1P1MA

Structure of thermotoga maritima amidohydrolase tm0936 bound to ni and methionine
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
404
structure length
404
Chain Sequence
MIIGNCLILKDFSSEPFWGAVEIENGTIKRVLQGEVKVDLDLSGKLVMPALFNTHTHAPMTLLRGVAEDLSFEEWLFSKVLPIEDRLTEKMAYYGTILAQMEMARHGIAGFVDMYFHEEWIAKAVRDFGMRALLTRGLVDSNGDDGGRLEENLKLYNEWNGFEGRIFVGFGPHSPYLCSEEYLKRVFDTAKSLNAPVTIHLYETSKEEYDLEDILNIGLKEVKTIAAHCVHLPERYFGVLKDIPFFVSHNPASNLKLGNGIAPVQRMIEHGMKVTLGTDGAASNNSLNLFFEMRLASLLQKAQNPRNLDVNTCLKMVTYDGAQAMGFKSGKIEEGWNADLVVIDLDLPEMFPVQNIKNHLVHAFSGEVFATMVAGKWIYFDGEYPTIDSEEVKRELARIEKELY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein TM0936
publication title Structure of the hypothetical protein TM0936 from Thermotoga maritima at 1.5A bound to Ni and methionine
rcsb
source organism Thermotoga maritima
total genus 147
structure length 404
sequence length 404
ec nomenclature ec 3.5.4.28: S-adenosylhomocysteine deaminase.
pdb deposition date 2003-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1p1mA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1p1mA02
4I6VA 1PO9A 2ANUA 2VC7A 4AQLA 1GKQA 4IFKB 1V4YA 1RAKA 4C6PA 4NP7A 1RK6A 4C6BA 3UR2A 2UZ9A 4LCRA 4DLFA 4IGMA 2GSEA 3PNZA 3E3HA 3DUGA 4ERGA 4CNSA 1FWFC 3BE7A 3PAOA 2WJEA 2I9UA 2EG7A 3NQBA 4PE8A 2VUNA 1FWCC 4KETA 3C86A 1GKPA 1NDYA 3S4TA 4RDZA 4F0RA 4PCPA 3QGKC 4WGXA 4PCNA 4DI9A 3E0LA 2ADAA 2Z26A 3MTWA 4J5NA 1P6CA 3ID7A 4B92A 4V1XA 4C6EA 4IFKA 3URNA 3SFWA 4LH8A 2W9MA 1A5KC 3PANA 3GTFA 3GU9A 4EP8C 3GTIA 4WHBA 5FSDC 4G2DA 4KEUA 3F4CA 4H9YA 1P6BA 3V7PA 3CAKA 2Z2AA 1RA0A 3AU2A 1O12A 1YIXA 4IGNA 4INFA 4P5UA 3S2NA 1POJA 3IARA 4PBFA 3S2JA 2HQAA 2WJDA 1A5MC 2DVXA 1FWDC 1RJRA 4XD3A 3IGHX 3CJPA 4B91A 3IRSA 1KCXA 4M51A 1V79A 1V7AA 1K1DA 4OFCA 3G77A 3UR5A 3UPMA 3MPGA 5A6TC 2QT3A 3TNBA 1FWEC 3EGJA 4XAYA 2R1MA 4C6QA 3GU1A 3A3WA 4H01A 1A5NC 4KEVA 4H9XA 5HMDA 4J35A 3AU6A 2BB0A 4YIWA 4UB9A 3NURA 3LS9A 4C6KA 2Z4GA 4DYKA 4ZSUA 4IG2B 3MDUA 2OODA 4G7EA 3WMLA 2HPIA 2D2JA 3E2VA 3WZ0E 3RYSA 1YBQB 4ERAA 2O4MA 4ICMA 4EPKA 2OB3A 2P53A 4IF2A 4KIRA 4L6DA 2F6KA 2XIOA 1O5RA 1FWAC 3N2CA 1EZ2A 4HJWA 4IH3A 1FWIC 2QS8A 3IACA 3RN6A 3E74A 4XAZA 2PUZA 3E0FA 3GRIA 3LNPA 4TQTA 2ICSA 4QROA 2Z00A 2OOFA 4IG2A 4MUPA 3JZEA 3URBA 3O0FA 1IE7C 2GOKA 4LALA 3HTWA 1YBQA 4DZIA 2BGNE 2VM8A 1PB0A 3R0DA 3LA4A 5HMFA 3GTHA 5G4HC 4RZBA 1UBPC 1RA5A 1PTAA 1V77A 2Y1HA 4QSFA 3GIPA 4H9VA 4C6NA 1M65A 4R88A 3GU2A 3MJMA 1E9ZB 4BKNA 4EPEC 2PGFA 4E3TA 4GOAA 4L9XA 4HA0A 3HM7A 3URAA 4EPBC 2FTYA 4WVXA 3D6NA 4GX8A 1UIPA 1WXYA 1S3TC 2GWNA 2HNHA 1DPMA 4C6OA 1WXZA 4D8LA 1XRTA 2AQVA 2Z24A 4DO7A 3T1GA 1JGMA 4LAKA 1QW7A 3GIQA 3EWDA 1NDVA 2Z27A 1ITUA 3NEHA 4QS6A 2YZ5A 1RK5A 4KEZA 2FVKA 2P50A 3OJGA 3B0XA 4C6IA 3ITCA 4C5ZA 4GY0A 2IMRA 2OGJA 4H9MA 2Z25A 4J2MA 1GKRA 4UBPC 4LCSA 1NDWA 4C6JA 2G3FA 4RDVA 1M68A 2D2HA 3FEQA 2OQLA 4C6FA 4B90A 4DNMA 4CNTA 4HK5A 3UF9A 2YB4A 1J6OA 4GK8A 4NI8A 1YNYA 2R1PA 2PLMA 4JOMA 1EJWC 1KRAC 4C6DA 4DI8A 4CNUA 4C60A 3LGDA 4KF1A 2FVMA 4IQJA 3B40A 2Z2BA 3URQA 4KERA 3F2BA 2AMXA 3K5XA 1UMLA 1ONXA 3CS2A 2A3LA 4DIAA 2Z29A 1FKWA 4DZHA 4LFYA 4LCQA 1ITQA 4BY3A 4CEXC 4QRNA 3GGMA 3GG7A 4LAOA 4HK7A 4C6MA 1PSCA 4GX9A 3QY7A 2I5GA 3A3XA 4XAFA 3IPWA 2Z28A 3UBPC 2VR2A 2PAJA 3RHGA 2KAUC 2EG8A 1EJRC 2DVUA 4NG3A 1K70A 2AQOA 2YXOA 2FTWA 4R7WA 1EJTC 3EWCA 2E25A 1NDZA 2E1WA 3MSRA 3QGAC 2O4QA 3DCPA 4GXWA 3TN4A 1A5LC 3ICJA 4GZ7A 3OODA 1FKXA 3LSBA 2RAGA 1R9YA 3F4DA 3K2GA 4I6KA 4AC7C 1XWYA 3LU2A 3QY8A 2Z7GA 3ISIX 3T8LA 1A4LA 1HZYA 5CH9A 2D2GA 4F0SA 1FWHC 3OOQA 5FSEC 3IV8A 2P9BA 3MKVA 1R9XA 3AUOA 5HMEA 3B0YA 4LAMA 1FWBC 2UBPC 2QPXA 1A4MA 3RCMA 4LANA 3ORWA 1EJVC 4GY7A 1J5SA 4DLMA 3S2MA 4V1YA 1ZZMA 4RE0A 2GWGA 2WM1A 4CQBA 1VFLA 4IFOA 1I0BA 3WYZA 3SO7A 4QS5A 4ZSTA 1KRCC 3FDGA 1EF2A 4KESA 4C5YA 3OVGA 3PNUA 4XAGA 1RJQA 4H9TA 3T81A 4Z42C 4EPDC 1J79A 3IJ6A 2R1NA 4LEFA 4R85A 3K4WA 1EJSC 1A5OC 1UIOA 4H9UA 3GTXA 3F2DA 2WJFA 4C6LA 2ZC1A 4C65A 4CQDA 2VHLA 4RDYA 1W1IE 4PBEA 1E9YB 4GBDA 2Q01A 4XD6A 3MDWA 2DVTA 2HBXA 4CQCA 2HPMA 3TN5A 3FDKA 3TN6A 1RJPA 2GZXA 3LGGA 4H00A 1ONWA 3KM8A 1KRBC 3MVIA 4ERIA 3S2LA 4G7EB 3TN3A 1I0DA 1EYWA 1R9ZA 4GY1A 1EJUC 4BJHA 3HPAA 1POKA 2QVNA 4C6CA 1QXLA 1FWGC 4B3ZA 4F0LA 3QY6A 1NFGA 1K6WA 4RDWA 3F2CA 3A4JA 1ADDA 2R1LA 3GUWA 1M7JA 1XRFA 1YMYA 4CEUC 4HK6A 4XD5A 3E38A 2FFIA 4XD4A 1P1MA 1BF6A 3OU8A 2EG6A 1XGEA 1KRMA 3LSCA 2YB1A 2PGRA 1FWJC 2Q09A 1YRRA 1V51A 2CZVA 3MVTA 2HBVA 4KQNA 5E5CA 3OQEA 1J6PA 4GYFA 4IFRA 4QTGA 3PBMA 3O7UA 5AKQA 3LY0A 3DC8A 2VC5A 4GC3A 2R1KA 1EJXC 5LXXA 4H9ZA
chains in the Genus database with same CATH superfamily
