1P1MA

Structure of thermotoga maritima amidohydrolase tm0936 bound to ni and methionine
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
404
structure length
404
Chain Sequence
MIIGNCLILKDFSSEPFWGAVEIENGTIKRVLQGEVKVDLDLSGKLVMPALFNTHTHAPMTLLRGVAEDLSFEEWLFSKVLPIEDRLTEKMAYYGTILAQMEMARHGIAGFVDMYFHEEWIAKAVRDFGMRALLTRGLVDSNGDDGGRLEENLKLYNEWNGFEGRIFVGFGPHSPYLCSEEYLKRVFDTAKSLNAPVTIHLYETSKEEYDLEDILNIGLKEVKTIAAHCVHLPERYFGVLKDIPFFVSHNPASNLKLGNGIAPVQRMIEHGMKVTLGTDGAASNNSLNLFFEMRLASLLQKAQNPRNLDVNTCLKMVTYDGAQAMGFKSGKIEEGWNADLVVIDLDLPEMFPVQNIKNHLVHAFSGEVFATMVAGKWIYFDGEYPTIDSEEVKRELARIEKELY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein TM0936
publication title Structure of the hypothetical protein TM0936 from Thermotoga maritima at 1.5A bound to Ni and methionine
rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 147
structure length 404
sequence length 404
ec nomenclature ec 3.5.4.28: S-adenosylhomocysteine deaminase.
pdb deposition date 2003-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1p1mA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1p1mA02
4NI8A 4GBDA 4L9XA 2PUZA 4F0SA 1KCXA 3PNUA 4AQLA 3URBA 3K4WA 5HMFA 3GIPA 3IRSA 1NDVA 2RAGA 4C60A 3NQBA 4XAZA 3GTXA 4V1XA 4H9ZA 4IGMA 4PBFA 2Z2BA 2FVKA 4B90A 3GTHA 4R85A 4C6PA 4E3TA 1GKPA 3F4DA 2IMRA 4M51A 3UR2A 1M65A 2P9BA 3K2GA 2QS8A 4WGXA 1PB0A 3UPMA 2O4QA 1A5LC 4PE8A 4F0RA 1KRAC 4EPBC 4LCSA 1O5RA 3NEHA 4EPDC 3OVGA 4XD6A 2R1NA 1QXLA 3CS2A 1M7JA 3QY6A 1NDZA 1EJVC 3ISIX 1YNYA 3LS9A 4CNSA 2WJEA 3ID7A 2Z2AA 2G3FA 3HTWA 5AKQA 1YIXA 2ADAA 4GC3A 1POKA 2I9UA 4GK8A 4RDYA 4HA0A 3LSCA 1RA0A 1R9ZA 4DLFA 3R0DA 4IGNA 1XWYA 4HJWA 3TNBA 5FSEC 2VC5A 3CJPA 3OJGA 1P1MA 4LCRA 3GRIA 3MDWA 4C6MA 1I0DA 3IPWA 4IFKB 3OODA 4ERGA 3WYZA 1J6OA 4LAKA 4DNMA 5LXXA 4BY3A 1NFGA 2Z26A 1GKRA 1FWIC 2I5GA 1HZYA 4KQNA 4CQBA 3FDKA 1EJTC 2QPXA 2YXOA 1M68A 1UIPA 1UBPC 3MPGA 2GWNA 4L6DA 4CNUA 3WMLA 1FWHC 4RE0A 3PAOA 2O4MA 1KRMA 3E3HA 3GUWA 2A3LA 2ICSA 4NP7A 1ONXA 5HMDA 4H9XA 4B92A 1FWCC 4TQTA 4GX8A 5E5CA 1FWEC 1YBQB 4KF1A 2AQOA 2AQVA 4AC7C 1A5MC 3G77A 4PCPA 3A3WA 3IARA 1EJUC 2Q01A 1FWBC 2YB1A 4H00A 4C6FA 4GYFA 4ERIA 3KM8A 3RHGA 1EJSC 1EYWA 1RAKA 4C5YA 3MDUA 2PGFA 4DO7A 3C86A 1FWJC 3S2MA 3E0LA 1XRTA 4DZHA 4DZIA 4QS6A 2HPMA 2FVMA 3IV8A 3CAKA 2VM8A 1UMLA 4R88A 3IACA 3PANA 3SO7A 1P6BA 2W9MA 4CEUC 4BJHA 3TN5A 2WJDA 4QS5A 3LNPA 4HK5A 3LU2A 4IFRA 1GKQA 3QY8A 4EPEC 2FTWA 1ITUA 3ORWA 1XGEA 4LCQA 4G2DA 2OODA 3MJMA 4B3ZA 1XRFA 2CZVA 2PLMA 3TN6A 1W1IE 1J6PA 3NURA 4LH8A 2E1WA 4LAMA 2YZ5A 2OB3A 2F6KA 1JGMA 1RK6A 3F4CA 1FWGC 2UZ9A 3S2LA 1FKXA 4YIWA 4CEXC 3HM7A 3SFWA 2PAJA 2D2JA 4J35A 3O0FA 3A3XA 3B0XA 4LALA 2QT3A 1ITQA 4H9VA 3F2CA 1A5OC 4GY0A 2Z00A 5HMEA 3EWCA 3S2NA 1J79A 4INFA 1EJWC 4WVXA 4QRNA 2R1KA 2EG6A 1FWAC 2R1PA 4XAFA 3T8LA 4QTGA 4P5UA 2EG7A 1RA5A 3JZEA 4LANA 3DCPA 1V51A 3V7PA 4H9UA 1YRRA 1RJPA 2VHLA 4PBEA 5G4HC 3QY7A 2OGJA 4C6KA 2Z25A 4KETA 4C6JA 1J5SA 3GU9A 4IFKA 2E25A 1A4LA 1WXZA 4JOMA 4RDZA 4ICMA 1POJA 1RJRA 3GTIA 3RYSA 1K1DA 1V79A 3UR5A 2VR2A 4EP8C 3PNZA 3HPAA 5A6TC 4IFOA 4C5ZA 4CQDA 2OOFA 3AUOA 3BE7A 4G7EA 2Q09A 1V7AA 2ZC1A 2UBPC 4D8LA 3S2JA 1UIOA 4B91A 3LGGA 1BF6A 1P6CA 3PBMA 3LY0A 3GTFA 2EG8A 4MUPA 2FFIA 1K6WA 3OQEA 4PCNA 4C6LA 4CQCA 4IG2A 1V4YA 1FWFC 5CH9A 4GZ7A 4EPKA 3MTWA 1K70A 4LEFA 4GY1A 4RDVA 3K5XA 4OFCA 3RCMA 4DIAA 3LGDA 3WZ0E 1VFLA 4C6IA 3DUGA 2FTYA 3E74A 4C6EA 3S4TA 3F2BA 2PGRA 3AU6A 4F0LA 2R1MA 3QGAC 3TN3A 2P53A 4DLMA 1E9YB 3TN4A 3OU8A 3LA4A 1KRCC 4KEUA 1FWDC 3GU2A 5FSDC 4IF2A 4QROA 3E0FA 4C6QA 4C6OA 4H01A 3GIQA 2XIOA 2Z28A 4LFYA 3GG7A 4RDWA 2P50A 1PO9A 1ZZMA 4KIRA 3RN6A 3T1GA 4XAYA 1A5KC 4XD5A 3URQA 3F2DA 4UBPC 4IQJA 2Z4GA 4XD3A 4WHBA 4DI9A 1PSCA 2D2GA 2Y1HA 4GX9A 1ONWA 4R7WA 4ERAA 2DVUA 1I0BA 2BGNE 4C6BA 3EWDA 1V77A 2HBVA 4HK7A 4XD4A 3GU1A 1ADDA 3MSRA 4I6VA 3UBPC 1A4MA 1EZ2A 4GOAA 3AU2A 1RJQA 3ICJA 1YMYA 2GOKA 4KESA 2AMXA 3O7UA 2WJFA 1R9YA 3OOQA 3MKVA 2KAUC 2ANUA 4J5NA 4H9MA 2R1LA 4C6CA 4C65A 1E9ZB 1DPMA 4RZBA 4KEZA 1NDYA 2DVTA 3A4JA 3T81A 2Z24A 2GWGA 3DC8A 4V1YA 2GZXA 4HK6A 2DVXA 2Z7GA 3QGKC 4ZSUA 3B0YA 3N2CA 2Z27A 4GXWA 3EGJA 4GY7A 3LSBA 4BKNA 4DI8A 1FKWA 1RK5A 3URAA 1A5NC 1S3TC 4LAOA 1EJXC 3B40A 3E2VA 2D2HA 2HPIA 1EJRC 4KEVA 2Z29A 4UB9A 1NDWA 1KRBC 4IH3A 4J2MA 2HQAA 2WM1A 4NG3A 4G7EB 4Z42C 4H9YA 4C6DA 1O12A 3IJ6A 4XAGA 4CNTA 1EF2A 2VC7A 4DYKA 3GGMA 2YB4A 3MVTA 1IE7C 3FEQA 3MVIA 1YBQA 3URNA 4C6NA 3ITCA 4IG2B 3E38A 3FDGA 2HBXA 2QVNA 2HNHA 1R9XA 3D6NA 3IGHX 1PTAA 2GSEA 4KERA 1QW7A 4ZSTA 2VUNA 4QSFA 3UF9A 2OQLA 2BB0A 1WXYA 4H9TA 4I6KA
chains in the Genus database with same CATH superfamily
