4JICA 2HV5A 3IRSA 4JBRA 3VOJA 5IFPA 4CQ9A 2QV5A 1E4NA 1LJYA 3T0BA 7PTDA 4CLMA 3HGRA 3PB0A 3LCGA 3GS6A 4FLQA 1JZ6A 1V4YA 2DUXA 3QOMA 3WLTA 1DIKA 1GTHA 2J7HA 2F6XA 1US3A 3QV7A 1XGZA 1J0KA 1PZ0A 3VIHA 4QSHA 1HN1A 2MUCA 3VIJA 3BOFA 2NVDA 3BLDA 1M7PA 1TPEA 2P3ZA 2JIEA 2PTXA 3QGKC 1DJIA 1FRBA 3E0LA 4F3HA 3I6EA 2GJLA 4Q4MA 1M65A 1QBBA 3L65A 3EX4A 3V6HA 1V0KA 3HJZA 2PWUA 1RV8A 3L4VA 3NQMA 4JL1A 3ZVHB 1JXLA 1FWRA 4K8EA 4PE8A 1I60A 4MF4A 3H4GA 4UR8A 3GNPA 3W7CA 1CLXA 3LCLA 2XINA 1LRQA 3QV6A 2XU2A 2FLNA 3T8LA 1BG9A 3TH6A 1UP0A 2UY2A 3A47A 1R46A 2XFRA 1B57A 2X40A 2FGBA 4AY7A 1L2QA 4LCQA 4ICCX 3AOFA 2ZBTA 4XUYA 4XD6A 3AIWA 3HV9A 4V33A 5HJYA 3ANYA 1UZ1A 3VKCA 1UUQA 1FUYA 4YIWA 3S1GA 2J7CA 3QV9A 3ITYA 2CXGA 4IP4A 1WV2A 2DGAA 5DF0A 3CO4A 4RNIA 2HJPA 3SCRA 3CO8A 1BGGA 3LHZA 4RR4A 2ANUA 1EGZA 3WH9A 1K4GA 3I7QA 4WCJA 3HZ3A 5IHSA 4JN7A 1JDCA 3NTYA 3FV9A 4O1BA 2NXGA 3E9AA 3EMCA 6ENLA 4IG2B 1LROA 1KO0A 4ADSA 3R10A 1E4MM 3ANVA 3BTNA 4GJ1A 3M0LA 2XFWA 1OX6A 4GZEA 2IBKA 4IGMA 5KT6A 4AX6A 4LRSA 1S1RA 2DIJA 4HN8A 3EXSA 3USZA 2RAGA 1TRDA 3NVDA 3G6LA 4DJFA 3HBLA 4JZ5A 1ZTVA 3ES8A 3DEQA 1QWGA 4PUMA 9CGTA 4PBGA 2XGPA 1I2QA 4ENLA 3B97A 1HJVA 2I5QA 3N17A 4LFYA 1W3TA 3EYPA 1JIBA 3RM4A 2D3LA 1F3WA 1YLVA 3TROA 3K5XA 1W56A 2ZE0A 1XLGA 1K8ZA 1J4EA 2QEZA 1E3XA 3CASA 3R79A 5AC7A 3A3XA 3UPMA 5LIWX 7XIMA 2VFEA 4E6MA 3NL2A 1P0NA 1LRNA 3MSGA 1PYFA 2YXGA 4PSPA 4AIEA 1EWEA 2UZ9A 2DSVA 2WQPA 5T9CE 3VNZA 1U1UA 3UWQA 3GYCA 3UW6A 1WA3A 2Z29A 2ZOXA 3APGA 3OVPA 4IIFA 2OO0A 2INEA 4ZXOA 4ZODA 1FXQA 3V3WA 2Z6JA 4M19A 5HUOA 3WN6A 3N2OA 3S6TA 3HB9A 1YPFA 4HYRA 4TTGA 1VEPA 3PSWA 4N7QA 3SCWA 1Q8AA 5C9XA 4NHVA 2PCEA 1KFKA 1TA3B 3WJYA 4OJYA 3AIUA 2VDGA 1ZQ5A 2ACUA 4L1XA 4MLRA 3QR3A 4JKMA 1JGMA 3JS3A 3B9NA 5LHFA 2DPEA 4E2BA 4HMNA 