4CQBA

The reaction mechanism of the n-isopropylammelide isopropylaminohydrolase atzc: insights from structural and mutagenesis studies
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
402
structure length
402
Chain Sequence
SKDFDLIIRNAYLSEKDSVYDIGIVGDRIIKIEAKIEGTVKDEIDAKGNLVSPGFVDAHTHMDKSFTSTGERLPKFWSRPYTRDAAIEDGLKYYKNATHEEIKRHVIEHAHMQVLHGTLYTRTHVDVDSVAKTKAVEAVLEAKEELKDLIDIQVVAFAQSGFFVDLESESLIRKSLDMGCDLVGGVDPATRENNVEGSLDLCFKLAKEYDVDIDYHIHDIGTVGVYSINRLAQKTIENGYKGRVTTSHAWCFADAPSEWLDEAIPLYKDSGMKFVTCFSSTPPTMPVIKLLEAGINLGCASDNIRDFWVPFGNGDMVQGALIETQRLELKTNRDLGLIWKMITSEGARVLGIEKNYGIEVGKKADLVVLNSLSPQWAIIDQAKRLCVIKNGRIIVKDEVIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE
publication title X-Ray Structure and Mutagenesis Studies of the N-Isopropylammelide Isopropylaminohydrolase, Atzc
pubmed doi rcsb
source organism Pseudomonas sp. adp
molecule tags Hydrolase
total genus 162
structure length 402
sequence length 402
chains with identical sequence B
ec nomenclature ec 3.5.4.42: N-isopropylammelide isopropylaminohydrolase.
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 4cqbA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4cqbA02
4ZSUA 4F0SA 4C65A 4LALA 3K2GA 3FDGA 3ISIX 2EG7A 5CH9A 1FWFC 2Z2AA 3N2CA 4C6NA 1J6OA 4WVXA 1EJRC 2OGJA 2HPIA 2YZ5A 1EJTC 1KCXA 2Z4GA 2P53A 4IFKB 1V51A 1KRBC 3MDUA 4XAFA 1JGMA 4QROA 3B40A 3O0FA 1YBQB 1NDVA 4IH3A 3G77A 5HMDA 3OU8A 3T1GA 2BB0A 1PO9A 4IGNA 3JZEA 3E74A 3PNUA 4P5UA 5FSEC 4LH8A 4V1XA 4UB9A 3RCMA 1KRCC 4C60A 1EYWA 2HPMA 1KRMA 4MUPA 2YB1A 2GWGA 1M68A 3GG7A 1FWAC 3D6NA 4CQDA 4C6FA 4HK7A 1W1IE 1K1DA 1RK6A 4QS6A 4QS5A 4EPDC 3NQBA 3IRSA 2Z00A 4H9TA 3FEQA 4RDZA 1A4LA 3FDKA 1J5SA 2WJFA 2FTWA 3URQA 4C6QA 4J35A 4XD3A 4KESA 3WZ0E 2AQVA 3SFWA 3IV8A 3MTWA 4KEZA 4BKNA 4WGXA 1NDZA 3LU2A 4GC3A 3TN6A 1V4YA 1A5OC 1O12A 4IGMA 4PBFA 1YNYA 4ERGA 4DYKA 4GOAA 2VUNA 1XRFA 2D2GA 2ZC1A 2VR2A 4RDYA 4DLFA 3KM8A 4H9YA 3E0LA 5A6TC 3UR5A 2BGNE 3E2VA 4LEFA 3IJ6A 2Q09A 1FWCC 2GSEA 5HMEA 1I0BA 3LY0A 4IG2B 1WXZA 1A5KC 1XRTA 3TN5A 4C6CA 1XWYA 1RA0A 2VHLA 3F2DA 4XD5A 3HPAA 1UIPA 3UPMA 2VC5A 3HM7A 1J6PA 4C6PA 3BE7A 4H01A 3GU2A 2QS8A 1A5MC 1GKQA 2PLMA 4J5NA 2QPXA 2R1NA 1A5NC 4PE8A 4G7EB 3S2NA 4C6BA 1V77A 3E38A 3QY6A 3WYZA 3DUGA 2Z29A 4XAGA 4WHBA 4C5YA 3LNPA 1EJSC 1PB0A 3E3HA 5AKQA 4CQCA 2UZ9A 3PAOA 2CZVA 4KERA 4BY3A 3QGAC 3IARA 4B92A 3RN6A 3GTXA 5FSDC 4GZ7A 3ICJA 4OFCA 3OOQA 4GY7A 4CEUC 2ANUA 2Z26A 3EGJA 2AMXA 2DVTA 1FWJC 3NURA 4IFOA 4CQBA 2Z7GA 4C6JA 1FWDC 4V1YA 4HK5A 3S2JA 3UR2A 3S4TA 1XGEA 3TNBA 4CNSA 4XAZA 3S2MA 1NDYA 3LGDA 4ICMA 2GWNA 4C5ZA 2E1WA 2D2HA 4HA0A 4C6IA 3GTFA 1RJPA 2FVKA 4DIAA 1ZZMA 4EPBC 3MVTA 1A4MA 3AU2A 3GU1A 4C6EA 4IFRA 1BF6A 3MVIA 3MPGA 3CAKA 1FKXA 3RHGA 1POKA 2EG8A 3URAA 3GRIA 1R9XA 2Z27A 4DNMA 3LSBA 1YIXA 5G4HC 4NP7A 3MJMA 1K6WA 1S3TC 4CEXC 2OB3A 3GTIA 4DZHA 1A5LC 3TN4A 3OODA 4LAMA 3PNZA 4NI8A 2I5GA 3MSRA 4DI9A 1J79A 1EJWC 1UIOA 2G3FA 2E25A 4LAOA 4XD4A 3GIQA 2A3LA 1V7AA 3QGKC 3NEHA 1K70A 2D2JA 1KRAC 1P6BA 4RE0A 4AC7C 4G2DA 3LS9A 4KETA 3A3WA 2EG6A 4GBDA 2DVXA 3B0XA 4ZSTA 1QXLA 2WJEA 2OOFA 1YRRA 1PSCA 4GY0A 1R9ZA 4DLMA 4LCSA 1V79A 4M51A 4C6MA 3GGMA 2PGRA 2GOKA 3CS2A 3GIPA 3F4CA 1ONWA 3TN3A 4I6VA 3ITCA 3PANA 2Z25A 4RDWA 2ADAA 3LGGA 4GX9A 2AQOA 4LANA 4H9ZA 4XD6A 4J2MA 4R85A 4H9MA 4GYFA 2Q01A 4LCQA 4C6LA 1UMLA 1EJUC 1P6CA 4QRNA 2Z2BA 1O5RA 3LSCA 2QVNA 4B91A 2R1PA 2HBXA 2O4QA 3GUWA 4CNUA 3OVGA 2R1LA 4L6DA 4PCNA 1E9ZB 3E0FA 5E5CA 1R9YA 4NG3A 3GU9A 4KEVA 2Z28A 4AQLA 1VFLA 4GXWA 1GKPA 3PBMA 2O4MA 2FVMA 4KF1A 3S2LA 4R88A 1EF2A 4C6KA 3K4WA 1EJXC 1E9YB 4LAKA 2VM8A 2W9MA 2Z24A 2IMRA 3RYSA 1FWIC 1NFGA 3A3XA 2FTYA 4L9XA 4KQNA 1RA5A 1ITUA 4LFYA 3UF9A 4DO7A 3CJPA 4H9VA 3F2BA 4B90A 2PAJA 4RZBA 4PCPA 4IF2A 4I6KA 2PGFA 3OQEA 4ERAA 4Z42C 3MKVA 1ONXA 4HK6A 4XAYA 2QT3A 2WJDA 3ORWA 1HZYA 1NDWA 1FWEC 4DI8A 3R0DA 1RJRA 1QW7A 2HNHA 3IACA 4TQTA 1P1MA 1EJVC 4PBEA 4EP8C 4F0RA 3K5XA 2Y1HA 2RAGA 2ICSA 2YXOA 1FWHC 2R1MA 4UBPC 4BJHA 4H9UA 3DCPA 4KEUA 3AU6A 1RK5A 3C86A 4RDVA 1FWBC 4EPKA 1M65A 3IGHX 4KIRA 3ID7A 4H00A 3HTWA 1UBPC 5HMFA 4D8LA 2OQLA 4GX8A 3IPWA 4H9XA 2HBVA 3T81A 2PUZA 3QY8A 4HJWA 4GK8A 3F2CA 2DVUA 2WM1A 4ERIA 2P50A 1GKRA 1ADDA 3A4JA 3EWCA 3GTHA 4C6OA 1YMYA 1FKWA 4IG2A 2P9BA 2OODA 3O7UA 4B3ZA 2I9UA 1DPMA 4IQJA 2FFIA 1POJA 4EPEC 3B0YA 4INFA 1IE7C 1M7JA 2HQAA 1ITQA 4YIWA 3OJGA 2UBPC 4E3TA 1FWGC 3URBA 3UBPC 2GZXA 1RJQA 4DZIA 4GY1A 3DC8A 3SO7A 4R7WA 4G7EA 4IFKA 4CNTA 4QSFA 4QTGA 2XIOA 3LA4A 2YB4A 3QY7A 4C6DA 3URNA 1EZ2A 1YBQA 2VC7A 3EWDA 2R1KA 3V7PA 1WXYA 2F6KA 3WMLA 1I0DA 3T8LA 4F0LA 3MDWA 4LCRA 1RAKA 2KAUC 3AUOA 3F4DA 4JOMA 1PTAA 5LXXA
chains in the Genus database with same CATH superfamily