3WLJA 2XH0A 4NIRA 3GHSA 5KFFA 1H7WA 4TX8A 3MFHA 1JF6A 1OF8A 3DYPA 4S1FA 1IT0A 3CL7A 4HN4A 2OWCA 2C22A 1DWAM 5A3HA 2QDGA 3VIFA 5KFCA 4JTEA 1NOUA 2B7NA 1FVPA 1R87A 4WGXA 3II1A 3NYZA 3PG9A 1XBXA 1FWTA 4J28A 2VXNA 1MW1A 3A5FA 2X05A 1JRCA 3MZ2A 1S5WA 5DFAA 1TA3B 1ME9A 2RDWA 2W9BB 1V6YA 1UR3M 2TPSA 4DL4A 2ZZ4A 3NUKA 4A8RA 2HRWA 4HPXA 1ONEA 4B5XA 4ZEPA 4Q8FA 1EPXA 3NXLA 5G1YA 1MUMA 4PCTA 3W1TA 2E68A 3HGOA 5E0CA 3VNJA 3QFEA 4DZAA 4GI9A 3B0PA 3VMPA 1XL9A 3MHFA 1JXJA 1QHPA 3R5EA 3ZVIA 2X42A 4U28A 3QZ7A 3KW3A 4DUWA 2C2RA 3S1WA 1JIHA 4BQ5A 5GJPA 1JI2A 3KLLA 4OOUA 1QNSA 2OYKA 2HXTA 4AZCA 3TYEA 4PMJA 4Q3MA 3R25A 4P7RA 4Q8WA 4EWJA 2ZXQA 3A5VA 2QPUA 4L6DA 4ECSA 2OZTA 4OGZA 3EDKA 4CN6A 3LCGA 3QTPA 3PAOA 5G2WA 4E2VA 3MS8A 1BYDA 5CC6A 1VENA 2AOSA 4KWSA 1KTNA 3R6IA 3AIUA 1EWDA 4DN1A 3K8KA 4D6IA 4Q8VA 3PFRA 3N11A 3G6VA 2VFDA 2IQ0A 5DG8A 3WF4A 4QR6A 2HS8A 3LHZA 2GFTA 4AC7C 5K7JA 2H9AB 4UTTC 9XIMA 3M9YA 3UT0A 2DZBA 4H8HA 5CBBA 3N73A 4FMVA 1S3HA 2WV8A 5KFKA 4GINA 2OVLA 3KLKA 1EYWA 3HPFA 3UESA 4FALA 1V3KA 5A8GA 3UZJA 4XISA 4C7DA 5IM51 1ZETA 3ZJ7A 4H8NA 4B5NA 4DO6A 1A49A 3W7CA 3WFZA 3M0IA 2NQ9A 4KWVA 3EB3A 1L6GA 1GVFA 1JFXA 4AY8A 2OZ3A 2VM8A 2ZUWA 4GQ0A 5EFFA 1V5XA 4V2XA 2GQ8A 3EX1A 3S5YA 1QBAA 4L6HA 1AMKA 3T78A 4ATDA 1EEXA 1M9HA 1JCTA 3HG3A 1F3TA 3NURA 2JKEA 5FACA 2V4QA 5FJIA 5DO8A 3ALGA 1XYMA 3QV7A 1FWGC 1OF6A 1WKYA 2A6NA 3B9DA 3EDEA 4U4MA 2J66A 2VFGA 3U7VA 1V03A 1E5NA 3MZNA 4CQ8A 1LZOA 3TROA 2V3DA 4RLIA 3KP0A 3T5JA 4GQRA 4JKLA 2C1IA 3GW3A 4XAFA 2YLAA 1HO1A 4R27A 3TLQA 1ITXA 1PX8A 2C28A 4XKMA 3PUDA 2PDWA 3VIGA 1PTGA 1DWHM 4AZBA 4LYKA 1S1RA 2C91A 4DYJA 1MFUA 2YA2A 5CSRA 4NYUA 4RDZA 4R9XA 4IHCA 1EBHA 1IEIA 4AZHA 1K8XA 4YQWA 4G7FA 2AGQA 5AHMA 3PUOA 3PZOA 4RW5A 1IXOA 4ZE5A 2OT1A 1Q8AA 2X41A 3HPAA 4O54A 1PYMA 1QPOA 1RR2A 1UUOA 2WMIB 1T5AA 1LCOA 2ZC1A 1IZJA 1X6LA 3BG9A 4PB5A 4TVDA 3S83A 4A3YA 3AC0A 3XIMA 1ZCCA 3E02A 3MC5A 4FF7A 2FDMA 2R8WA 1A3XA 4PCNA 4IOTA 1V6WA 4IX2A 1JF5A 4EKJA 1S5TA 4RDVA 3EBVA 4RK8A 3DUGA 3PPHA 2C2EA 4K3ZA 3GV8B 3TV8A 3V75A 3LYEA 1GVYA 2PDKA 1I8JA 3KXQA 4HSHA 2CLOA 3B9OA 3WLPA 5EL1A 2X0SA 3LA4A 1TFVA 1DIEA 4O8RA 4IXHA 3KCOA 4CU8A 4C6OA 2Z28A 5C0QA 3ARUA 3PZGA 2J7CA 4KIRA 3V36A 1EBGA 1B0IA 3EKLA 4PCSA 5HWJA 2Z4GA 1LWIA 3TWAA 4K68A 1LLOA 5A94A 2HBVA 2XIMA 5ABFA 3OLDA 2FLPA 3BW2A 3NR0A 2XN0A 3UW6A 3VAVA 4NF7A 3NQEA 1E6ZA 3IS4A 4O1AA 3K30A 3WUEA 3Q4DA 2RGLA 2IUZA 5C9RA 3MKVA 1F3XA 3WD4A 1KBKA 1S2AA 1NDYA 3W1QA 2OEKA 1FY6A 2QUTA 1DYSA 3WDPP 4YCPA 4MB3A 4HK6A 4AWEA 1EXBA 3E96A 4LXFA 1UPMB 4QE1A 5DLFA 2FJKA 2HS6A 1XC6A 1SPQA 3GNPA 3ABSA 5BYWA 3URAA 4AYSA 3FA3A 4LS2A 5A8PA 4Y9PA 2FLLA 1BG4A 4DELA 3VU2A 4D6HA 4JTCA 3QGVA 3PJUA 5AC5A 4A35A 4U31A 4Q4OA 1YBQA 1J0KA 3LXAA 4YYFA 1KLYA 2F38A 1TWDA 4WXYA 3IWPA 1R9XA 1OYCA 4R7OA 1H7RA 3WLLA 4D6FA 3RRAA 3ITXA 4JKKA 3M6DA 1UR9A 3N34A 2VUNA 2YCIX 3KCJA 1ZL1A 2GVLA 3OLEA 1C8XA 2YCLA 4NJIA 4ASTA 6ENLA 3W4RA 4A8IA 1UC4A 2VT0A 5I09A 1DIKA 4GA8A 1YX1A 1XDJA 1X38A 4AEEA 4V1XA 2POZA 1D8CA 2IMWP 4Y6GA 3ZWSA 1RH9A 4Q8TA 3RU6A 2NQ5A 3KDNA 4S2BA 1PHQA 4N7QA 4FK9A 4GUIA 4FF5A 3AXIA 4JYDA 1VPXA 1GOIA 3GDMA 3AYVA 3R4IA 3OVGA 4E8GA 1E5JA 1W5NA 2C7FA 2R82A 5EPDA 3PY2A 1NTHA 3JZUA 2Y7DA 5RUBA 2WJEA 2JEPA 3GKFA 4GGHA 2NQLA 2JQXA 5EDWA 1V6UA 4GC7A 1POKA 3QQ1A 1PCKA 1YPIA 3DXIA 4JBRA 2E9MA 3RLHA 4O14A 4ECXA 1IEQA 4DBWA 3B3DA 2VC5A 4FX7A 3C2FA 1ENUA 1NELA 4XUGA 7ODCA 4S3FA 4O8AA 1I0DA 2B7PA 2J7GA 1VFFA 3WLIA 1BF2A 5BCAA 3NVTA 2E40A 2ZCGA 4DO4A 4KRTA 2XN1A 2HDJA 3AYTA 5ENLA 3WMBA 1XJBA 2XYLA 3H54A 1JFHA 2INEA 2V6AA 3G1DA 1MFVA 4EK7A 1W1TA 1EHAA 2YA0A 2YDAA 4B9YA 1KXVA 1FWEC 4GISA 4UQAA 2AQOA 3BTNA 4J9NA 3FXGA 4IP4A 1CXFA 1TR1A 3CO4A 5T26A 3W7DA 4LVFA 2WSKA 2ZYFA 3W38A 5E70A 4ENLA 4W85A 5CXPA 3RHGA 2JIWA 3GVVA 2FJUB 3UCDA 3AS2A 1PIGA 2E9BA 3GD6A 1KLZA 5KZMA 4UNKA 2GGJA 4L9ZA 4ZQPA 4HQVA 2ZUVA 1DJYA 3KL0A 3PW0A 1LYXA 3P0WA 2XGIA 3AS1A 1UD2A 2V5CA 1Q6CA 1EIXA 1O6IA 3C2YA 4JFWA 2V63A 1MQRA 4IMGA 1HJQA 1W1IE 3MUAA 3DENA 1E3XA 2IPFA 3AYSA 3EX3A 4HNUA 1FWSA 1LP6A 3G6XA 4N4PA 3SSJA 1Q65A 4Y8EA 4CD8A 2PRMA 4JFVA 3O16A 3FXYA 3IIZA 1THFD 2E5CA 3PW7A 4B16A 2IPGA 3QTGA 1IWBA 4DJDD 1DOSA 1QBBA 3ITLA 1KTCA 2X2GA 2YDSA 5LNWA 4B5SA 4NNCA 3RCYA 1BXNA 4QTGA 2FH6A 3L4WA 1NY1A 5XINA 1X7IA 3WMSA 5KFNA 1AL7A 4WIWA 1M01A 5FCZA 3FLUA 1EKOA 1T40A 1VPYA 3OEXA 1S0MA 1PX3A 4Q7NA 3SCWA 2BGQA 2QDHA 3ARZA 1J18A 3PP7A 3T09A 2XVKA 1R86A 3WQ6A 1L0PA 3WLSA 5D03A 4UCFA 4IFOA 4ECUA 3FYOA 2OCZA 3PTMA 3LMYA 1FBAA 2YYTA 1BLIA 5KG5A 1Y65A 3DKJA 1E3ZA 3G8RA 1P48A 1QPKA 3PZ9A 2EPHA 3LTPA 4NLGA 2ISFA 1GZGA 1UC5A 1XYFA 5I07A 2YW4A 5U4NA 2Y89A 3WX7A 4DXVA 1RBLA 3MTWA 1M41A 4H7ZA 1KBJA 4O13A 4IL2A 4UIOA 1KM2A 1PEZA 2NLYA 1KFEA 3EB4A 1MDLA 3WK0A 3LPFA 3NQVA 2YOCA 4WF7A 4X9YA 4XB3A 3VD3A 3INPA 2V9WA 3FEMA 3E0FA 1XQLA 1G7UA 4KMQA 3LDVA 2ZZ3A 3QOMA 8TIMA 5HNRA 2QJHA 3TSMA 5FEZA 1HW6A 4GJJA 2TRSA 5LHFA 2WCGA 2REQA 5HANA 3T1GA 2FYMA 4XAYA 3WUFA 1HVXA 1AW5A 3UERA 1PSCA 5T9CE 4UR8A 1TQXA 1EB3A 3MY9A 1TX2A 3RMJA 2VC6A 1SW3A 3Q8PB 4GKTA 4L1WA 1QPRA 1JUEA 3ARWA 2YFOA 3G1FA 3H12A 3LZ3A 1KGUA 2QXWA 4JCLA 1OC5A 1BYCA 2V3FA 4ZTYA 1WP6A 5KFLA 2UV8G 4R5EA 4CD6A 2IXVA 3TYUA 3W7OA 3W07A 1GPWA 2PZNA 2D3LA 2HE8A 3CZKA 5G2IA 3A4JA 3T81A 2Z24A 2G3MA 3L7RA 4B3LA 4H8VA 4LOCA 2VX6A 3ELFA 1QOPA 3LMZA 4E5TA 1OFEA 1OFRA 3B0YA 1EQPA 3AJXA 3EGJA 2HMCA 4UTTA 5J5DA 4HOXA 4AZ7A 1S3TC 2VVNA 3M44A 2XTKA 4B4FA 4NILA 5KT4A 4EYIB 4PMOA 5A95A 3NQ7A 3NQDA 4US5A 3WK3A 1UUQA 3Q58A 1O7AA 4K1WA 2NLIA 3GGMA 3VE7A 4ZQOA 5D30A 2PP0A 1U83A 1WXJA 4PBGA 5A2AA 2J6SA 4I5XA 4LS1A 1TQJA 5CPOA 3TTSA 4FIQA 1AUSL 2HEJA 3GXIA 3GZ3A 1W1ZA 3WNOA 5I78A 5I06A 1OWQA 2YX0A 3CV7A 