1P1MA

Structure of thermotoga maritima amidohydrolase tm0936 bound to ni and methionine
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
404
structure length
404
Chain Sequence
MIIGNCLILKDFSSEPFWGAVEIENGTIKRVLQGEVKVDLDLSGKLVMPALFNTHTHAPMTLLRGVAEDLSFEEWLFSKVLPIEDRLTEKMAYYGTILAQMEMARHGIAGFVDMYFHEEWIAKAVRDFGMRALLTRGLVDSNGDDGGRLEENLKLYNEWNGFEGRIFVGFGPHSPYLCSEEYLKRVFDTAKSLNAPVTIHLYETSKEEYDLEDILNIGLKEVKTIAAHCVHLPERYFGVLKDIPFFVSHNPASNLKLGNGIAPVQRMIEHGMKVTLGTDGAASNNSLNLFFEMRLASLLQKAQNPRNLDVNTCLKMVTYDGAQAMGFKSGKIEEGWNADLVVIDLDLPEMFPVQNIKNHLVHAFSGEVFATMVAGKWIYFDGEYPTIDSEEVKRELARIEKELY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein TM0936
publication title Structure of the hypothetical protein TM0936 from Thermotoga maritima at 1.5A bound to Ni and methionine
rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 147
structure length 404
sequence length 404
ec nomenclature ec 3.5.4.28: S-adenosylhomocysteine deaminase.
pdb deposition date 2003-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 1p1mA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1p1mA02
4INFA 3MKVA 2Z2BA 1FWEC 4R88A 4KETA 3HPAA 1R9YA 1FWDC 1FKXA 1FWGC 4KF1A 3E2VA 1FWCC 4L6DA 3F2BA 2HBVA 3UF9A 3HM7A 4BY3A 4H9YA 4G2DA 3E74A 1ONWA 4QSFA 1RK5A 4DO7A 2GWGA 2HPMA 2OGJA 1JGMA 4DZHA 3E38A 4PCPA 4QROA 3S2JA 2YZ5A 4H9VA 1NDYA 2VR2A 4EPDC 3WZ0E 4GZ7A 3G77A 4IFKB 4R85A 5FSDC 1UBPC 4IH3A 4LCSA 4XAZA 3B0XA 3WYZA 2YXOA 4C5ZA 1EJTC 2BGNE 4C60A 4IF2A 2GSEA 2VHLA 1R9ZA 3IV8A 3ID7A 4GY0A 4C6NA 2RAGA 2Z25A 2O4QA 4EPEC 4GC3A 3RN6A 4XD5A 4DI8A 1EJWC 2OODA 1KRBC 3SO7A 4RDWA 4C6FA 4NP7A 2Q09A 1YBQB 4GX9A 3B40A 4HK6A 4KEUA 1PTAA 4AC7C 4C6KA 2ADAA 1KRAC 1YIXA 1POJA 3ITCA 2PUZA 2Z00A 3PBMA 4GYFA 3TN4A 3IJ6A 3E0LA 2Z28A 4DLFA 1O5RA 3LS9A 1J6OA 2OQLA 4KESA 1W1IE 1GKQA 