2BTMA 2YGYA 1W8GA 2VUYA 3W01A 1GKQA 1CZ1A 4S39A 4F48A 3DAQA 1KTCA 5A8NA 3RX2A 1UA7A 2VEMA 4LCRA 3VNMA 3V3WA 4PBGA 4RKAA 3VZYA 5A69A 1V3MA 3TX9A 1OC5A 5T9CE 2VUNA 4RE2A 1TFVA 1NDYA 4RUBA 1XHGA 3DFPA 5C9WA 3RLGA 4AIEA 4PCNA 3WEZA 3LI1A 2ZC8A 3KTXA 4S2CA 3SUTA 4UQBA 2WNQA 2CBJA 4DXKA 5KG2A 1SO3A 3B8TA 4QDMA 4ECRA 3N4EA 2DT3A 1QHPA 2WSPA 3CV6A 2PE4A 2JE8A 2WKLA 3K30A 3WLSA 5KFNA 4ML9A 1N56A 3VCNA 4YMZA 5HAOA 2DFAA 2QUNA 1JDCA 4DPPA 5I3DA 4QXIA 1QPRA 4GZEA 2OYMA 5CZTA 1EJ7L 3DC0A 4HSHA 3TKFA 2QAPA 1QFEA 2JEFA 2Z1VA 3D0CA 4LUYA 3WLRA 2VGFA 1VCVA 1G7VA 5LA2A 4D72A 4E0CA 3HGSA 4MJ2A 3FSUA 1H5YA 3J7HA 2CYGA 1K1SA 4XBKA 1WKDA 4JD4A 1L6GA 4UMAA 1K3UA 5H2ZA 2YZRA 1FP8A 1F3WA 2X40A 1UUOA 3A3WA 4D71A 1RV8A 1MYRA 2JIEA 2C19A 5E9XA 2FYMA 3OZYA 1Z3NA 4QIUA 1I75A 4H9XA 4WCJA 1KW1A 4GJJA 3N3TA 1Q6RA 1OFAA 1A5UA 1L0PA 1H60A 5GPRA 4Y8EA 1JZ5A 1EHAA 5AHNA 1RP8A 3UGVA 4FLQA 4PYSA 1CYGA 1YBQB 3VIJA 3PZOA 5FJJA 1AA1B 2I1OA 2GUUA 4KIRA 5CC6A 2YLLA 2WK2A 5KG1A 3OYZA 3HU7A 3IWPA 1IF2A 4ZGYA 2FLNA 4IIFA 3S2CA 1EP3A 4FNSA 4NZJA 1AJZA 1GHRA 3HTWA 2DZPA 1T5AA 4A6GA 4UFKA 1QI0A 3MFIA 3O07A 4OU1A 3V6JA 3H23A 4FX7A 2YDSA 4QNEA 2XVKA 2Y1HA 3QFEA 2J62A 4EAMA 4WKFA 3N04A 3LRMA 4JIRA 5HUPA 4U28A 3A64A 4K1GA 1PKNA 1RH9A 3BAIA 4LPCA 1CX9A 1JRBA 2FTYA 4GXMA 2XIIA 4DJDD 1YXCA 3AIBA 4KCWA 3RLVA 3IK2A 1VRDA 1YDYA 3BPWA 2WC7A 4M8UA 1NWUA 4FZIA 1IR1A 1MXSA 2J8FA 1MO0A 1YDNA 5LNWA 2A2IA 3U5YA 1I8JA 2YBUA 3UWQA 2OGJA 2X0YA 3JS3A 1U30A 2FB2A 3LRLA 1MQPA 4P7NA 5AYBA 5ABFA 3PUEA 4DL2A 3GVGA 4E6MA 5IHSA 1L6YA 5BWFA 3SCQA 1OG6A 6XIAA 1TPDA 3F4WA 5DLCA 3GKAA 1MRAA 3SUVA 8XIAA 5JXQA 3TYEA 2W27A 3O1NA 2NQLA 3B0VC 4AWTA 3KBMA 4C60A 2YSWA 1OCJA 1HVXA 3LHUA 3CIXA 1PIIA 3S8HA 3P74A 2F8QA 2DSUA 3E2QA 1WDWA 4QDWA 3QYSA 3MP4A 2A3LA 4JYFA 4JTCA 2WVSA 4HTBA 3I7SA 1VFSA 2XFWA 1XSJA 4HA3A 2GVLA 3RM8A 1Q6GA 3IPWA 1JUBA 2QAFA 2Q8LA 4BWLC 4NG3A 3B9AA 1BQCA 3LCGA 4ZQRA 1P0EA 4NXKA 3RU8X 1G4TA 1UB3A 1QNQA 1XC6A 4WUIA 3QGAC 2HXUA 1FHDA 3PW2A 1X7IA 4CNOA 1DE6A 2X1UA 1DJZA 3PZPA 5LHEA 2QXWA 2X09A 3R10A 3ZWTA 3KBNA 3H4XA 3B8WA 5A6MA 4FA3A 2JEJA 1OZQA 3UZWA 4GPNA 1UWIA 2D1ZA 4QWDA 2OCZA 3VMPA 4WDWA 3EAUA 4R7JA 1EH9A 3FA3A 1F3XA 1KM2A 1IYXA 4LAMA 2J13A 3PPHA 3GVWA 3BC9A 1I2QA 1YDVA 2YX0A 4CVWA 1N55A 3KVKA 4V1YA 5CGTA 4YN5A 5KFDA 1J0YA 1B4EA 3G1HA 3CQIA 4DWSD 5KT5A 2C2EA 1K9FA 2QCLA 3L9CA 3W88A 1SSDA 4LEFA 3C2RA 3BW4A 2YDQA 3F2DA 1EA9C 3TIMA 3O16A 1UUMA 3W7LA 1BD0A 4EOUA 3ARPA 1S1RA 4M19A 1XLJA 4L65A 4HP5A 3HJZA 3UXDA 1UYQA 4ERIA 2B31A 1S3HA 1OVDA 4O53A 5KFSA 3QOMA 4X22A 5RUBA 2PDXA 2WWDA 4BJHA 2ZFAA 5IFTA 4S3AA 2WNWA 4GH3A 1L2UA 5FD0A 4HN4A 4IR1A 1NQKA 1KFWA 3U7VA 4JDYA 4AHPA 4F9DA 2QV5A 1HX0A 1B3YA 3LK6A 5T91A 3WN6A 4MNKA 4IPIA 1JDDA 2X1SA 1PE1A 1EUNA 4LBRA 5KSWA 5HATA 1XYFA 1DIOA 4LOCA 4Q43A 3MI2A 3QQWA 4MAZA 5BRQA 2F6UA 5H1WA 3O7UA 5HOSA 2VXNA 1YE6A 1QI4A 1M3UA 3GNPA 1PO9A 4R33A 3W1TA 2VC7A 1OIFA 4C7FA 2A6LA 4L1GA 4U5KA 4ECQA 4C6PA 5C71A 3KRBA 4O28A 4CNSA 2BY1A 1FWFC 4UTIA 1XF0A 4O12A 4B4FA 2GJXA 5FJPA 2Z6IA 4ZO7A 1LRNA 3AO0A 4GI6A 2AQ4A 3NDYA 4IPLA 3W27A 4KFOA 1XPGA 4L6OA 1ZALA 3IUDA 4C6EA 1Q2RA 3SFWA 2PRHA 1JPDX 1FWRA 5AZ1A 4OECA 3KP0A 1ISYA 1XH0A 1OFQA 4US5D 3O9NA 4AMCA 3CHVA 2XFYA 1C93A 3TAKA 3ZSSA 1DIKA 2INEA 2JEQA 1P6BA 4DB7A 5MKGB 1HJVA 4WY0F 1BRLA 1O12A 3AU2A 1H7XA 1POJA 1EB3A 2HQAA 2WJDA 2ZBTA 4O54A 4JIQA 3DENA 2NV9A 1WZMA 4V15A 3I6RA 4FXJA 3FJLA 5J04A 1WDQA 2OPJA 3M0IA 4Z1AA 3AISA 5AYIA 2ZADA 4MVAA 1V03A 4OOUA 4Q8VA 3N14A 5KFVA 4E5TA 2GGGA 3TJIA 2IW0A 4PUDA 3QR3A 4UR7A 1KM3A 1KTNA 1TJ0A 5CG7A 1Q7ZA 4ECYA 1IEIA 4ZBCA 1V02A 1OFOA 1LP6A 1OT2A 3A21A 4GUIA 3LS9A 4C6KA 1B3OA 3KHRA 3R79A 3FW6A 3N2MA 4XZMX 3E1F1 1XIFA 1GYLA 4L61A 4DO4A 5PTDA 2Z6JA 1W9XA 1XPYA 1PIFA 1XIMA 4GUFA 1GGOA 5D8ZA 1D7FA 4L4PA 2AKMA 3BSGA 5AC4A 3APGA 1RY8A 2OVLA 3SECA 3V1HA 3V0TA 3GC4A 3O0FA 3N9RA 5D32A 4D6CA 3CNYA 2ALDA 3GLCA 3ARQA 3W84A 1Q7QA 3WLOA 3GVRA 1D3HA 2NLIA 4LYKA 1YTDA 4DJDA 1IR2A 4WDTA 1TR1A 4PMJA 1DORA 4WEVX 1WKEA 2DSVA 2D0GA 1EX1A 3LXCA 1CXKA 1GZ1A 3M9OB 2CHOA 3D3AA 5IOBA 3T55A 4Q6JA 3N9SA 1VQTA 1IT7A 3HBLA 4FOKA 3CZKA 2HTMA 4KGLA 3WQCA 1SO4A 1JYWA 4H9MA 2YL6A 4E4UA 4S23A 2O55A 3KL5A 1S5MA 4S3DA 1HL8A 3W22A 4R53A 2CERA 4H4IA 3CV2A 4I3GA 5CLWA 5E6ZA 3MV01 4D6IA 1VD6A 3UWUA 2J77A 2Y5JA 3EMQA 3M47A 3H26A 1UH3A 4PTXA 3B40A 3W87A 2OO0A 1NFBA 3URQA 4BA0A 1FA2A 2PI6A 1MDRA 3ZT6A 3SBFA 1TE1A 3OZMA 2EPNA 4I7VA 4UCGA 5FF2A 2GUBA 1QHZA 3PW4A 4L56A 1EOKA 4ZA0A 1XIHA 5K9DA 2QKFA 4PUUA 3WLLA 3ZJ8A 4K6AA 1LM1A 3BW3A 2Y6ZA 2VQTA 3SCUA 5KFHA 2CHNA 2QCHA 2NQHA 3S1WA 3SSZA 3UWVA 3WQPA 4B15A 3CQJA 5HDRA 2V82A 3KRUA 1F74A 1TVPA 2OG9A 3G1XA 4AZGA 4LWWA 4RXFA 2V5KA 5ABHA 4XZBA 3ZM8A 3G6MA 3DFOA 2Y61A 3U9IA 3EMCA 2A1YA 2D2GA 2YLAA 1X7FA 4BQ4A 2P9BA 2PTYA 3PVFA 3B0UX 1BXNA 3FSTA 3RX3A 4LANA 4GYPA 2QCDA 3RF9A 1DQUA 2YA2A 4AB4A 1CLXA 1QW9A 3RIKA 1KD0A 4FB7A 1JZ4A 2FLLA 4XVEA 1NF7A 3IGSA 2PDNA 4CQBA 2QCGA 2P88A 1VFTA 2QIWA 5LZLA 1UP2A 2QUUA 3AJXA 4H9TA 2WSQA 3AIRA 3P93A 3UXAA 1EIXA 3PC0A 3T0AA 3RDKA 2PRLA 4H9UA 2VOTA 4O8RA 1WOAA 4IQLA 4TTUA 3SUUA 4FNRA 2J27A 1NEYA 2WSYA 1CXEA 2HROA 4CQ9A 3DFTA 3I10A 3SIMA 1UKQA 2C3ZA 3BICA 5FL0A 3NSMA 2OX4A 4RZ5A 1EDQA 1HKVA 1OX5A 1XKJA 4H00A 3OYXA 1CXLA 2VFFA 5KFBA 1J0JA 1MDLA 3ARZA 3WBAA 3MCMA 3GHTA 4Q8PA 4JNYA 3WKZA 4K7VA 1I9CB 1J12A 5F1UA 3UCDA 4AYSA 1L6FA 3N9KA 4NZCA 4UMBA 3VIHA 1BKSA 4IPNB 5FAJA 3G6YA 4IIGA 2Q09A 1XGDA 4CN1A 1RR2A 1S5TA 1NH6A 3LUTA 1SZNA 3MR6A 3BCJA 3SURA 4ZQMA 1BXBA 3UYCA 4YWIA 1HJUA 2IQDA 3UFYA 2VA3A 3LHVA 1V4YA 2LLEA 2UV8G 1RAKA 4NP7A 1U1HA 2DP3A 5B80A 2I9UA 2TRSA 3NG3A 2XM2A 4JQAA 5D37A 2FMOA 3B4UA 5LYRA 1OC6A 2ABAA 4I7UA 