1IHIA 3TU9A 3QQ0A 2FHFA 1NDVA 1H61A 4UZUA 4IWWA 2V2CA 1C8YA 1HUVA 2Z2BA 2D20A 2OU4A 4IL0A 3WH8A 2WXDM 3VMNA 2I57A 3RR1A 1BVZA 3WQCA 4IP5A 4FXRA 1KO0A 1PB0A 1TMQA 1QWKA 4TMCA 4FR1A 4RUBA 3GDKA 5EGRA 3M6YA 5AC4A 4XTIA 2NVDA 3ISIX 4KGLA 2V67A 5G4WA 1TIWA 4HZ6A 4L56A 4POCA 1UZ1A 4R34A 4UNLA 3VIPA 4YTUA 4P7OA 4IISA 3BGAA 4L4OA 2ISDA 1X8FA 4XO7A 5I7GA 2F9RA 2OSXA 2F7FA 4HBKA 2E5DA 4EBDA 4HZMA 4IR9A 2ASHA 3AUJA 4BCEA 3EOLA 3NSMA 3K4DA 2ZWZA 1QJWA 4IGNA 4HJWA 2A3CA 3OJGA 1OEPA 4D6JA 1DJNA 3IPWA 1MW0A 3OZYA 1UA3A 1YTKA 3ARQA 1FTXA 4KS0A 2WVUA 1NFGA 3RLGA 3I6RA 5D02A 2BVTA 1FWIC 4DL3A 3IGXA 1SW7A 4KPLA 4JV2A 3S0CA 6A3HA 6TAAA 1GT8A 1MW3A 5FL1A 1F6YA 1RBAA 4F9JA 5AYBA 3N9KA 4Q6JA 3N29A 4CCCA 2D23A 4EF9A 1AZ1A 3T4CA 1JZ2A 2A3LA 2VEFA 1S10A 4K39A 1D3HA 3ZOAA 2XWEA 4A2RA 5E5CA 4OBSA 3IVUA 3QOKA 4KF1A 1WO2A 3SQMA 1S0NA 4IMFA 3C61A 3LBMA 4HKPA 2OFJA 1FWBC 4AFYA 1A80A 3BAIA 3EA2A 2X1RA 2DZSA 3PF3A 4XO6A 4EE9A 3VGDA 2ZRUA 1H0GA 4OUIA 5FIPA 3QV9A 2RFGA 4M6VA 3W3OA 3S2MA 1S5VA 1TJ1A 3TA6A 2FZ8A 1J2WA 5A6JA 3R12A 4DO5A 3W70A 2G0WA 4YHEA 3BANA 4GUFA 5DELA 4H83A 1WDPA 2A7PA 3A13A 3LU2A 2QCDA 4U3CA 2J78A 3W22A 4IGHA 1XGEA 1DQUA 4DJFC 5KZEA 4PB4A 2CBIA 4PTXA 2UVVA 2Q8ZA 2YBUA 5KG1A 4X2PA 1K9FA 3VD9A 1RP9A 2ZRYA 2OB3A 1JGMA 2ACQA 2RDIA 3H2OA 3LG3A 2WYSA 1JYWA 2XM2A 5E0FA 2HJPA 4F0KA 4JS3A 2Y7FA 3A3XA 2QT3A 1DWJM 3PTKA 3T7VA 4F9DA 2PLJA 5C54A 4AB4A 4AHQA 2BR0A 5DT5A 5HXMA 3L2IA 3V1HA 3GIYA 5KETA 1T41A 2WBKA 3DCPA 1D8WA 3OBKA 1BYAA 4ZO9A 2IS7A 1N8FA 4O3RA 5CSSA 3TC3A 2Q8LA 3W27A 3MA8A 4CUCA 1IXNA 3OGRA 4JIHA 2C18A 1PIFA 1G4PA 3N4AA 3P8JA 3B9EA 4JEQA 1OGGA 1RBOB 3WQOA 4UFKA 5IHRA 4EP8C 1P7TB 3UETA 4CQDA 4AZ6A 1H63A 3MI3A 3RCNA 5MF5A 1JUBA 3PBMA 2E5BA 2VEGA 1AODA 4A6GA 2NT1A 2BV9A 3HJEA 4GZ7A 4KCUA 4BQ3A 2J7BA 1I2PA 2Z1WA 4AYGA 4KRUA 3PZMA 2GSJA 3G6LA 4DUVA 2VMFA 3F4WA 2P53A 2DZWA 4MIMA 2QYGA 3OSNA 4KEUA 4XZMX 2Y62A 4S3GA 4HSNA 1KKRA 5AYZA 1Z8AA 2EHHA 2P50A 1E56A 4WJEA 4H04A 3OGVA 4GYPC 3UG4A 2PS2A 4OU1A 5D37A 4ML9A 1K9EA 1XI3A 4DVOA 2NV2A 4LU0A 3UCQA 5AHLA 2P8BA 3GO2A 4HU4A 4BEUA 4M6PA 1SR0A 2Y5JA 3EEZA 2O9PA 3WLMA 4PRRA 4HB7A 4K1GA 1R85A 4P8UA 3A47A 4XSMA 4DX3A 6ALDA 4DAFA 3M0YA 2X8RA 2CLKA 3CHCA 4JTRA 1I2RA 2ODOA 1JD9A 4HMNA 1QI2A 2GSHA 3S9IA 4C6CA 4JNYA 2OLSA 5M5DA 2XJ7A 2ZTKA 1UR8A 3HURA 1M1BA 4Z17A 2PDGA 1LBMA 1E72M 3VNKA 1VJIA 4HSOA 1W9UA 5KFGA 2R6OA 2GJXA 3NIYA 1LUCB 1JI1A 5CZSA 5B7ZA 2W67A 3W6YA 1TTQA 1QNOA 5HBFA 4FA3A 1Q85A 2QF7A 2W91A 1FFQA 1VAHA 3QPZA 1JDCA 1LWHA 4PTMA 1EOMA 3Q37A 2HQAA 4FXSA 4I7WA 3S9YA 3A22A 3U4AA 1E6SM 1M04A 4LV9A 4H9YA 2QAPA 4CNTA 1U30A 4ADUA 3W1XA 2PA6A 3OLGA 2PMQA 4HD5A 3BQ2A 4C6NA 4M7TA 4OE7A 5KFHA 2JALA 4LF1A 4TX6A 3WBAA 1J4EA 1TPUA 4QGCA 3HMJG 4O0KA 4KERA 4FNTA 5FL0A 1EWEA 2OLHA 1ZGDA 3DFOA 2OQLA 3KZPA 5DG7A 1XICA 1NAL1 1HGYA 3ONCA 3LM3A 3GNRA 2G96A 4DAIA 5FAGA 4NI8A 3UPWA 5EMUA 3L0GA 2IPJA 1KM4A 5HMFA 1E0WA 5FEWA 4MDPA 4O4WA 4PMRA 4QX4A 1FDZA 4Z1DA 3GDRA 5H1WA 2HWGA 3WF1A 1HJSA 2QVHA 5LIYX 2YCKX 3RJXA 1SQ7A 4C1LA 1OC6A 3NPXA 3MMUA 2Q3RA 1DQXA 2O4QA 1ECQA 3R11A 1UYQA 1W2VA 1A5UA 4EPBC 3V1PA 1A5BA 1ZNNA 4QWAA 3QYSA 1D7KA 3ARYA 3W1MA 3LOTA 4F40A 5CAHA 3Q8RB 3GG1A 1J10A 4O3NA 2WHJA 3DEQA 2V68A 1W5OA 2C0AA 1YIXA 3IVTA 3FY1A 1MNSA 3WJYA 2JKAA 1KBLA 1XIMA 1R9ZA 4LUSB 3M0KA 1W2PA 1QHZA 5HJXA 2PDXA 1PCWA 4YN5A 1XLCA 1XWYA 8XIAA 1CI1A 1VYPX 4ACYA 1P1MA 3M9NB 3GR7A 3GRIA 2ZWYA 4M3PA 1P6WA 3TFXA 4IT1A 2PB1A 2IW0A 1XQKA 3ALFA 1B1YA 4DNMA 3PWGA 1H0IA 3NQFA 2Y8VA 1GKRA 3AICA 4A2SA 1XV8A 4HGXA 3M0JA 4L80A 2A1YA 4ED3A 3LHVA 3OYXA 3GHTA 3VKCA 3ES7A 2GL5A 5ABEA 2E6YA 3VGHA 2INZA 2WZTA 1RVKA 3TLLA 1TV4A 1JCYA 2OG9A 3G18A 2JE8A 1X7FA 4YP3A 4WZHA 4LJ3A 3R1ZA 3QMSA 3JRKA 3WK1A 3VC5A 4DEZA 3QV8A 4GRSA 3PUEA 3UXAA 3LZ5A 3KM8A 1X8CA 2XVNA 1UG6A 1ICSA 3UYIA 4C5YA 4LYRA 2C6QA 2P76A 2PGFA 2PDCA 4WLCA 4Y96A 2Z7KA 4Y7EA 2R94A 3M5ZA 4HMDA 4HJFA 3GKAA 2IPWA 1XKJA 1G7VA 1VFHA 1G0CA 2ON3A 2VUYA 2CLHA 5IFTA 1XPYA 4TX9A 2YYUA 5LSMA 2EAWA 1B9ZA 1G69A 5E1QA 3H7VA 1UPPA 3WF2A 3DG7A 4JV0A 3WJZA 2D0GA 1RCOB 1CW2A 3P5YA 1H50A 1EL3A 1OYAA 4JFSA 3PPCA 3KCLA 4Y8FA 4EANA 1JAKA 3CZLA 4AIUA 3VFLA 4DJEC 3FSTA 4QEHA 1AQMA 3VILA 3B9NA 2CZFA 4FNQA 3FV9A 4R7JA 1F05A 1X1NA 3CK5A 3RO6A 3B0XA 1OD0A 4KFOA 5K4ZA 5CLWA 3VM7A 4YVXA 3EPNA 3QRHA 1C92A 1EP2A 1FXQA 4QG8A 3VKKA 1K8ZA 1AK5A 5C5JA 1PKLA 3KOZA 3UXKA 3KVJA 1ZCOA 3V7PA 2YKKA 1YXCA 4HU8A 1V3HA 2QCCA 4NY2A 7A3HA 1E4MM 5C55A 3PS7A 1UP0A 5FJOA 2PDMA 1JPHA 5I2UA 3L5MA 3GTIA 4QWEA 1TZ7A 1MXGA 1O4UA 1N55A 4PUEA 1GOXA 2PP3A 4S38A 5ECUA 5JH2A 2AGPA 3ATZA 2ZDRA 1R2SA 1TE6A 2XIJA 4UQEA 1P6CA 1BD0A 1W9PA 1HJWA 4YJ5A 5D9OA 1DVJA 2PBOA 4X0NA 3OQ8A 2D0FA 4CQCA 1FWFC 5CG0A 1S2UA 3VPLA 4UXDA 4PC8A 2FTYA 1SMDA 3F2BA 2E67A 1CIUA 1UP3A 3NGJA 4LWWA 3VIKA 5H8MA 1R3WA 1WUFA 2X1IA 1XX1A 3MANA 2DSKA 4UTJA 1AA1B 2H8ZA 4J9MA 4IF2A 1JIBA 2X1UA 3ZJ8A 4KFPA 4LFYA 2ISVA 3CMFA 5HUOA 4XUYA 3PWAA 3DHPA 1ZY9A 1NOWA 3RN6A 1CDGA 4K6AA 3LENA 5FESA 3VC6A 1TTJA 1XLIA 1Z42A 1ML1A 5AB3A 5KT5A 5L9XA 1ZB5A 1SZNA 3A4XA 1ZBVA 4Q8EA 1OT2A 3MMDA 2GVEA 1JPMA 2Q6ZA 4PA8A 1U1HA 1Q2RA 4LGXA 1UD8A 4QHRA 2BY2A 4FNRA 3UWVA 3MB9A 2AQ4A 2CBJA 