5DN1A 2ASLA 3RMJA 3RF9A 1CPUA 3WD0A 2OX4A 4U4MA 1JX4A 1NSJA 4GFSA 4J3VA 4PYSA 1F7BA 3C4UA 4C6NA 2CHNA 1DJNA 1XIFA 3U5UA 1H7WA 3LLFA 1OT2A 3OZYA 1KCXA 2JKAA 1X38A 4FS2A 3H4XA 3Q94A 4QJ4B 4PMOA 2YGYA 1V3LA 4I9AA 4O57A 1ZAIA 5KFEA 4Y9PA 2HS6A 4IR1A 3BJTA 3CK5A 4KKXA 1X6LA 4UUIA 2XIIA 3T1GA 2HE5A 1V5XA 4HPNA 3FN9A 4K7VA 2V3EA 3E74A 3MMWA 3L4YA 3GC2A 4Z1AA 2ZKMX 4MZ8A 5B7ZA 3WKZA 1WDQA 1OFOA 3P6LA 1R85A 4AWUA 3BLOA 3EZ4A 2E6YA 1KM4A 3STFA 2WO5A 3ALFA 3OG3A 4JV1A 3REQB 2P5NA 3QZEA 4AHQA 2YCJA 1KXQA 3HPFA 1CB7B 1MDLA 1P43A 3T5LA 1GOWA 1DV7A 1DJZA 3C0SA 5KFNA 4ZB0A 2F6XA 3W2KA 3EX3A 5F2IA 3TP4A 1Y7VA 4J35A 1EX5A 1M7OA 1TX0A 2PGEA 3LMZA 3TMQA 3RCYA 3TAOA 3R58A 3EX1A 3W28A 3G0XA 3AAMA 3R8HA 1W9BM 2IXUA 3UWVA 2A7PA 3BJFA 4ECRA 5I7GA 4RE4A 1HUVA 3EOSA 3PPGA 2ZC1A 4OBRA 3SCOA 3TXZA 4FPSA 3EMQA 3ABXA 3ARYA 4AF0B 4S3GA 5MKGB 3T08A 2GSEA 1HJSA 3D47A 1I0BA 3B8WA 7TIMA 1F6KA 3PVXA 1GEHA 4FP1A 4JIQA 5EKYA 5G2WA 5BU9A 1WZMA 4OKDA 2VC5A 4UNKA 1GVSA 2QUNA 1TUXA 4H01A 4H7ZA 1XPYA 3W7GA 2ZZ7A 3VNMA 2DZTA 3VGBA 4NZ1A 4S3FA 3CWOX 1DBTA 1NVMA 3WYZA 1TPH1 3VIHA 3H26A 4CU7A 4TTGA 2XWDA 4PUJA 5HNRA 3TOPA 3UVAA 1EDGA 4XIAA 3ICJA 2OZ0A 4I5XA 4I7UA 2IUZA 4G56A 1OT1A 3CBWA 4NZ4A 2VA3A 4PL1A 4G6CA 2W8KA 5HATA 5BXRA 4O1CA 4KMQA 2PPGA 1K3UA 2WVSA 2NQLA 5EY5A 3B8VA 1XDJA 3I4EA 4M3PA 4IFRA 1XBZA 1SFJA 4MM1A 3BSMA 3THUA 1PVNA 2VD8A 3IEBA 1GOOA 1AQ0A 5G4HC 3HURA 1EOMA 1VPXA 3PSWA 1X97A 1J18A 4MB5A 3AXXA 4BEUA 3EKGA 2X1UA 3W7QA 4PTNA 5LIYX 2DPEA 4CU6A 1QNSA 4QG6A 3TC7A 2A3LA 2MNRA 3V0SA 3WK2A 3QGKC 3QV8A 2V3DA 3BV7A 4RR4A 3EX2A 1V6WA 4JTKA 5HOSA 2D24A 1O5QA 2WNNA 3HIJA 3OGSA 4AZCB 3MW7A 4N6EA 3N29A 1XH1A 5AY7A 2OOFA 3WUFA 3WO8A 4JDYA 3MB9A 1R3WA 1X6NA 4ZB2A 1UKOA 4G1KA 3VUPA 4HA3A 2AGPA 3MMDA 1H0GA 3HV8A 4BQ2A 1WOAA 3W24A 2J6TA 3KOFA 2AQOA 4LANA 4XD6A 2J7GA 3FJLA 4W5UA 3LBOA 1JCTA 3SQLA 2DZWA 1DXEA 1QHZA 8A3HA 4FMVA 4ECYA 3UZWA 4O54A 2YBTA 3EMCA 2NV1A 3AROA 3ZSTA 3AWOA 4CVWA 4L65A 2O4MA 4JN7A 5ECUA 1TV2A 3HBLA 3IN5A 1UA3A 1GOXA 3S6TA 2O92A 2W9MA 3LHTA 1NFGA 1AODA 4EEYA 4JBRA 2TMDA 4LS1A 4FXRA 3WDHA 4YNGA 5KFWA 3H4WA 4O8AA 4AY8A 3TNOA 1GYNA 1R87A 2OYLA 1VGAA 1OD8A 5DEZA 3PZ9A 1QBAA 1NDWA 5KFBA 2E09A 3P0XA 2UY4A 3BG9A 4H04A 2NW0A 4MOZA 2YCLB 3N9RA 3VIFA 1JIBA 4GNKB 4PC8A 4E4FA 3A4WA 4QJ3B 3W70A 2XJ7A 1ZP4A 2G96A 4O3NA 3KUMA 1JJKA 1EEXA 3AIEA 5KG0A 3AOFA 1XC4A 3W82A 3AFBA 5A6SA 1UR0A 1S1PA 1K9TA 2BVTA 3NAVA 1XHGA 3KRUA 3AS1A 4NJKA 2DEPA 2OWWA 4LUSA 1PZ1A 4XKYB 3TFCA 3EWCA 7REQB 1NAL1 1XSIA 2F38A 3GNRA 3CL7A 1X96A 3EWZA 1TV5A 1J0ZA 3VOFA 1JIHA 2I16A 1W37A 1ZENA 3CPGA 4J9OA 2W9AA 1EGMA 4ACZA 3QVQA 2WAGA 1JNEA 4MJMA 4GMEA 3OLIA 4DF1A 1QO2A 4O53A 5FJRA 2E5BA 3NQCA 3PW5A 1LBMA 3SJ3A 1XIGA 2XWEA 1RCQA 2V6AA 3C6CA 4PGLA 1YBQA 3T5HA 1I0DA 5A2AA 3SSZA 2VELA 2PDLA 3A4XA 3F4DA 2B0MA 3EA3A 2UVVA 4F2TA 4ZZ9A 5CBIA 3NQ2A 2IW0A 4DJED 3LCWA 4TTUA 1AQMA 4NX0A 1JDDA 3ITXA 4QAIA 5DG8A 5DF0A 1HIZA 4D6IA 3M43A 1QPNA 2SFPA 4NILA 4UZSA 2DW7A 1KRBC 5EWEA 4J9LA 4LVDA 4GQGA 1JGMA 1NM9A 2WSRA 3PBUA 4ZMGA 1GEQA 3G1AA 3TTQA 4RZ6A 1I2QA 4QSHA 3PY2A 2WQDA 3IANA 3VU2A 1F3TA 4IJRA 1TV8A 3I6RA 4LUTB 4F66A 2A4AA 3VIKA 5I77A 4LGXA 2WMKA 5GNXA 3PNUA 4PH6A 4HNVA 4GBUA 1XUUA 2BX7A 5CPNA 3QQWA 4AY1A 1LLZA 1B9BA 3WNOA 4RE3A 1NARA 5HANA 3RPDA 4W89A 2AGKA 2YYUA 3PZGA 3OHAA 1AH3A 1UPPA 1X7FA 4JPGA 4J9NA 4HK7A 5KG2A 3ABOA 3PJUA 1KM3A 3KWXA 1S2TA 1RVKA 1LT7A 1A4LA 3NYDA 3MHFA 3SB0A 1I60A 2GDVA 1V0LA 2YIHA 5IHSA 4FLRA 3PPFA 1JZ7A 1WDPA 3N13A 3OLGA 4D9PA 4GNVA 1M1BA 2QJNA 4IQDA 3IV8A 1LOLA 3DX5A 1WBJA 4IJBA 5FKYA 2I14A 2HVOA 3BQ0A 1LWJA 2X8RA 4YTSA 1BQGA 4DM1A 1KV5A 1XR2A 4IGMA 5F2MA 4EK7A 3NIYA 1S2CA 1EJ7L 4X9SA 2VUNA 4UFIA 3ZT5A 5IRPA 3WD3A 4MHBA 4CD8A 3O63A 1VRDA 3GR4A 1GVEA 1OCNA 4WDXA 5M3WA 2Q09A 2C15A 2PDPA 3KHDA 1RQEA 1BSLA 2R94A 2P0IA 4DBWA 3BAYA 1W2PA 3LXCA 4ZXOA 2XM2A 4GLEA 4H41A 2YFOA 3W6YA 2F8QA 1K03A 3GU2A 4J1OA 3PR5B 1IV8A 2H9AA 3I7SA 2PLMA 3V36A 5KT4A 2FJUB 4KFPA 3VGFA 1QJWA 1DIDA 2PU0A 3NL3A 5A5WA 3HGJA 3DG6A 1M53A 3ZR6A 1M3UA 1KR1A 1HKMA 3GAKA 3MCOA 2IPJA 4BY3A 3LHUA 3RN6A 1UWIA 4A22A 1ZJBA 3NG3A 4ZL1A 3BG5A 2Z26A 3F5JA 3ARPA 3RRAA 3TONA 3GE7A 1B3ZA 1UBSA 1XSKA 1LG1A 2DSWA 3MUY1 1TKKA 2E1WA 3P82A 1VBHA 3W1QA 4NU7A 5CSSA 2BOFX 5DLGA 1JAKA 1XLCA 2DPJA 1MI3A 1Q8AA 1FH9A 3PFMA 1S5MA 1W3HA 3Q58A 2VJXA 3V5FA 4GVFA 1XISA 1DE6A 4GUJA 1O68A 3W9ZA 2F2HA 1JZ4A 1RD5A 4RNIA 1PYFA 2ISWA 3R11A 2X41A 3OBKA 4NI8A 3KDNA 1K7EA 2ASDA 3P2VA 3VIPA 2WTFA 2GGGA 2PSNA 2X42A 4XD4A 1M41A 1YNPA 2RGMA 2V63A 3H55A 3KE0A 4RE0A 3GXPA 3ITLA 1XDMA 2WZEA 3M5XA 2Q8LA 3RU6A 2DVXA 5T9BG 2VFGA 2WJEA 3CIVA 1YRRA 3ZJKA 1QHOA 3BOXA 3POCA 1W6TA 2AL2B 2D22A 5AHEA 1AH0A 4NXKA 1OWQA 2WZTA 3CUJA 4Y9MA 4PB5A 2PRMA 3L12A 1TELA 1JCXA 2P1FA 2OGYA 3J7HA 1EJUC 5CGMA 3F7JA 4HOWA 4C1LA 1XLGA 1OX4B 3UXIA 1KTNA 4PCNA 1RP9A 3LHZA 3W76A 2OPJA 3GU9A 2UWFA 5LNRA 1VIWA 3GNXA 1VFLA 3FA5A 5M1TA 4Z1BA 2J7FA 4ADSA 3SCTA 2D1ZA 1Q6QA 2CLKA 1TRIA 1XGDA 2JKPA 4PMDA 4NASA 4DWSA 1TRDA 2ZUUA 4N9EA 4ZOBA 5D2VA 3NZ1A 4H9VA 4DBDA 5A1AA 4I6KA 3REQA 4Z42C 4PTVA 3WF3A 5A6BD 2PA6A 2Y63A 4IMAA 3GILA 2XZ7A 4EACA 3KL5A 1S3HA 1KM5A 4LVBA 4DELA 4NQ1A 4XV0A 3BV4A 5HWMA 1MO0A 1FFRA 3PJTA 1PZ0A 5ABFB 1BD0A 3L9CA 1MEHA 3KOYA 4Q33A 1E72M 3KTCA 3BPWA 4RW5A 4HNOA 1CTNA 2BHZA 3EOOA 3T81A 2VRQA 3GS6A 4C7GA 1TUFA 3NPVA 4AF0A 1GKRA 4HVXA 1HKJA 1UR4A 2YL6A 3CLWA 1ADDA 1TJ2A 2PU1A 4C6OA 4NJJA 1YTDA 1RXOB 2GGEA 4QHRA 1Y5WA 4W84A 1DWHM 2VC9A 3ITOA 2HS8A 1XLFA 4RNHA 2JEQA 3KL0A 1E70M 3B0YA 4TX6A 2YX0A 2PDBA 1O94A 4H19A 1UC5A 2ATMA 2GQ3A 1XF0A 2RFGA 3DC8A 2VGFA 4X9YA 2XISA 