3OU8A 2Z27A 3SFWA 3NURA 4NI8A 4LAOA 4J2MA 3GG7A 2OB3A 4WGXA 4PE8A 3K5XA 4M51A 3V7PA 2UBPC 4B3ZA 2YB4A 4H9TA 1UIOA 2Z26A 3O7UA 4DLMA 3LA4A 1QW7A 3F4CA 3C86A 4H9MA 1BF6A 2HNHA 4HJWA 1A5OC 4IFKA 2VM8A 4ERIA 3AUOA 1I0BA 4DYKA 3GGMA 3EWCA 3ISIX 3NQBA 4RZBA 4YIWA 2GZXA 2R1PA 2YB1A 4XD3A 1FWHC 3OJGA 3CS2A 1V51A 2Z7GA 4XAFA 3LGDA 4ZSTA 4C6EA 4LAKA 3F2CA 4WHBA 3S2LA 2FTWA 4R7WA 3LNPA 4CEUC 2VC5A 1FWAC 4KIRA 4HA0A 3MSRA 2EG7A 4WVXA 4EP8C 1KRMA 1RA5A 4CNSA 1YBQA 1YNYA 2QT3A 1M65A 4RDZA 2WM1A 2PAJA 3MPGA 2O4MA 2QS8A 3GRIA 2BB0A 3UBPC 3GIQA 4CNTA 4UBPC 5HMDA 1EJSC 3OVGA 2R1KA 5FSEC 4LH8A 3OODA 4DZIA 4PBEA 2OOFA 4J5NA 3UR5A 3LSCA 3IARA 4CQBA 4MUPA 3NEHA 4HK7A 3K2GA 4IGNA 3WMLA 4F0RA 2F6KA 3E0FA 1GKRA 4C6QA 1NDZA 3AU2A 4IFRA 2P53A 5HMEA 1VFLA 4C6OA 1A5KC 3TN5A 3GUWA 1A5MC 2DVTA 1FWFC 2KAUC 1UMLA 1V7AA 4LANA 3AU6A 4RDVA 4CNUA 3DCPA 3KM8A 3PAOA 2FVKA 3DC8A 3EGJA 1I0DA 4F0SA 3S2MA 1P6CA 3RYSA 1PSCA 3LY0A 4ZSUA 1R9XA 2IMRA 3QGAC 4IQJA 5CH9A 5LXXA 3CAKA 3HTWA 3URQA 3URAA 3MJMA 3IRSA 3QY8A 4V1XA 4C6DA 4KERA 4I6VA 2PGFA 2VUNA 4AQLA 3RHGA 2GWNA 3T81A 2UZ9A 2I5GA 2VC7A 4H00A 4RE0A 4GX8A 4XAGA 3O0FA 1J5SA 3QY6A 4GK8A 4L9XA 4J35A 4PBFA 4UB9A 4E3TA 5A6TC 1FKWA 4PCNA 3URBA 4OFCA 1EJXC 1EJVC 2AQVA 4DI9A 1K6WA 4KEVA 4RDYA 4LEFA 3GU2A 4ERGA 4XD6A 1ONXA 4LAMA 1A4MA 4ICMA 1XRFA 1QXLA 2Z4GA 4KQNA 2WJFA 4F0LA 4C5YA 1RA0A 3GU9A 4QRNA 3GU1A 1A4LA 1RJRA 2ZC1A 4V1YA 4H01A 4B90A 1FWIC 1PO9A 1HZYA 1YRRA 4HK5A 2QPXA 3TN6A 2R1NA 1J6PA 1ZZMA 4C6BA 4IGMA 3K4WA 3R0DA 1P6BA 2Z29A 1K70A 4LALA 1RK6A 4C6LA 1E9YB 3CJPA 4H9ZA 4QS5A 3PNUA 3A3WA 2EG8A 1V4YA 4CEXC 4B91A 2Z2AA 3A4JA 2R1LA 1ADDA 2GOKA 4ERAA 3QGKC 4C6CA 3TNBA 3F4DA 2WJEA 3DUGA 4JOMA 3LU2A 3GTIA 1KRCC 1M68A 3UR2A 1EYWA 3FDKA 4EPBC 3F2DA 4D8LA 1YMYA 4IG2B 1DPMA 4QS6A 4B92A 4G7EB 2XIOA 3QY7A 2W9MA 4GXWA 2AQOA 