4QQ3A 1EP3A 4H1ZA 4ZTXA 5C8BB 1JCNA 1J0YA 4C65A 3VD4A 4PSRA 1VLIA 3B8DA 4ZO8A 1C9DA 5CJ5A 2DIJA 1PZ0A 2F84A 4ATLA 4ZMGA 3NYDA 5KT3A 2I9EA 4FX8A 6REQB 1G01A 4JTAA 1IZCA 3S6DA 3EOOA 4QE5A 1OG0A 3LSBA 4K8GA 3ANYA 3TJXA 1PZ3A 3GAYA 2ZXBA 1J12A 3A4AA 2OKOA 1AW1A 2EXOA 4YTRA 3WBEA 2CU0A 2C15A 3THCA 3CQHA 1AJZA 1GK8A 2AAMA 3W2LA 2C13A 4DYKA 1K6AA 3VDBA 2WSYA 4DPQA 1NQKA 3ZT5A 1AQHA 4IG2B 3TYAA 3TQ0A 2QVNA 4M81A 1KV8A 3CXOA 1HF6A 4DJFA 3B03A 2JGQA 4G1NA 3GDLA 3IIXA 1ZJAA 3DECA 1TUXA 1YPFA 4MY9A 3VABA 4ACZA 1K9DA 2Y6ZA 4LF2A 1X6NA 1DV7A 3WUBA 1WPCA 3GTXA 3WNNA 1R6WA 1KCKA 2FVKA 4M51A 1CXHA 3GVGA 4MNJA 2BTMA 3UR2A 3UGVA 3JU2A 3K2GA 3R7MA 1JPIA 3QC3A 4Z2HA 1H1YA 4MB1A 1VPQA 1FP8A 4LYQA 4REQB 1TYGA 5E09A 2GPTA 5DLCA 4HCDA 1GJUA 1CLVA 1Z44A 3NZPA 1LOQA 1BAGA 4JN8A 1OX5A 3GTNA 3OHBA 4IPIA 2ZVRA 4NUWA 4ZENA 3RK8A 1QI0A 4WJXA 3LSCA 3CQIA 4QAIA 2DZUA 1UROA 1XUUA 3EDFA 3BXWA 1MVYA 3S9ZA 3KRUA 2VFFA 4IPPA 3PW4A 1WKFA 4M56A 4XIAA 2O55A 1OIFA 3MCMA 5DX7A 3OODA 3ITTA 1H60A 3I7SA 4V28A 5LYRA 2I56A 1JUKA 1KFBA 3H21A 2MNRA 1M68A 3ZFHA 3WO8A 2V4RA 1WYIA 5HA7A 3BCFA 3TTQA 2VO5A 4B3KA 2B81A 1IEVA 4RE0A 5BU9A 3CV6A 4JGDA 4S3CA 3PJXA 2V81A 3PBVA 4HTBA 5H2ZA 3OTRA 1PKYA 3MSYA 1XIJA 1G4TA 2XM1A 1G4SA 3HGJA 3V6HA 1J8VA 2D22A 4UC5A 2PE4A 1PX4A 1GVSA 4NX0A 3E2QA 3I7QA 4UTLA 1A5MC 2W8LA 3KHDA 1FUYA 1OFOA 4WEVX 4N02A 3PSVA 4JN7A 3WDHA 1X6UA 4GYPA 3G6YA 2A3AA 4US6A 3BOFA 4BWLA 4LAUA 1PJ9A 3W29A 4OUEA 2Y24A 1JJKA 3LM7A 1H5YA 3N2MA 3KOFA 4O53A 5FEXA 4XBSA 3WL1A 3VNMA 1SO4A 2CLFA 4J3XA 3TN5A 3ZR6A 4ED8A 3CPRA 3L65A 3NO3A 3GWQA 1RZMA 4W7WA 2DZXA 4R3UA 5HNNA 1QNPA 5DRIA 1RP8A 1XRFA 4L9YA 2GGEA 1ZS2A 4LUYA 1WQ5A 5I79A 2FGLA 3GNDA 3VCRA 5CBIA 4M6UA 5ABFB 4BI6A 4YWSA 5FF3A 3O63A 4QCFA 2DV0A 3RAOA 4F4RA 3NDZA 4IIDA 3MR2A 2QCEA 2H90A 3CO8A 3CUZA 4MPKA 3GNXA 3LTSA 1FHVA 3CC1A 3OVRA 4ES4A 3UP8A 3SURA 2XVGA 4L1GA 1EZWA 5FJUA 5MHBA 5TNVA 4MWAD 4M1RA 4IMCA 2ZX6A 3JZEA 3H23A 2BY1A 3O1NA 4MF4A 4C6KA 2OWWA 4TO8A 2X7WA 3RXZA 2DW6A 5IBXC 3S5NA 1A4LA 1XS2A 3QBUA 4ICMA 3QZ8A 4FBUA 2A3EA 4GNKB 4B4HA 3TMLA 3RYSA 4H19A 3OA3A 3UR5A 2QDEA 5A5WA 4PRTA 3C8NA 1IR1A 5LIWX 3CH0A 1IV8A 3IRDA 3L2MA 4EACA 5TD4A 2VFEA 3A3HA 1C9WA 3MKKA 3SRKA 1WAWA 3ZLHA 2UBPC 2XZ9A 1FWWA 4AY7A 3TFCA 2ZUNA 3REQA 1ZU8A 3HB9A 3MFIA 3LHYA 3FA5A 3N6QA 4BK9A 1OBAA 5EFDA 3ARVA 1HFBA 5LIUX 5CH9A 2ZZ5A 1Q7ZA 2D1ZA 2PGEA 4JICA 3R13A 5AVHA 4QJ1A 5DQPA 4HHMA 4ML4A 3RPMA 3EPIA 4PUWA 2RHGA 3UWYA 1HNYA 4GQGA 5A8MA 1XD0A 5J04A 1NM9A 1RQEA 4B2DD 1GTEA 4EEYA 1EX1A 1H51A 4GNJA 3RX4A 5DANA 3SCNA 3CHDA 1I9CB 3KVMA 1M7XA 2WVTA 2ZE3A 1E1CA 2DZPA 1PO9A 5I77A 5MKGB 3M43A 1H1ZA 4E4PA 4JYEA 4DXXA 1UD5A 3FA4A 3FKKA 2DZVA 4LTSA 1AJ2A 3YPIA 3WL0A 3T2QA 2PGWA 4NYYA 4ZFMA 5CZ0A 1ISWA 5HNTA 4P8VA 4WDXA 1C7TA 2Y0FA 3M7SA 1I2OA 4IMAA 2G41A 3BG3A 1R9YA 2CITA 2YBVA 4CKQA 3LTYA 3Q8SB 4KEZA 4WX2A 3QR0A 7TIMA 4A3HA 2X09A 5D8WA 4JIQA 3WLOA 2BHZA 2DGAA 5DMMA 1Q3NA 5FJTA 3CL6A 3CTLA 2DPJA 3M5XA 1CGUA 4KRZA 4GUJA 3MSDA 1Q6LA 4J9KA 1XGDA 1PYFA 8RUCA 4M0XA 2BY3A 1KCZA 2ZZ7A 1BTMA 5I3GA 3S8HA 5H6HA 3H2NA 2O0TA 2PTWA 1RK5A 2ZRVA 4H2CA 1QWGA 3W23A 4KEVA 4UB9A 4PL2A 4HPGA 3K46A 1FRBA 1BQGA 5KG4A 3VZZA 5CC3A 1EYEA 3UWZA 4NAEA 3W28A 1CNVA 3BAXA 3ZLGA 3TK7A 4J9JA 1X97A 1TZZA 2IKHA 4QWCA 5HAOA 1V6VA 1R47A 3ECQA 4GKLA 5I3FA 3T5LA 2DDXA 1K7EA 1TJRA 1KGXA 2VP8A 3QZ6A 2W7OA 3N9SA 4MB5A 3R79A 1QW7A 4DJDC 4E2DA 3R89A 3BAJA 2W79A 4QSFA 3MUY1 3H2EA 3ZSSA 2BFGA 1BG9A 4EAMA 3DOPA 4NSBA 3R2GA 4GBDA 4Q7IA 1DJHA 3PAJA 4F0SA 1OY0A 3PNUA 1JYXA 2G3NA 1IQ8A 4DJEA 1Q45A 2C0HA 3D3FA 1IM4A 5AYXA 4NZJA 2CFFA 4R85A 3I6EA 1ZP4A 1TR9A 1UH4A 2QUVA 4GYKA 4XZBA 4H7VA 4IMDA 5D38A 4XWUA 1R2RA 4Y90A 4OT7A 3G0SA 1CECA 5D9PA 1B3XA 1O5RA 4UFHA 2YA1A 4TQSA 2X1TA 4WK9A 2R8JA 1XYBA 4IQLA 1GGOA 2YW3A 2D3NA 4CD5A 4EIVA 4DEFA 4MNKA 3T0AA 7REQA 1KKOA 1GPFA 4FNPA 3A64A 2CZ5A 3TQVA 2B7OA 3P81A 2WO5A 4DLFA 2OT0A 3L0NA 1UBSA 4UMAA 2RDUA 2DZTA 3HV8A 2WSQA 4D6EA 3PPFA 4H7CA 3ZT6A 1ADSA 2RJGA 2VVSA 1DE6A 3OO2A 3WYZA 1GOWA 1NJJA 1PKNA 1W56A 4FSAA 1QO5A 2UY3A 4AWTA 4KQNA 3MP4A 4JQ1A 3CWHA 3PTDA 5H8PA 1GHRA 3C0JA 3AQUA 3NL5A 1UBPC 3AMLA 3BK0A 3MPGA 4C1KA 1KTBA 3WMLA 1XIHA 4E38A 2C1GA 1B4EA 3ZZ1A 4QITA 3DGBA 5KFAA 2R14A 2ZZ6A 5KFTA 1RHCA 4DBUA 1K02A 1TV5A 2NXHA 1P0BA 1QDSA 3W6MA 5A6MA 1NEYA 1SMAA 2GGGA 3WNMA 2EJAA 3NAVA 3ABRA 3HN3A 1KCLA 3RPTA 4PCPA 2E77A 3W86A 5A2CA 4E2OA 4UFIA 1JCLA 2YIHA 2XH4A 4ERIA 1F2JA 4GMEA 2QCFA 1RYRA 3C86A 1LBLA 1CLXA 3DFQA 4LT9A 3GAKA 3KHLA 3MMTA 4JL1A 2ESCA 5KFYA 2P3ZA 4ZQRA 3G3MA 1B3WA 3IV8A 7PTDA 4FXFA 4WDWA 4EYHB 3EEGA 3IACA 5C70A 1OD8A 5M3WA 1DXFA 2FHCA 7ENLA 4BJHA 2REQB 1ECEA 4QS5A 2DSZA 4K2SA 1LWJA 3HQPA 1AVAA 3TWBA 4GYJA 3RU8X 1X39A 4RR4A 1UZHA 2G50A 3N19B 2PPGA 1F07A 3T0DA 3OIHA 3ZQ9A 3EXTA 5KFQA 3WH5A 3F4CA 4F79A 1TVPA 3UJRA 1LL6A 4AY1A 4Q6XA 3WNKA 3T42A 1FKXA 4D8ZA 4PTVA 3PJTA 3HM7A 2HROA 2FTPA 3BW4A 2VYOA 2OKTA 3KTCA 2GOUA 3OBAA 3CBWA 3WNPA 2R1KA 1JYVA 2F2HA 1PXGA 4KBXA 3PTQA 4K38A 5FD0A 2DFAA 9RUBA 3FVMA 2EG7A 2QMKA 1RA5A 4GVFA 1HIZA 4GC6A 2NV1A 3FX4A 4QLKA 4WGHA 4YNGA 1W17A 2BVWA 5GQBA 4Q45A 3PZNA 4YTTA 3ANVA 4BQ2A 2WTFA 1YDYA 1E40A 3A4WA 1ME8A 