3L2LA 1JCYA 2XIOA 2J6SA 1V6YA 6XIAA 5AHFA 1SFLA 1UHVA 3L4TA 2FPVA 3W1PA 2F6KA 2DDXA 2B7PA 3RITA 1A5UA 3W38A 5EMJA 2A1YA 1EP2A 1UQYA 4QJ1A 2E67A 3L21A 3W7OA 3BCDA 2WJZA 1L6FA 5CH9A 4S38A 3AI0A 3VX0A 3WLQA 2Z2AA 1KGUA 4Q4QA 3N2CA 1Q3NA 5DELA 1W3IA 3VNLA 3N11A 1EJRC 3DESA 4GUGA 4HJFA 4J9RA 2PCEA 3LXAA 2OZ8A 4J9PA 2FHBA 2V5BA 2P76A 3ZOAA 1UWAA 2C71A 1OGSA 3O0FA 4MJ4A 3RO8A 4M6QA 3BZGA 3DFQA 3QHOA 1S0OA 5A6AA 4MB3A 4MF4A 3AYSA 4JV0A 2Z1KA 2WVUA 2EKGA 2PWFA 1W54A 1S2VA 4AH7A 1P0EA 1WOBA 4YTUA 1CGUA 1KRMA 3A22A 4XAPA 3GG7A 4Q4SA 1V3JA 1YKWA 5LA0A 4AZCA 2ZZ1A 4P8WA 1W1IE 1TB3A 4IRKA 3C2RA 5REQB 4DJFD 2YFNA 1V0MA 4G8TA 5I09A 4ECXA 4QE5A 1UUQA 3SUUA 5KT6A 3WZ0E 1CXFA 3DIPA 3E0IA 1BYCA 3LBMA 4US6A 3VGHA 3A64A 1W0MA 4RNFA 1QK0A 3EMZA 3A21A 3EPOA 1C8YA 1V4YA 2CLPA 3ECQA 1W9DM 3U0HA 1X39A 3VKCA 1YLVA 1VQTA 3O6CA 3CIXA 3U6WA 4H9YA 3E0LA 3VAVA 1T41A 1OABA 3M6YA 5C9RA 2C1IA 1AW1A 5AZ0A 3PBWA 1P48A 1LM1A 4PMYA 3MUAA 1F9CA 3PG9A 1UIPA 4K68A 1TR1A 4KH2A 3EAUA 1RD6A 3H7VA 3CQ0A 4NKCA 1CYGA 4IMDA 4REQB 4DBUA 4QLJA 2YCLA 4JIHA 1SQ7A 4RXFA 1V77A 3DECA 3TEVA 1E3ZA 4PUMA 1J9YA 3PW0A 3WLOA 2ATLA 1S9FA 3GXIA 3LD5A 1EH9A 2Y5EA 2CETA 5D37A 1GQNA 5F9NA 4MKNA 4N2YA 1SZNA 2CWXA 4B4HA 1LQ2A 1FWWA 3D46A 4IP4A 4H8VA 4XKYA 3LMYA 3NYZA 4PA8A 3A23A 2FVKA 3VVGA 4CKQA 1QI4A 3W84A 3N2TA 4C90A 1PAMA 5H2ZA 1E4IA 1XPGA 4IUGA 3R1ZA 2V68A 1IWAA 3KBSA 2C19A 5BOEA 3ZWSA 3O6DA 3B0PA 1Q63A 2PLCA 1S1RA 3NZRA 3GVWA 1Q2RA 2BXVA 3UCDA 3NQGA 2C2RA 4EXBA 4HSHA 4LAOA 4LY4A 3N12A 4PFMA 1V7AA 3CL6A 4GYPC 3NCOA 4NRRA 1ONRA 1WUFA 2EG6A 3WMCA 1JRBA 1L9WA 2VGGA 2YPIA 2BMBA 3UW6A 3GGMA 1XM3A 4Q8EA 2V8ZA 1DORA 3RM9A 1BAGA 1OFBA 5G5IA 3ZR5A 2QCLA 3DHFA 5HQMA 4C6LA 3OP2A 5EMYA 3IJLA 5D05A 2HBXA 4IP5A 1XBYA 1ZALA 2EQDA 3TDFA 3O05A 2Y7GA 3PTMA 2ZUMA 4NG3A 2PTZA 1ISVA 2CZDA 2E9LA 3WJYA 3A6OA 1H4PA 5GQBA 1Y65A 3PBMA 4M6VA 5AOUA 1J01A 4A2SA 9XIMA 4AEFA 4HMNA 1R8LA 3N6JA 3OQ8A 4LAKA 3V75A 3HGOA 2OT1A 4GINA 1NELA 3UZJA 4URIA 3ZJ7A 1JPMA 2FTYA 2NQ5A 4PFHA 4B90A 4EBCA 4H8UA 3M1ZA 3QQ0A 3W72A 2RDWA 1ME9A 2EO7A 2WVVA 4GHRA 4ED0A 4ZXLA 1D2KA 1ONXA 3E5PA 4HTBA 4H6QA 2GSHA 4C7FA 3VIOA 1BLIA 2PTYA 3H2MA 2HNHA 1XLBA 1H7NA 2HE8A 1WE5A 2BLEA 5L1LA 2XVLA 4WSKA 3RK8A 2Y1HA 1E0TA 5AVNA 2FHFA 3DENA 3GC4A 1HX0A 1OFAA 3EB4A 4ZQCA 4A05A 1JULA 1L0PA 2HV5A 1FWBC 3WIJA 2XH7A 5K9DA 2V4RA 2Z2UA 3N2OA 4Q8UA 1H1YA 2VFEA 3L2IA 4ORMA 3TAKA 4GX8A 3I65A 3S1GA 2O7SA 3VDBA 2WM1A 1A3WA 1TV3A 3A4JA 3VO0A 4UWMA 1UZ4A 4KIEA 3PB2A 3LOTA 5BRBA 3H70A 4KWVA 1DE5A 3PJWA 1OFQA 1LLWA 2D0HA 1JUKA 3C52A 3VIIA 1E6SM 2UBPC 1ZTVA 1W56A 2GZXA 3KVMA 1RJQA 1FWRA 4UCGA 4QM1A 1TQXA 2Y7FA 1CXIA 3LA4A 4YVXA 1PZ2A 4B2DA 3AUJA 1WXYA 3NO3A 2VWTA 2GUYA 3EPNA 3V0TA 4Q6JA 1T8XA 4JHMA 3CLMA 3MR2A 3AXIA 2R91A 3S83A 3WFAA 3MMUA 3NUKA 4JQ3A 2ZZ2A 5HWJA 4AD3A 3TUUA 4D72A 2I5QA 1OC5A 4HHHA 3P5ZA 4BI5A 3LCGA 4FX7A 4QNWA 1GUVA 3S1XA 2C2DA 4M5PA 3WNPA 3GVQA 3SQMA 1RSCA 4Z1CA 4IP7A 4FALA 4M82A 4PTWA 1W1A1 5JIWA 1L6WA 3OW1A 3C0LA 1FRBA 4WUIA 1V02E 1JCLA 1ENUA 4X22A 2PWDA 2QPUA 4Z0SA 3WF4A 2BV9A 3L0GA 1VYRA 4JIRA 2Q02A 3UP8A 1N55A 4YPJA 1E43A 3QYSA 5EDWA 4DHGA 4JTFA 3PBYA 4FI4A 4GXPA 1N56A 2ZUWA 4D1JA 1S5NA 5I06A 3ENLA 1QHPA 2WQPA 1ZNNA 3KVKA 1KBIA 4H7VA 4FBTA 1GPWA 4FNSA 2YXXA 4JCMA 3ONBA 4JD4A 4KESA 2G97A 5G1YA 5F9LA 2Y24A 4D8AA 4DWSD 3W00A 1E6NA 4RZ5A 4F8XA 3GXDA 3TYEA 1R3TA 5HWNA 4FSAA 2Q3RA 3TWAA 1AJZA 4PSPA 4AXKA 2PWGA 3AHXA 4XK2A 5CZ0A 1J12A 1TPDA 1YTEA 4TVUA 4RDYA 1GVQA 2WW5A 4V2XA 1XLIA 1A49A 2BGNE 3AHYA 2F2KA 4FIQA 1R5YA 4MY1A 4KGLA 6REQB 2GUBA 4OJYA 1Q7QA 4IG2B 1KLYA 3WH6A 1EHAA 1A5KC 3TZNA 2VX7A 3M7SA 3TLLA 3HM7A 3UXDA 2QJHA 4JFSA 3OLDA 5AECA 4J5NA 2VX5A 2OO0A 3NQAA 5IBXC 1RH9A 1UP3A 2OLHA 3E3HA 3S47A 4E8DA 1MEIA 4JQ2A 2PDNA 4LB3A 2QF7A 3PTKA 2CZVA 4JTIA 3VPLA 1SZGA 5T9CE 5A6JA 5I00A 4ILSA 3OOQA 4QQUA 1S5WA 5CQ1A 4GY7A 4U5IA 2H6RA 4KRUA 3T0CA 2P8BA 2H3DA 2XIMA 2OFJA 2HEJA 3NL2A 3WLHA 4QG9A 3UXKA 1B0IA 4XB3A 5ABTA 1OM0A 3LB0A 2PF0A 4O4VA 4DJDD 4LBUA 4EF9A 3M9NB 3MY9A 2ACRA 2GQ8A 3ARSA 2QCNA 2Z0IA 4CN6A 4NVTA 4EE9A 2AL1A 1K6WA 1S3TC 1M01A 1Y0EA 5A6LA 3EX4A 2J9ZA 3NQ7A 3W75A 3RU8X 1QRQA 3P7YA 1WAWA 2XH0A 2R82A 2GJPA 4E4UA 3WQWA 4WDTA 2OEKA 3STGA 3T6CA 3P61A 2ISDA 1VH7A 1B3WA 4J3UA 3RR1A 2E8YA 2VDHA 4UQCA 4WDUA 1HKWA 4KEMA 2XGZA 4LVGA 2YL8A 3PS7A 3LS9A 4EAMA 1V02A 4RL3A 1EGVA 3RO6A 1R9ZA 4IL2A 4LCSA 4C6MA 2VFIA 4W9TA 4QQ3A 5E6YA 1MXGA 2ZX7A 3PZUA 4QG8A 2WZMA 3S3GA 1MXDA 3UZXA 4R85A 1E5NA 1BKHA 3EPGA 3BW4A 3LNMA 3TJIA 4O3OA 4M29A 2DT1A 1KM6A 3ALGA 4AMCA 1KO0A 4Q45A 2QGYA 3OVPA 3WLPA 5DO8A 1IIHA 1ZRQA 3AHTA 1DP0A 3TCSA 1SFTA 4LY8A 3RIKA 3NSXA 3DFSA 3E12A 4JYEA 5DQHA 1FWSA 2DFAA 3UEQA 2DT0A 2CYGA 4AD0A 4A3YA 2FFCA 2BP1A 5M17A 1C91A 1TREA 5CAKA 4ZR8A 3OQEA 4ERAA 1SM9A 2QCDB 3UWWA 1CECA 3SZ8A 1SW3A 3DFHA 3BLPX 3BQ6A 4R5EA 1RPKA 5LNWA 3ARWA 2QJMA 5REQA 1EJVC 1DJHA 2PLJA 4EP8C 3MI6A 2QNEA 3GO2A 3VE9A 2VZOA 3SN4A 1P1XA 3THAA 1FWHC 3G22A 2YLAA 3L7RA 4HD5A 4A3UA 1DJWA 4G7FA 4M56A 4RDVA 4NUWA 1IEWA 2F61A 5FESA 1KBLA 1I2RA 3G6LA 3V6JA 1JPDX 1VS1A 5AYYA 4LUJA 2IKHA 5LIWX 3AJ7A 3HU7A 2BXYA 4L6OA 2WVTA 3E2RA 2IPGA 3VM7A 1EUAA 4AZBA 3O7UA 3CAWA 5T14A 