3AIVA 3TN3A 3F2DA 2WJDA 3QPEA 1UUMA 4IP5A 4KCWA 5J5RA 3AROA 3SBFA 2QIWA 1BEUA 1X39A 2JF7A 3F2CA 3WBWA 3WNNA 4L1GA 1OYCA 5KFSA 1UCWA 1A5UA 3VDGA 4A2SA 5LXEA 5DXYA 5M1TA 3BDKA 1ZNNA 4ECRA 3W2JA 4Q3MA 4XSLA 4DO6A 4WSJA 4U4MA 2W6RA 1JNEA 1T6MA 3ALGA 1W2PA 4HHPA 2FJUB 1A5OC 4O28A 1GORA 4IMEA 3N2TA 2BQRA 3CIWA 1KWGA 4L61A 2VZOA 2NQLA 5DQHA 3CBWA 4W84A 4UNLA 4RV8A 3WLSA 9RUBA 3TJIA 3KRSA 4X0NA 4CUCA 1B2YA 2DFAA 1NOFA 3Q67A 1LCOA 4QG8A 1Y5VA 3VMPA 3G5EA 3GH5A 4HA4A 4XKYB 1XUUA 3RK8A 1ZRQA 2GPTA 2W7PA 3T8QA 3QR1A 1A0DA 2XIQA 2Y1HA 1JZ2A 3KBSA 4Q7NA 2DPIA 1TX0A 1QOXA 4PRTA 1H11A 4H7VA 1S5MA 5CZTA 3BPWA 3RPTA 4PTVA 1A5NC 4TX8A 1N8FA 3SURA 3RXZA 2XVLA 4ECXA 5KFVA 2BODX 1GPWA 5ECUA 5RUBA 4A8NA 1V8EA 1MXSA 6A3HA 3AC0A 2OSWA 2Q8XA 1ME9A 1Z42A 5AC5A 1ZHAA 5CZSA 3B04A 1XP3A 3A3HA 4FIRA 1QO2A 3G1HA 4W5ZA 3TXZA 1YW1A 3LM3A 3KLLA 3WNLA 2GGGA 2ZRWA 5D03A 4FBUA 2WVVA 2AL1A 1LL4A 2W8LA 3BCFA 1PTAA 2VHLA 2PDBA 1V51A 2C1GA 3W7KA 1E6NA 2O55A 3THAA 3S1VA 1TPC1 1XKYA 2D73A 3CUZA 2OQHA 1RA0A 3C4UA 1G0CA 1XIIA 4YPJA 5I78A 2NLIA 4ECZA 1GNXA 4XAZA 3S5YA 4TTUA 3PB2A 3JUGA 1KCXA 5A2AA 5BU9A 3QQWA 1IZKA 1OFBA 3D47A 3W85A 1K9TA 3GVGA 3HIJA 4EANA 1IWAA 4C1NB 1CB2A 3S9YA 1XGEA 2NT0A 5CPOA 1I2RA 5D9PA 1KM4A 2INFA 1FCBA 5D2VA 2QGHA 2BY0A 4TQSA 4NYUA 4IQEA 2HNEA 4BK9A 4Q4QA 3RNDA 1XXXA 2YCEA 3CHFA 2RJGA 1C7TA 3MP5A 2DVTA 3NQVA 3W84A 4MOZA 5JMUA 4ZMGA 4HQVA 2RDJA 3S1UA 3W6YA 2GGEA 4HNNA 1NFGA 2VEFA 2ZZ5A 2QF7A 3DUGA 4GQRA 2ZCGA 4PULA 2W91A 5BXRA 1EGVA 3C5QA 1G4TA 4GYPC 2XIIA 5DY2A 4L1WA 1P0EA 3OYZA 4DUXA 3AXIA 3A23A 3TDFA 3PW5A 2A1YA 4LUYA 1Q66A 5T8GA 5CSYA 5DMNA 2O7SA 1KW1A 1BG4A 3WG6A 3BSGA 4P8WA 1A47A 4BEUA 2QUNA 3W38A 2TSYA 4HHLA 3FJ4A 3KFTA 5CKSA 1Q6QA 4D2JA 3BVJA 1ZAIA 4O10A 2PRHA 3GG1A 1QT1A 3R8GA 5F4XA 1H7NA 