3LLDA 3BQ6A 2C79A 3TVAA 3NCOA 4WRHA 3TZFA 1P4CA 3PB0A 3R8GA 2XGQA 3A21A 1TV2A 3VX1A 3FYYA 3PM6A 4BI5A 2AL2A 4M29A 3ZMRA 1J0IA 4NZ1A 3KL5A 3GILA 2NX3A 2JEFA 3R94A 1JNEA 4MUPA 2ZZ2A 5DBUA 2OEJA 1ZJHA 4BFAA 2PDFA 1ZTVA 3CV1A 5GNYA 5LGXA 3LGDA 1TCMA 1V02A 1RLCL 3BJFA 4DM1A 5KFXA 3WLRA 2PF8A 3S6TA 3RLVA 4ADSA 3H53A 5HMSA 4U3AA 3TC6A 4MFDA 1XM3A 2VR5A 2QJMA 3M0ZA 4ADTA 3VNDA 2NUWA 3GFYA 1UKSA 1FWDC 3QC0A 2VZTA 4UUIA 1F4AA 4DHGA 1LORA 2WVVA 4QROA 3V18A 5AN7A 3NO5A 3TMQA 2VRQA 2V5BA 1ZBWA 3RBEA 2A7RA 1OSEA 2XINA 3F4NA 2QULA 1UJQA 1XIGA 3IN5A 1W0MA 1JZ4A 1GVQA 3MUCA 4I7VA 3W83A 2WSPA 3V35A 3WQDA 3UXDA 4K7YA 1ICPA 4N9DA 3EWDA 5LNVA 2EKCA 3LX9A 4ZXLA 1C8VA 2CLLA 3DX5A 2YLLA 3EWXA 2XCAA 3CAQA 5EB8A 3R0UA 3PVFA 2GQAA 4WSJA 4S3EA 2ZBTA 4EVZA 2KX9A 1SFLA 3H7RA 3ZM8A 1GOOA 3TONA 4Y9OA 1F6KA 5TAOA 1OZQA 3L4ZA 5A69A 2E7FA 2WPGA 1N8IA 2GZXA 3GQYA 4NAFB 4GBUA 3CWOX 4JIRA 1GOQA 5L1JA 1E0UA 4R9OA 2J79A 4UQBA 3SN4A 3VDCA 4GACA 3CQJA 3HBLA 2QEZA 1E4IA 2OPJA 3ABOA 4IH3A 4J2MA 1TMHA 3H2AA 5A8NA 3ITVA 5LNSA 1DJXA 3LQLA 4S23A 2BDQA 5F1UA 4D6CA 1M53A 4XAGA 2XWDA 4N9BA 1Z41A 3SN1A 3ZJKA 1EGZA 3GVRA 1QOQA 2Q8XA 5IOBA 4PMUA 1H41A 2WC7A 1W1A1 3APTA 2H9AA 3OZMA 1I75A 2XDFA 3IGHX 5CJMA 2GSEA 1F76A 3SRDA 2TYSA 1I2NA 1ZUAX 2NQZA 1W9XA 3W7RA 1RD6A 3EXSA 3BJTA 3BOLA 3W84A 3ZO9A 4HNVA 2PBGA 1CGVA 1W31A 1BVNP 2WJZA 2NVAA 4PMDA 4UQ9A 3OVPA 1OHLA 1XUZA 3RM8A 4BHYA 1UD3A 1R3TA 1EDTA 1TE1A 3USBA 3SY5A 3F4DA 5BMXA 1BQCA 5A6BD 5HDRA 1Q5MA 3GZAA 5TF0A 1TPB1 1QW9A 1YEYA 3DFYA 4O1BA 3LI1A 4JYFA 2DH3A 2QQ6A 1M7JA 4Z2KA 4MNLA 3U5UA 1N56A 4J1OA 3AMKA 2NVCA 3TTYA 4GGBA 2RH9A 4O3PA 3H4XA 3MUXA 5E93A 3AIRA 3LB0A 3C6CA 2G3IA 2A85A 1RXOB 2GDVA 4I7UA 4P8WA 3ARPA 1JCXA 3QR3A 1WDRA 1PKMA 4UFJA 3EB2A 4GIYA 3C52A 3O07A 2VURA 4UR7A 1Q4WA 2XGPA 3VIOA 4WSHA 1VR6A 3RGTA 3SAZA 2RDJA 2W3ZA 1REQB 4A8LA 1ICQA 1Z32X 1L8NA 5LXXA 3EMQA 2P88A 2BGSA 1DP0A 4FS1A 1E6QM 3NWRA 1GZ1A 3VOGA 4ED0A 1UD4A 1W9VA 3TTEA 4DPPA 3BMXA 3EPOA 3BLIA 1ALDA 3VKDA 1JDDA 3M5YA 2ZUUA 3W6LA 2WMIA 4P7QA 1Q66A 1OK6A 1EP1A 2TSYA 4J3SA 5AC6A 1LG1A 2Y2WA 3MBFA 2GK1B 4YTSA 3SUTA 4NZ5A 3KVKA 3RB3A 2IKGA 1P5BA 3U2ZA 1EJSC 5DGBA 1RAKA 2PDJA 3MDUA 3GDBA 4OV9A 1KXHA 1UB3A 2OYLA 5C9UA 4N9EA 5CCZA 3GC4A 1G5AA 2ZRWA 1XRTA 2GVGA 1SSGA 4U7CA 1TPH1 4RV8A 1EX5A 1W1YA 1KR1A 3TQPA 2DT2A 2FIQA 4GIRA 4ORMA 1FWRA 3EYPA 1W1B1 3G6MA 3SCUA 3UZZA 3C2EA 3U0HA 1GKQA 2WC3A 4AC1X 2V3EA 4QISA 4G2DA 1XBZA 4WQ6A 4F2TA 4MAZA 6XIMA 1NFPA 4UR9A 3TH6A 4O57A 3THQA 3U5YA 4P2VA 2Y7EA 2WMKA 1E9IA 3RIKA 1PTDA 4PFHA 2PCQA 5KFOA 3CPUA 5A8QA 1P0EA 4U2YA 1JPKA 1HKJA 3DBPA 3SFWA 4YR3A 4XG1A 5GJMA 4OJYA 3GG0A 1ITQA 1SJCA 5HMEA 3LLFA 3P5ZA 1J79A 1E15A 2G5WA 4MJZA 1EJWC 4AUBA 1Z48A 1VEPA 1A5SA 3G3DA 2C3ZA 3PJWA 3ZLFA 2EG6A 4AD1A 2R1PA 4YYCA 2VD9A 4P5UA 4FNSA 2Z6JA 4ED2A 1K4HA 2I14A 1CWYA 1JRBA 2GJXB 5AHIA 2ZA2A 5GVJA 1B54A 4NNBA 3B8SA 3MWCA 4JIIX 5LIKX 1WXZA 3UVIA 4Z08A 5HQLA 2WAGA 4HMCA 4PTWA 4PGLA 1NWTA 4JQ4A 1XLMA 4QM1A 4EBEA 4B15A 3G24A 1V79A 3QPEA 2WCAA 4DJDA 4JTDA 1ONRA 3W88A 1D3CA 1GYNA 4NQ1A 2NV9A 1US2A 1JAEA 1Z69A 2E8ZA 4JY9A 1MI3A 5JU6A 1V7AA 3FS2A 3IIPA 4GPNA 3LGGA 8XIMA 1V02E 3CAVA 2ZRZA 1U5HA 3GR4A 4JKMA 2BQUA 4EPKA 3IUHA 3BDKA 3FNDA 4R33A 1MUCA 3UG8A 4ECTA 1LLZA 5FJPA 2VZSA 2Q02A 2W61A 2PTDA 2JF7A 4CCZA 5CPLA 3QMTA 4DL7A 2VL4A 3AIQA 1E9YB 1TMLA 1B3YA 3W1LA 2PU1A 1IEXA 4L4MA 3FAXA 3GG8A 3UXLA 4ZCWA 1QI4A 2PF0A 3UZ5A 4XZ9A 3UY8A 4AD2A 2VDGA 1HG3A 3U2CA 2PDNA 3T08A 5JUVA 5F4SA 1OFQA 3U2OA 4UFLA 1TPFA 5KT7A 4XD5A 1XP3A 4MMWA 3V3WA 3VNIA 2D2GA 2YXXA 1UKPA 4YVPA 2INFA 3O6AA 2Y4SA 1FH7A 2ALZA 2PWDA 2EPNA 4XBKA 3ICJA 4F48A 1YMYA 4KESA 1BKSA 3UJ2A 1WA3A 4J5NA 4FAMA 1SR9A 1IWPA 3T5HA 1GEHA 1VRDA 1EPVA 2BODX 5JIWA 2EBNA 2OH2A 1UR4A 3EXRA 2EEXA 2WMHA 3TP4A 1B3VA 5CC5A 1QPNA 3LI0A 5F2GA 2Z7GA 1FCVA 4ZSUA 3N2XA 2D0HA 4IRKA 2W9CB 3DKLA 4MB4A 1XINA 4GG9A 1YKWA 2XVPA 4W9TA 1YTEA 4UOZA 1V0NA 4LNCA 1LT7A 1KRBC 1U33A 4JL2A 4ZO7A 1RQBA 4MJ2A 4Z42C 4GI4A 1MZHA 1TTPA 2QR6A 3EWZA 1CGYA 5AZ1A 3SFKA 4PMYA 2BOEX 3MVTA 2CXEA 4EXQA 5A8OA 5IHSA 2ZTJA 2VELA 3QLDA 3E38A 3A12A 1W54A 4Q8UA 4FLQA 4KFNA 1KR0A 3NL6A 1PAMA 1U1JA 1YXDA 1R2TA 3QV6A 3NDYA 1EO5A 3SB0A 4EBCA 2PCEA 2Z1KA 3THUA 2PUZA 3TW6A 2W4XA 3SI8A 2QGHA 4XIMA 1E0VA 3M5VA 3W74A 5D2WA 3N2OA 4IGMA 4TV5A 4F2UA 3FYPA 4HNNA 4E3TA 1GKPA 2IMRA 1OJXA 3W1UA 4WCJA 1LQAA 3WQFA 3UPMA 2VWTA 4F0RA 1W32A 1D9EA 2R91A 4EX4A 3NEHA 5BZAA 3HV9A 2JK2A 3LPPA 2W27A 5CJNA 4O16A 1CGTA 1H4PA 3BAKA 2DEPA 2ZDSA 3VM5A 3G1VA 1QO2A 1E9LA 3LCLA 2J7DA 3WDJA 1TPC1 4M82A 3U57A 5AKQA 1B4KA 3RAQA 4MM1A 3KTXA 3OP2A 2J8FA 4Q8PA 4RDYA 1VCGA 1SZRA 3CUHA 3DZ1A 4FS2A 4QJ5B 4JIPA 2L5HA 4LPCA 3P80A 2XFRA 3PR4A 3KRBA 2FB2A 4C6MA 5KFDA 3N4FA 2A5HA 2DSUA 1OX4A 3UWQA 5BXTA 4DWSC 3S1GA 3WY1A 5EWEA 1B31A 5CSUA 2BOFX 1W91A 4PEKA 2I5GA 2NW0A 2BXVA 3CUIA 1FHDA 2J24A 3PB2A 4UTFA 2GVJA 1AQ0A 2NXIA 1XIFA 3WFAA 3SADA 1RV8A 3PK7A 3GUWA 3GXMA 4FOJA 2QV4A 1F4HA 1UKOA 5E6YA 4AZIA 4HIBA 4DQWA 3JUGA 5C7HA 2DT1A 2BVDA 3FGCB 5I00A 1PL9A 4XTDA 4RX0A 3SCOA 1F74A 1H7OA 3N9RA 5F4XA 3GNOA 1LF1A 1Q2SA 1SJAA 5L9FA 3E12A 1LLWA 3VKJA 1EJUC 4K8EA 4F0MA 3GH7A 1V0KA 3ZYZA 4IICA 