4B2DA 4GGBA 3DFNA 2AL1A 4URIA 5AVHA 2W9MA 3ARRA 3U8GA 2XVLA 3BZJA 3WQ6A 4J28A 1LBMA 4XVDA 2WSRA 3F4CA 4EWND 1EEPA 1WUFA 3P84A 4MZ1A 2IA6A 2W7PA 3L5AA 3DFHA 3IARA 1WV2A 3AICA 4A2SA 2J66A 1GJWA 3VD3A 4TV5A 3GG1A 2XH0A 1D3CA 5DX7A 3UPMA 5IXEA 4MUZA 4NZ5A 3G1FA 4WOQA 3ABOA 3IVUA 5H91A 4M3PA 1UWRA 2PS2A 4OHQA 5J8LA 4ZR8A 2YR1A 4A8LA 1DJXA 2XM1A 3TQPA 1UZ1A 4AD2A 3AU6A 3AHXA 5CJNA 4YIWA 3RK8A 3MP3A 3WDRA 1S5VA 3B8DA 1Q6EA 3A5VA 4DL6A 4CCCA 4IHCA 5CPOA 5HK4A 3T44A 4P7RA 4ICMA 2OB3A 4O19A 4BQ3A 1UR3M 3PPGA 4OUIA 3AI0A 4YCPA 4MMWA 1ELSA 4IH3A 4P8XA 5E9AA 3W2NA 1EC8A 4X60A 3RN6A 1ISVA 2JKEA 2GDUA 2PDMA 3URBA 1W9VA 4LB4A 1JYVA 4JICA 2WC3A 1TREA 2OLHA 1BWKA 3R0DA 5HMFA 3S46A 4N6EA 1RP9A 4FLRA 1EA0A 2ZE3A 4PTVA 1RA5A 3PK7A 4MB3A 3L4TA 3N3MA 5BYWA 1B4KA 1E9ZB 5I3KA 4NAFB 5M2FX 3R0UA 2G0WA 3VOJA 1PYMA 1VS1A 2YA0A 3VIFA 2HNHA 3PBUA 3PULA 3MY9A 3W7OA 4AHOA 2AQVA 4QHRA 5C9UA 3DI1A 3DG7A 4LY8A 3BSMA 4UIOA 4LC8A 2ONEA 3W53A 3BAYA 2HISA 3L5MA 4IP5A 5EWFA 3OTRA 1K6AA 3RLUA 4NJKA 4IX2A 2Z25A 2VGIA 2ZTJA 3PS7A 4PR4A 3U2OA 1WBHA 2BY2A 3W7EA 2GGHA 1WOBA 1V6YA 3FKRA 2FLIA 3B9OA 3NL5A 3TCEA 2W9CA 1R3RA 2ACRA 1XD1A 1EC9A 4J3TA 3TA9A 2F7FA 5BOOA 2QJGA 1W5QA 4HKPA 3W2KA 2DZTA 4UTWC 3CAVA 4U4MA 4XUGA 3VGDA 4A3RA 1GYMA 1XDJA 4GD0A 5DO8A 4B5UA 4JHZA 4A21A 2QULA 1DHKA 1ZAJA 3NQ7A 1LRQA 5HPCA 1LZOA 1OFPA 5E0KA 4ED6A 2V3FA 5KFYA 3GGMA 4AIUA 1PSCA 3ME3A 2I5GA 4JN8A 1LQAA 5KMYA 4H8VA 3W37A 4HSOA 2ZDSA 3I6TA 5I3FA 3UBPC 1CGXA 1I2RA 2VR2A 3U2CA 5KT7A 4FEZA 1K70A 3QZEA 4O0KA 2DIEA 3EWCA 4WZHA 1OCNA 3C2FA 3LOTA 1CXIA 4QEHA 1H4PA 4QX4A 3PJTA 3OODA 3TE9A 4BI5A 2DDXA 2ZRUA 1TPUA 1OK6A 1FY6A 5KFTA 5A8GA 1XWYA 1REQB 3H2NA 1LUCB 3VFLA 2DH3A 1QOQA 3VKCA 1V0MA 4XO6A 1CW2A 2PLJA 4GUGA 2XH4A 1KGWA 3BMXA 4NHVA 4XWUA 1FWBC 1AJ0A 1ISZA 4HU3A 3WQFA 4L4MA 2DGAA 3NSNA 4NX0A 1JEZA 3LCHA 5LHFA 2Y5SA 1FBAA 3LB0A 3QFWA 1RALA 5KZDA 5TD4A 4LY4A 2A6NA 4Y8FA 3G0XA 3A24A 3UJEA 3WBXA 3T81A 3NOEA 3IJ6A 4A29A 3SGZA 4FS9A 1K8XA 4N9CA 2HVMA 1KM6A 2WJFA 4C6LA 3M6DA 4F0HA 2VWTA 2QYGA 4AD0A 1QPNA 1Q7MA 2FZNA 4K1WA 4L4OA 3EPIA 3E0IA 3I3DA 1J93A 1I60A 4JHOA 1KC7A 1LBFA 1C7SA 2POTA 1UH4A 1ZBVA 3WLIA 1NJJA 4PMOA 3R12A 3Q2DA 3IN5A 5L9XA 1D8CA 4RNOA 3WMSA 4GXPA 3H2AA 1OGBA 4DBUA 6CGTA 3LEPA 5T26A 2G97A 3QY6A 1MUWA 3THAA 1MW2A 2R8KA 5LNUA 3WDJA 4A3YA 4GC7A 2EG6A 3AS2A 1TMQA 3F5KA 1DYSA 1KRMA 3AWOA 4HPNA 2DPEA 4H3DA 2DZXA 3RU6A 4QP0A 1PHWA 4MGGA 4KRTA 2HXTA 4AU0A 1QNVA 3OEXA 1FRBA 2FZBA 3UJRA 2WVVA 1OFRA 1EJXC 1RXOB 2XTKA 2X42A 3BOFA 1K8CA 1I45A 3R8GA 3A4AA 3L65A 3SCSA 1E5NA 1QNPA 1KWGA 1LOLA 4XZHA 1BVNP 5A2AA 3LYEA 2INZA 1K02A 4C1LA 2XINA 3QYQA 3OW1A 2QJJA 1HO4A 1GQIA 4KCUA 2WYSA 2JKPA 3RRXA 4AISA 3TYCA 1AQFA 4J5NA 2YCKX 1K4HA 1N8WA 3P82A 1FX6A 5A6AA 3UNDA 5C2GA 3VVGA 3BAXA 1KLYA 2ACQA 3V35A 1JCLA 1YKWA 1A5BA 1RD5A 3MUIA 3FLUA 3GIMA 3L21A 1FWDC 1RVKA 4ZOCA 5JIWA 4NF7A 5I3HA 3FYOA 2AGKA 3MWAA 2RGMA 1RLDA 3RXZA 3G1DA 3GVQA 1VPQA 3AJ7A 3SY1A 3N34A 2VR5A 4LVAA 1XIJA 3DBPA 1Q85A 3W0KA 3QSRA 4PSPA 3A3HA 1TRDA 3PB2A 2WWCA 1KQYA 4GO8A 1BYAA 4J9OA 1XIDA 4B5SA 4IG2B 2E67A 4F8XA 4DF2A 3E2VA 3LN3A 2QGYA 3PR2A 5ENLA 1JF6A 2Z1KA 1O95A 1T40A 3M7WA 2NV2A 4F4WA 3AMLA 3QMSA 1Q13A 1VHCA 4MJMA 3E74A 4O4WA 4XAZA 3D3FA 4XBSA 4TQTA 4AG0A 2YCLB 1P4CA 4Z0JA 1IWAA 1UR4A 3TC7A 3NM3A 2D0FA 5A3HA 1XYAA 2NT1A 3ZJ7A 3VDAA 2PD5A 1RZMA 4DAIA 2YJQA 2QZRA 4NJIA 4EAYA 1HP4A 3QHOA 4H9VA 2MANA 4RJEA 1V3KA 5A6BD 3MV11 8A3HA 1KB3A 4RV3A 3STPA 4WIWA 4BQ2A 3C0SA 1XXXA 1KM5A 3IEBA 1PCKA 4C7DA 1PZ3A 4RE4A 5HNTA 4OIFA 2V5LA 1TWDA 3V16A 3WH8A 3TONA 3PBGA 4L1WA 4Q4MA 3CUFA 2FDMA 3T1GA 3OBKA 4ZZ9A 1VP5A 1VB9A 3OSNA 4G7FA 2R8GA 1JNDA 2Z27A 4J1OA 4KEZA 1BSLA 3NL6A 3OSPA 2ZICA 2F2KA 5L1IA 3ITCA 2IMRA 5GNYA 3W28A 1V93A 4AZIA 1GKRA 4RDVA 1X1OA 4JV2A 3MO7A 2TPSA 3G3MA 1RQBA 2QEZA 1K8YA 3C6CA 4E4FA 3QC3A 4HMEA 3E96A 3UJFA 2DY3A 5KFEA 4B90A 2Q6ZA 4NI8A 1EO5A 3CL8A 4JOMA 2ZKMX 4W7WA 4ECZA 3TROA 3CV7A 5DANA 4PRWA 3VKDA 1H0GA 2V2DA 1GOWA 5DBTA 2P3ZA 2GJRA 1EO7A 1QK2A 5CSUA 1S38A 5HWMA 3HQPA 1TWSA 1F07A 1A5CA 1XCWA 1V3HA 3VUSA 4JIEA 5HINA 5IDIA 2B81A 3O06A 3LPPA 3H24A 1XI3A 1AVAA 1XCFA 2FTWA 4Q8OA 4NUWA 4AEFA 1E73M 1EWEA 3LTPA 1RYRA 3OG3A 4DL5A 4TMCA 1UBSA 1BG4A 4NYYA 3CZLA 3UJ2A 1R46A 2O9PA 1R9YA 1W9PA 4H04A 4UFHA 3L7RA 1LOQA 1BYDA 3EDFA 4MAVA 3STFA 1PZ1A 5CH9A 2GSJA 4LBSA 1R9XA 1Q3NA 3GBEA 1OYAA 1P0BA 4YR2A 3IJLA 1KBKA 4U2ZA 4Y7EA 4RE0A 3W81A 1I0BA 4J3SA 2WCGA 1OX4B 3NO1A 3OIHA 3QLLA 3MI6A 1BLIA 3WUEA 4MPKA 5DCBA 1KBBA 1BTCA 4ORIA 2Q02A 3MMUA 2JBMA 3ELFA 1KKRA 1WPCA 1Q6LA 4Q6XA 3RPDA 3GW0A 1GVEA 4CQDA 1JPIA 1DE5A 3VCCA 4PBEA 3SFKA 4IOTA 1BAGA 4C1NB 2HBXA 3EWZA 3Q65A 3TN5A 3MMTA 4GI9A 3T5KA 3DERA 2P0IA 3LCLA 1DBTA 4WOZA 2JEIA 4G7EB 1A53A 3RX4A 3NYZA 5C70A 1UD4A 3A47A 1BEUA 4O0ZA 4RPPA 4UNIA 2D3NA 1YYAA 4B3ZA 3THDA 3IV3A 4LYQA 1GNXA 2HCVA 3UA4A 5TNVA 4KW2A 2X7VA 3VD4A 3UNTA 5GJNA 1P43A 3M4HA 4LT9A 1UR2A 3CBWA 5FKYA 1TPC1 2FFIA 2E5CA 2Y89A 5HANA 4GE8A 3EKZA 1RBOB 1SZEA 3KZSA 1VAHA 4WJ8A 3UW6A 1E1FA 3LCWA 3GM8A 4E8GA 3TYBA 2G4FA 3UZJA 4EEYA 3NVDA 4H19A 2FHBA 3R8RA 5HNRA 2EPKX 2YXXA 3DC8A 3H40A 2ALZA 1XBYA 1OM0A 3W1MA 1L6WA 2C1IA 1AG1O 