3NOYA 5C2CA 4U7CA 1R38A 3BCDA 3P5ZA 5CXPA 2EG7A 4K7VA 5M5DA 1AZ1A 1EUNA 4IQDA 3NYZA 2Z1KA 1OSEA 1D2KA 1T94A 4OIFA 3ZVIA 3PW0A 3SECA 4BWLC 2Z6IA 1QTWA 1TB3A 3PUEA 1Z41A 4P7RA 3P67A 2ZC8A 3AHVA 4JV1A 5CG0A 4DXKA 2V3DA 3GH4A 1Q6RA 1HL8A 3MUCA 2QCDB 3TTQA 4HNTA 3UP8A 1IXOA 3LGEA 4B5NA 3TXVA 1PCWA 3TCSA 1YADA 5HJLA 4M29A 4LVGA 2XHYA 5BYWA 3BL3A 1K8YA 3KP1A 3GE7A 1XIGA 1HXJA 2WVVB 3FDKA 1KM2A 4C1NA 3STCA 2A0NA 4AFYA 3V35A 4K3ZA 4Q8MA 2FZ9A 1FDJA 1PVNA 2YJQA 3SSZA 5CLTA 4UZUA 5SWUA 2E8ZA 3ATYA 4NI3A 1W3IA 1LOQA 1TPVA 3KBNA 3T08A 1W9DM 1O95A 3LHUA 1R3QA 1QHZA 2KX9A 5I3GA 2NXHA 2XWDA 3VD4A 5A2CA 3VAVA 5M03A 3BGJA 4O12A 4GH1A 2CLPA 2E9LA 1DQXA 3BK0A 1PV8A 4WY0F 3VE7A 5C9ZA 2F2KA 4NNBA 5KFRA 3A12A 1F8MA 5D9MA 4AZHA 3LUTA 1J2BA 4C6IA 1G01A 3L23A 3S2JA 3PW4A 1HNYA 1LBMA 1YE4A 4HK6A 4LB3A 1U5VA 4TMCA 4H4IA 3CAQA 4JTHA 3NQ2A 7A3HA 4EEYA 2VXNA 3IGHX 4O57A 4ZA0A 3SCNA 3CH0A 3B06A 3HU7A 4O3PA 3OVQA 3B03A 1EJVC 5KFBA 4HU3A 3QVQA 4PL2A 4Q44A 1QPQA 4C6JA 1JDEA 3DECA 3H54A 3GM8A 4DUOA 5TD4A 1A3WA 1WDSA 4JXCA 3RLGA 3HFTA 2QS8A 1R3VA 4J2MA 2DH2A 3ABRA 3RGTA 3CPGA 4IX2A 3BV4A 4OVXA 4JKLA 1EO7A 3UXLA 1M6JA 5A6JA 5AECA 4ONVA 3UD6A 3NQCA 4F0LA 3MO7A 1R9XA 1RP8A 1AD4A 5AHMA 3KTSA 3IJLA 1QNQA 4BF7A 5I3KA 2G41A 4Z1BA 3ZLGA 1YKWA 3PG8A 3GTNA 4UC5A 1NEYA 1UIPA 3EWXA 1J8VA 4K36A 3WF3A 2ZZ3A 1F4AA 4UFLA 1JDFA 3UR7A 3NQEA 4PUWA 3B9DA 2CBVA 1F7BA 3M1ZA 1I75A 2BSLA 4RDWA 3GXDA 2PU1A 1FCUA 3LCXA 2GK1B 1J0IA 3QKEA 4IWWA 3H2CA 1NTHA 5D2TA 3A4WA 4WUIA 4ZOBA 3TC3A 2FGLA 3NOEA 2P88A 1YBQB 2CLIA 4MLJA 1Q13A 3N34A 1ODZA 4BZYA 3NIYA 1BYBA 3BARA 1EJWC 4N0RA 4MDPA 1F05A 1B0IA 5I5RA 4FXFA 1JCLA 5HQLA 1SO5A 5CGMA 3BZGA 1RJRA 4KGLA 3VC6A 3UYIA 3MO4A 4NX0A 1PIIA 1W5OA 1B3OA 3SUVA 2WNQA 3S9ZA 4R7OA 3HURA 3VFCA 4WJEA 3VABA 