3W9ZA 2DY3A 5I24A 3APGA 5TBOA 3I6TA 3W76A 5D2YA 1NVMA 3HPSA 3KS5A 2WBGA 1ZAJA 1TUFA 2DIEA 4WJ8A 5JXQA 2QJJA 2ACRA 2CZDA 4Y2WA 3M1ZA 1SZGA 2YCEA 4JTFA 5HWMA 4J27A 4L7ZA 4GIAA 3V5OA 4GHRA 3W73A 3V6KA 3UZXA 1J0JA 2XGBA 3MJMA 2CZVA 4HVXA 2J6VA 3PR5B 3DHFA 3ZT7A 3HZ3A 1XLHA 3ZR4A 1QPQA 1AG1O 4FBTA 3BLFA 5DQIA 1HGWA 4FP1A 4M80A 1HL2A 1LG2A 1RD5A 3GFZA 1BTCA 4IIGA 4MKVA 2RDXA 4ZFCA 5F4WA 4ZXOA 3R10A 4QRNA 3MP5A 4RJEA 2DSVA 2VA2A 1W37A 4YXGA 3UJFA 1V51A 5G2HA 4KETA 1G94A 4O1CA 3DERA 2ZUTA 1XDLA 3SRFA 2ATLA 3N2TA 3PBGA 4XK2A 3EWUA 1K77A 3S6OA 4M8UA 4MHBA 1IT8A 2PTZA 4DBSA 3D3AA 1ZJIA 3NQ6A 4LQ1A 4NNAA 3SUUA 3S2CA 2EPLX 3AFBA 1GVOA 4D8LA 3CAWA 4FOUA 1MXDA 1LBFA 2XG9A 4YWIA 3BSGA 3DFHA 4I9MA 1T8QA 3A6OA 4C6LA 4F2BA 4IR1A 1HJVA 1OGBA 3KBMA 4LEFA 3I3BA 4OFCA 3Q2DA 3E0IA 4OZOA 3AU6A 1XCXA 4IRCA 2C14A 4DLMA 4CU6A 4F3HA 1B9BA 3TN4A 1US3A 3VVGA 3HQNA 4J2PA 4XVDA 1JYNA 1ZHAA 4Q4MA 2PD5A 3T44A 5J8LA 1JEZA 4FXJA 4IPJA 1SYTA 3NDOA 1GOKA 3GH4A 1UHVA 5CAKA 2E6FA 1KFCA 3RILA 1RY8A 2OX1A 1A53A 5DY2A 2J6UA 3RB6A 4IQJA 2JIEA 4A22A 1HKWA 3FK4A 3IEBA 3I7RA 5DBTA 3ITOA 4D72A 4Y9NA 4OKDA 4TV6A 2ASJA 2G37A 4HK7A 1XIIA 1XD1A 2QJNA 3UG3A 1J0ZA 3W00A 4WY0F 1GCYA 2V5LA 3WH7A 1LL4A 3VMOA 2KAUC 1PBGA 4E0CA 5D04C 3W81A 1YNPA 1QRQA 5I3HA 2ZUMA 3DC8A 3EKZA 4O0ZA 4LX4A 1BPLB 1CEOA 2X0YA 1WBJA 4IIEA 2F2KA 2D24A 2HK1A 5K9DA 4GXWA 3BMWA 1Z6KA 1JZ6A 2V9DA 3CLWA 4BS0A 3O6YX 5KG3A 3CL8A 3WLHA 1DJWA 4MZ1A 1SFJA 2Z0IA 1V6XA 3VOHA 4S3AA 4H41A 4L1XA 3H40A 2FVLA 3GIJA 2YB4A 2ALRA 1EJ7L 3IANA 2CHRA 4HHPA 3SCSA 4PFMA 1U22A 3GW0A 5CEWA 3I3EA 4CQ9A 4G5DA 3P3BA 1IGSA 3IJ8A 4GO9A 4O10A 4I6KA 1K03A 3VDAA 1YXYA 2XCPA 4MWAC 1ISZA 3WJWA 4BQ4A 3GIPA 4LBRA 4V15A 1TG7A 5CGQA 1LRTA 4DY1A 3TQKA 3O06A 3T05A 1YDNA 5E9XA 1DJGA 3W53A 1FFRA 3LNMA 3VYLA 5FJJA 4MLJA 1WZKA 3B0VC 5BMWA 3IJDA 3M0MA 2NWRA 1XFBA 2QJIA 1OVDA 4AMAA 2BHUA 2NX9A 4RNJA 1RSCA 3RM9A 3WKZA 4H8UA 3K1GA 1TPEA 3KBSA 2P0IA 2P5NA 2G3FA 3W24A 5L6UA 2DQXA 4MPQA 1TV7A 1B30A 2JEIA 4QG9A 2POTA 1M7PA 2QCHA 2I5QA 4ZZ9A 4AX7A 1NH6A 4O3QA 3MR5A 4PTDA 4HPNA 4JEJA 5DQHA 2B4GA 4I9TA 3F03K 3FAWA 4DUXA 1JZ7A 5AHNA 4HHHA 4R8UA 4KWOA 4Q4KA 2BNJA 4JNMA 4MTVA 6PTDA 2A21A 1XHGA 2IBKA 5DXYA 4E4FA 4UTWC 3WLTA 2JBMA 3NOEA 2NSOA 2IA6A 1DQWA 2PWEA 3SJNA 2ZX9A 2R24A 4QQUA 4QWDA 3TYZA 4GZEA 4JHMA 3R58A 1P7TA 5LA1A 3B4UA 5TQLA 3REQB 5G4EA 1MEWA 3UZWA 3CHEA 3B9AA 4GX8A 1T96A 2OJPA 2AQVA 3CUXA 3QHMA 2HVOA 5BU6A 2CKSA 3TXVA 3LHWA 4GI8A 4FNUA 3SQLA 3ITGA 4PN2A 4Z1BA 4ZGYA 1TJ0A 1GTHA 1KBIA 4YR0A 2XZ7A 4LB3A 2CHNA 1R7AA 1VJZA 2VGIA 3AWNA 3IJIA 1FWJC 3UNTA 4CD4A 4UWMA 3J7HA 3CUJA 1S5MA 1OCNA 1NF0A 3I4KA 3L21A 1E1CB 9XIAA 1NFBA 1QTWA 1UMLA 1Y5XA 1B2YA 3POHA 3FVDA 2GGIA 4PZVA 2HTMA 2XIIA 2HVMA 4RZ6A 3GHRA 2OZ8A 4FB7A 3LV6A 4QXIA 4TUFA 3OLIA 1V8EA 1J6PA 3QW4B 3VINA 2EPKX 1JR1A 3JVAA 3WQ4A 3GIMA 3VD5A 4QG6A 1GQIA 4F50A 1W8SA 2WMGA 1E70M 2DT0A 1TELA 2GUBA 1ZRQA 2V3GA 4Z0JA 3N12A 3H2FA 1JQXA 1CB7B 3BURA 4ALDA 4WVXA 2WLYA 4B5VA 5I5RA 4I9AA 3T8LA 2AQWA 1S2TA 4DNHA 1HN1A 1N8WA 5DXXA 3QY7A 1Y7VA 3QHNA 2VCAA 3MCOA 4IFKA 2CBVA 3S5SA 3QQWA 1YTDA 2J27A 1S2VA 1XBYA 3Q45A 5JUMA 1DTNA 3V4BA 2HVNA 1K1SA 5CPTA 5A6TC 4CN1A 1TVNA 4OECA 4QJ4B 3AUOA 1CZ1A 4DWDA 2ZIDA 1X1ZA 3AHYA 2XGZA 2W8KA 1Q6OA 2BX7A 1VBHA 3V5FA 4W5UA 4E8DA 1IGWA 2WKLA 2FFIA 3LCFA 2BG5A 1V4YA 1UWRA 1F7BA 3M0HA 3MHUA 3WLQA 3S46A 4C6EA 1BRLB 4ICNA 2YL6A 2X2YA 3XINA 5G1TA 1JCMP 1XSIA 1W5PA 3H4WA 3SY1A 5C9WA 1A0CA 1O1HA 4UQCA 1V0MA 1SO5A 3APYA 1WE5A 2PD9A 2F61A 5M1TA 4H01A 2XIOA 3EWYA 3M47A 3IUDA 4NXSA 3NL3A 4XV0A 3QJAA 3CIWA 2V2DA 5FAJA 2BY0A 3OHAA 7TAAA 2NWSA 3B06A 5KG0A 3AALA 4OV4A 1OABA 3W2JA 4C6BA 4DWSA 2IKIA 4AD3A 3STEA 1MMFA 4HMEA 2PLCA 1E4NA 1A4MA 3WENA 3L66A 3ARSA 1TV3A 3UPBA 4N2YA 5HK4A 1WV2A 3NQCA 2VQTA 4LUSA 2EQDA 4YMZA 3D0CA 5GNZA 3MV11 4H9MA 5LXEA 1DPMA 4YL2A 4JD4A 1E1EA 2ZZ1A 5BRBA 5L1LA 4A8NA 1ADOA 3HG2A 1KFWA 4MKNA 5FF0A 4AIEA 4V1YA 1XLJA 2BOGX 3E49A 5EMMA 2X40A 5LHEA 3KAOA 3QM3A 1Q4NX 1W6TA 3N2CA 4KWWA 2FMNA 1ITCA 2WWCA 1DEDA 3VFCA 4ZOEA 2DUAA 3EPGA 1VBGA 2H6RA 1A50A 5IFPA 3E2VA 4MZ8A 3WG6A 1H49A 2E6DA 1E43A 2WM1A 3T07A 2AGOA 4G7EB 1O12A 2PDQA 4W8LA 3N2BA 4JQ3A 1W5QA 5E9AA 2X0HA 2CHOA 2YBTA 3TCSA 2PU0A 4H6KA 4XKYA 3KHHA 3M9OB 1VIWA 3QYQA 1SZEA 3IK4A 1YDOA 2VOTA 2VEKA 3U4FA 3H70A 4QNEA 1R0MA 5KZDA 2CERA 4LUTA 5T9BG 3SCRA 2VR4A 4CNPA 5HWNA 1QK0A 3BUVA 4LVAA 4CLMA 1OZMA 2RAGA 2VFHA 4NZFA 2NSXA 1CGXA 3W71A 4JHZA 4MNMA 1H1NA 2W9AA 3GTHA 5BRPA 4C6PA 5AVNA 5L1KA 2J8GA 1E4LA 4ZB0A 3U6WA 3FJ6A 3LQGA 2E9LA 4XD6A 3WQWA 4LY8A 4ROPA 5EYWA 1PE1A 5DMYA 5IXEA 4X3ZA 3VDGA 4CNSA 1GQLA 3U9IA 4S3DA 3NL2A 1EHNA 2CPUA 4F4YA 4IRDA 1XLEA 3UWUA 4O1DA 3FCPA 4Y9MA 1OIMA 4Y9AA 3T55A 4KH2A 3BVJA 4LEQA 3TW7A 3CM4A 3MW7A 4Q4RA 3M9MB 3ENLA 4G3IA 3W7IA 1LOSA 1EGMA 1SW0A 3TNBA 5FSEC 1QVBA 2Z2UA 4WSKA 2EJ1A 5D33A 3SEPA 4TQRA 4PR4A 3VOFA 1AJ0A 3P0XA 1WOAA 1K1QA 2CCRA 4ECRA 1PVNA 1TWWA 2J9ZA 2Y5EA 3H2MA 3GHUA 4FO4A 1EJTC 1PIIA 1DBTA 2HXUA 4JX4A 5M2FX 3GM8A 2BS9A 2YXOA 5AHFA 1UIPA 3BV7A 4MFEA 1WUEA 5KFVA 3WBYA 4QW9A 3BGGA 5BROA 4J9LA 2O4MA 1TSIA 5CLTA 2ACUA 2W62A 3GYEA 1A3WA 6CGTA 2V30A 2V2HA 1E6RA 2J6TA 2FZMA 