3V3WA 4IUOA 3ZMRA 2QUUA 4B5VA 1W91A 2FIQA 1IE7C 4U2YA 3V35A 3TA9A 3CT7A 3MU7A 2CBJA 4DRSA 4ECZA 3QV6A 1RYRA 4REQA 2ZTKA 3MUIA 1TMHA 2V69A 4IFKA 4S3DA 3ONCA 3BLLA 3PZQA 4RLIA 4O3SA 4Q22A 4C6DA 1KM1A 3IAQA 1BXBA 4Y90A 4D2JA 3EYPA 1QI2A 5DY2A 1NFPA 1QK2A 4JFWA 3AUOA 5TF0A 1TVPA 1FH7A 4Y9AA 4PTMA 4K37A 1VBGA 2X16A 3A13A 3C3UA 5XIAA 3QTGA 2XTKA 3PPHA 3VIJA 1XW8A 1US2A 1PEZA 1EEPA 2ZA3A 3OIHA 3OVRA 4JHOA 4BFAA 2PDXA 1WNOA 3BLEA 5JU6A 1H7PA 4AD1A 5JH1A 5HQLA 3O6YX 1VEPA 2WYSA 3QFEA 1XLLA 1LORA 1RLCL 2DH2A 3TXVA 1V03A 4V27A 3T0BA 1B3XA 4CUCA 1N8IA 3R79A 3W7CA 1XINA 4IGNA 1JFXA 5EB8A 2P3ZA 1XH2A 2ISVA 4ECVA 4UB9A 1C90A 3H21A 3USZA 1C29A 3RUBL 3TWBA 3GYCA 4JR5A 1F6YA 4TIMA 2OZTA 4XZBA 2NXHA 3WK0A 3HQOA 1P7TA 5KETA 4Q6XA 3ATYA 1SGJA 1F05A 2PODA 4A3QA 4EPDC 1M04A 1PJ9A 3D3AA 4P7LA 3GH5A 1DJGA 1OG0A 1BYBA 5D2TA 1S5TA 4CQ9A 1CCWB 1KXVA 3P67A 5C9XA 4US5A 3RX3A 3FJ6A 4EVZA 3UY7A 3C2EA 1LWIA 2VOMA 4AU0A 3E49A 9XIAA 5C54A 2ZZ4A 4L4OA 5BXSA 4MKSA 3I3EA 1E55A 1K8YA 1Q4WA 5CZTA 3N9SA 3WJSA 3WQ5A 1LL6A 3W1RA 1YDVA 1F76A 4O1EA 4PEEA 3BL3A 3IJ9A 1J93A 4AVNA 1KM0A 4MAVA 3UR5A 5I3DA 4KT2A 2NX1A 4B5XA 3GHUA 2ZCGA 1ALDA 1B30A 1J10A 4OHQA 5HK4A 1E4NA 1OIMA 3MSYA 3HQPA 1ZJAA 3WQFA 3UPWA 3GDBA 4XD5A 4B5TA 2EEXA 4BQ4A 5CLTA 3GH7A 3RAQA 3M64A 3KFTA 1GKQA 1PL9A 1YTKA 3JZUA 1VP5A 2RH9A 1Z32X 2Q71A 3E38A 3QKZA 4CLMA 1LRNA 4HU3A 2UVRA 3W7NA 4ZBCA 3FY1A 4CQCA 1VRXA 3E2QA 1H7OA 3R89A 1GVRA 3IK2A 2QDEA 4ROPA 3TR2A 1WB0A 1TVNA 4IFOA 4ATLA 3G0UA 3W26A 2J75A 4V1YA 2JE8A 1H7RA 1XYLA 4X0VA 1GG0A 1BG4A 2VFFA 1AJ0A 1XC6A 4B5WA 4UXDA 2DQXA 3KW3A 2GGIA 3QKEA 2EGZA 3S6OA 4DIAA 4DO6A 2XFFA 1J2BA 1A5SA 5DCDA 1T3NA 4EKJA 4B2DD 1POKA 3URAA 3O2LA 1J0KA 2Z27A 4P8UA 5BWAA 2RJHA 3IVSA 3WLIA 4CEXC 5DQIA 2H8XA 4H8NA 3QMTA 3QLLA 4J3ZA 3AISA 3TN4A 1GQKA 4RCXA 5FF3A 2ZX9A 1DIKA 3P62A 2VQTA 5I03A 3CB8A 1T94A 3N9KA 2W63A 3GH4A 2CZEA 1ICPA 2FVLA 4BI6A 1QASA 4ICCX 3KOXA 2E8ZA 4UTLA 1QDSA 4C1NB 5H1WA 2XH4A 3HA1A 4MFDA 4AWTA 4A8IA 3OA5A 1EC9A 2BOGX 3IIZA 3GIPA 4Q8FA 4UQAA 5EMUA 3T40A 4N0RA 4RDWA 4IL0A 4XISA 3CV2A 3GTNA 1U2YA 3O9NA 2ZICA 3EWUA 3TYDA 5FJUA 4PR4A 1P0DA 1KQYA 1P6CA 5LNVA 2DP3A 1UR9A 3TU9A 3FIGA 1FUYA 4X3ZA 3W86A 3ZLHA 4RKAA 1H0IA 2FZ8A 3SADA 2VCAA 3CMJA 3IGXA 4GG9A 4IIGA 1JD9A 4QLLA 3SI8A 2VL4A 5KFVA 2WWDA 3PSVA 2CBUA 1LQ0A 5C9WA 1WCGA 1YXDA 2VR4A 1XKJA 3K4WA 3ARZA 4QEEA 2NQZA 4H3DA 3PB0A 5ABHA 4MNKA 5KG4A 2Z24A 3SQSA 2X1RA 3ME3A 2HRWA 4FOUA 1RALA 3S6DA 4N42A 3T07A 2QHAA 1VAHA 4UTMA 1OY0A 2C6QA 2DZPA 3H8AA 4ZVJA 2DIEA 3VE7A 2DV0A 2BSLA 3JRKA 2QYGA 4PMRA 2W61A 2BWGA 4HZMA 2OH2A 4PBEA 1W32A 2C79A 3EDKA 3W7IA 5F4XA 5FF2A 1J11A 3GXTA 5GJMA 3NOYA 5I07A 4MG4A 1J8VA 3WH7A 3ID7A 3HTWA 4S39A 4PMNA 5DLFA 4XWUA 5KFLA 1ZP3A 2PDMA 2UY2A 4NT0A 4KCWA 1DKWA 3IIOA 3GTHA 1KR0A 3R4IA 5I3GA 1GVIA 6REQA 1G6CA 3H2NA 4IG2A 4GNJA 1D9EA 1VFOA 1W3TA 1K6AA 4NZ5A 2X7VA 2I9EA 1YX1A 4HMEA 3TW7A 4Z2HA 3DHUA 4XO7A 1FOBA 4QWCA 4WKHA 2WHMA 1OEPA 3DG7A 3DHDA 1ELSA 4YVPA 1RCXB 3URBA 3UBPC 4AHPA 4DZIA 4NF7A 1GTHA 4JDBA 3AMLA 4QSFA 4JTDA 3KRBA 4J9SA 4RNOA 1DWJM 3W1UA 1TJPA 4UNLA 2R1KA 5JUVA 4ZQPA 2VEIA 2NQJA 3M46A 5AZ1A 2A3HA 4AZHA 3W7HA 3LERA 5J5DA 1QBBA 3IIXA 4DEZA 3ISIX 2CLMA 4V15A 3QHMA 1D8CA 2W6RA 2Y5JA 3BVJA 2OWXA 2W62A 4XTIA 1ISWA 4YWIA 2UVWA 2TAAA 1Q6DA 1MNZA 5DMNA 2GVGA 2R8WA 3IGUA 2XHYA 1LRQA 3VMNA 1ZCCA 3EA2A 5D8ZA 4Z17A 2W4XA 1WZAA 4BA0A 3MI3A 4MPKA 1KXHA 3OU8A 3P80A 2BB0A 4IPIA 4WR3A 4EYIB 2VVNA 3JZEA 1VR6A 4P5UA 3TQKA 3WD1A 1YDYA 5CZKA 3BLFA 2VEKA 4RNNA 3NOEA 4R9OA 2WB5A 5AHMA 3WL1A 5FF4A 4ZO7A 2ZXDA 3GDTA 3LRLA 2EPOA 4HNNA 3W2UA 1E1FA 4WX2A 2ALRA 3FAWA 2AKMA 5LIXX 1RP8A 2ZRWA 4QWEA 1MQPA 4K38A 5CSYA 2XVNA 5G1MA 2EXOA 5A2BA 4HZ6A 1G94A 4DUXA 1KQZA 1QPOA 2F6UA 1AW5A 1B54A 1AZ2A 2O7QA 3LENA 4KEZA 3AJXA 3LU2A 1VC4A 3W83A 3SR7A 5AC5A 1QATA 3ABRA 5KEZA 5BRPA 1XFCA 3K4DA 2FZ9A 4LBSA 4ED3A 1XRFA 4JS3A 3CUFA 3W1LA 3OHMB 4N9CA 1XS2A 3BANA 2PBOA 3KM8A 4AEEA 1US3A 4HBKA 5CAHA 5HNNA 4A2RA 2QPSA 4YU1A 4FR6A 4Q8WA 3ANUA 3DDMA 4GKTA 2HVMA 4K39A 4UMCA 2WSPA 5TBOA 4DXXA 3F2DA 2QCDA 4KRZA 3PJXA 4JNYA 4A8LA 1EO7A 3GR8A 2NXIA 4IPPA 3GR7A 1EPXA 5EPDA 4PE8A 3S2NA 1H60A 2JEPA 3GW3A 1PB0A 1VBUA 1V3MA 4O17A 1B4KA 1A3XA 1U33A 4UOJA 2X1IA 1T99A 4GZ7A 2W9BA 1HJXA 3VMPA 4DJDC 3C56A 5C8BB 1BXNA 4CEUC 3N2BA 3M5YA 1XLJA 2XIJA 3RJXA 2Y4SA 4MB1A 3BH4A 4OVXA 5CZJA 5K4XA 5CPTA 5CPMA 4CNSA 3SFKA 1CLVA 1AFSA 1VYPX 1O95A 3FW6A 4DEFA 4WSJA 3TA6A 2D2HA 4E8CA 4P7RA 2ZWYA 1UR8A 2ACUA 2WCSA 1QWGA 1GVFA 1B90A 1IR2A 1TVLA 4S1FA 2FZNA 4CCDA 2DSZA 2LLEA 4NSBA 1L6YA 3CAKA 1AD4A 1HL2A 2NLIA 3CXOA 2Z6IA 3CUZA 2QDHA 1VPYA 2B81A 4HP5A 2Y8UA 3ZFHA 2WCGA 8CGTA 1EHNA 2EJ1A 1AQHA 3RLGA 3B4YA 3GIYA 3H7RA 3UY8A 1C8XA 3APTA 3OHIA 3AZRA 1OGGA 3A47A 1SO6A 3BLKA 2HTMA 2ZVRA 2VC6A 4OV9A 3UJRA 1QPRA 4G5DA 4IMFA 4GJ1A 3DN5A 2CKSA 3MUCA 4WJXA 2V2CA 1RCOB 5MHBA 3WEMA 4F2UA 2EKCA 4FS1A 4KETA 1V6XA 2IMWP 3WH5A 1T96A 4RK8A 1ISXA 3M0XA 2WCAA 1CGXA 3ZXWA 3CQJA 3CMGA 1TTIA 5I3FA 3LGGA 1JG9A 3SECA 3WF0A 2Z7KA 4WJEA 2WPBA 5FEZA 4H8HA 5LA1A 2BQ3A 1K7XA 2QR6A 5KZEA 1PE1A 2GQAA 4JEJA 1E9ZB 3VKBA 4Q4KA 3HO8A 1E4LA 1EL3A 1OCJA 3LQGA 1Q6LA 2CLHA 1UYQA 2D20A 