3VK5A 5LNWA 2ZADA 3LENA 3UETA 2Y4SA 1JEZA 3DDMA 3SN4A 3SN1A 4R8UA 1ZZMA 2GVGA 3TN4A 2VFIA 1MDLA 3W02A 1UR0A 4W8AA 1HJSA 1EDGA 3EMQA 4KT2A 2XH7A 3ZT5A 1LM1A 2PDMA 2PDUA 2C15A 3WF0A 1TZZA 1C9DA 4HZ7A 4CQBA 3AYTA 1TPFA 5F2IA 3WBXA 5C9UA 4C5YA 3W3OA 4L9XA 3F03K 3QZ8A 1WX0A 1EJ7L 2VNCA 4HA0A 3TP4A 2NT1A 2G8ZA 2BOFX 1UA3A 4RPQA 3OQEA 4IG2A 3VC5A 4H19A 3OP2A 4J9KA 1B90A 4W89A 4KWOA 2PPGA 1R2TA 4QBXA 1X1OA 3TAKA 2TODA 1UJQA 3SCQA 3B9OA 3BJFA 3LXBA 1MUMA 1L6YA 1EWDA 3E96A 5HR6A 3TYDA 2WC7A 3WMCA 3AIEA 1Q5MA 3ARPA 3WQ8A 1IM4A 4D6DA 4L64A 2XIJA 3QMSA 4FXRA 2C0AA 2P8BA 5AKQA 3MUAA 1AW5A 4Y7EA 3E2QA 1VPXA 3GR4A 1VRXA 1JYNA 4NI8A 1TCMA 3QKZA 1VHCA 3RCNA 3PK7A 4AD4A 4I7WA 4U31A 4I7UA 1DYSA 3SZ8A 1BTMA 1DL3A 3AU2A 3CQ0A 5I09A 3G77A 3QEZA 1PO9A 4U3AA 1XM3A 4UQAA 2ZVRA 1SVDA 3WL1A 1S10A 3TA6A 4JTIA 1VBJA 2GQ9A 3EOUA 1UZHA 4LF2A 1S1PA 2WSKA 1BWKA 4HJWA 3B3DA 3WH6A 1KFCA 4IFKA 1SSDA 3NZGA 1JPIA 1OC7A 5E93A 2OX4A 3KOWA 2A7PA 1RQBA 3P7YA 1FWGC 4XB3A 1V0LA 2YDSA 4GXPA 4YN5A 2GL5A 3A24A 2Y5SA 2PC8A 4HB7A 2UWFA 4DELA 1CBGA 4PUJA 4TV6A 3Q65A 4L9YA 1OB0A 3D5HA 3LHWA 2BGNE 4I6VA 4CD5A 5EMKA 3ZM8A 5D09A 3O9NA 1V3LA 4KFPA 4K2SA 3G1RA 2HXUA 1KBJA 2B4GA 1PEZA 2P8CA 3GILA 4TUFA 2FZDA 4CQCA 1JD7A 3GV7B 3TVAA 1GKRA 4ZVJA 5CBIA 1J12A 1JAEA 3OU8A 5CPMA 1K6WA 4XD4A 4B3ZA 1E15A 3KRZA 4NXSA 1EYEA 1J0HA 4NZ4A 1PIFA 1XYFA 3VGGA 1GEQA 4OGZA 1PSCA 3A6OA 3QFWA 2V3FA 4H3DA 1JZ8A 5HWJA 4XIMA 5DRIA 3VNDA 4FA3A 1T8QA 3QLLA 1Z8AA 3QHNA 2VDIA 3KP0A 5HNTA 4NJHA 3GR8A 3VMOA 3W7QA 5LHEA 1QJWA 4QEHA 4UMCA 2W5FA 1M9HA 3VXGA 1K77A 1HJWA 3KBMA 4RE4A 3UXAA 4FX7A 3RX4A 2QUMA 3F4DA 5FACA 3CQKA 2QNEA 5C70A 3NQBA 2QCNA 2VTFA 2E25A 4QDMA 3QXBA 3ARRA 3LXAA 3PZGA 1ALDA 3R0DA 3FCPA 2R9RA 4ECUA 3PUGA 2VD9A 1WZLA 2BVDA 3T5LA 5AC4A 2GJNA 