3T8LA 3GTFA 2DVXA 2EG6A 2I9UA 1KCXA 4C6IA 1EZ2A 3IACA 3URNA 4H9UA 3N2CA 1EJRC 1P1MA 2D2JA 3GIPA 3IGHX 3MDWA 1RAKA 1V79A 1O12A 4XAYA 3PNZA 3TN3A 1UIPA 2Q01A 2E25A 4NG3A 2ANUA 4TQTA 1ITUA 3E3HA 3OOQA 4LCQA 4GY7A 3GTHA 4C6PA 1GKPA 2CZVA 2Z24A 2G3FA 5G4HC 3ICJA 1XGEA 2D2GA 1K1DA 1A5NC 1NDVA 4KEZA 2PGRA 3RCMA 1WXYA 1FWJC 1A5LC 1XRTA 4LCRA 1WXZA 3UPMA 1S3TC 1PB0A 1ITQA 2FTYA 2QVNA 4C6JA 4GY1A 3D6NA 1IE7C 2P9BA 1NFGA 1POKA 3FEQA 3MVTA 4I6KA 1EF2A 1FWBC 5AKQA 2HBXA 3JZEA 2E1WA 3LSBA 3GTXA 4CQDA 1M7JA 2Y1HA 1RJPA 4C6MA 2HQAA 1EJUC 3B0YA 3S4TA 4BJHA 1NDWA 2DVUA 2ICSA 4DNMA 2WJDA 3T1GA 2D2HA 4C65A 3LGGA 4EPKA 4IG2A 1XWYA 1E9ZB 3FDGA 1V77A 5HMFA 3PANA 4G7EA 5E5CA 3MVIA 4GBDA 4H9XA 2AMXA 3S2NA 4CQCA 3IPWA 4DIAA 2FVMA 4BKNA 3A3XA 3OQEA 2P50A 1RJQA 3ORWA 3EWDA 4Z42C 1J79A 2FFIA 2HPIA 4P5UA 4GOAA 2A3LA 4LFYA 2PLMA 4XD4A 3BE7A 3MDUA 4QTGA 2R1MA 4IFOA 3MTWA
chains in the Genus database with same CATH superfamily
5D9NA 1ISWA 2ABBA 3Q45A 2VVNA 4J1OA 4GZEA 1UR9A 3V1PA 1Q5MA 2EHHA 2NQHA 3B8DA 4KF1A 2EPLX 3NIYA 3BW3A 3U2OA 1OD8A 4S39A 5CPTA 4PZVA 2VOMA 4WKAA 4WX2A 4E2OA 4RCXA 4W84A 4PCTA 1JGMA 1Q45A 1UP0A 1W1YA 2FPTA 1RR2A 2AAMA 3B8SA 4EPDC 5DXYA 1TV3A 1XV8A 3C56A 4I8DA 4DBEA 3NGFA 4AHPA 1QOXA 1LZOA 5CSUA 4EXQA 3I6RA 3VO0A 1LWJA 5I79A 3ONBA 4XAZA 5A6BA 1KV8A 1UJPA 1ZB5A 3U57A 4IIBA 4UNKA 2ZCGA 2VGGA 4AH7A 4IMDA 3VKBA 5DG8A 1XINA 1Q6LA 4UTMA 3WLLA 3R2GA 3PJTA 5JMUA 4CNOA 3KDNA 3KWXA 1ZALA 1V03A 1RY8A 3BUVA 4CN4A 1B3VA 1WQ5A 1TTJA 4M5PA 4HQVA 1TJ1A 3WUBA 3N29A 5M2FX 1LLZA 4J27A 4JDYA 3MY9A 2ZVRA 1PTAA 3W1PA 1V93A 2CHOA 4RW5A 6A3HA 2Z00A 3UG4A 1TVNA 2J9YA 5CZJA 4GINA 1AG1O 2B81A 2XM1A 1UOZA 1EKOA 1C8XA 1R46A 3OU8A 3FDSA 4FNRA 1B2YA 1GOQA 3VD7A 2XIBA 2B7PA 3L5LA 2ZUTA 4V27A 2R8HA 2OFJA 3KCOA 3T09A 3E2RA 3NXFA 1N56A 2OPJA 3F5KA 1F5ZA 2DJXA 