2QQ6A 3NL3A 2C2DA 2DIKA 2FZDA 2ZYFA 4IFKB 5BRBA 1FHLA 2FMNA 1PXGA 4UOQA 4I5RA 1VENA 4W8LA 2BS9A 2W3ZA 3BQ2A 4P7OA 3MHFA 5EMJA 1NAL1 5M17A 3KVMA 4RR4A 2P1FA 3GUGA 1UOZA 4DI9A 5H8MA 1WX0A 2WQPA 4AC1X 2FZMA 3ABZA 3W00A 3SRFA 3JRKA 1E70M 1DWHM 3SCPA 1TUXA 2XGPA 1E0XA 1Z32X 3FEMA 4FX8A 4H2HA 1JULA 4PCTA 3W1QA 1B9BA 2XCPA 5TF0A 1JDAA 3V7PA 5KG5A 1DQWA 2F2HA 1SUXA 5DMNA 3ARSA 1LYXA 3GDRA 3WLMA 2CLPA 2BQ3A 4Y9NA 4D6JA 2A7RA 3IS4A 3T0TA 1E56A 3QC0A 1XR2A 1YW1A 4Z2KA 4LF2A 4UZUA 1V79A 1V7AA 2GVGA 3UR5A 2YW4A 3PZGA 4H7ZA 5E6YA 2NWSA 3WQEA 2ASHA 1BF2A 1SSGA 4QR6A 3L4UA 4ADUA 3OLDA 3R4IA 4ADTA 5E93A 1EGZA 4U5IA 3SY5A 4WSJA 4D1IA 2VFEA 4J35A 4Q32A 4DEFA 2GVJA 1DKWA 4EIVA 3VGEA 3A4WA 1GVOA 1PX8A 3W7MA 1QNSA 3P6LA 5K3VA 1CECA 1CCWB 2QJNA 1WAUA 4BCEA 2X2GA 4ZTYA 3S9IA 1A3HA 2XN2A 2H8XA 4JCMA 1VLWA 3FOKA 3PSVA 4GI8A 3S0CA 2WVUA 3PZ9A 1ZAHA 3I7QA 5KT3A 3TH6A 4AD1A 1MNSA 4PMUA 4IX0A 3BLIA 2OOFA 1TJPA 3M0YA 5CKSA 1UQZA 3VDCA 4M7SA 5A6BA 3VYLA 2BGNE 4YWSA 4NRSA 3SIZA 1B3ZA 3LA4A 3KS5A 1V3LA 8XIMA 1TCDA 4NNAA 3S5ZA 4F40A 1WDRA 5J5DA 5BOEA 1LT8A 4ZOEA 1DJWA 4NSBA 3H7RA 1B3XA 7REQB 4TQRA 3B9EA 5TQLA 2OSWA 3DU0A 3ES7A 2GWNA 1TR9A 1T99A 4PFHA 3R25A 3LMZA 3STEA 2POZA 4Q4QA 4MM1A 3MSGA 4DO7A 1XSIA 3T05A 2VEFA 1H50A 1VF8A 4JIIX 2EPHA 4O3RA 5CSYA 5KZEA 5G1MA 2VFGA 2V5BA 3B8SA 5ABEA 4JEQA 4JN7A 5AC6A 5FJUA 4B5XA 3HMCA 2W5FA 4XIAA 4ICNA 4UOZA 3PPFA 3DEQA 5CAKA 2J6TA 1H62A 3N2BA 4R9OA 3LBMA 1L6SA 1C3FA 3T78A 4C6FA 4IRKA 1T8XA 2ZA1A 1WNOA 4CNTA 5MKGA 3UF9A 2PF8A 2VZUA 3CHFA 1YNYA 3FHAA 2PLMA 5SWUA 1EDGA 1XD0A 1SJCA 2E8YA 4F9JA 3OVRA 2DQXA 4LS1A 4ES4A 4IGHA 1GOXA 2Z2BA 3M0KA 3VINA 3F2BA 1BFNA 1VHNA 2C79A 3TR9A 2IMWP 1LROA 4NNCA 3STGA 1ITQA 6XIMA 4MY1A 4DF1A 1XLBA 1OG0A 3TQ1A 2PDKA 3PZVA 2AQOA 2YXOA 1AQHA 5HQLA 2RDIA 2V9DA 4PUWA 5A8OA 5CCZA 3N1AA 1V08A 5AHLA 4YL2A 4RW5A 1WDSA 4YS1A 1XLKA 4FNUA 2DW7A 4JX4A 2XWDA 1AH0A 1Z8AA 2VX6A 3N29A 3LI0A 1GW9A 1O5KA 4HNVA 5DY2A 3UWWA 4W9TA 4F0SA 3F5JA 2QDHA 5BU9A 4XQ6A 5EPDA 3M0XA 1GQKA 1LQ0A 4CGTA 5KFQA 4DHGA 2ACSA 1UC5A 3W1LA 2XZ9A 2Z7KA 4P7QA 3S2MA 1QBAA 5CAHA 3KL3A 3TFXA 1T0OA 4HJFA 4MG4A 1W3HA 2CZFA 3SO7A 4IXHA 4KESA 3WO8A 1K7XA 5T8GA 1XGZA 2VZOA 4GZJA 4NAEA 3GAKA 3EDKA 1J79A 3CL7A 4DRSA 5LIWX 4GKTA 2B4GA 1WE5A 3TW6A 1XIEA 3EPOA 5E70A 5G5IA 1P6WA 3GNXA 3EPNA 2VFDA 1W1IE 5AC8A 1VBJA 1TV7A 4HHLA 4CQCA 5M1TA 2QW5A 4GBUA 1WO2A 3WK2A 1OJXA 4D6GA 4NU7A 4ATLA 3BGJA 3TN3A 3B8UA 3BCFA 3Q8RB 3ANYA 2QVNA 1EL3A 1S2VA 4YHGA 1IT8A 4AZ7A 3N6QA 4RPQA 1UW9A 1VEMA 2FZ8A 2ATLA 3GILA 3G1VA 3H21A 3F2CA 3UXIA 2DH2A 1XRFA 2W9BA 5FF7A 4CEUC 2J75A 3ITYA 2WPBA 2WMIA 3NQAA 4FS2A 2YB1A 4MWAB 3RB0A 2VVSA 1IZJA 2REQB 1V51A 4HHHA 3AYRA 1TIMA 3RM4A 4NL1A 4ZB0A 4UTWA 1C8YA 1RQHA 4FF7A 1QUMA 3C2YA 5U4NA 5LXXA 1ME8A 1DXFA 2DW6A 2E5DA 1LTDA 4PTMA 5DEZA 4WX2A 3N25A 4FBTA 5A6LA 4DLFA 2QHAA 4O16A 3UG8A 3ZIZA 1ISXA 1ZTVA 3WCZA 1VFHA 1JDEA 2EG7A 1SMDA 2F84A 2NX1A 3TTSA 1GORA 1UR8A 3NQ6A 2HEJA 3W23A 1FQ0A 3GR8A 3EWYA 3M6YA 3MU7A 5D2VA 5KFXA 4QG9A 2A7NA 2R8WA 2V5CA 6REQB 1A5KC 3BLFA 2PDWA 2WKGA 1TVLA 3W2UA 4JFTA 3RB3A 4KIEA 4DBSA 3CEPA 4M6QA 4E4PA 1OFEA 3EMZA 3CHCA 3ABXA 2OX1A 3WQ8A 4DL4A 1YIXA 4OJYA 1IV8A 4ACYA 3EXTA 1LWJA 2R14A 1F6YA 1VR6A 1XKYA 1DL3A 3KLKA 4ZE5A 1M41A 4OFCA 1K1DA 1L8NA 2WHJA 3H70A 3MANA 3PSWA 3SCWA 1C8VA 2ZX8A 1TUFA 4FF5A 2J7HA 3T4CA 5EMMA 4ZO6A 1W3IA 2SFPA 3KWSA 3WD3A 4RK8A 3GU1A 5H6HA 1XP3A 2QDGA 2QV4A 1GCYA 2W91A 2G41A 1CGWA 2EF9A 3LENA 5HMDA 1TPB1 1G5AA 3BJSA 1FHUA 1LQ2A 4PUMA 5KFAA 4DYKA 2YXGA 4ZSUA 2VO5A 3MDUA 2V30A 3CK5A 4IMFA 1I1XA 5CJ5A 1CPUA 3W82A 5L1LA 1QI5A 1O68A 4ADSA 3KZPA 3EKLA 4YTUA 1FCUA 2XIOA 3M5ZA 2RDJA 1KM0A 5JUVA 3WQWA 2J6XA 3LTYA 3VE7A 4C91A 2A5HA 1ADSA 4F66A 1TTJA 3RAOA 3VCRA 4QITA 5LKYA 3VIPA 1IE7C 2NXHA 1HJXA 5ECVA 4FHAA 2XIJA 3S1XA 4DZIA 1JYNA 1JCTA 3LPFA 4F2UA 3KHLA 3TLQA 4PRTA 4LUSB 5K9XA 4DL7A 1QW8A 1M65A 4K8GA 4EPEC 2PGFA 1VBHA 4GOAA 2PEVA 4P2VA 5D09A 3CAQA 5I24A 4GX8A 3NAVA 3EX1A 1VFUA 3O15A 3QOKA 2QIIA 2QUMA 5EGRA 4QSHA 4RV8A 2Z24A 4Z2HA 3W1AA 3WLPA 4GVHA 3W9ZA 3GV8B 5MHBA 1DJIA 1NDVA 4U2YA 2VI0A 4LSBA 3T0DA 2XUCA 3EYPA 2B7OA 4PMNA 5IM51 2PDCA 1DVJA 4Q8WA 4IMGA 4AF0B 3WDHA 1QI3A 4I8YA 5JIPA 3ZLFA 3KLLA 3VI2A 3CH0A 2G3FA 3USBA 2PC8A 1XIBA 4J9SA 3M1ZA 2ZX5A 3EDDA 4IP7A 3WK1A 4J9MA 2GYIA 3CZGA 1Q8JA 4HPJA 2CLEA 3E02A 1A3WA 3DFYA 4QWEA 1CXFA 4XKYA 2OWXA 1TV3A 2WCAA 4JYDA 4HA1A 5I79A 4DZAA 2W8LA 1TJRA 1TA3B 4K38A 3T2QA 4ZEPA 3AXKA 4EBCA 4QNWA 3GDBA 4Q8EA 4NYUA 4Z08A 1U33A 5B7ZA 2DT2A 5D9OA 2IKJA 4JL1A 3W7PA 2CLKA 2AL2B 2CZDA 4Q7NA 3HF3A 3UY8A 5KFCA 3GG7A 3QR1A 4GQBA 5DMYA 4O3SA 3WF4A 1LT7A 3CV1A 3H4GA 3CLWA 1G4PA 2WJZA 3ECQA 1DWGM 2ALRA 2OU4A 5JBEA 1RD6A 4LNYA 3WL0A 3GZ3A 4DJDC 4DAFA 4MKVA 3FDSA 4U31A 4GNVA 7PTDA 3V4BA 4QLLA 5HBFA 1E4NA 2YDRA 3DCPA 3JR2A 1I2PA 4GXWA 3W38A 3GIIA 3SZ8A 3SM0A 5M03A 3CQHA 1US0A 4LS0A 3LLFA 5A94A 3RM9A 2JFEX 4BZYA 2I57A 2G8ZA 1A4LA 4KFPA 3DHDA 1GPWA 1FWHC 3OOQA 1GEQA 3NZPA 2C1GA 3WSUA 5JUMA 4I5XA 2QUTA 3IJIA 3KOYA 1GVFA 4F0KA 2QPXA 2GDQA 2OZ0A 1EJVC 3THCA 5FJTA 7ODCA 2E6YA 3ANVA 3CWHA 5G2HA 4Q8FA 3BXWA 3CHEA 4IPPA 1VFLA 2WBKA 3LERA 4DWDA 3LHWA 4ZSTA 1KRCC 