4F50A 3BOFA 4UTWC 1BTMA 1NQ6A 4M0XA 1RHCA 4R88A 2GVEA 3UWEA 1EF2A 3AIQA 1TJ0A 1CDGA 1KWGA 4UTUA 2VM8A 3H24A 1BQCA 2ZQ0A 4DNHA 1AUSL 4US5D 4DQWA 3V6HA 3VZZA 1R2TA 3BG3A 3QPZA 3ZO9A 1H2JA 2C3ZA 1FY6A 3RGTA 3S5OA 4W7UA 5LGZA 4ADTA 2D23A 3VYLA 4DO4A 3P93A 3Q8SB 2BQRA 3TE9A 4Z2JA 3S5SA 3C2YA 3BJSA 1UUOA 5MF5A 3IJDA 1VCFA 2RGLA 2AMGA 2J7DA 3K5XA 1JZ6A 3GLCA 4Q4RA 5L6UA 1JXJA 1W2VA 3ABZA 3BSGA 4GYPA 3LCXA 2PDIA 3CPRA 4GVGA 5A8NA 2R8IA 3A12A 2VEMA 4HPGA 5FD0A 3DEQA 1UR2A 3CB3A 3FYYA 7ODCA 2YOCA 1XLAA 1XIJA 3A5FA 1RBOB 2QCEA 3GIMA 4LAZA 2PI6A 1XX1A 3AICA 1GYLA 5KFGA 1H41A 2R8KA 4MNJA 3R0UA 3CHCA 4B3ZA 5C2GA 5D09A 1IXOA 5G1TA 1B3OA 1GZ1A 4INFA 1M7JA 4R7OA 1XIBA 5DANA 1ITQA 4D1IA 4YR2A 2DZUA 3BMWA 5I78A 2CXGA 4LT9A 5CGQA 1YPFA 2OG9A 3UCQA 3M9OB 1M7XA 1QI3A 3IUDA 1BXCA 4TO8A 2V5KA 3T44A 3H4DA 2O0TA 2VC7A 3TYAA 2VX6A 4B5NA 3LM3A 1CB2A 2WKGA 2RDTA 4OZOA 3OPSA 1XD1A 3V4BA 2KAUC 3U2CA 1XYCA 4MGGA 3ANVA 1MYRA 1E15A 3GDKA 3N14A 1HFBA 4E2BA 1D7FA 1KBKA 2WMFA 5DGBA 2PZNA 1C8QA 1ICSA 1R86A 2IQTA 2VDIA 1J4EA 1ZB5A 3R25A 5J04A 3BURA 2OGJA 2DZSA 3I4KA 3CV1A 1TPFA 1K1SA 3QF0A 1K77A 1YBQB 3UG4A 7CGTA 4S3CA 5KFMA 1UOZA 3LRKA 1FP9A 2VWSA 2OKOA 2RHGA 2W7OA 5GNYA 4ZE5A 1U1UA 3WJZA 4ED6A 3NSNA 1ZCOA 1AJ2A 4GFIA 4JL1A 3BICA 3GXMA 4CU8A 3WQGA 2YR1A 2ZXAA 2BDQA 2YW3A 4C1NA 2V3GA 2X7WA 2G3NA 4M7TA 3SCRA 5KFUA 4UTFA 1SSDA 4U28A 3VD4A 3FEQA 1W1PA 1SU5A 3FDKA 2GL5A 2GJNA 1SJBA 4OUEA 4Z0JA 5I3JA 4QW9A 3TJ4A 3B8IA 5K2ZA 1V0NA 1WX0A 1WDRA 2YZRA 1NOUA 5BROA 4O12A 1ML1A 2Y0FA 5T26A 4GC3A 1Q6OA 2ISSA 3R6IA 2ZUVA 3CUIA 4QISA 4CVUA 4ATDA 2VR2A 3N4FA 3IWPA 3ZVIA 3GZAA 3PK7A 4LEFA 3TYCA 5A3HA 3RJYA 4JKKA 4WRHA 4UTIA 2ODOA 4DL3A 3H22A 1T7LA 1FHVA 4ZQNA 1FCQA 3QJAA 5D04C 1F73A 1TWZA 1WZLA 1I1WA 3BE7A 3GQCA 2WMHA 3UWQA 3GZ3A 4Q7IA 3VKJA 3MHGA 4I8DA 2R8HA 3GV7B 2QJJA 2ZZ5A 1TMLA 1SO3A 2BGSA 1YNQA 4XAGA 3LNPA 3VXGA 4LW7A 4M81A 4BS0A 5IOBA 1JUEA 5G4WA 3TROA 1SVDA 3EDEA 1W9PA 3R94A 3EGJA 5IHRA 3NURA 1UA7A 2FLLA 3UWYA 5H8PA 2E5CA 2ABAA 5LSMA 1W3NA 3P60A 3NQVA 3W71A 1REQA 3DU0A 3ZJ8A 1OG6A 1IIGA 1OYCA 3VKAA 3DGRA 2GGHA 2HK1A 2H9AB 2V9WA 1MFVA 4AZIA 4Z2KA 3DHPA 1XP3A 1NF0A 3GFXA 4C6EA 4JTQA 4TQRA 3MVIA 1ADOA 1F5ZA 1G4SA 3RHGA 3BCJA 2QUMA 4DPPA 3RB3A 2W66A 2MUCA 3NVTA 5K3VA 2OB3A 3GTIA 1E6QM 2ZE0A 1MEWA 4PRTA 3B8DA 4ZE4A 3PW2A 4FLSA 2JQXA 1EWDA 2QZRA 4GJIA 4I90A 4B3KA 3HMJG 2G3FA 2Y7DA 4R8UA 3VI2A 5KFOA 3GIQA 3R12A 4PCFA 3SBFA 4OT7A 1V3KA 4MZ1A 2GOUA 3A4AA 1KRAC 4ZO8A 2RDXA 1QU4A 4JEQA 1HTIA 1I1XA 4JFTA 2GYIA 3G1SA 2HXUA 5CPSA 3FSUA 4L1GA 3NQ6A 3OA3A 5EMLA 1DWAM 4ZA0A 5IBXA 4L1XA 3PANA 2QAPA 1W8SA 3VIMA 2NX9A 3SCSA 1BWLA 4UIOA 1QO5A 4XBJA 4A29A 4ROQA 1BRLB 3OYXA 5ABGA 1I45A 4ATWA 1TTJA 3MV01 2UVUA 3TTSA 3BARA 3RNDA 1FHUA 3LQLA 5DQGA 1FWNA 3N3TA 1DTNA 4GABA 3SEPA 4Y96A 3QLDA 4H7CA 3JUGA 1V3IA 1E9YB 4JY8A 1Z44A 1XBVA 3FX4A 3MZNA 4ECWA 3VNZA 3CJPA 2POZA 2GJRA 2WHJA 4RZBA 5D9PA 4IF2A 4ICNA 4UNIA 1UKTA 5KG5A 5D33A 5D9OA 4XZLX 3AHZA 2J6XA 2J74A 3FGCA 3R0DA 3EDJA 2V81A 4O1AA 3WQ8A 2DJLA 1F8MA 4M24A 1DWGM 4FAMA 2AQWA 5HR7A 4NAEA 1QT1A 4JNMA 2VZTA 2JEIA 1FP8A 3A5VA 1F8IA 4S2CA 1DXFA 4DWSB 3B04A 4EPKA 1PHQA 4Y8FA 3TIMA 3ZJ6A 3PUOA 5CSUA 2QCGA 1UBPC 5LZLA 5U7SA 1UD4A 2W7PA 1TMQA 3H23A 4O1DA 1B31A 1I4NA 5FIPA 2OO6A 5C0QA 3CTLA 4JTHA 4DBEA 4H9XA 1K9FA 2BHYA 3W85A 2PWUA 4TR9A 4GK8A 1JNDA 3GIJA 3UERA 1Z48A 3IIPA 3TKFA 1OCBA 1PBGA 1E0UA 1OGBA 4QITA 3FNDA 1GJUA 4B5SA 3U8GA 1MXSA 3NL5A 4R9XA 3E02A 2FFIA 3N1AA 1W9XA 1XLDA 2Q6ZA 3T0AA 5D30A 1ME7A 3OJGA 4PL2A 5A6BA 1ZBCA 1K8CA 4GISA 4J9JA 1L6GA 1E9IA 4XZ9A 4N02A 3HG4A 2I17A 2G4JA 3RLVA 3VGDA 1EF3A 1A3HA 3G24A 4YR3A 3M0YA 5DQPA 2YA2A 2WPGA 4HQVA 1B5TA 2YL5A 3NEVA 2PGWA 2PZ0A 4ZQOA 2JIWA 5T91A 4GWEA 4UQDA 4Z08A 2ZXBA 1EFZA 1EPVA 3SCPA 4ZSUA 3S5ZA 4TVDA 3M9YA 2EG7A 5FOOA 4AX6A 3G6YA 2X30A 1Q65A 2QLYA 5I0DA 1FDJA 3GFZA 1HJQA 1OB0A 2Z4GA 2Y88A 1LLOA 5KINA 3IJ7A 5D03A 2CC0A 3MDUA 1XIMA 3GVRA 2IPWA 1OQFA 3OZPA 3SI9A 4GKLA 5FACA 3QOKA 3BGJA 3II1A 3GK0A 3HGRA 2E6AA 2BY2A 3HQ1A 3G6MA 4DAIA 1DWFM 2NV2A 1OVDA 4AB4A 4L9ZA 5G4EA 2IKJA 1MUWA 1EBGA 3AQUA 1SJAA 1LUCB 1TV7A 2PB1A 4UR9A 4HCHA 4Q8MA 1XJBA 1B3VA 2EPKX 2V0TA 2DUXA 4I9TA 5C71A 4S3JA 4TV5A 5JH2A 2VENA 4MUPA 3MO4A 2GWGA 3M44A 1PV8A 1AH4A 2ZC8A 1DL3A 1G7UA 4GVHA 1RK6A 3T7VA 1DJYA 4JCLA 1TTQA 1NEYA 4IM4A 4NZCA 4GE8A 4Y6GA 3SY8A 4XZNX 5KFFA 3TR9A 1XYZA 1MW3A 4M8UA 5DMLA 5DRCA 2EJAA 1MDRA 2TSYA 4IMCA 2VFHA 2POTA 3VILA 1PUDA 3L0KA 1A5OC 3QMRA 3C3NA 1GHSA 4LB4A 1JYXA 1YNYA 3WQPA 4DYKA 4GOAA 5JIPA 3UZZA 4U6PA 3INPA 2Y2WA 3LHVA 3C61A 3P8IA 5I5RA 1KFLA 1CGTA 4NY2A 4HN4A 1I2PA 4M6PA 2OU4A 4UR7A 1VF8A 1PDZA 3OVQA 4RPPA 5LKYA 5BMWA 1IZJA 4IICA 4O15A 1ECEA 3UGVA 5AVHA 3OYZA 1JXLA 2WOQA 3NM1A 3LTSA 4JFVA 3ZVHA 2W8LA 4JYDA 2D69A 4KFOA 2A3BA 5KZ6A 3CZEA 1WP6A 2DIKA 3GC5A 5ENLA 4DB7A 1DJQA 1FDYA 1ITCA 4MYXA 4G7EB 4GZIA 3UR7A 3WELA 3PWAA 4DJFA 1GGOA 2ZUTA 1TWIA 3P81A 3M6DA 3DERA 2QCHA 5J8LA 3KOZA 1XCFA 2Z1WA 3HOJA 3WLJA 3TK7A 1RYSA 1IGSA 1M9HA 5E9AA 4LXFA 5DLCA 3Q65A 1TZZA 1H1NA 5L1KA 3TYBA 3S2JA 4HK5A 4PZVA 2XSXA 1CWYA 3L0NA 2Y70A 1ODUA 1RV8A 3KDOA 2AU0A 3LLDA 1BVNP 1UW9A 5GJPA 1LTDA 3TTEA 3OEXA 3GV8B 