1ONXA 1BHGA 4O3SA 4PL1A 3G8EA 4ICCX 4MYXA 3TJ4A 3N6JA 3IV3A 4YHGA 1WDDA 1AFSA 3PZPA 1IR2A 4IGSA 3HG5A 1DJZA 2LLEA 3G77A 1HJXA 1FXPA 1TWIA 2VX5A 5K4XA 1N82A 1H3GA 5EMJA 4H4IA 2W63A 3DH7A 2YB1A 4C6FA 4GYFA 4NJKA 3VTRA 3W7EA 1GVIA 3CUFA 1FOBA 1V3LA 2XPKA 4S39A 4UMBA 4ZQNA 2VRKA 4DYEA 2WVVB 3GYCA 3N13A 1W3LA 3N14A 1XLBA 3WN6A 2HPMA 2FVMA 3GK0A 5M03A 4R88A 1O5XA 2G8ZA 4R53A 3L4XA 1HKMA 1DHKA 4M7SA 4Z2IA 2DSWA 1E71M 1V0LA 2VZVA 4LRTA 3BL3A 1ITUA 3HQOA 2CBUA 3IGSA 2I16A 3ORWA 5CZJA 3CTTA 4J4KA 3AXKA 1CTNA 1YE4A 1RCXB 3SIZA 3BG5A 2XUCA 2F6KA 1RK6A 2YL9A 4HT3A 1NOFA 3S1XA 2YPIA 3NFUA 5JBEA 3CT2A 3U7BA 4A4AA 1SJBA 2J7HA 3O0FA 1RCQA 1OB0A 1XC4A 4NVTA 1QI3A 2O7QA 4QCEA 3NPUA 1GVRA 1XRSA 3TEVA 5EA9A 4PBEA 5K9XA 3ZSTA 1XYAA 1DL3A 4ZO6A 5ABGA 3LBCA 6REQA 1IZKA 4QIUA 3SDOA 3W7GA 1GW9A 1BXBA 1QMLA 1RJRA 3VCCA 5GJNA 2J62A 1VFSA 5DF0A 4D6DA 3ZVHA 3CV2A 4PUKA 3BE7A 3ARTA 3O3RA 4MWAA 1W9DM 1ZALA 2VZOA 2Q71A 3G22A 2O56A 3CU2A 4DZ5A 1LQ2A 4X9SA 4LC6A 4IG2A 1Q7MA 3E5BA 1OM0A 3QEZA 5DCBA 1VFLA 1OFAA 4C6IA 2R8IA 3RNDA 3S4TA 2PGRA 1KNWA 3TYBA 4KWUA 4DL6A 1HVQA 1QNQA 1CX9A 2R8KA 1LOLA 4GNVA 3FW6A 4LY4A 1EUNA 1QATA 1VHCA 1PUDA 2AMGA 1B5TA 1UJPA 3VKAA 2PODA 4W8AA 3RDKA 4GH1A 3A9BA 4REQA 1YPXA 2KZHA 7CGTA 3PULA 1ONWA 2DVUA 1BGGA 4RNIA 1B3OA 4GC4A 4UTWA 4LNYA 3H4BA 2CKRA 4B2DA 1P0DA 3UBPC 3NZRA 4JQ2A 1SFTA 3QHOA 4K36A 1TO3A 4NRRA 1UH3A 1VC4A 3CASA 5BOFA 1KB3A 2E6AA 2P0OA 3L4YA 4ECVA 1OINA 2GDQA 2VD8A 3AHXA 4J9OA 3VIIA 2GJNA 3QGKC 3ARXA 2ZX5A 2WMFA 4Q8MA 1H11A 3CHFA 2H3DA 4HNTA 1XYZA 4B5UA 2DZAA 4LBSA 1L6YA 2Z27A 3MR6A 4GY7A 3CZ8A 2H3BA 3MHGA 1FKWA 4XX6A 1BXCA 4EF8A 3B40A 4D8AA 4EXBA 1X96A 1OGSA 3E6EA 1H7PA 5BNKA 3IJ6A 4HYVA 2VC7A 2DIKA 1E0TA 4RNOA 5HUPA 2YL8A 2GYIA 3E2RA 2J77A 3MVIA 1K9TA 1MQPA 1S2CA 1IT7A 4ZODA 4C1NB 1W9BM 4JIEA 3CHVA 1M7OA 4TVUA 5FF4A 5HQEA 4UOJA 1S38A 1DJIA 2UY2A 4GZIA 1TX0A 3STPA 1OADA 4W88A 2QHAA 3V0SA 1L6SA 2P1FA 3W2KA 2ZA1A 3T40A 4AQLA 2BHYA 4JFUA 3S5OA 2VGBA 3L67A 3C3UA 4XAZA 4H9ZA 3SCPA 5REQB 3W02A 3C56A 2OQYA 2X16A 4AWUA 3W7QA 4PE8A 1ZJBA 1PHWA 3CLMA 4MKSA 1W3HA 3KRZA 1XH2A 2OR2A 4DL2A 2QAFA 1KM1A 4FS9A 3KRSA 4JR5A 1DKWA 3M07A 4UQDA 1UWUA 3MQTA 5CPNA 2YXGA 2Z2AA 1IIGA 3ITYA 1B90A 3PFMA 1UD6A 3HTWA 4PMXA 3VA8A 3CQ0A 2JEQA 3QW3A 3ME3A 2P3EA 2ADAA 4XBJA 3SQSA 1MUWA 4ZBCA 3W7PA 1UWQA 1LTDA 4FLRA 1S5NA 1RA0A 5L1IA 2PWHA 4HNLA 1VFTA 1K7XA 3QZAA 5E6ZA 2WLZA 3TTOA 1OC7A 1UZ4A 2MANA 3T2OA 2NX1A 3F5LA 3MBDA 2OMAA 5IDZA 1LROA 1K8YA 3BWWA 4U2ZA 2MUCA 2XIQA 4KW2A 2BWGA 1X98A 3P82A 4RZ4A 2BLEA 2VA3A 4NT0A 1O68A 1XYLA 3AJ7A 2QCGA 2CIPA 5JBDA 1H7NA 1DXIA 2ZFAA 1BFNA 4I5RA 1NIUA 3M7WA 1G6CA 3E3HA 3MO7A 1HP5A 1XYCA 2ICSA 2NQJA 2DP3A 3CGTA 2OLAA 4CNOA 4PMNA 5HR6A 4OVXA 4PUUA 1FWCC 1W3IA 3UVAA 2E8YA 3DG3A 3HQ1A 3GQCA 3VGBA 3GV7B 4RE4A 3CQKA 4ZOBA 4F4XA 3TUUA 4JQAA 4YTQA 1FDJA 3IIVA 1E55A 3OZOA 4RUAA 2WNZA 3KEHA 1V7YA 4AHOA 1PV8A 4H00A 3OB8A 1EC7A 1XLLA 3EDJA 2TAAA 3BLLA 3KOWA 5DN1A 4PULA 1OFDA 3LRMA 1VIZA 4DO7A 1YE6A 3GC5A 4QFUA 5XIAA 2ACSA 4OHQA 4DZIA 2QPSA 3GR8A 5H91A 4G1KA 1XLFA 1P6BA 4N0RA 3UNDA 2JGYA 1XG4A 4WDTA 4HK5A 4CVWA 2FPYA 2UY5A 5MKGA 1KBBA 3BW3A 2PLMA 3LCWA 4PODA 3GIIA 4LH8A 2E1WA 2SFPA 4WOQA 2XFWA 4GVHA 3P2VA 5AY7A 1UWSA 4AVFA 1SO6A 2UVWA 3N4EA 1YW1A 3LHUA 1YHTA 4YIWA 2D2JA 3CIXA 1J11A 1UCWA 1WZLA 1EUAA 2WPBA 5BWAA 3WDQA 4CGTA 3WDIA 1NWUA 5DCEA 1MDRA 2WZEA 3GXTA 1VFOA 1OG6A 1OX6A 4BI7A 4HZ7A 4RNMA 5ABHA 2CZEA 1KXQA 1EIBA 4C91A 5I23A 5JBFA 3THAA 4K8HA 3PHAA 1YRRA 3TDFA 2OGJA 2QNEA 4G56A 4RE2A 1GG1A 1M03A 2FPTA 1Q6GA 3CB3A 1R5YA 4I8YA 3PUGA 4HNOA 3M41A 3GY1A 1C91A 4JOMA 5F9NA 5EWFA 1UH2A 4Z1CA 4AZCB 1Q6QA 1CXIA 1FDYA 4RUCA 1T99A 1DORA 3VIMA 4MWAE 3KTSA 4HOZA 1KM3A 1I2QA 3SCVA 2OOGA 2PDYA 4X60A 3PNZA 5A6LA 1F8IA 3AXXA 2G3JA 2V5JA 8CGTA 4W4QA 3SW6A 1YQ2A 2Q09A 2EF9A 4ZR8A 2BSLA 2OGYA 4MVAA 2QJGA 1AH0A 5A6SA 2YCJA 4MJ4A 3WCZA 2YJQA 4LB4A 4JY8A 4JPGA 2JFEX 4GY1A 3K5XA 3RCMA 3LXCA 5CQ1A 1DJQA 1UKQA 4JTTA 4V27A 3NSNA 5FOOA 1TPDA 3L4VA 5KFMA 1GONA 2WWDA 4F0LA 2HZGA 1RUSA 3TN3A 2BASA 1DWGM 3OU8A 1EDQA 3RO8A 1H2JA 3IGUA 1S97A 4F0HA 4Q8OA 1J5TA 3GIQA 1ZPTA 5DGAA 2VCCA 4PMZA 3MR3A 4ZB5A 2AL1A 3DYOA 1W3KA 1ZZMA 2FHBA 4LC8A 4QDPA 1QU4A 4QWBA 1WDWA 2HV5A 3PW2A 1A5KC 4LRSA 2HK0A 4UBPC 1B57A 4DI9A 1I1XA 4O52A 1I6NA 1VBRA 4BF5A 2FGBA 3GU1A 5EMKA 3MMWA 3MSRA 4DRSA 2RGMA 3H4GA 3PZUA 1XIEA 4A3RA 2J7FA 1IXPA 1F3EA 1VJSA 3GE7A 2VX4A 1W3NA 1FWNA 1JQVA 2YSWA 1WBHA 1F3WA 1FX6A 5H8UA 1OX4B 1YYAA 3H6OA 4RZBA 3TAOA 3GFXA 3NZ1A 1S9FA 3DBNA 3TE9A 2GWGA 5C9ZA 3F4VA 4GD0A 1A0EA 5JQ9A 2PRLA 3UYCA 4NX5A 2AGTA 1XSJA 4RNFA 3NM1A 5D05A 4AH7A 1EOKA 2AKMA 1L9WA 2ATMA 1EJXC 2ATSA 5AYYA 1PZ1A 1E6PA 3IJLA 3SBFA 1BKHA 1FCUA 4NG3A 2G95A 4Q4SA 1TWZA 5KZ6A 2BZNA 3T2PA 2V8ZA 1P1XA 1C29A 5C2CA 1TV8A 1DWFM 4FLOA 3FEQA 4YLWA 3URNA 3B97A 4LAZA 3ITCA 5KT6A 2HBXA 2J13A 1UQYA 4RZ5A 1VLWA 3PBUA 4ZSTA 5D8ZA 1PZ2A 2BB0A 1AD4A 1QNRA 3RUBL 1OT1A 1SUXA 1TRDA 4NI3A 1BYBA 1VF8A 3T6CA 4M24A 1FQ0A 3UG5A 3BLDA 3LCHA 4PBFA 1KW1A 1GJWA 4D2JA 4BZYA 2CC0A 5C2XA 4DBEA 3R8HA 4DF2A 1LDCA 3R0KA 4W93A 5HINA 3HGRA 2R1NA 3M0LA 1I1WA 1QXLA 2CEQA 2YDQA 3BC9A 1NDZA 3H55A 2ZOXA 1ELSA 