4NZ3A 2DSKA 3N17A 5KFZA 4XAGA 3NQCA 4FALA 4MNLA 1EGVA 4GIYA 4R3UA 4Z42C 1S9FA 4M5PA 4FIQA 2V5JA 4ACZA 4MPQA 1B3WA 4JV0A 4JL2A 2VHLA 5DT7A 2DVTA 2R24A 3GH5A 4NJGA 5LA1A 1US2A 2BWGA 3PFMA 2GZXA 5EMUA 2E09A 4UTFA 3MVIA 2BODX 4NILA 4JPGA 3R8HA 3AYVA 3I6EA 4HU4A 4JX5A 2MNRA 2ZZ1A 2PWHA 3WLTA 4W93A 3KCJA 4H8UA 3KBVA 3MR5A 1TX0A 3QV8A 1LWIA 3QKZA 1R0MA 2WB5A 4PEEA 1EUAA 3IIXA 3WQGA 1W91A 1WDDA 1LLWA 3N13A 1ONEA 3LSCA 1YPFA 1X6NA 1E0TA 5C5JA 5AZ0A 1Y5XA 3P0XA 1AD1A 1GOMA 4H6RA 4ECXA 2Y7EA 2ZUWA 1MSSA 2OYLA 4AZCA 4HZ7A 4DWSC 3KHDA 5KTLA 4NJJA 1V0KA 4JZ5A 4GIRA 2EAWA 3TTOA 3S5YA 5DRCA 6TAAA 4HCDA 2IPFA 3W7CA 1ICPA 5KT4A 1FWCC 1GKPA 4MDOA 2WAGA 4RDZA 7TAAA 1XC4A 3W2JA 3W7RA 2Y7DA 4GIAA 3VD5A 2ATSA 3C56A 1LUCA 4AXNA 1W6TA 2ACUA 1DWAM 6ALDA 4RZ6A 5F1VA 4G2DA 4QE5A 4JNZA 1Z6KA 4H8NA 2E3ZA 3VKKA 4DBWA 5C7VA 2F6XA 4MLJA 3W73A 4DY1A 1PX4A 4P8WA 1A5MC 5EBUA 5G1TA 3GNNA 3P62A 4F79A 4B91A 2PF0A 5C8BB 3CQKA 1KCXA 1M01A 4ROQA 4KBXA 4M51A 4FLSA 3W7GA 3WL1A 1X6UA 2O56A 2DZAA 3IVTA 4IIBA 3TFCA 1XYCA 3TUUA 3K8KA 1K7EA 4O18A 5C9XA 3BWWA 1YNPA 5JBDA 4S3EA 3MR3A 5D30A 4HSNA 2CXGA 1R7AA 3AIWA 2BB0A 2NX9A 5CXPA 2HJPA 2HK0A 5D02A 1E6SM 3WNPA 3SW6A 3WMLA 2G3MA 4G1KA 4JQ2A 1HKIA 1G4EA 4XK2A 4XZ9A 4YXGA 2P53A 3GNOA 2ZUNA 3MBFA 2R82A 3W74A 3AHVA 1TWWA 3DYPA 3SB0A 1S97A 5A8PA 1V6VA 5BXPA 4HJWA 2J24A 2QS8A 2ZUUA 4PRRA 3U4AA 3VABA 4BK9A 4YCOA 4GA8A 2GQ8A 4HIBA 4DJFD 1FWNA 3JZEA 4WRHA 2I5IA 4LALA 2JIWA 1BYCA 4MADA 3JVAA 4V2XA 3K4DA 1JZ2A 1KKOA 1ZRQA 3ITXA 4IWWA 2VR4A 4JBRA 4KWOA 1AW1A 1V77A 3BTNA 1SFLA 4GINA 1CLKA 1HGWA 1H2JA 4DNHA 5M5DA 5DLGA 2OXNA 4E3TA 3QBUA 4HA0A 4UC5A 4Y96A 3URAA 4Z2JA 1KA9F 1S2TA 2Z1XA 3KFTA 4MLRA 1TPH1 1OGGA 2G3IA 3WF2A 3QPZA 1HT6A 4IGSA 3A9IA 1ZBWA 1TMHA 3GFYA 3PG9A 1ZJAA 4QDPA 3KL0A 1X1NA 2DZVA 4WY0A 3ABQA 2AU0A 3DGRA 1CENA 4W84A 3NGJA 4HPGA 4WXYA 1O7AA 1NU5A 2UVWA 2NX3A 1LL7A 1QBBA 1GK8A 3HB9A 4JR5A 2FGLA 1XW8A 1Q65A 4RXGA 1DJNA 4JTUA 5JH2A 5DLFA 1GUVA 4LUTA 4M6UA 4RNJA 4AX6A 3PY2A 4ATDA 3NVTA 4UTLA 4H83A 3D5HA 1TTIA 2R8HA 3GE7A 3H4DA 4PN2A 1Z41A 1R47A 4NASA 5IDZA 3VIMA 1IHIA 3GXDA 2QLYA 1ESWA 1D3GA 3APYA 4GCAA 1TV5A 4UTTA 3LGEA 3W75A 4EVZA 4Y9PA 3UGRA 2OWCA 2FH6A 3PTQA 4BF5A 3QF0A 3WIJA 3QY7A 4UQDA 3QSTA 3R0KA 1SZFA 3A3XA 3GC5A 3L12A 3LM7A 4ONVA 2VA2A 1UJQA 2Z28A 4LU0A 3BK0A 1UC4A 3VKBA 3GR4A 2EG8A 4CD7A 1VJIA 2CLHA 2AAAA 4M6PA 3HPFA 2J25A 1NDZA 2VRJA 2W0UA 2YA1A 3HPSA 1FCBA 3TXVA 2BY0A 1MZRA 1V0NA 4MFEA 3B04A 4Y90A 4QAWA 2PDGA 1FKXA 3BQ6A 4F50A 3EA2A 1ODZA 2QDEA 4O57A 4EXBA 1XLCA 1OCBA 1XLMA 3RMEA 3QXBA 1K9TA 4F2TA 4DLMA 5FJIA 4JYEA 3AXIA 2DJXA 3HGJA 4LVFA 3QQ1A 3OVGA 2JQXA 3ABSA 2OMAA 1RJQA 2VD8A 1TQJA 3G1AA 4EPDC 1C9WA 2GJNA 1UIOA 2IS7A 3GTXA 1O5XA 4BHYA 3UERA 2FHFA 1CXHA 4A22A 4YVPA 4XD6A 4ML4A 2O7QA 2GGEA 4J27A 3AS1A 3UXLA 1E0WA 4I7WA 3UR8A 2YW3A 5DMMA 1JVNA 3EXSA 1W1VA 3M43A 4IMAA 3B4YA 4H7VA 4GY1A 3QV6A 3PR4A 1SO5A 2IXUA 2QPUA 2OOGA 2V2CA 3T2OA 5KEZA 3WJWA 2E9LA 3GDLA 4IMDA 2OEMA 3KDOA 1XSKA 3P61A 5XIAA 1LRTA 1KFBA 4D8ZA 1QOPA 3A4JA 4MFDA 2PP0A 1GVQA 3BG5A 3VKAA 4LNCA 1V3IA 2GGJA 1KFEA 1HN1A 4AUBA 1Q45A 1FDYA 2PWDA 2ZXAA 3M0MA 1FH7A 4UFIA 1DQXA 2DSWA 4Q33A 2R91A 2E40A 1ICSA 1YRRA 2WW5A 4ZXLA 1CLVA 5E5CA 2CLIA 1J6PA 2IPGA 3N2TA 3TSDA 1RVGA 4J3WA 5FEXA 4MKNA 5D2XA 2H3BA 4XV0A 4GC3A 2Z1WA 2R1KA 4E2DA 5LGZA 5XIMA 4HNCA 2NQZA 2HK1A 3S42A 2R6OA 5BXRA 1GG0A 4PA8A 2ISWA 2E7FA 5HPOA 5A6SA 5KFRA 3SJ3A 1JIHA 3C8FA 1NOWA 3RAQA 4IJBA 1I1WA 1QATA 2J9XA 4V28A 4QFUA 4UNLA 3EX4A 1LBLA 3U7BA 3F4VA 2GJLA 2I56A 4QCEA 4WGXA 3RBEA 4KMQA 3QHNA 3E0LA 1ZBCA 3M41A 2RUSA 3ID7A 4I5UA 2PC4A 5I78A 1H63A 1XUZA 2B7PA 3EEGA 5D2TA 2C7FA 4AWUA 3WFZA 2WOQA 4Z2IA 4EP8C 4D8AA 1JUEA 4KEUA 5DQIA 4GQRA 3H22A 2XDFA 3NFUA 3BJFA 2MUCA 3S9ZA 1JG9A 1G1YA 2PDBA 2PDPA 5I00A 2DUAA 3BAJA 3S2JA 3RB6A 1GT8A 1TZ7A 3UCQA 3GY1A 3AIEA 1FH9A 1BPLB 4S38A 5CJMA 3CJPA 1OX4A 2ZTKA 4GO9A 4WF7A 4K2SA 3IRSA 3E5PA 2XFRA 3U48A 3AHZA 2Y8UA 1QDSA 4CU8A 2VZTA 2OZ3A 2J7BA 2V3DA 4ZFCA 1JD9A 1EC7A 1R6WA 5BOFA 1FXPA 3VXGA 1TPWA 4JY8A 4Q8UA 4IIEA 1TO3A 3MCNA 1FVPA 3VZXA 1CB2A 2R1MA 1B57A 2HV5A 3G18A 4C1NA 4S3GA 2OGYA 4P61A 2J74A 1JCJA 1X6LA 2XSBA 1Z9AA 6ENLA 1ADOA 4FNPA 2V67A 2OODA 4G7EA 1J8VA 2A79A 3RYSA 3VO0A 2WM0A 2TMDA 1V8EA 2A3AA 4Q8TA 4IIHA 2VGBA 4L6DA 4PUJA 1HL2A 4O1EA 3L0GA 2VNCA 1GVYA 5DQPA 4D9PA 2ZZ2A 3ZJ6A 4PEKA 3P81A 4FMVA 4ZQPA 3M44A 3EWBX 1JNEA 3EB4A 3WDPP 3Q8PB 5HNNA 1W2VA 4ZL1A 3ZVHA 2GOKA 1XS2A 1XL9A 1VH7A 4UQEA 4W88A 1Q6QA 1PB0A 1BG9A 4IZGA 1EPVA 2TAAA 2BBFA 4RNHA 3PZQA 5BW6A 2VCAA 3HZ3A 3M0LA 1M6JA 4MWAD 1TTQA 1JAKA 2BLEA 3VFCA 1U2YA 2WHMA 1G01A 1UP0A 2D24A 2UY5A 2YBVA 4HMCA 4HQVA 1ENUA 2DORA 3KRZA 3E9AA 3AZRA 3WELA 4F4XA 5E09A 1D2KA 1DPMA 4EWJA 1WXZA 3MSDA 3DFQA 5KFMA 4WSKA 4WJXA 1R7OA 4WD0A 2UVRA 1TVNA 4J9QA 4DO6A 4IP4A 4KCVA 4JN6A 3NQVA 3UESA 2NUXA 2V4RA 3ABRA 4TX6A 3NR0A 3VDBA 3R94A 3VIKA 2VYOA 1ZUAX 3LHTA 5FIPA 1E51A 3ERPA 4DUWA 3TYUA 4HNTA 2J47A 3ITTA 3QZ6A 3TK7A 3O05A 2XYLA 4HTYA 3NTYA 3IGXA 3BGGA 1AW2A 2G50A 4W7UA 3S6TA 1TV8A 2WPGA 5D9MA 1J6OA 4NJHA 3ZR6A 2YL8A 4LW7A 1KCZA 1JFHA 5C6MA 4ZFMA 4PCSA 1MW1A 3U2ZA 3DG3A 4IQJA 2NQJA 5L1KA 1W1B1 2YL9A 