1G67A 3M6DA 3GH7A 2WSKA 5GNXA 5BU6A 1I2PA 4HZMA 2WPBA 4N9CA 2ZRVA 3P5ZA 1XJBA 3MS8A 3GXDA 2VCBA 3IGXA 4AD3A 1BRLA 4WVXA 1JNEA 2ZXDA 5J5RA 1L2QA 3W7PA 4OUEA 2YBVA 7PTDA 4HGXA 5JQ9A 4NJKA 1T94A 1CT5A 5FL1A 2YCKX 4V33A 4PSPA 1EJSC 3KBVA 5IDIA 4JTGA 2V8ZA 1FWSA 3VDCA 2ZZ4A 2R6OA 3EKGA 2Z7KA 4UOQA 3IARA 4I5RA 5F2MA 1PTDA 1EYEA 5C6MA 3V6HA 3ZR6A 5T91A 4FNUA 3WMLA 3FKKA 3VOGA 3WX7A 4O17A 2AL2A 1GW9A 3TTQA 2V3EA 1E4IA 4B5NA 1TELA 3ABZA 4PUNA 3UR7A 3AU6A 2WHJA 3EGJA 1KCKA 3DHUA 4HP5A 1SFJA 1QO5A 1ADSA 5CLTA 2XHYA 5GJPA 4ZCWA 2XC9A 3QRHA 2GQ3A 4GYPC 3HTWA 3VNZA 1ODZA 5C9WA 3HG5A 3HFYA 5E09A 3BLKA 2GVLA 2O9TA 2V2CA 2WC7A 4H04A 4EE9A 2UZ9A 5AN7A 2YJQA 3BMWA 5C2CA 2DW6A 3THQA 1TO3A 3ZM8A 5KFXA 2WW5A 3LG3A 1GHSA 3PZGA 3O16A 1HUVA 4JKKA 5DMNA 5D2VA 4DJFA 3LPGA 3G1RA 5XIAA 2AGQA 4ZE4A 3UCQA 3IK2A 3NTYA 1A4LA 4R9XA 1HGYA 3DG7A 3AXHA 4GIYA 4A2RA 4H01A 2QPSA 3LRKA 4YMZA 5L9XA 3W7EA 3PG9A 1HZYA 3LGEA 2XWEA 1EO5A 4UR9A 1Y5WA 1HL8A 4XKYB 5BRBA 4MAVA 2JALA 2CWXA 4IGMA 3EZ4A 1W56A 2PP3A 4E4UA 3AUJA 4Q4QA 4GYJA 1AODA 5D9OA 2VDIA 2DFAA 4XVEA 1FDJA 1LQ2A 3EPGA 3GSMA 2OYLA 2G3MA 2BDQA 5EFFA 4KPLA 1MZHA 3ZYZA 3UWWA 3PPGA 4S3BA 1VCVA 3CWOX 3TYBA 1EWDA 1I60A 3L4WA 3GH4A 4EBEA 1KXQA 4D6EA 1IWPA 1WCGA 1KCLA 3CIXA 5CQ1A 4CU8A 2QGHA 2GLKA 3AXIA 2OCZA 3GTFA 2E8ZA 4LW7A 3UWQA 2NUYA 4J4KA 1OD0A 2PBOA 4Q6XA 3P93A 3IGHX 2J7EA 3WLKX 4FPSA 4RL3A 2VFFA 2XVNA 4DEFA 3L5AA 3O63A 1OX4B 4LUTB 3GZAA 4AD5A 3ICJA 1XGEA 1RLCL 1A5NC 1AFSA 3NL2A 2G3IA 1VHNA 1AMYA 3TLLA 1WXZA 4ZOAA 3G0XA 5G2IA 1PWLA 4QQ3A 1KWKA 4B15A 4GGBA 4Y7EA 2ZFAA 2YGYA 2V5LA 4YTQA 3E02A 3TR9A 1IIHA 2HVNA 4JR5A 1HJSA 1R3SA 3T07A 4A3UA 1NWTA 4HNOA 4JTJA 2BOEX 3S4TA 2G95A 1WAUA 1NDWA 2A7PA 2WJDA 1W5PA 4Q4OA 3B4YA 4IXHA 3P8IA 1JAKA 1J0ZA 5AVHA 2OOGA 1XH1A 3EWXA 1NSJA 5B80A 3WQCA 4JFSA 1TYGA 4N42A 2ATLA 3UETA 