4UOQA 5C9XA 3BSHA 1N7KA 3S1UA 2Z1VA 4QJ3B 3P14A 5FF2A 3MO4A 5LA0A 5JMUA 4M6QA 1N2VA 3B4YA 5A6BA 4LSBA 2XHYA 4MADA 3B05A 4J40A 3LD5A 4PRWA 3VGEA 1VP5A 3OW1A 2YR1A 4GCXA 3WH9A 4ERGA 2PDBA 4JTQA 2GDUA 1BWKA 1O5KA 3WIJA 3AHZA 3DHUA 3RRXA 3NXFA 5BW6A 3STFA 1TJ2A 1IEWA 2Z26A 1SFSA 3IUIA 1CB2A 1QW8A 2DUXA 3NQAA 3ARRA 1E6NA 3NGDA 1OQFA 4ED7A 3RF9A 5GNXA 1T3NA 1BEUA 4GI6A 1NWSA 3NZQA 4TVCA 1BGAA 3DDMA 3ABZA 1Z7AA 4AIOA 2WQPA 1ZP3A 3RB4A 3ABXA 5D2VA 5HMDA 4H9XA 4AVOA 3WQVA 3OG2A 2GLKA 2FQIA 1YBQB 3TNOA 2DU2A 3SUWA 1ODZA 3UJEA 4AZ5A 1GWJA 3CEPA 2OSWA 5C6MA 1JGIA 2FZ9A 2GQ9A 5EMYA 2YCLB 5F2IA 1MYRA 2P10A 4WXZA 5LA2A 5KG7A 2FZNA 5FEPA 4ZB2A 3G1YA 2Y7GA 4KKXA 1RPKA 3E0LA 4ONVA 3P61A 3VUPA 3GNNA 3UXIA 4DZHA 2XSAA 4HYKA 2ONEA 4RL3A 3QLLA 3WUGA 4O50A 1G67A 3SO7A 4CEUC 1ISVA 2Z6IA 2QKFA 4QSHA 1ZLPA 4RZRA 2NXGA 3NJ3A 4HP5A 3G1SA 2QV5A 1J9YA 4H6EA 2BBFA 3HIJA 3UCCA 1CXEA 1WX0A 1P0KA 1G4EA 3WEMA 2HSAA 4LALA 4AZGA 4URIA 3F2CA 3LXBA 2Z00A 5K2ZA 1JZ3A 2AU0A 1T6MA 3BSMA 5D4YA 3WEZA 4B9ZA 4JXCA 1KFJA 2X30A 5AHEA 1FWAC 1NU5A 4JHOA 2QDDA 4PUMA 3QFWA 5AZ0A 1H7XA 1QASA 2H8XA 4AF0A 2W0UA 4NAFA 2OQHA 1J5SA 5CBJA 4MSSA 5DLGA 4PTNA 3W7HA 4JTUA 3N18A 5FA5A 1UASA 5A2BA 5CG7A 2OZ0A 5EU9A 3C0SA 2ZVIA 3UGRA 4W8BA 1EA9C 4J3UA 3LEPA 2WHLA 2OOFA 1A0DA 4TIMA 3ABQA 3GBEA 3T0BA 1K8CA 4YU1A 1UIOA 3GDTA 3E9AA 1J0HA 3UWEA 3N3TA 2WZMA 3GIKA 2EG8A 3RM4A 2PURA 1K6WA 5KSWA 3BQ5A 4JTSA 5AC7A 3LPGA 4CCEA 1DHPA 3PZQA 4M5PA 3EOEA 1JULA 1DWIM 4DIAA 1HKVA 1FH8A 1OCBA 1TVLA 3C4UA 1UOKA 2PDUA 3KBJA 5KFUA 4HZ8A 4ZOAA 1R7OA 1O1ZA 3G1HA 3EX4A 3QGAC 3SUSA 1M3UA 1KM5A 3TSDA 1MSSA 1EGVA 2GVYA 3H2CA 4ECYA 3B8TA 2FPVA 3ZIZA 1HP4A 3VUSA 4X0VA 4RDWA 5I03A 2P8CA 1QR7A 4OIFA 1GOMA 3VNYA 3AZTA 1S39A 5PTDA 3R43A 4KEMA 3TOPA 1NARA 3URQA 2BVYA 3QR1A 4N42A 1O95A 3B04A 2HNEA 5DT7A 2VZUA 1KM6A 3AIWA 1MZRA 3L68A 5AYIA 3GB6A 2O9RA 3L23A 1EZ2A 4GOAA 4I8DA 1TB3A 1XLGA 2TODA 4QLLA 1RJQA 3CB8A 4J9SA 2EPOA 2ZA3A 4R8UB 3UZYA 2WJFA 3OOQA 2FMOA 2QUUA 3MP3A 3RJYA 3LV5A 3NNTA 1E9ZB 2ZXDA 1I4NA 2D2OA 4XZIA 4I3GA 4Z2LA 5G5IA 5EWGA 4J9RA 1QT1A 3KUMA 4Q44A 3TXZA 1REQA 5KG2A 4PSPA 2E4TA 2ZUSA 1UOZA 3FJLA 5KINA 4Q7BA 2Z1XA 2W66A 4E8CA 5KFBA 1BSLA 1IIHA 1SU5A 3AWOA 1X1OA 3VGFA 1JXLA 5ABTA 3DFPA 2GJPA 2RDTA 1NDWA 4ORIA 3KOYA 3MYPA 1PS9A 3W01A 3OBEA 5CGMA 3KS6A 4DL5A 3MUIA 1IE7C 2IXUA 4O12A 4CNNA 4IJBA 3HF3A 2GK1A 4MJMA 3FDGA 3O05A 4JX5A 3S3GA 3SGUA 1Q13A 2NUXA 4AG0A 5BOEA 3NG3A 3NGFA 3PZVA 2CETA 1WXYA 3AAMA 2BQ3A 4D71A 4H9TA 1FP9A 3IVSA 1XIDA 1JVNA 3KVLA 4GH3A 4MGGA 5FF7A 3M4HA 4QBXA 4BF7A 1MEHA 3UEQA 5XIMA 3BH4A 3W1PA 3FJNA 2Y8UA 2C1HA 4KCTA 1EEPA 3P84A 3BZJA 3PSWA 4OWGA 3KP1A 3HOJA 5CC7A 3WD2A 4Z0SA 4BWLC 1GORA 4GXMA 1JZ8A 3BQ1A 4LCSA 3CZJA 3WELA 4EPDC 3W25A 5CPMA 3QY6A 2Y5SA 2HE5A 2XSXA 1KC7A 4ECZA 1NWRA 3C0LA 4YCOA 4UTMA 4Q32A 4D9PA 1PDZA 1RPXA 3WSUA 4JDBA 1S2WA 3OGSA 4GC3A 3SR7A 4GK8A 4HA0A 3WF3A 4HTYA 3QXBA 4DF1A 1DTUA 3NPVA 2W5FA 1QI5A 4JN6A 3UR8A 3L12A 3CUGA 4CVUA 1E0XA 3CMJA 3GXFA 4WKFA 4LCRA 1LRNA 2B7QA 4IMEA 2O7SA 3GC2A 4IFKB 4MAVA 3AS0A 1V6TA 2J4GA 3T9PA 3LBOA 1IXQA 2E28A 2VI0A 1UA7A 3CIVA 1EO7A 5HATA 4CQBA 4WY0A 4O3OA 2QLYA 3VIHA 2FLNA 2VC9A 4HU0A 3FHAA 4AU0A 4HPHA 1JX4A 4TR9A 4QDMA 1M5WA 3BZGA 1DIOA 3F1QA 3NOYA 4NL1A 4MLRA 1TZ9A 1CCWB 4YR2A 4FOKA 1EDGA 1MWOA 3L5LA 1R38A 2A7NA 1E51A 1LM1A 4AD5A 2FB3A 4KCWA 5LKYA 4G6CA 3UA4A 3A3WA 2CWXA 2WHMA 3AISA 5T91A 3VO0A 3KBVA 4PYSA 1QCWA 3KOXA 2JKPA 1HXJA 1W8GA 1WCGA 2F6XA 3TAKA 1ZAHA 1SJDA 3VGGA 4BF9A 1BVWA 5KTLA 1MRAA 1RQHA 4IJCA 2O92A 4RNNA 3PANA 1CGWA 4O28A 2UVUA 2WJDA 4DM2A 3BLOA 3D5HA 1Y0EA 1XLDA 4EPEC 2VOMA 2PDLA 3SSZA 4LCQA 1VQTA 5AFDA 2OODA 4B3ZA 4JNZA 5GPRA 1VZWA 3TN6A 3MI6A 1YNQA 4DWSB 2F6UA 4KCVA 1TJPA 4LAMA 1R8LA 3FIGA 2QIWA 2YDRA 4ZA0A 3TIMA 3CNYA 2UZ9A 3T5KA 2EKGA 4MYAA 3S2LA 4AW7A 3FOKA 1OK4A 3MUZ1 1J93A 1TA3A 2ASDA 2W9BA 3P60A 1F6PA 3WDRA 4ZL1A 4MZYA 3GLCA 3VIJA 1HQTA 3E2SA 3GVWA 1A5OC 4GY0A 1MEIA 5JH1A 3D47A 4W89A 3UD6A 3N17A 4GQBA 4GJ1A 4LANA 1L6WA 1RJPA 1MW2A 3BLPX 1V3IA 1AH4A 3DAQA 3FDSA 2C2DA 1E6XM 3I4EA 5KFPA 3GU9A 3E0VA 4RPQA 4LBUA 3USZA 1Q6RA 3MT1A 6XIAA 2W9CA 2GQ3A 4E4UA 3F7JA 3W37A 5I6SA 1AW2A 4GXPA 2PFHA 4XZNX 2VR2A 4A21A 4BEQA 3IJ7A 1O66A 3OG3A 1S1PA 4TXEA 5KT2A 3S2JA 4JTJA 1XH0A 1MQQA 1XDMA 3VK5A 4XKYB 4MY8A 1SGJA 3GTFA 5KITA 2PRHA 4W84A 4LS0A 1GZJA 5HPCA 2RUSA 3M0VA 4KGJA 3TOYA 2QF8A 3SZ8A 4Q22A 4Q33A 4ATWA 4LUTB 2WNWA 2GJRA 3AZRA 3WLKX 2GGHA 4S3JA 2CLPA 2R1MA 5D9NA 1SVDA 4QW8A 4GE8A 3P8IA 2A0NA 1UR1A 2NT0A 2V38A 1KRCC 1VH7A 4P8XA 2BXZA 5DY3A 3M46A 1PPIA 2PDHA 2QCDB 4GABA 1Q8JA 3IJQA 3PBYA 5KFJA 1GQKA 2CXGA 4NJJA 1IWAA 4IIHA 2OWXA 3OIXA 4DXKA 3DHDA 2Y1HA 2PC8A 3H24A 4RPPA 1XISA 1V3JA 1RYSA 2ZC8A 4RV3A 1LL7A 3W1AA 1ADDA 3V0UA 2Z1BA 1W5MA 3L9CA 4HA3A 4L61A 4U6PA 5IBXA 2PDIA 4FIRA 3VX0A 3CH9A 4FEZA 3K13A 3WK2A 4AISA 2ANUA 4X2RA 3DI0A 4US5D 2R1LA 3DFTA 2VKZG 3P62A 4Q4PA 3U2EA 2QCMA 5LNUA 4RNHA 2ASLA 3DG6A 4U10A 1US0A 3MWAA 4IM4A 3N6HA 3RPDA 2OX4A 2DW7A 1EFZA 2ISSA 5AECA 3W26A 3N3MA 1R3QA 1JXKA 3C2RA 3G0UA 3AIEA 4DI8A 2IQDA 2OSYA 4LVGA 2ZICA 2R9RA 3AYRA 3BGJA 5CSYA 3VOCA 3W85A 6TIMA 3G0XA 3OA5A 1WOBA 1I45A 1FCQA