1FHVA 3VD7A 1Z89A 2XZ7A 5C54A 3K5XA 1R3TA 1B0IA 1W54A 5C5YA 3NXFA 3PB0A 1A5AA 2VZSA 3BUVA 3CT7A 4RLIA 3RUBL 2QF7A 2YOCA 5J5RA 1C9DA 2VTFA 3GB6A 4QCFA 3KCLA 4A05A 1IWPA 1UH2A 1VKFA 3M0ZA 3RHGA 5DRIA 3HQNA 4FOJA 3NCOA 4QG6A 2Y4SA 1C91A 4NLGA 4YVXA 4LVDA 3AOFA 2ZUSA 2XCAA 3JW7A 3DHUA 1Q4WA 5KFUA 3EX2A 1LORA 1MW0A 3TW9A 1EWDA 4QM1A 3ICJA 4GZ7A 3GDTA 2TSYA 1E6XM 3F1QA 5I07A 2VOMA 3K2GA 3NO5A 1QK0A 3ISIX 3AAMA 2WZHA 2V2HA 1W3TA 2WMGA 2ZZ5A 3C2OA 1FWTA 4UR9A 3MMWA 3KOFA 3LLDA 3RCYA 3O6YX 5FL1A 2QPSA 3QTPA 1T94A 1TIWA 3PW5A 4LBUA 4XKMA 4JGDA 4IFOA 3GXPA 3WLHA 2E9MA 3ZOAA 3VX0A 4Z17A 1GJPA 4QQ3A 5CPQA 4AEEA 1ZQ5A 3GO2A 3W7QA 3IUHA 1PZ2A 1WKFA 5JBFA 2DPJA 1JCNA 1U1JA 1A5OC 2A3CA 4WJEA 5E0CA 2RH9A 1A3XA 3TR2A 3LCXA 3V0SA 2I14A 2PU1A 1DJQA 4YYCA 5D8WA 1PV8A 1JPHA 1UROA 1F8MA 3VTRA 1MFUA 3CUHA 5LSMA 3HOJA 4XISA 5A95A 3FAWA 5HA7A 3SY8A 3KCOA 1C29A 3R43A 4JTTA 1XICA 5BZAA 3AMCA 4DUXA 1VYRA 5EL1A 3NPUA 4WXZA 5I3GA 2DV0A 3FGCA 3S5SA 1K77A 1XDLA 1FCVA 4K39A 4RDWA 4H1ZA 4EKJA 4PUKA 1XDMA 4UTUA 3EA1A 3O2LA 3H6OA 2ZXQA 3DHPA 4NIRA 3I68A 3DN5A 3GK0A 4EF8A 3QRHA 3OLEA 5FJOA 4F4YA 3VGHA 3NZGA 1FWJC 3WUFA 4EK7A 1V0LA 2J7CA 2Q8XA 3NQ8A 3FY1A 1MXDA 4J7RA 5FACA 4AH7A 5G1YA 1EBHA 1V6UA 1S0OA 2I9EA 3A6OA 1UD8A 4RNNA 4LUIA 4HHPA 3RMJA 2FZ9A 1U83A 5KFPA 4XUYA 2PB1A 3G6VA 4MYAA 3UR2A 4C6BA 5CSSA 4HMNA 1EHNA 3KBWA 2OKTA 3CYVA 5DF0A 2PMQA 5A2CA 1E43A 3L67A 1SR9A 2XN1A 4UR8A 3E0VA 1D7KA 1XINA 3NYDA 1KFKA 2W92A 3QW4B 3QGKC 1ODUA 2AAMA 4MY8A 1K9DA 2GOUA 2VCBA 1EIBA 2YDAA 1E6NA 2V69A 3L68A 3URNA 5BRPA 3GAYA 4EBDA 1TELA 1XRSA 1OD0A 4PTWA 3GIKA 1J5TA 4XB3A 1F9CA 5FSDC 1RLCL 1DIDA 1CGUA 3WFLA 3I7RA 1KNWA 2Z2AA 3QMRA 4AW7A 2OJPA 3GH4A 5LNSA 3K8LA 3II1A 1UR9A 4OWGA 5EBAA 3W7KA 3WH6A 1NELA 5A8MA 3LHZA 4YHEA 2CEQA 1VBRA 4DJED 1DJYA 3W70A 1AL7A 4B5WA 3W7JA 4R9XA 2VGGA 4KS0A 4CNPA 3UZ5A 2P3EA 2E9BA 4HYRA 1VEPA 3MPGA 4PMVA 3BMVA 4LAZA 3NPWA 3E5BA 4W4QA 2BX7A 3WQ5A 1OK4A 4XAYA 1VPYA 4N6FA 3LLXA 3WJZA 1THFD 2PTWA 1XYMA 2FQIA 2EJ1A 1MWOA 4UB9A 4KRUA 2DSZA 1PIGA 4JQ4A 3KVLA 3ZVIA 3VDGA 5HR6A 5A5WA 4HOXA 5EDWA 1BWLA 2RJGA 2AGPA 1EZWA 1ZAIA 5K9CA 3N2CA 1JL8A 1C7TA 1FWIC 4XO7A 4EBEA 3LNMA 9XIAA 4YLWA 3GRIA 3WQDA 1LF1A 2Z00A 4J9LA 1DWJM 1HP5A 1L9WA 3HG5A 2OEJA 5HJLA 1YX1A 3N6JA 5AY7A 4U3CA 1W56A 3WF0A 2NVAA 2YCIX 3GNDA 4FSAA 1LG1A 1FXQA 2Y88A 3WUBA 1BGGA 3H55A 2ZA3A 2IKGA 3UG5A 1BKHA 4FPSA 3UPBA 4X61A 3WK0A 4JTQA 2HS6A 1DV7A 3TTQA 3QZ8A 4S2BA 4HNUA 3NL2A 1UIPA 3L4VA 2VELA 2XIBA 2C0HA 5REQB 2KX9A 5F9NA 1YE4A 1H11A 3WDIA 4DWSA 4ED3A 4D6EA 1JZ6A 3PZUA 5CEWA 3IUIA 1V3JA 1XX1A 1JI1A 3BMWA 3QW3A 2W9CB 3OJGA 4GG9A 4YR3A 3B0XA 3LMYA 4C6IA 3LZ3A 1FUYA 4L5ZA 2AMGA 3MI3A 3BLLA 2HNEA 2ZA2A 4DXVA 4XSMA 4NY2A 1GVRA 4J3VA 1M68A 4DELA 4TUFA 1LJYA 4L7ZA 2E6FA 2PTXA 3LCFA 1E1EA 3W2LA 3OZPA 1GJUA 1OINA 4GYJA 4DF0A 4GKLA 4O15A 3BSHA 2ASJA 2QGHA 4DI8A 1NWTA 1RUSA 3KHHA 2HS8A 3MA8A 4MB4A 1JXLA 2P0OA 1JPKA 2NLYA 3W1NA 5D03A 4CN4A 2OQYA 1GTEA 4Q44A 1FOBA 1JGIA 1E55A 2OQHA 4YNGA 1B5TA 3GHRA 2OSXA 5I3IA 1FKWA 5F4SA 4IM4A 4U33A 3HJEA 3WD2A 1VC4A 2WCSA 2WLZA 4DM2A 2G5WA 2WSKA 2ZUTA 4B16A 1E4IA 1JX4A 3GC2A 1RCOB 4R8UA 2VDGA 3UVAA 2J7GA 3VNZA 2BXVA 4W85A 2X30A 3DH7A 3NZ1A 5CGQA 4NZ4A 4OV9A 2QCCA 1E40A 1OADA 3LQGA 4ECLA 3RITA 4REQA 2I16A 4DUVA 3OBAA 4KRZA 4XG1A 3SAZA 3M9MB 3ZR4A 1FFRA 4IL2A 3MP5A 1DWFM 3QY8A 2Z7GA 4ENLA 3PBYA 1TJ2A 2D22A 3EOOA 5FSEC 3BOXA 1BGAA 3W1PA 2UWFA 4KFNA 1B1YA 3FYYA 1ZHAA 3O63A 2Y85A 4POCA 1JAEA 3HFYA 5BU6A 1CGVA 1SGJA 4FK9A 4US5A 3SGGA 1UWAA 5HR7A 1R2SA 1O1ZA 1RPXA 2XSAA 4GYKA 3RAXA 1ITXA 1QAPA 4MNMA 3L4YA 2NSXA 3PAJA 2H9AA 3TOPA 2D3LA 5GQBA 4Y9AA 1O4UA 4TU1A 1UASA 4MJZA 3MZNA 3NPXA 4EYHB 1JFXA 2UY3A 3N19B 4IL0A 2XPKA 1SR0A 3DOPA 3FVDA 3IJ9A 1XISA 3KM8A 3KBJA 4HYWA 2PTZA 1EYWA 1R9ZA 3ITVA 1EJUC 2CLOA 3R58A 3EWWA 2BASA 4AXKA 4MJ4A 1MUCA 3CWOX 4OBRA 4ASTA 4O52A 1HO1A 1W8SA 2ZZ7A 2VMFA 4JTKA 4Z0SA 1F6PA 3T5JA 1K6WA 2WVVB 2NZLA 3LBCA 5GJPA 1DTUA 4AZ5A 3L0NA 3XINA 2QCFA 3RGTA 1TRIA 3E38A 2WQDA 4JTAA 1BF6A 2C8NA 1TYGA 2YYTA 1J9YA 4MZ8A 5LA0A 1SQ7A 2VJXA 1L2QA 4ECUA 2V6AA 3L2LA 2AL2A 2Z2UA 3QPYA 1NTHA 1EX5A 3CMFA 4I6VA 4F4ZA 2E4TA 3G1RA 4N9DA 3S83A 1P0DA 3OHAA 4HGXA 1GZGA 4EE9A 1W1A1 3P80A 3WJXA 1HUVA 1YPXA 2UZ9A 3GXMA 3V5OA 2VVNA 3GG8A 3N12A 4WKHA 5T9BG 3TYDA 3B9NA 3PAOA 5FF0A 3KRSA 1S1PA 1H1YA 3N2XA 4XZWA 1HJSA 3S4TA 3EPMA 3WBWA 4LF1A 2JF6A 4L9ZA 3Q37A 4OKDA 1HNYA 1PL9A 3VIIA 5FOOA 3Q94A 4V1XA 1PWMA 4LRTA 5H8UA 4O50A 3H7UA 3DKLA 4GACA 1VLIA 3AUJA 5BWAA 5I23A 4O14A 1VFOA 6TIMA 3O6AA 3GTIA 5FEZA 4WHBA 3EBVA 4HZMA 5F2GA 3AMGA 2WO5A 2QDDA 3BW2A 4DJEA 3PZNA 1QU4A 3BDKA 4OGZA 4TR9A 3S2NA 4UFMA 2CBVA 1KV5A 5AC7A 2DVXA 3HN3A 1O60A 3W83A 1M7OA 3IGHX 3SI8A 3GXIA 3MO4A 3ZR5A 1QO5A 3B9DA 3RO6A 3GV5B 2HVOA 3G77A 1OHLA 1W9BM 3T7VA 5EFFA 1HL9A 1Y0EA 3QLDA 4NI3A 3MQTA 1E6QM 4XZIA 4WDXA 4WQ6A 3PW7A 1IIHA 2BGSA 3BJYA 5ECUA 2OZ8A 4KEVA 1JIBA 1SJDA 3CGTA 1H5VA 3SQLA 5GNXA 1A5SA 3C0JA 3TP4A 5AHIA 1G7UA 2ZVIA 3V0UA 1PDZA 3N15A 2PFHA 4CU6A 4BQ5A 1H09A 2JF7A 4LJ3A 4L9YA 1UZ4A 2D2JA 4XSLA 4ED2A 2EKCA 3W7NA 1V5XA 1KV8A 1M03A 3ZT7A 3HA1A 4H6KA 4LYRA 3FYPA 3KOXA 3REQA 2HSAA 1HKWA 2UY2A 