2XU2A 4F4WA 2YPIA 3SR7A 2D20A 5ECVA 4LAZA 3ZLFA 4BKNA 3WK3A 1OFBA 1OCJA 1E6ZA 4E38A 2H6RA 2ACRA 5LGZA 5K3VA 2JEFA 4YCOA 4GZJA 1CGYA 1EJ7L 4DX3A 1OFDA 1MQPA 1YE6A 5CSRA 1TMLA 1SZRA 3BSHA 4B5WA 4MDPA 1OINA 1XKYA 2ACUA 3AXKA 1RHCA 3MC5A 3CEUA 4NKCA 3BGGA 1U83A 3KVJA 4ZQCA 4H2CA 2OELA 4AU0A 3W07A 4A8IA 4RUAA 1JZ3A 2QCLA 3WJSA 2DIKA 1Q6QA 3D3FA 1O60A 1RBOB 3O15A 1E5NA 2W9BB 1TZ9A 5C0QA 5AECA 1H5YA 4AZ5A 2YA0A 1EFZA 3S9IA 3L5MA 3SCPA 2PLCA 3WELA 2GUBA 3CB8A 4FP1A 2A4AA 1YIXA 1NF7A 1OFAA 4J7RA 2CZEA 1OJXA 4DF1A 3E0LA 4CCZA 4EOUA 1J2WA 1UASA 1ITXA 1V0KA 3RB6A 3LLXA 1SVDA 1ZBCA 3BLFA 3KP1A 3ZSTA 1SSDA 5DLGA 4WGXA 1QPKA 3V7PA 1SZFA 1PX4A 2YB4A 5CLWA 4DLMA 3VIKA 4NX5A 3R6IA 4ZOBA 5DCEA 3TVAA 3B8WA 4NXSA 1ONEA 2VRQA 2QCMA 4IFKA 3CZGA 5JUVA 4J3TA 3KL0A 1XQLA 2YCLA 3B03A 1DWFM 1VBHA 1TSIA 4OOZA 4YN5A 5A2BA 3A9IA 3AZSA 1SMAA 3TFCA 2C13A 3DKJA 5CPSA 4YQWA 1EOMA 1B5TA 1LCOA 4J3UA 4UZUA 4GWEA 2QDHA 2FGLA 2WMGA 4KIRA 4Q4MA 2EG7A 1KXTA 1WA3A 1DEDA 2NX9A 1YBQA 4L61A 3E5PA 3CT2A 5KMYA 2O9RA 2R91A 1L8NA 1X6LA 3AYRA 1TB3A 4X9SA 3V6KA 4JD4A 2V81A 3H4GA 1NM9A 1XGZA 1BG9A 3HJEA 1GORA 1YTKA 2VX6A 3CIWA 2JE8A 4QW8A 4Q44A 3V36A 3FLUA 2VEMA 3GV5B 2YDAA 2X30A 5D4YA 4HSOA 1K1SA 2QQ6A 2PE4A 3EAUA 4LB3A 1B3XA 2AGKA 1IR2A 5H8UA 1J11A 4XZBA 2YL6A 3QR3A 3FJLA 3BAXA 3IIVA 1YDNA 3DYPA 1I0DA 1ISYA 3VKCA 4F0SA 5BOOA 4HMCA 2I1OA 4KCTA 3WQDA 4JTHA 5LIYX 4GGHA 3MANA 3QY8A 4JZ5A 1GTEA 4S23A 3TMQA 4MYAA 4QDMA 3MSGA 5JH2A 1TZ7A 1DP0A 3W81A 4O28A 3RO6A 5JIPA 4D2JA 3WMSA 1J93A 3N12A 1AA1B 1E40A 2PWHA 4KEVA 3AWOA 3SI8A 3HPZA 4AAJA 3MBFA 2I5IA 4B9ZA 3LCLA 3VCNA 1YQ2A 2INEA 4Z08A 1P1XA 5A2AA 1VRXA 4F0LA 1ADOA 1E3ZA 3TC6A 1JDAA 1OT2A 1TWSA 2X8RA 3S46A 3P5YA 4POCA 5B7YA 1UZDA 3KW3A 1X8FA 3BOLA 1JD7A 3JUGA 1GVIA 2VELA 4O13A 3R0DA 1E3XA 1E56A 2WC4A 1TG7A 1L6YA 4RPQA 1BYCA 