5D4YA 3N15A 3MPGA 3ABQA 3HFTA 3GRIA 6ALDA 4DNMA 5LHEA 1O66A 2HMCA 1EGZA 3QV7A 4MDOA 4Y9NA 1GK8A 1CGYA 1TPEA 1UUMA 1JRCA 2ZA1A 4RU9A 1P5BA 1UC4A 4JX4A 4LAMA 3RDKA 1L2UA 3PNZA 4XG1A 4B4FA 2I5GA 3CT2A 4V28A 1XBXA 2W67A 1UKPA 4E8GA 2ISFA 4F4RA 4LC6A 1WA3A 1NH6A 3CHFA 2IA6A 3FAXA 4LUIA 4M7SA 3N4AA 2C2EA 4FB7A 3W29A 4GBDA 4FXFA 4GY0A 3VGEA 4RV8A 4HHPA 1SO5A 1Z3NA 2O56A 9CGTA 1BKSA 2GJLA 1JR1A 2O9OA 1NY1A 3VINA 5HNTA 4H9ZA 3LRMA 2QV5A 2XZ9A 3F4VA 4H9MA 3UQNA 4OBSA 2NUYA 5C2XA 5I3IA 3OGRA 3GUWA 4CNUA 4NIRA 1I8JA 1I2NA 1W3KA 3E0FA 2QAFA 2A3AA 3TC3A 2O9PA 1ISZA 4E2VA 2Z1XA 4TMCA 3IJQA 4D8ZA 1VFSA 2OEMA 3AS3A 2C28A 4W7WA 4MYAA 4QLKA 3RBDA 3NTYA 4L9XA 1K9DA 3M7WA 3STCA 2XH2A 1EXPA 1XRSA 1V08A 4HU4A 4ZQMA 4UZUA 5E1QA 2CLOA 4OUIA 3H2FA 3RB0A 3VNIA 3BQ5A 2ASJA 3I6EA 1ZJHA 3HN3A 2JF6A 1UH4A 3BLDA 1HO4A 2GUUA 3RFAA 4AWEA 4ED1A 2QULA 5HJYA 1QFEA 1XH0A 2WSKA 3QM3A 3NNTA 1JPIA 2V82A 3XISA 5HULA 1LDCA 4KEUA 1U5HA 3V5CA 1SSGA 1HXJA 4F3HA 1DJIA 2FDSA 3VZYA 1GNXA 3B9AA 2VOTA 4A21A 2RDIA 1J0YA 3AIVA 1QVBA 2WC4A 4Q43A 1WO2A 1XRVA 3KBMA 2QDDA 2WVVB 3G1VA 5CC5A 5CBJA 3LZ3A 1UOKA 1A0EA 1XGZA 3VIGA 4GZEA 5D8WA 3U5YA 2WMIB 1PYMA 1A80A 1NF7A 1MRAA 2BG5A 3QPYA 2CHRA 5TAOA 3Q67A 2OR2A 2V5DA 2Y6ZA 5IXEA 1DPMA 1POJA 2WXDM 1Q6RA 2XVGA 1S0NA 2HQAA 5E93A 3M0KA 4WOQA 2YYTA 3UCCA 5CSRA 3SAZA 4ZFMA 4OU1A 5HNUA 4I7WA 3WUEA 1L2QA 2ZXQA 3QY7A 3XINA 5D2XA 4LCRA 3BW2A 3L4UA 4QWAA 3UYCA 1W9UA 2WLYA 5KFYA 5LNUA 3LI0A 3GG1A 3R2GA 4J9MA 1ODZA 2INEA 3WF2A 1QMLA 2WC7A 1MW2A 1LWHA 2HPIA 5FF7A 1EJTC 4HPXA 5EWGA 4P7QA 4FIRA 1G4TA 4YL2A 2E77A 2J9YA 1GVYA 2BTMA 2XGIA 3W81A 3GIKA 1AG1O 3BW3A 1GORA 3G77A 4UQEA 3PF3A 3SIMA 4ECLA 2C0HA 1NIUA 4W8AA 4WF7A 4PBGA 3I68A 3IJ8A 4AWSA 6XIMA 6A3HA 4IR9A 3B06A 4W93A 1M03A 3GV5B 3GM8A 2VGIA 4L4MA 5CPLA 2V5CA 5HA7A 6PTDA 4OGZA 3OSNA 5HUOA 4CQDA 2ZZ6A 4ENLA 1DYSA 5IDIA 1SMDA 4B3LA 5E70A 1UZHA 2BVYA 1E5JA 4RDZA 2ZRYA 3AMGA 1CGVA 2BODX 2E4TA 1JD7A 1YPIA 1KFBA 1BSIA 4X60A 2E0PA 3T42A 1XYBA 3G3MA 4QIUA 4JTGA 3U4AA 1BRLA 3RMEA 2Y8VA 4P7OA 3THDA 3BMXA 2REQB 1VFHA 3O1NA 5DFAA 1O12A 1H5VA 2ALDA 3NPWA 2GK1B 3OBEA 4PRWA 4GCXA 2PDKA 3TC6A 1BGGA 2XG9A 4H2HA 2J7EA 3TQVA 1T8QA 1TA3B 3E2VA 4W8LA 2OT0A 3EWXA 4WQ6A 1E9LA 5BOFA 1YPXA 5EFFA 4A6GA 2E40A 3VK5A 3BOLA 1QNOA 3AMKA 2PD5A 5C5JA 3PPCA 2CERA 4RE2A 2QS8A 2GJXB 3E96A 3ZLFA 1DTUA 1TV4A 1EC8A 1BWVA 3N2MA 1G67A 3SDOA 1KFCA 4ZO9A 1R7AA 4J2PA 4D6EA 2UZ9A 5L1IA 3PAOA 4TVCA 1HGWA 1DHPA 5CKSA 3QGVA 4OOZA 3FLUA 2PFHA 3JU2A 1CXLA 2AGOA 4M80A 1UP0A 1UH3A 3T2OA 4D6FA 3SCQA 1V6UA 3LBCA 1G4EA 4XAZA 2J8GA 4M1BA 2GWNA 1S0MA 1VKFA 3S1UA 3GTFA 3TYZA 3WN6A 4XSLA 5KFIA 3MVTA 3AU2A 1E0WA 4XIMA 3M0ZA 5KFXA 1PPIA 1R9XA 2OYMA 3VDHA 3LSBA 2WM0A 3SGZA 3EXRA 2YSWA 3R8GA 2FQIA 3W6LA 3WBEA 4DXKA 3TSMA 4RZRA 2OTDA 3S1WA 3VZXA 1O4UA 1BEUA 3DI1A 1G01A 4O8RA 1EJWC 1VFMA 5I3HA 4NI3A 1IWBA 4WZHA 3CUHA 1SMAA 4OTKA 4R53A 3ZZ1A 2PLKA 3N6HA 4B9ZA 4AC7C 5H6HA 3CH9A 2GDUA 2DZXA 2BVWA 3L4VA 1JCJA 1NWTA 1Q4NX 4AFYA 1V79A 2WNZA 1IR1A 1A0CA 2X1SA 3UZYA 4AISA 3QOMA 5DCEA 3SGUA 1HF6A 3QSRA 1FBAA 2TRSA 3TMLA 3LPPA 4QRNA 4DJDA 3U2EA 3LSCA 2OKTA 4B91A 2R1PA 3VOIA 1TTPA 1TIMA 3W7JA 1FCBA 1H51A 2A6LA 3VM5A 4GGHA 2FZMA 3PZPA 3HQNA 4NL1A 4Y8EA 4IXXA 3S2LA 3WFLA 1QNQA 3SSJA 1LUCA 2NQ9A 3BDKA 1EJXC 5EYWA 5A8QA 4OBTA 2ESCA 2DZVA 4ECUA 1BWKA 3PZMA 1UP2A 3RYSA 3TV8A 1W5OA 4L64A 3LEPA 3UF9A 5F2GA 1HP4A 3E2SA 1LYXA 2NVAA 4EXQA 5KG7A 3ARVA 2YXGA 3Q4DA 3DGBA 5FJOA 3GDRA 4Y2WA 1E71M 3MP4A 2P8CA 1P6WA 2X09A 5FJJA 1P1MA 1JQVA 2BNJA 2XPKA 1EP3A 1A5CA 2RAGA 4U7CA 4H9UA 3CEUA 3CHDA 4O13A 3KP1A 1M65A 4NRSA 2A7RA 3W7LA 1R3YA 5CJMA 4A35A 4IZGA 1IM4A 1UB3A 2GVJA 3UXLA 3WY1A 3TLQA 1G9HA 3UNTA 1HQTA 2PUZA 3QY8A 3HV9A 3HPZA 3U57A 3F2CA 2DVUA 4CN4A 2OX1A 2HDJA 1S39A 4ECSA 3PBVA 3SCUA 1PX8A 4MZYA 2FB3A 2I9UA 3POHA 4HNUA 1WV2A 3MMTA 3KRZA 2YKKA 3TSDA 3ARQA 4UTWA 2QCMA 4E3TA 3ZWTA 4BHYA 1PTDA 6TIMA 4WXZA 1HN1A 2PDJA 1D8WA 1Z7AA 3M41A 4Z2GA 4G7EA 4OOUA 4GGBA 4P8XA 4YHEA 4D71A 3MS8A 1R3RA 2Z1VA 4HPHA 4UOZA 1O6IA 3EWDA 1KKOA 3WMLA 3AXKA 4R3UA 3W88A 3BSHA 4FS9A 5KT3A 1N2VA 3B8UA 5KFSA 1ITXA 4MTVA 4JQAA 4AIOA 4QDPA 3SW6A 4F0SA 4LALA 1ZPTA 2D0GA 2Y7EA 2ZRUA 2ABBA 3B0UX 1Z69A 3WG6A 4AD4A 1V3HA 1KFJA 5I6SA 3DH7A 4JTLA 1FVPA 5DMMA 4J3WA 1LROA 2G4FA 4IFKB 1V51A 2FZBA 5DBTA 4B15A 1BVZA 4GI9A 1IQ8A 1AQFA 4N4PA 3TTOA 5KFZA 1P0NA 1XG3A 1CLXA 1FXPA 2EHHA 4FF5A 1JCNA 1WXJA 1PO9A 3RILA 1HVQA 4JTCA 1WPCA 2XN1A 4GRSA 3K8MA 2L5HA 4LH8A 5FEPA 4JN6A 5GVJA 2F9RA 4J9QA 4HYVA 1GT8A 3SCVA 3O3RA 4AZ7A 2UY3A 1CNVA 3BAIA 2CLIA 2YB1A 4JQ4A 3VTRA 1QUMA 2HISA 1RY0A 2CPUA 3BXWA 4C6FA 4K1WA 4Q8QA 4QS6A 3SUTA 3PR4A 2WBGA 4YHGA 1TSIA 1H63A 2Z00A 3VX1A 3WJWA 2PURA 4MWAC 1W1TA 4K7YA 1YE6A 2AGQA 1OK6A 2DSVA 4O10A 6TAAA 3GD6A 3QZ6A 1SYTA 2CKRA 3MT1A 4XD3A 3W1AA 1JFHA 3CQHA 5JBDA 3RAOA 1NOWA 3NGDA 4JTJA 2G3MA 1GONA 4BKNA 3TH6A 1FA2A 2J77A 1NDZA 3VD7A 2YCKX 5KFHA 1LT8A 2FKPA 1P7TB 4PBFA 3CYJA 1R6WA 5BMXA 3U9IA 2FH8A 3JW7A 2BY1A 2WSQA 5A6TC 4F0KA 4E6MA 1FWCC 4IMGA 3N34A 3EX6A 2DQWA 2X2YA 1ADSA 4MJ2A 4G3IA 2VHLA 3W74A 4B5UA 4QWDA 1HJWA 3HF3A 2JKEA 3B97A 2G50A 3CM4A 1MWOA 2QPXA 3JS3A 2ATSA 4LV9A 1A5NC 3SGGA 