5DG9A 3E0FA 4R34A 4DM1A 3VMNA 4MB1A 2E77A 2P8CA 3AC0A 3FA4A 4Y9MA 1BXCA 3TDFA 4HPHA 4N9BA 4EYIB 3TV8A 3NQ2A 3MHUA 1E6ZA 2XVNA 1PTAA 5IBXC 2OFJA 5D38A 4AIBA 3Q45A 3CLMA 1G94A 1E4LA 3TNOA 1X8CA 4IQEA 1U5JA 1EGMA 1DWIM 2AGQA 3CUJA 3D6NA 3IIPA 3K46A 2FGZA 1W31A 1JCXA 2A3HA 1IXOA 1E1CA 5EMKA 3LHYA 2EJAA 2HVNA 5DBUA 5DGBA 1JZ8A 1YTEA 1XYZA 1QW7A 5JH1A 1U5VA 1UKOA 3GIQA 3PTDA 3T0BA 1TQXA 2J7EA 2Q71A 1IXNA 3VNLA 1ZCCA 5EWGA 1FH8A 3Q8QB 1UR1A 3DKJA 4QISA 4LCSA 4M1RA 2YIHA 3PN8A 5BMWA 1U5HA 4M0XA 1MZHA 2JGQA 3SEPA 2WV8A 1X38A 1A0DA 4IUGA 4UUIA 3B05A 1VYSX 5LNRA 1KXHA 2XHYA 1GOQA 4MHBA 3NUKA 3HG2A 4GC6A 4PUEA 3CHDA 5LIUX 1VRXA 1OFBA 4LGXA 4UTMA 1TKKA 3AZTA 3M9YA 4NKCA 1JUKA 3S9YA 3W2MA 4US6A 3COTA 4YP3A 2HZGA 1A0EA 3BAKA 3V6HA 2BV9A 4CU7A 3A9BA 1S2AA 4RUCA 3GFZA 3UT0A 1V6WA 2CETA 3GVVA 1H0IA 1SVDA 4G6CA 4JXCA 4JKMA 4HBKA 3EX3A 4DUOA 2DT0A 1WBJA 5I03A 3L5LA 1KBLA 3P3BA 5K4ZA 4Q45A 4D1JA 2A7PA 3MHGA 3TN4A 3SN1A 2D0HA 1AQMA 2Q3OA 2RAGA 3QTGA 3MCOA 3CM4A 1UP3A 1TSIA 1E9LA 3T07A 2CPUA 2XIMA 1HGYA 4GLEA 1O1HA 2NUYA 1HZYA 3QV9A 4ZE4A 3AFBA 3MYPA 1AUSL 1UZHA 5FCZA 1WAWA 3IV8A 2H6RA 2FPYA 4ZQCA 4LUJA 3W26A 3B0YA 3SI9A 1YQ2A 3QGVA 3ORWA 1OF8A 3ARWA 4U7CA 1J5SA 3W7HA 1UMYA 4KGJA 1R3VA 3NO3A 3QVQA 3KE0A 5F2LA 1PTDA 4WKAA 1Q4NX 2RDUA 2VC9A 3FCPA 4QS5A 1RBAA 2VD9A 3RCNA 1EF2A 5BXSA 3G0UA 4RE3A 3THUA 2NWRA 3AWNA 3VC5A 1AZ1A 3P67A 2WZEA 1OD8A 6A3HA 3KHJA 4G56A 1EBGA 3V5FA 1SW3A 1SFTA 4JCLA 3KHGA 3L2IA 1UOKA 3PG8A 3FXGA 4RDYA 3QEZA 1J01A 1X8FA 2YBTA 3DG6A 3WNNA 3S1GA 2HPMA 5KG3A 2PPGA 3R1ZA 2BP1A 3PTKA 3TN6A 1DTNA 8CGTA 1OC7A 3PTMA 3WLNA 1MUMA 4UTKA 2OR2A 3GDMA 3S2LA 4DBEA 1ME9A 1H7RA 1SJBA 3UZYA 1GTHA 2XN0A 3AS3A 4JTDA 4UXDA 1QXLA 1NFGA 2W8KA 2TODA 4PFMA 1DEDA 3W6LA 3CTLA 1ECEA 3B8IA 3RJXA 4PUNA 3ARXA 3K4AA 4N4PA 3O3RA 2XH2A 2D23A 4P7LA 4IFRA 4QTGA 2GJPA 3VX1A 2XIQA 1UD5A 3CB3A 4Q4KA 3LV6A 1K1QA 1MEWA 4M1BA 2E28A 3EB3A 4BF9A 1R38A 1DXEA 3NNTA 3AYSA 5LXEA 1RK6A 4GCXA 3PWAA 1T3NA 1TX2A 3M64A 2CWXA 3MSYA 4IRDA 3LDVA 1Q66A 5I0DA 1HKKA 4IR9A 3FA5A 5EFDA 3PJXA 1W5MA 1P7TA 4F0RA 1ZETA 1PYFA 3VIGA 3RG6A 3W85A 4IMEA 2Z26A 2ADAA 3ATZA 3MUXA 1T96A 2DZSA 1DIEA 3W25A 3AYTA 3GTFA 3GU9A 2D73A 5KG0A 1RY0A 4JX6A 1ECQA 2Y7GA 3TQKA 2A85A 2INFA 3EDJA 2O7SA 3KWXA 2EQDA 3ZZ1A 4LVBA 3GQCA 3BH4A 1M7PA 2G4JA 2ZE0A 4FO4A 3EOSA 2PDIA 4CN6A 4PMQA 4ZOBA 3TCSA 4G3IA 3AHTA 4MWAE 1DHPA 3C2EA 4YTSA 1JCMP 3BQ1A 3H12A 2YFNA 4ORMA 3TNBA 4Q4SA 5CGMA 3YPIA 1LG2A 4KWUA 5I7GA 3FX4A 3UJSA 2NXGA 2CLMA 1A5NC 2CIPA 3KW3A 1XLLA 1W5PA 1UD6A 3UZXA 1OGSA 4HA4A 4HCLA 3M16A 4E2VA 4ICCX 4A35A 3PBVA 4DPQA 2FGBA 4EPKA 2FJUB 5D33A 2E8ZA 1GQJA 1CGTA 5KT6A 1NY1A 2JALA 3CWNA 3MUY1 3V36A 1SZRA 3VMOA 4EXQA 4PMDA 3IACA 3L4WA 4GFSA 4O3PA 2ZIDA 5CBJA 1M1BA 3W7IA 2X41A 3QJAA 5AYZA 4MUPA 5FAGA 2IKIA 1YBQA 3MS8A 3NQDA 2P10A 3GHUA 3RNDA 1TB3A 3GV7B 2G3JA 3QZ7A 1UBPC 2YPIA 2C71A 2IQTA 3PW0A 4L9XA 3CT2A 3GG0A 4Q8MA 3HPXA 1QTWA 3H2OA 1EXPA 4LXFA 1MXGA 4JKLA 3WNOA 4B2DD 3K1GA 3C4UA 1JGMA 1RCQA 4Q7IA 1I2OA 4XTIA 4QWCA 1BWVA 4Y9OA 3G1SA 1IXQA 2P50A 5CPNA 3WQOA 4W5ZA 1Q6FA 4UNKA 4MDPA 1F73A 2XGIA 3LXBA 3MJYA 1US3A 1NDWA 1O6IA 3MBDA 2GQ3A 3CU2A 3UEQA 4B5NA 4RW3A 3POCA 4QW8A 2OQLA 5CC5A 3FAXA 2HE5A 3VOCA 1RBLA 4DXXA 2BOGX 4AWSA 1G9HA 2J9ZA 3DGBA 3INPA 3CIVA 1EJWC 3NQGA 3WBYA 4MTVA 1UWUA 3ZLGA 3N4FA 3F4NA 1OQFA 3S6DA 2X0HA 3GH7A 4J4KA 3ALFA 2A3BA 2J7FA 1HFBA 1O66A 3LTSA 1SO6A 2EEXA 3S3GA 1ALDA 4AYGA 4X3ZA 1TMLA 2RDXA 1EF3A 1SYTA 3LM3A 1R87A 2VP8A 2C0AA 4DX3A 3TOYA 1O94A 2PAJA 5DQHA 1W3NA 1OWQA 2GFTA 5FESA 1UD3A 3CO4A 4KWSA 3BV7A 4R7WA 1EJTC 5EYWA 1B3VA 2ZX6A 3WQ4A 4Z2LA 1QR7A 2V63A 3RPTA 3ZXWA 3BLEA 1YDOA 2AKZA 3T2PA 3Q4DA 3U57A 1I6NA 2QCEA 1VEOA 2Z1BA 1XLGA 3GYEA 4ZODA 4AC7C 2CKSA 1TPFA 4JQ1A 5A8QA 5CPTA 1YTKA 4K7YA 1G0CA 3GQYA 4NAEB 3GZAA 3OZOA 4M24A 3ARUA 2W6RA 4BS0A 4J40A 3WD1A 3RCMA 1KCLA 3O6CA 3M5XA 3OHBA 4LAUA 1YXDA 1N2VA 1VBGA 2CITA 5IRPA 3BV4A 2XFFA 1LCOA 4H6EA 1ZJBA 1VCGA 3WF1A 1A50A 3B8VA 5I5RA 3EX6A 5KG4A 1W1YA 1IZKA 4EACA 1VPXA 1HF6A 4LYPA 3TVAA 4TQSA 4Q8NA 3PWGA 3TTYA 1E9YB 1CWYA 3WLQA 4RNFA 4V27A 3U2EA 1Y7VA 3UQNA 4UTTC 2W9BB 2BVWA 1KGUA 4QW9A 5LIKX 1PEZA 4MOZA 2WMIB 3B06A 1QHOA 1C8QA 5FEWA 1KTBA 2FDSA 3I3BA 2DJLA 1QPQA 1XG3A 3BCDA 4A3HA 2ON3A 1XM3A 5IHRA 1AQ0A 2BQRA 1EKOA 5A2BA 4FLOA 3W7DA 3WNLA 3G6LA 4W8AA 3T9PA 5CC7A 2CLFA 3PVXA 1OYCA 3VE9A 1SU5A 5HQMA 2HBVA 4KQNA 1XIGA 4GYFA 4ZO8A 4M80A 3B97A 4UMCA 1HTIA 3PZMA 3OG2A 3TJLA 3K13A 4H9ZA 4PODA 4ZVJA 2J6SA 3FJ6A 3BG9A 4TOQA 1KXQA 4DBDA 2DU2A 2P5NA 4X63A 4W7VA 3F5LA 2W62A 3DIPA 3BO9A 3UU0A 1CNVA 5BCAA 1E15A 3UWYA 1DJHA 4N9EA 3THQA 1OCQA 4PCPA 4FBUA 5CSRA 5F7UA 3ENLA 1W3KA 5F4WA 4LH8A 1KLZA 2VWSA 4H8HA 1GW1A 3EOUA 1G69A 3C52A 3PANA 3TEVA 3LRKA 3UZZA 3NDZA 3FJ4A 4A8RA 4QBXA 2PDLA 3MMDA 2PODA 1KFCA 2XGZA 4P5UA 4S3BA 4PBFA 2D69A 3R6IA 3QV7A 3NDOA 3IIZA 2X1TA 1HXJA 1GEHA 4X9YA 1IEVA 1UKSA 1NOUA 2BXYA 5K7JA 1S39A 2Y5EA 3WH5A 2QT3A 1CB7B 4JQ3A 4E3VA 1FWEC 3DYOA 3U0HA 3L0KA 1J0KA 3G1YA 4C6QA 5KFKA 4Y2WA 1W0MA 1TZ9A 1V6TA 4HOWA 3IRDA 3FFSA 5EA9A 4ZB2A 3L66A 4ECWA 2AOSA 2QF8A 3FNDA 1JQVA 4BI6A 3AQUA 4PSRA 4R27A 1KXTA 1Q5MA 3WZ0E 1YXYA 4L80A 