1LG1A 4ZEPA 3LTSA 5GQBA 1R9YA 1ECEA 5AYZA 1REQA 1S2AA 4XZHA 3QN3A 4LS0A 4L4PA 3TWAA 2JEIA 5JIPA 1XC6A 2E3ZA 1NF7A 4ECWA 4O0QA 1FP8A 4DJEA 3MI3A 4GNKB 4AW7A 1C8QA 2WHLA 2ZX6A 1P43A 4LUSA 4I5RA 2I5GA 2A85A 1YXDA 4CKQA 4DY1A 4P7QA 1MUCA 1XCWA 3CUJA 2XG9A 5C71A 2QJJA 1WAWA 3T2OA 1HF6A 2RHGA 2R94A 3HPAA 5FCZA 1CGVA 4GKLA 4UFKA 3VIPA 5JBDA 1O5XA 1NWUA 4HT3A 4AEEA 5KG4A 5AZ1A 2E6YA 3TW6A 2YDRA 2PU0A 1PHQA 4LALA 4A8LA 3WK2A 4QE1A 3TC6A 1GYMA 3UXIA 3UNTA 2J78A 4DWSB 2QDHA 4G8TA 1UG6A 4KPLA 2F6UA 1KFJA 3JU2A 1TE6A 1XRFA 3QOKA 4H8VA 3WH8A 1TJ2A 3I65A 4HMDA 3KL0A 3LOTA 3PC0A 1GTEA 2GVEA 3JVAA 2QHAA 5REQB 3RIKA 2C71A 3CEPA 3KTXA 5BRBA 6PTDA 4GLEA 5G2HA 2OR2A 3LX9A 4N2YA 4JIPA 4CN6A 2NV2A 1OGBA 1TMLA 4CD4A 1ELSA 4DWDA 2X1IA 1LDCA 5I6SA 2FTWA 2VD8A 1SGJA 1ZJAA 3CMFA 3GBDA 4F9JA 1A5BA 4BFAA 5KG3A 1G6CA 4AU0A 1Z3NA 4UBPC 1CZ1A 4LTSA 3HV8A 2GQAA 2R6OA 2YCKX 3CIVA 3PJTA 4FP1A 6TAAA 1R8LA 5DQIA 4G1KA 4LPCA 4ALDA 2J62A 3TYEA 2OOFA 1W32A 4UR7A 2OYMA 3DHPA 3EA1A 3ITOA 3TN5A 4MKVA 3UYCA 1HKIA 4EWJA 4PB3A 2DH3A 1O1ZA 2DJLA 3D0CA 1TYGA 1Q45A 1TFVA 3LCWA 4YVVA 1EL3A 2EJAA 2C7FA 2J27A 4LT9A 3GWQA 4D8LA 4GYPA 3AHXA 3W7OA 1OHLA 3EPGA 4NVTA 4NJJA 4ADUA 1NJJA 3K13A 5KFNA 1SFTA 3HG4A 3THDA 1A53A 2OEMA 1G7UA 1E6SM 1VJSA 2BX7A 4JIEA 5C2GA 3QSRA 4C6LA 3JRKA 1OK6A 2FHFA 5AB3A 2JF6A 3EMZA 1DXEA 2X2YA 1LWIA 1B1YA 2VM8A 4OKDA 3MHUA 1BPLB 3UCQA 1JXJA 1W1TA 2QUVA 3TONA 4XZIA 3WLPA 3M0JA 2WJZA 1HVQA 4JFSA 3W1MA 4BI5A 1LLOA 2OEKA 1WZKA 1W3HA 2BTMA 1XD1A 3AXMA 2QJMA 2ZA1A 3ZT7A 1FTXA 3OW1A 5L1LA 1UWSA 1E0TA 1UW9A 4HOWA 2OWXA 2HS8A 1N7KA 1BYAA 4NF7A 1U1HA 4JQ1A 3U5YA 3W37A 3I68A 4GYFA 4GNVA 2D0GA 3HPFA 1O4UA 3WDJA 3OZMA 1Z9AA 3LCIA 2DUAA 3G6MA 3MSYA 1DWFM 1XLJA 3P82A 4AQLA 4HVXA 4HPHA 1AJ0A 1MSSA 2V6AA 3IIPA 1JI2A 5I7GA 