1O1ZA 1QWKA 5FEWA 5AKQA 5E0CA 2R6OA 3QGAC 2R9RA 3IARA 4YLWA 1W8GA 5KMYA 4OFCA 3PULA 4W85A 2NWRA 2NSXA 4Q32A 2I57A 3JVAA 2VEGA 3NPXA 2X05A 3S4TA 5IM51 2OWCA 1HW6A 3TQ1A 2G95A 3H2EA 2OJPA 4YCOA 4HN8A 4YWSA 3LI1A 3W1XA 3MANA 4C5ZA 1CEOA 3N19B 2WMIA 2BOEX 2G5WA 2BXZA 4HA0A 4N6FA 3PW7A 4PMXA 1LZOA 4EPBC 2J47A 4GD0A 3F5KA 2F7FA 1GYMA 3CV7A 4ZOEA 1UASA 5KT5A 3H12A 3EKLA 3UA4A 2EG8A 1GWJA 2NXGA 2CZ5A 3M0VA 1VBRA 2JEJA 2CEQA 1BPLB 1S46A 3QZ8A 1OFDA 1PX4A 2YA1A 5K9CA 4DL4A 3T2PA 5F4WA 1X8FA 4UQ9A 2I1OA 4GPNA 3KRSA 2V30A 4NJGA 7TAAA 2XFRA 4GQ0A 3WX7A 2ASHA 1MZRA 2XFYA 4LQ1A 4NX5A 4U31A 3AS2A 1V6TA 1XXXA 3W23A 3BGGA 1H49A 3XIMA 2EBNA 4Q8NA 3WUBA 2PGRA 3UYIA 4H2CA 1EQPA 3QTPA 3CC1A 4EIVA 2X0HA 3AXMA 2Z25A 1FTXA 1N82A 3GYEA 1UR1A 1U1HA 3QFWA 1ONEA 3WLLA 1JZ3A 1UMLA 1IT0A 3KHGA 2O4QA 3OVGA 1G7VA 3GNPA 1U1JA 3PWIA 1QTWA 4WY0F 4L5ZA 1Q7ZA 3S8HA 4U33A 3K8LA 2A21A 5IFTA 1HT6A 1KC7A 5DG7A 3KZSA 4GIRA 3L5MA 3I3BA 1F07A 4UTJA 3GNOA 3LV5A 2AGTA 2CFFA 3SRKA 4AD2A 2OLAA 1LBFA 3E5BA 3OG2A 5LNSA 1F3XA 1RA5A 4LFYA 1U83A 4DO7A 2A3EA 1OHLA 1OCQA 2E9MA 3GXNA 1VD6A 3GFYA 4O3RA 3MKVA 1W31A 4XAYA 4GC6A 2ZX8A 4DPQA 1MW0A 4TX9A 4Z1YA 4HHMA 4P2VA 3WQOA 1JCMP 1J0HA 1X6UA 2JF7A 4M19A 5DGAA 4L9YA 4XZHA 4IX0A 1E0XA 2QUVA 1TZ7A 1PCKA 1EZWA 3LTPA 4FF7A 3UA3A 1Q2SA 1ZFJA 3MHUA 1MSSA 5C9UA 1UD3A 4K3ZA 2Y62A 5H91A 1B3YA 2FGBA 2REQA 3EDDA 5HMFA 2WHKA 3GDLA 3U4FA 2GK1A 2BBFA 4AIEA 4IJCA 5I23A 1E73M 1ZQ5A 3V6KA 3KBJA 3IPWA 2OOGA 1ZAJA 3S5YA 3BJYA 1TA3A 3GNDA 3KBWA 3KHJA 4WIWA 2YW4A 1KM2A 3DBNA 1K9EA 2W92A 1N8FA 2E6DA 3CZKA 1FKWA 4AEOA 4AG0A 2DZAA 1OFEA 1LP6A 3UJEA 2PP0A 4J28A 4S3BA 2J8FA 2YCEA 1QCWA 1EIXA 1FWGC 1Q8JA 1CI1A 4KCUA 2GJXA 2J25A 1EP1A 5FEXA 3HMCA 4LPCA 5EFDA 3LHYA 2YB4A 2BR0A 3PUDA 4TU1A 2A6NA 1KNWA 1Q6CA 1IXPA 3P5YA 3GVVA 3EXSA 1UMYA 1RPXA 3T9PA 4PMJA 3QC3A 4GI8A 5HUPA 2WK2A 1NOFA 1E1CB 1VFUA 1GG1A 1GOQA 1PXGA 1E6RA 4DYEA 3MR3A 3UJ2A 1ECQA 3S9YA 3VD9A 5KFAA 2VD9A 2V4QA 2YZ5A 2VGBA 1IGWA 4H83A 3HZ3A 3SIZA 2PDUA 5KFKA 5CBBA 3V1PA 5LA2A 3CHEA 1MFUA 3AYTA 3CMFA 4IH3A 3UVIA 3KEHA 1DQUA 1NTHA 3V0UA 4PUEA 1GHRA 3PBGA 3MCMA 2PDHA 3S0CA 3QR3A 4W5ZA 2VX4A 3QPEA 4R33A 2WZIA 3LDVA 2NWSA 3V18A 4V1XA 4JV2A 1GW9A 3RCMA 1SJCA 4O0QA 4QJ5B 4IIFA 4LTSA 3W7PA 2HK0A 4I5UA 1YHTA 3CWNA 2F84A 4HNLA 3IGSA 4QCFA 2FLNA 1M68A 2YDQA 4K8GA 3NDZA 3D6NA 1DXIA 3N2XA 4H1ZA 4RNMA 1DQXA 1UWUA 4DUWA 4MB4A 4MLRA 1WAUA 4UFMA 4BZYA 4YTRA 2Y89A 1S5VA 3WNMA 4ZOCA 4ORIA 3MUZ1 5CG0A 4C1KA 2WJFA 3B3DA 4RXGA 1AL8A 5AHLA 2XVPA 2QDGA 2P3EA 1GOKA 5A95A 2YLLA 1W3LA 1QI5A 3WJXA 2AQ4A 3U48A 2VCBA 1UD5A 4IQLA 4CD6A 1VLIA 4NJIA 1LOSA 4CNNA 4EAYA 3M07A 2ZIDA 1R0MA 3QQ1A 1HL8A 1Q5MA 3KTXA 5HAOA 5M03A 2PE4A 2D2GA 1KB3A 4DLFA 1Q6EA 4O50A 1Z41A 3CZGA 1PWMA 3T5JA 4A3RA 3QEZA 2EPMX 3PN8A 3T4WA 1ZS2A 1UCWA 4C6CA 4HOXA 2A7NA 2DPIA 4IIBA 3O16A 4C6PA 1KBBA 1PKNA 1SW0A 3WK3A 1TE6A 1PIGA 4F0HA 1DHKA 1IF2A 3LCFA 2WMJA 4D6DA 1OYAA 1UG6A 2CXEA 3OB8A 4C6BA 3R10A 2WV8A 3PP7A 3N6QA 1Z42A 4ZO6A 3DUGA 4EXAA 5U4NA 3BWWA 4WHBA 1GCYA 2D73A 4UR8A 2G0WA 4Q3MA 1TWWA 3MP5A 3GTXA 2VFDA 5BU6A 4DF2A 4OE7A 3MSDA 4J4KA 1T5AA 3QHNA 2PP3A 4Z2IA 1H3GA 3MJYA 2Y8KA 3TNBA 3T2QA 3ARRA 3KTSA 5EBAA 2XYLA 4GH3A 3NSMA 2R24A 1YQ2A 3VA8A 4XO6A 3W27A 4EX4A 5C6MA 3P0WA 2JGQA 1ZZMA 1A4MA 4QAWA 2BZNA 4MVAA 4TUFA 3CUGA 3QSTA 3R5EA 4Q4MA 3R7MA 5KG1A 2G3JA 1BYDA 3FYPA 3ZIZA 4NP7A 1Q13A 2W9BB 4PB4A 2CHOA 2OVLA 4MSSA 1GPFA 2C8NA 3IRDA 1LCOA 4KCVA 2ZBTA 3I7QA 2Q8XA 4AZ6A 3B9NA 2XCPA 3TOYA 5I02A 1J5TA 5HJLA 4DL6A 1X98A 2HWGA 4DN1A 4HMDA 3UG8A 4KWWA 4AIUA 3MBFA 6CGTA 2C16A 3QZ7A 4K8HA 3S9IA 3W2NA 4FZIA 4UCFA 1K70A 5FI8A 1IEVA 2W91A 2PDYA 4J3SA 4F2BA 4O28A 3KS6A 4ZSTA 1QXLA 3A9IA 2CBVA 5CC3A 4DLMA 1ONWA 4XQ6A 1EC7A 5C7VA 2XDFA 4JIIX 3UESA 1R7OA 4U3AA 1OINA 1HKIA 2Q01A 3SY5A 5DBUA 2AOSA 3HB9A 4XZWA 2E28A 3WDQA 3R8RA 3NL6A 4UFHA 5DMYA 1R9YA 4BEQA 1CZ1A 3O07A 3EB3A 4J3XA 4IRDA 2FVMA 1CXHA 1S2UA 3F5LA 2W5FA 3CQIA 5DXYA 4X0NA 3VC5A 1M5WA 1XQLA 4Q8TA 4GUHA 1KWKA 3FDSA 3A3XA 1WKDA 4PUNA 4JIEA 2WBKA 4H6EA 1RLDA 4WOZA 5DY3A 2NSOA 4LS0A 3VABA 3EOLA 3HG3A 3PUEA 4JX5A 2FYMA 2YJQA 1Q85A 4EWND 1QW7A 1TFVA 2X2GA 1YE4A 3ZS4A 4YYFA 3S46A 1PHWA 3C0QA 4TOQA 1XLKA 4F4ZA 4ZTYA 2YXOA 4GYJA 4WJ8A 4I9JA 3DCPA 2ZUSA 2XFWA 1RK5A 3C86A 3MYPA 5AYXA 5AC7A 1X7IA 2CU0A 1VCGA 4H00A 4JTTA 3W53A 4MWAB 3LX9A 1HO1A 3V16A 3NQFA 4EYHB 1R3QA 3RX4A 3C8FA 4WDWA 3VDAA 4MY8A 4GIYA 3CYVA 2QJGA 1G69A 4Q8OA 4QR6A 1GJPA 3MO7A 1R2RA 1G1YA 1UROA 4IOTA 2VRKA 1Z6KA 4ECQA 2Q3OA 2E68A 3ITTA 1UKSA 2YDRA 1LBLA 3FVDA 1NU5A 1OYBA 4MLJA 1KFEA 3OTRA 1WZKA 3SUWA 1B1YA 3G2GA 2QQ6A 2BQUA 1EZ2A 3T8LA 1D3HA 2NQHA 4FX8A 3UG5A 4JTUA 2ZUNA 5J5RA 2XGPA 3DBPA 5CPQA 5F1UA 3VC6A 4C65A 4XZIA 3MC5A 1AMYA 3W2LA 3H53A 3R13A 4BWLC 1TR9A 1HVXA 2H90A 1PKLA 1QPQA 3CNYA 3LTYA 4JQ1A 1QOPA 4DL2A 1GZJA 2P53A 1JZ8A 3LUTA 2Z1SA 1VENA 1A50A 1EA0A 2VZUA 1QOQA 4QROA 3B40A 1DJXA 3VOGA 1C7TA 5HQEA 4D6GA 2ZZ3A 3EXTA 5HMDA 1WDSA 4O18A 2RDUA 4AYSA 3KHRA 4R34A 4X63A 4YQWA 3GY1A 1MW1A 3VCNA 2E9BA 4HNTA 1ZSXA 3DKJA 4BQ5A 4M6UA 1PIIA 1JF6A 5CCZA 1BF2A 4C60A 4FLOA 2V67A 2X0SA 1Q6GA 1X1ZA 4AXNA 2FGLA 2V2DA 1B57A 1D3CA 4AVOA 1A5AA 5JBFA 2VP8A 