3GVRA 1GOXA 4LALA 4TMCA 3LN3A 3R12A 4H9ZA 3R8GA 3OP2A 5L1JA 4R5EA 2EG8A 1V4YA 2BFGA 3A4JA 1W8GA 1B31A 5LZLA 1QHOA 1TA3A 1JIBA 2DZTA 4O1CA 4ZZ9A 3S42A 2YDQA 1K6AA 4AVNA 3TUUA 2PU1A 2RUSA 3D3AA 3BQ1A 2ZDSA 2WZTA 1D3HA 2R8WA 5T14A 3P60A 3AICA 3HQ1A 2AQOA 1GQKA 3L68A 1O1HA 1VP5A 2ZIDA 8CGTA 2WO5A 3PSWA 5EKYA 1UKPA 3TWBA 2OSWA 2GVJA 2Z1SA 1P43A 3LHUA 1QTWA 3SFKA 3IVTA 4JTKA 2NZLA 3NM1A 2J6UA 1VFUA 3M43A 4F4ZA 3N2OA 3QPYA 1QWGA 2D3NA 2XSAA 5G1TA 3IN5A 1KD0A 4TQTA 2Q3OA 3FA4A 1IXNA 2BXYA 3QW4B 3LCGA 5I3JA 2V82A 2ZA3A 3N3TA 2DQXA 3FKRA 1Q65A 1A5AA 3MSYA 2Y61A 1LL7A 4KEZA 3DECA 1WXYA 5KT7A 4NZ1A 4L64A 4DELA 2FTYA 3V16A 3WQWA 4RXFA 4WRHA 1ENUA 1U2YA 2ZYFA 5HBFA 1K02A 4M7TA 1OG6A 3FA3A 5KFEA 2XFRA 1UH4A 2FLLA 2Y1HA 3GFZA 3NWRA 4HPXA 2DVUA 1XUZA 4GFSA 3UZZA 2ASJA 5G5IA 5CZTA 2XH0A 4AZHA 5DLFA 2UVWA 2RDUA 3S2NA 3BQ2A 1CLXA 3IS4A 3BMXA 4QAIA 5JH1A 1J79A 3DFOA 2Z1VA 4P5UA 2A3LA 2CLEA 4QBXA 3RX4A 3BE7A 2BWGA 3MV11 1S1PA 3PR5B 4WDWA 4RE4A 4INFA 3TP4A 3H6OA 3M9YA 4K2SA 1O7AA 4IZGA 3ZIZA 3WDIA 3GC4A 4DL6A 3W02A 1O1ZA 3QVQA 3AMGA 1Q6DA 4AWTA 1CTNA 1XD0A 2D23A 4YHGA 1RK5A 1W5QA 2G8ZA 1HO4A 3EX3A 3RITA 2YZ5A 3KHHA 2PD9A 2VR2A 3VD3A 4J9QA 1G4PA 1IEXA 4IMCA 3F4VA 2QCCA 4A2SA 1OFPA 4G1NA 4GLEA 1QNOA 1X39A 3ZS4A 2E4TA 3S1GA 3L4VA 2A2IA 3I4KA 2J6VA 3RLVA 4X9YA 3OGSA 3VUPA 1E1CB 3BW2A 3K8LA 2FZDA 1HKWA 7TIMA 4CN6A 3C2RA 3OLGA 3OGVA 4NASA 1TQJA 2BQRA 2WPGA 2Y8VA 5CCZA 6XIAA 1FWTA 3OG2A 6REQB 3LXBA 2Q09A 3RK8A 1XSJA 3DESA 4AIEA 3TJXA 4AC7C 4QISA 3TYDA 4F9DA 1POJA 4OV4A 2PUZA 3OTRA 3PR2A 1C90A 4Y9NA 3RDKA 3WQEA 1W2VA 3ITTA 3QV9A 2YCEA 2ZE3A 1VYPX 4GA8A 5AYBA 1X97A 2Y7DA 1W1IE 2GGHA 3OSNA 4UXDA 5EMUA 1GZGA 4DVOA 1PAMA 3NURA 1OF8A 2RJGA 4LAOA 4OECA 4J2MA 1XG3A 1YTDA 1JR1A 3EYPA 2LLEA 2A3CA 2OZ0A 4M51A 3IIOA 4L5ZA 3NQAA 2OSXA 3TLQA 2D0FA 1SZNA 3KS5A 