2OB3A 5H91A 3UXDA 4P8VA 1V6TA 4UTUA 4MUZA 2FHBA 2OZ0A 2ZRXA 3ZXWA 3CPUA 3IGXA 3H2EA 3GTIA 5CAHA 1UWUA 4FB7A 3CLWA 5FJUA 3W7DA 1EP1A 1TVPA 4V28A 2Y8UA 2R8HA 4ZTXA 2VX7A 2WXDM 4H41A 4XV0A 3OBEA 3CWNA 3PJXA 5GVJA 2BZNA 2AGOA 5LIKX 1KB3A 5EMYA 1OG6A 1LWJA 4Z0JA 3I3EA 4O15A 1PX4A 4I9TA 4J3WA 4EF9A 1XCFA 4DZHA 3MV11 4JN8A 2UY3A 3W53A 1NIUA 5KFHA 3TR9A 3VIOA 2O4MA 1JX4A 1H51A 4AVFA 1GUVA 1HIZA 2F9RA 6CGTA 3VIIA 3HPSA 1DQWA 5JUVA 1U83A 3LY0A 5IBXA 3TLQA 2AOSA 3OTRA 1X6LA 2EPOA 3WD4A 2VR4A 1C7SA 1VBUA 4J3XA 4EE9A 3W28A 5E09A 1ZFJA 4UTTA 4J5NA 4QW8A 2O9OA 3IRDA 1XBZA 5G4HC 1PPIA 4Z2IA 4RV3A 4CCZA 1XLLA 1FWCC 1DIDA 3A5VA 2E6AA 2D69A 1KD0A 2D2JA 2VA3A 1OT2A 4ASTA 3GDKA 3PWAA 3THUA 2ALZA 2O9TA 4TVCA 2RGMA 4ZO9A 4DWSA 3EDEA 3WQDA 1E51A 1JDDA 3WQ6A 2ACSA 6REQA 3LHYA 4I6KA 5FL0A 3WUEA 1UMYA 1S97A 2BOGX 4ZOAA 3AMLA 3FJLA 1DBTA 3V6JA 3DFQA 2HSAA 3TW7A 1GOMA 3CH9A 3MV01 5D04C 5I23A 3NPUA 1HP5A 3I10A 2YCIX 3UERA 2E5DA 2W79A 3OVRA 2XDFA 4Q8VA 2AGKA 3QW3A 3WEMA 2VKZG 3RU6A 2CWXA 1H0IA 4ZQMA 1YDYA 4BCEA 1KBBA 4HTBA 4Q8OA 2ZKMX 3S83A 3N3TA 4QRNA 1CXHA 2X0HA 4FHAA 3WX7A 4IUOA 1NDVA 4DM1A 4PRRA 1OM0A 3WNKA 1IGWA 3XIMA 3TNOA 3L4ZA 4UQDA 3DXIA 3V7PA 4BKNA 2PWEA 4LANA 4TO8A 3R4IA 1LUCB 3C3UA 4H83A 2PLJA 4ZBCA 2DZWA 3N29A 4CD8A 2OZ3A 4GUHA 2OT0A 2ISSA 3NO5A 4TVDA 1JFHA 2HK0A 2E5CA 2Z0IA 4ACZA 2EPNA 5GNYA 3WQCA 1Y5WA 3IGSA 4FOJA 3NWRA 4DL6A 3LV5A 3OBAA 1SZGA 1EFZA 3E2VA 2WMFA 1UZDA 3EPIA 2ICSA 4JIQA 5HMFA 3H4WA 3T0DA 4Z17A 2J66A 3LPFA 4H7CA 4B4HA 4AIOA 4IISA 5A6BD 1H62A 4K68A 1IEWA 1XWYA 3KDNA 2CETA 2GSHA 3LS9A 4O0KA 4JEJA 1S9FA 1XW8A 2Q01A 4RE2A 4JL2A 2E09A 1KGWA 3FSTA 1E6XM 1RY8A 4MGGA 3FAXA 4NU7A 1JR1A 4NG3A 3WQEA 3W73A 4ICMA 1OCQA 1ADOA 1Q6OA 3W81A 4HU4A 1PX3A 5BOFA 2E0PA 1VCFA 4MKNA 1A3XA 2VEPA 