4AW7A 5E0FA 1SR0A 4PMVA 3CU2A 4QS5A 5F4SA 3RB6A 2IXVA 5EBUA 4FNTA 1GQJA 1OJXA 3E0WA 3T5KA 1IEXA 5MKGA 2ACSA 1RQBA 2V5LA 3PG8A 4OECA 2FTWA 3H2CA 1ESWA 3GHRA 3WLTA 3GDMA 1XI3A 3W02A 4GCAA 2AQVA 3BAJA 3CO8A 1U30A 1EDTA 5KFRA 3STPA 4ADUA 4WGXA 4EWJA 2FTPA 1W5QA 2VQUA 4GQBA 1AL7A 1TCMA 3STEA 2D0FA 5HXMA 3EKZA 4ERGA 3DFYA 5E0KA 4IQEA 4L4PA 4HCLA 2GPTA 2PCQA 1ISYA 3UG3A 4A3HA 8XIAA 4X2PA 2NZLA 2PTWA 2ZA2A 1OK4A 4C91A 2D3NA 3LY0A 4PB3A 1JDCA 2HZGA 4JTAA 4HNCA 4WLCA 3HPAA 3LXBA 1XL9A 3ITYA 1A5MC 5ECVA 3F1QA 3VNJA 4CN1A 3RPTA 2PDCA 2VR5A 4XBKA 3PC0A 3KS5A 1JZ2A 3MA8A 1IEQA 2CBIA 3GVGA 4NZJA 5FAGA 3QY6A 4LSBA 3ZR4A 4A4AA 2QVHA 2PDGA 4D6HA 4KERA 4KCTA 4NYUA 4Q8PA 4B92A 1VEMA 2V5JA 2BY0A 2FJKA 4MPQA 1MUMA 5HR6A 3VNDA 1TPWA 2OMAA 1XIDA 3LCHA 2ZDSA 3W3OA 4W86A 1CXKA 2FMOA 3Q45A 1MVYA 3S2MA 3EPIA 3RLHA 1KGXA 3BZJA 4XKMA 4JGDA 4LWWA 3K1DA 3OLEA 1AVAA 4PUWA 5K7JA 1ICQA 3FV9A 4YXGA 4LYQA 3GAYA 3I3DA 1UJQA 2AAMA 4CGTA 3BQ2A 4KW2A 1F4HA 1NP2A 2DZBA 3Q37A 1E56A 3W2MA 1FKXA 4XVDA 4BK9A 4HIBA 1OADA 3G5EA 3L4WA 3BQ1A 1K1QA 1AD1A 1KW1A 1JAEA 3RRXA 2OEJA 1REQB 4O3QA 2INZA 3NDOA 3GBEA 3MSRA 3PZOA 2CW6A 1J79A 4O1BA 3EOEA 2J62A 3C0JA 4ED8A 5T8GA 2ZTJA 4P7NA 2CESA 2HXTA 3E6EA 2INFA 1JZ5A 2ZOXA 2IQDA 1YW1A 2CLEA 2RJGA 1DIOA 1CW2A 4LEQA 1O5KA 1E1CA 3EEGA 1AMKA 5CPOA 1YXCA 3TJXA 3G1DA 2CLLA 1QOXA 1PSCA 4I9MA 4WCJA 2DT2A 3HG2A 1T40A 2PD9A 3KXQA 3CS2A 4I5RA 2C1HA 3QBUA 4J7RA 4UMAA 1EBHA 1X1OA 3M0LA 1NQKA 1S10A 1H09A 3WK1A 3K46A 3MR5A 3NQEA 3U7VA 4I3GA 4TMBA 3LYEA 1ZBWA 3B9DA 3MP3A 1S2AA 5H8UA 5AHIA 2EPLX 1KCKA 5EWFA 3AZSA 4R8UB 1JDAA 2QJIA 3QRHA 3WBWA 5D9NA 4FX6M 4WXYA 4KEVA 1NJJA 3W01A 1TYGA 4CD5A 3VCCA 5GNZA 4AVFA 3ARTA 3LG3A 4L61A 3APGA 2OSYA 2WC3A 4PULA 3LZ5A 3VGGA 1IXNA 4MMWA 4XUYA 2P10A 3GW0A 1JI1A 2QGHA 1OX5A 2GDQA 3N18A 5JVLA 2PAJA 4CD4A 5JQ9A 1JF5A 3VOJA 4KPLA 3WLRA 3FOKA 4N7QA 1FWTA 2JGYA 2TYSA 3ORWA 1ZJIA 2WANA 1YDOA 1C9WA 1TG7A 1KV8A 1B9ZA 3M5ZA 4JKMA 1F6PA 7REQA 4UFKA 3AC0A 1XYMA 1X8CA 1PZ3A 2ICSA 4QXIA 2FZDA 2PMQA 1ZBKA 4A8RA 2NUXA 4JUZA 3T05A 4KIRA 3GG8A 1L8NA 3FJ4A 2DSUA 3LCIA 5K9XA 4YN5A 1SJDA 3BCFA 4YJ5A 4E5TA 4BF9A 1H11A 4FNQA 3FGCB 2PWHA 1MRQA 2ZRXA 2DY3A 1Y8BA 2Y5SA 3DI0A 3NDYA 4POCA 2P9BA 1KTCA 2OODA 2PWEA 4K36A 1WQ5A 4ACYA 4NAEB 3L65A 3VD5A 3S9ZA 4LC8A 4DUVA 4YVVA 1JUBA 4EPEC 1E51A 4QCEA 1CLKA 2W9CB 3T8QA 1XLHA 2PTXA 4UTTC 4R7WA 4XZMX 6ENLA 1F4AA 3N04A 4QTGA 3WCZA 1RY8A 3BAXA 3CAQA 3L5LA 1RBAA 2B31A 4MWAE 3MDWA 4FO4A 1PTGA 4JFUA 4JOMA 1UQZA 4LUTA 5LXXA 2IPFA 1WKFA 1I2OA 2JFEX 2C22A 3FDGA 5DX7A 2ZDRA 3VMOA 5EA9A 1O1HA 3H4BA 1E0VA 4YTTA 4FOJA 1HKKA 4DL5A 3L5AA 4WVXA 1H62A 4ONVA 2E1DA 3BC9A 3VNKA 1BVWA 1XICA 3NZQA 4XSMA 3APYA 1NDVA 2YCIX 1E1EA 4U2ZA 4YS1A 3TJLA 4XVEA 1JDFA 1KLZA 1DVJA 2O9RA 3TQ0A 3LCLA 4MDPA 2CNCA 3H2AA 4JY9A 1UWTA 3NVDA 3EOUA 1D3GA 1EX1A 2ZRVA 2OXNA 3LGEA 2TODA 1LL4A 4O52A 1C7SA 4JXCA 3CGTA 3GB6A 4DX3A 2OLSA 2ZWZA 3VNYA 3ZYZA 1K1DA 4KS0A 4W8BA 4OIFA 3W4RA 4QX4A 1SW7A 3RCNA 2PF8A 3AMCA 2VNCA 4K8EA 5D38A 3KCOA 4HZ8A 4YTQA 5LIUX 1KFKA 1DQWA 2DU2A 5I2UA 2XGQA 4RX0A 3DXIA 1BGAA 3ERPA 5EL1A 1H50A 3VKKA 3WEZA 4JNZA 4A8NA 3AXHA 5KFCA 2OZ3A 2ZYFA 3TX9A 3FS2A 3F4WA 4S3AA 4DJEC 3LPOA 3LHWA 1RBLA 3AHVA 4NNAA 4DF0A 1M7PA 1FX6A 1R38A 1GVOA 2J78A 1KCLA 2VYOA 2GLKA 4CCZA 4HTYA 2B7NA 1W5NA 1JYVA 2B7OA 1VZWA 2QUTA 1WUEA 4MNMA 1J6PA 5CXPA 4DWDA 1OF6A 2ZFAA 3NPUA 3WLKX 2R1NA 2XGBA 2WNQA 2UY5A 4WSHA 4EBEA 2DUAA 2Z29A 1EJSC 3TFXA 4W87A 2E5DA 4GACA 3R43A 1EIBA 1XYAA 4ECTA 4L7ZA 4LYKA 2C7FA 1U5JA 4AAJA 5IFPA 2VI0A 5A6MA 5PTDA 3W07A 1FCVA 4MWAA 2NLYA 5D2WA 3WQ6A 4ZFCA 5CC7A 1Y5XA 5CEWA 4GIAA 3ZVHB 5CGTA 1ZBVA 4H4IA 1NDYA 3FXYA 3WMSA 1TE1A 2BS9A 4NNBA 2Q8ZA 3I7RA 3UJSA 1AK5A 2NT0A 3G1HA 4HYKA 4D6CA 1N48A 3PTDA 4GA8A 1GOIA 5GJNA 1BF6A 3EWWA 3M47A 5D02A 1F74A 4S23A 1V93A 3E0VA 3DOPA 3SURA 3TZFA 2AL2A 3RX2A 4O0ZA 4DZHA 1SO4A 1SPQA 1A5LC 3K1GA 3LPGA 3GUGA 5A6KA 1VCVA 2FB2A 1UPMB 4IGHA 1W5PA 3M4HA 4LNYA 3BTNA 1YDNA 1SUXA 3S5NA 5LIKX 1D7KA 4UFJA 3W73A 1ZAHA 1OX4A 3DFNA 7XIMA 3HPXA 3THQA 2JBMA 1OBAA 2V3FA 3C8NA 5F1VA 4HA1A 3DAQA 3NR0A 2XN2A 3NA8A 8TIMA 1K8XA 2WZHA 3A3WA 3H40A 4FK9A 2DUZA 3T0DA 2XN0A 5DCBA 1UWQA 3F4CA 3PR2A 2C18A 3VKDA 2WLZA 1JYWA 3W7EA 4HA4A 3U3HA 4FLQA 4RNJA 4J2MA 3DFTA 3G0SA 4UTHA 2PDFA 2IKIA 4IIEA 2QVNA 2GFTA 4ZODA 3S42A 5E5CA 1UWSA 1XCXA 2OYKA 3WBXA 1FCUA 2OQHA 4JHZA 1TCDA 4YMZA 5EGRA 1S38A 2QCCA 4GXWA 1GKPA 4GJJA 2VXNA 2B4GA 2PRLA 5G2IA 3AIBA 4NHVA 4R7JA 3E1F1 2UV8G 4RUAA 1JQXA 4RW3A 3KLKA 2IMRA 3D5HA 1FWIC 1MZHA 2HSAA 2X0YA 1V7YA 1NP0A 5ABFA 1XUZA 1IZCA 2AAAA 1OF8A 2E7FA 4PCPA 4EF8A 4HOZA 2GQ9A 2QT3A 1HZYA 2DGAA 1Q66A 2W27A 3G18A 5AYIA 3W7KA 1V0KA 4DAFA 1JPHA 2D2OA 4ALDA 2IBKA 1GQLA 3AU6A 5KT2A 3ARUA 4F4WA 3EA1A 2TPSA 2HROA 4IPJA 3ABSA 3FSTA 2GVYA 4GZJA 2A3CA 1Z89A 3HJEA 5C70A 3WQCA 2OQLA 4FNUA 1TPB1 4FR1A 4L1WA 3QZAA 2NV9A 2OCZA 1TPC1 2WHLA 3L23A 4Y9OA 3SY1A 2ZE3A 4GI4A 3AYRA 4OWGA 5CLWA 1VJZA 4L80A 4G9PA 4AYGA 1FH8A 1ZLPA 4IWWA 3CZJA 4QE4A 5A8PA 4LV4A 1CT5A 2J8TA 1TX2A 8RUCA 4TQSA 4CNTA 1FDZA 1R46A 2CLFA 4Y7EA 3Q8RB 1QNPA 4NZ3A 3RM4A 4PSRA 4X2RA 3T0TA 3QW4B 3WLSA 5AC6A 3CHVA 3AIWA 2MANA 3L4ZA 3UT0A 1AA1B