1RYSA 4PMXA 3T5LA 3D47A 3VNYA 4Z1CA 4AX7A 1UQYA 3QKEA 2HWGA 1I2NA 4BFAA 1F3EA 3RR4A 1A47A 4CVUA 3AS0A 2BR0A 1E6RA 2F6KA 3ITLA 4DYEA 3ZYZA 1FWAC 4A8IA 1EZ2A 3S5OA 1S5NA 3RFAA 2O9TA 2ICSA 4QROA 1ZP4A 4OVXA 3W6YA 3C3NA 3DYMA 1ML1A 1ZB5A 1GOOA 5I6SA 3U5UA 4NRRA 3GTHA 1D8WA 4QEEA 3VZZA 5G4HC 5E1QA 4RZBA 2X1RA 4J9KA 3KEHA 5I06A 3GU2A 5FI8A 3ITOA 3SRDA 4ED7A 3UCCA 3UVIA 2WZMA 3LZ5A 5CBIA 4TVUA 4ZQNA 3SCTA 4C7GA 3OA5A 3KUMA 3QR0A 1J2BA 1WZKA 4MY9A 2V68A 4PMYA 4C6OA 4D8LA 3OHMB 3E0WA 3AXXA 3PPCA 2QJIA 4JHMA 1PKLA 5AC5A 3WG6A 5AFDA 3CL6A 2WMFA 1M04A 1W9DM 3B3DA 3V18A 1GYNA 1S5WA 3BOLA 1RK5A 4XKYB 2FVKA 2P8BA 4HYKA 1F2JA 2PGEA 2V9WA 4C5ZA 2GDVA 3TA6A 5EY5A 2D2HA 3CUXA 1QT1A 3CAWA 2BXZA 2FPVA 5F9LA 4B4HA 3BVJA 4F3HA 1MQRA 4DNMA 1JZ7A 4HNLA 3GR7A 4GK8A 1W3LA 4HT3A 1KRAC 5C2CA 2ZWZA 4OUEA 1FWSA 1MI3A 5AHMA 4DJFC 5DG7A 4EX4A 1AFSA 2YCJA 4G9PA 2C28A 3NWRA 1Q6DA 1KFJA 2ZOXA 3WDQA 2CZEA 2QMJA 2Z1SA 4NVTA 4Q4RA 2AMXA 2CESA 2J9YA 4L6HA 3VILA 1OF6A 3CS2A 5HQEA 4LFYA 1WA3A 1AH4A 4N2YA 4QRNA 3TYAA 4HK7A 2O92A 4KWWA 1C8XA 1OB0A 3BANA 1TTPA 3HO8A 3M5YA 1R30A 4KPLA 2VKZG 2X16A 1F4HA 3O8AA 3VKJA 5AHFA 1SZGA 5I09A 4W86A 2VEKA 2PURA 4MKSA 2BDQA 3WD0A 3CO8A 3CMGA 3AIUA 4HMDA 1ZSXA 2FHCA 3V75A 1H41A 1A5LC 5EB8A 1W5OA 1UPMB 1IGWA 4OTKA 3T08A 4WR3A 2IUZA 4Z1BA 3VPLA 4B5TA 4IMCA 4N42A 2PRMA 4FXRA 1ZENA 1AMKA 5EKYA 1T8QA 3C61A 1HIZA 5HMEA 4GI4A 4TTGA 2UBPC 4GIEA 4ACZB 3PHAA 1R85A 2OO6A 2QR6A 4U10A 3GFXA 3TMLA 3CTTA 3UA3A 9RUBA 2EPMX 2X8RA 3EKGA 3VM7A 2PDFA 2WVTA 3TC3A 2CZ5A 3L23A 2EGZA 5IBXA 1W32A 1CBGA 1EXBA 1XBXA 1H7NA 3OPSA 2ZZ4A 4M81A 1IWBA 3D46A 5DFAA 1GONA 3OQ8A 5REQA 4GABA 5KG7A 3GX9A 1CEOA 4RZ4A 5FF4A 8TIMA 3MYOA 2Y2WA 4AWEA 4CD6A 4XTDA 3MDWA 4RUAA 1E6PA 4JFVA 1UUQA 3FDKA 3WEMA 2FPTA 4MSSA 1LLOA 3Q8SB 2ASDA 5HMSA 1P48A 3FKKA 4GFIA 3VOFA 1Q6CA 2PCQA 5G2WA 3LV5A 2BZNA 2RDWA 1YHTA 4G1NA 3UG4A 1Z7AA 2OLAA 2B0MA 3TU9A 3KDNA 4F0LA 2FH8A 3GD6A 3IANA 4QWBA 2WKJA 3APTA 2QCMA 3STCA 4O11A 2G95A 2QUVA 1H51A 2ATMA 1GG1A 1HJQA 2WLYA 1YMYA 4AZCB 4DZ5A 4JAWA 3WFAA 3GW3A 1P1MA 1Z42A 4Z2GA 1K4GA 1H7OA 4IUOA 4ED0A 3P60A 4X0NA 3M0HA 5K2ZA 3T8QA 5JU6A 4HZ6A 2GK1B 5FA5A 2NT0A 4B3LA 3NGDA 2DEPA 1OT1A 1W17A 2V5DA 3BAWA 5D4YA 2FTPA 3LPGA 1UZDA 1KFLA 1BTMA 4AQLA 1NF0A 4Q4OA 3T5HA 3TSMA 3MB9A 1A0CA 5KFLA 4IGMA 3EZ4A 3ONCA 2X7WA 4L64A 2CW6A 5ABTA 3DUGA 4RX0A 3Q58A 4HN8A 3BE7A 4HU0A 1ZCOA 1ONRA 3N11A 5TIMA 2WJEA 3NQBA 3L4XA 1VJSA 2J88A 2EBNA 1TG7A 4XZNX 1AZ2A 5D2YA 5F4XA 1EOMA 1VBUA 3DHFA 3PM6A 4ECTA 1WCGA 1KM4A 1A80A 2QMKA 5A6KA 3KOWA 5E0FA 3LQLA 3CUIA 3KXQA 3WK3A 2NXIA 4H2CA 5LIYX 1RA0A 2HRWA 2GGIA 4S3KA 3PUGA 1XH2A 4XIMA 4IT1A 2C16A 1EFZA 4CCEA 4FOUA 3AMKA 1PHQA 4AY7A 3PP7A 4CKQA 4PZVA 3VOGA 5HULA 3HG4A 4M7TA 3JUGA 1SW0A 1P0KA 1QOXA 4GC4A 2Y7FA 3W72A 2FVLA 1PKMA 3B03A 1GVIA 5A6TC 5B7YA 3BLKA 2EO7A 1E9IA 1OABA 4GNKB 3VOIA 3OP2A 1S46A 1DP0A 5KFIA 3B0PA 3TZFA 5GVJA 1IZCA 4PB5A 1KBJA 3CASA 3OIXA 3MUAA 5GNZA 5HJXA 4GVIA 2EHHA 2Z4GA 3LBOA 5LNVA 1C90A 3AXMA 4LV4A 2W9AA 2IQ0A 2ZUVA 2C6QA 4L4LA 3WMCA 2RGLA 1AJ2A 4MNJA 1H1ZA 3P7YA 1B2YA 1NFPA 3NZRA 4F4RA 4YTRA 4TIMA 5AOUA 1M53A 4GJIA 1WXJA 3LXAA 4PL1A 1O5RA 1E72M 3IVSA 4I9JA 3QPEA 2CU0A 3I65A 3WLJA 3O6DA 1JQXA 1QO2A 2OT1A 3LNPA 3ZLHA 4ALDA 1G4SA 1WB0A 5KT2A 4GISA 3CUZA 2PBGA 4HNNA 4XX6A 1QNOA 4FXFA 4E2OA 1GQNA 5D04C 4AD3A 1V6XA 1V02E 4AY1A 4A3QA 3SQMA 1T6MA 4BWLA 3M7SA 1DJGA 3MJMA 3SCNA 4JUZA 2GQ9A 4BKNA 2XGBA 8RUCA 1ZLPA 2ZRVA 3E2RA 5KETA 1EYEA 3RRAA 4WY0B 3H8AA 1KM1A 4JTFA 3FS2A 4V33A 1PS9A 1S3TC 5DN1A 2ZCGA 2VDIA 1F76A 5K4XA 1G6CA 3EA3A 4U6PA 4RNMA 3BURA 3HMJG 2G3NA 1NVMA 4CD5A 1XCXA 2AQWA 5KZ6A 4FI4A 4WDUA 3G22A 4LUTB 4RL3A 4NAFA 2IBKA 2V81A 1UKPA 2E1DA 5I02A 1YEYA 1QJWA 4J2MA 4BEUA 3TC6A 7TIMA 3CPRA 3G8EA 4QAIA 1X98A 2J6VA 2ZQ0A 2AGOA 2E6AA 2Y63A 4MB5A 2R1PA 5CC3A 4CLMA 5DXXA 1PUDA 2VCCA 2CFFA 2VURA 2OKOA 3VOHA 4UZSA 4HNOA 4UQ9A 9CGTA 2FVMA 1F61A 2GPTA 4OQVA 2ABBA 1Z44A 3KTCA 4KERA 3PUDA 1M5WA 4MIMA 1Y5VA 2B7QA 2JKAA 4GQGA 3R89A 1FDJA 1M9HA 4DZHA 4O4VA 4E8CA 3PBWA 4BY3A 1Y5WA 4LAOA 1XG4A 4ECVA 4MWAC 1OEPA 2V0TA 5HJYA 3VDHA 4NQ1A 4HOZA 3OHIA 3IJ7A 3Q67A 3PZIA 3MFHA 4N4QA 4HVXA 4HU8A 4DYJA 4JTLA 2Z0IA 4YPJA 2C13A 3RLHA 4IICA 2E1WA 5G2IA 4B3KA 1E4MM 3KS6A 4LQ1A 4P8UA 3TSBA 5DXYA 3G0SA 4P8VA 4LRSA 5C7HA 2ZRYA 4A3UA 3SUWA 1K9EA 1IQ8A 4E38A 1WZLA 5BMXA 3WD4A 4OE7A 1IGSA 1WP6A 1ZJIA 3BLOA 1A4MA 4UCFA 5FF3A 4L1XA 4MF4A 3BGAA 2PWVA 4X9SA 2BFGA 2GWGA 2BQUA 4IPJA 1CDGA 1REQA 1QMLA 4C5YA 3PNUA 5TBOA 3E12A 5HUOA 3VGFA 2R1NA 2J78A 3OA3A 4FX6M 1EJSC 3PJUA 4J9PA 4M29A 3M46A 1ZNNA 1ZFJA 3DBNA 3A4XA 4C65A 1B54A 4AVFA 3H54A 4GBDA 4O1CA 3MZ2A 2CCRA 1UWQA 1M7XA 2BSLA 3AXHA 3MC5A 2VX7A 1TPVA 2BVTA 3WH9A 3LPOA 4C6CA 3U6WA 5G4EA 4YJ5A 2WMHA 4PGLA 1X96A 1H3GA 2ZDRA 3MWCA 1J18A 3N2OA 4I9AA 4UFLA 4LV9A 3TXZA 2IXVA 3O0KA 1N7KA 4GHRA 2R1LA 2G37A 1M7JA 3TQVA 5FJRA 2H8ZA 1HJWA 4HK6A 2W79A 2HE8A 1AL8A 2PWFA 4GUJA 3TZNA 5A6JA 4XD4A 3OU8A 3H2CA 1XGEA 3HG3A 3UYIA 2KZHA 1LOSA 1XFBA 4H7CA 3TAOA 1F05A 3WX7A 1ME7A 4YTQA 2A4AA 3KX6A 3E6EA 3GIYA 5C55A 5M3WA 4E2BA 3PR5B 5XINA 4H6QA 4QGCA 3SCVA 5DMLA 3G8RA 3UWZA 4N7QA 5DG8A 1E3XA 1W9UA 1P1XA<