5AN7A 1EBGA 3MUZ1 4J9RA 2DSZA 4LYQA 4Z2JA 4DL3A 3T09A 3GGMA 3STGA 2PF8A 2BVTA 1F9CA 2XZ7A 3URQA 1GWJA 5A94A 1EJUC 4C6MA 1ZUAX 1H7OA 4KERA 3MBFA 3NQGA 2XGZA 3RYSA 4OUEA 1RBLA 3UVAA 5F9NA 3G0XA 3PF3A 2FZ8A 4UTJA 1OIMA 1R3TA 2QCMA 4O3RA 5H1WA 5JU6A 1K70A 3POHA 3GKFA 5DEZA 4MB4A 3UJEA 1P0KA 1JZ5A 1V5XA 2VR2A 5LYRA 3NGJA 2V2DA 4H8HA 3PBVA 1BXCA 1V6WA 2NQZA 4X63A 3FYPA 1A4LA 4GCAA 5D37A 4NZCA 3NL5A 4OTKA 2PFHA 2WLZA 4DJDC 4HNUA 4US5D 3MDUA 1EF3A 4O18A 1VS1A 3H8AA 5IM51 5KT3A 5F1UA 2O0TA 1BF6A 3PP7A 1V03A 3G8RA 4YTUA 4CNPA 1TMHA 3LNMA 3LXCA 2X2GA 1KM5A 2PGFA 3M7SA 3CPRA 3PZTA 2PCQA 1KGUA 4JY9A 2BMBA 3D6NA 1E71M 1L8PA 1R86A 1XICA 2E4TA 1QHPA 4J9QA 3ZR4A 2QJNA 2FVLA 2WQDA 1E5JA 4BQ2A 3W74A 3LM7A 2TMDA 3G6XA 2VP8A 3ZYZA 1SW7A 2XN2A 3GTHA 2FJKA 3GZAA 1OG0A 5CC3A 4US6A 5KFDA 4CN4A 2WVUA 1LF1A 1UWAA 2BY3A 1BWVA 2QKFA 1SYTA 1XISA 5BXPA 1WXYA 4Q45A 3VILA 2QMJA 2EPLX 4H6RA 3LHTA 4RJEA 4GO9A 1XV8A 3R11A 5KZMA 1W6TA 4IHCA 1WXZA 2O56A 4IXHA 1FCVA 3GLCA 4E2DA 1T40A 3T0CA 2A4AA 3CB3A 4QQ3A 1GJWA 1QHOA 4UQCA 1AH4A 1GOKA 2DT2A 4IPLA 4Q6XA 4TIMA 1KCKA 4DF0A 1GPFA 4N42A 2EGZA 3TJLA 3B4UA 3GIKA 1ZB5A 2Z00A 1M7JA 2IPGA 4OECA 1Q6FA 2H8XA 1Y5XA 1GGOA 3G24A 4GQGA 2VX4A 1K7EA 2CLFA 2XH2A 3LNPA 3WLIA 3G0UA 4J9PA 2C18A 2D0FA 1YQ2A 3ZSTA 2I7GA 4H9UA 4WDXA 2IW0A 1PTDA 5KMYA 1E1EA 4Q8WA 1E9YB 1P48A 2FGZA 3PUOA 1OZQA 4LSBA 2VGFA 1ZALA 2PGEA 3G1FA 1SZNA 3N2CA 4XD5A 4BWLA 1XS2A 1LLWA 1N56A 1BKSA 3UWWA 3HGJA 3MSRA 4CD6A 3V5FA 4MADA 4IPIA 2ZX7A 1UYQA 3RU8X 3KOXA 4GI6A 4ZB5A 4WKAA 1FWSA 1GOIA 2HVOA 3H55A 3VNKA 5EL1A 3VGDA 3VPLA 4FALA 1UMLA 2A3CA 1FY6A 5D2WA 3U7VA 5DCEA 1RP9A 1X1ZA 4FOUA 1JRCA 2P0IA 3QH2A 5E9XA 4UFJA 4LX4A 1E0VA 4ZOCA 3LCHA 5TNVA 1FQ0A 2JKAA 5I06A 4OQVA 2WPGA 2WKLA 4WOZA 3RJYA 3EKZA 2X05A 2IPFA <