5D30A 1TWZA 3PB0A 1GVQA 1WDWA 1VS1A 4DYKA 4OWGA 2XZ9A 2ZX8A 2DY3A 4DPPA 3MKKA 1JDDA 5LIKX 1NWUA 2HSAA 2XYLA 2Y7EA 4XO7A 3MUXA 3W76A 1HGWA 3GIIA 1TV4A 2BXZA 5FI8A 4QEHA 1NF0A 3S2LA 5JVLA 4IRDA 4FK9A 5JIWA 3MUZ1 2FGBA 3MFHA 3VFLA 5BXTA 1P0DA 1XF0A 3R8RA 3SRDA 2G41A 3G6YA 1UWSA 2VEFA 3HO8A 2ZZ5A 3T4CA 4DZIA 3ZQ9A 1XLAA 2X2GA 4S2BA 4F66A 3AMCA 4O54A 1HL9A 5HANA 1V3JA 4AYSA 3CUZA 5KFGA 3APTA 3BSMA 3BJYA 3MI3A 4O1BA 3WQVA 4F0RA 5KG7A 2ZA1A 5MF5A 2ZUNA 2YLAA 5HUOA 4Q7BA 4I5UA 3LK6A 2OT0A 3GVWA 4S2CA 3GFYA 3OA3A 1X1ZA 1W9XA 3KTSA 1XS2A 3MO4A 2OXNA 3N15A 2FIQA 4GUFA 3NOEA 1AMKA 2WV8A 4D8ZA 4K68A 4F2TA 2PTDA 4H7VA 3CAKA 2XDFA 3P0XA 1G94A 1RCQA 1V8EA 3B4UA 3A12A 3P74A 3WF4A 4R53A 4D8AA 4IPJA 3HU7A 2GWNA 4A8RA 1W8SA 4RNIA 3GIKA 1I1WA 4O8RA 2DZUA 3H70A 4ZO9A 1EJVC 3P80A 5HNUA 3EDFA 3WQPA 4RDYA 4LEFA 4IT1A 1AQFA 5C9ZA 3WD2A 3QYQA 2OU4A 1V5XA 5GVJA 4XK2A 2Z4GA 3LRLA 3IIZA 4O19A 2FLPA 3OPSA 1RA0A 2BVTA 4K8GA 1RJRA 2ZC1A 4US6A 1EA0A 3UW6A 2Y85A 2EAWA 3KOFA 4NJJA 2WMKA 2YA1A 1B3ZA 4JFTA 1E4LA 1VFTA 4GBUA 3GIMA 1Q2RA 1Q6GA 5EMMA 2NQ9A 3EWUA 4NRSA 1XP3A 3W7GA 4PFHA 2JF7A 1DXEA 3RG6A 5KG4A 4C1LA 1RK6A 5AB3A 3PAJA 3SJNA 4H6EA 4OQVA 1REQA 4MY8A 2QXWA 3A3WA 1FX6A 2AQWA 3S6DA 4B91A 1C3FA 2ZKMX 1QDSA 1YNPA 4Q8OA 4WDTA 3A21A 3U9IA 1F6YA 3DUGA 1S0NA 3W2MA 4NAFB 4FS9A 1M7XA 2PP0A 1CI1A 2YLLA 4ECWA 5EBUA 3T7VA 1WZAA 1GJPA 3PPFA 4JTCA 4PRRA 1FP8A 3DXIA 2ISSA 4MJ2A 2VVSA 5L9FA 3RNDA 3GBEA 1XXXA 3OHBA 3IK4A 5HQEA 2C1HA 1OZMA 4P7RA 3GIPA 2ALRA 2PWFA 5LXEA 1I45A 3FIGA 4M7SA 2BQUA 4BI6A 4LB4A 4GC6A 4DPQA 1HVQA 4OUIA 3FX4A 4B3LA 3M64A 3MMDA 2IPFA 1WPCA 3SGZA 4W5UA 2XIQA 4JCMA 5BOEA 3ZZ1A 3WN6A 2Y8UA 3NR0A 1K8ZA 2PGRA 3FYOA 1ECEA 3TJ4A 2GPTA 3MR2A 2EKGA 1EIBA 1OFOA 3B04A 3QZEA 4B4HA 1HW6A 1UWIA 3PTKA 3V0SA 5EL1A 3TXZA 1FWBC 3A13A 4UTWA 3EDKA 3SJ3A 1UWQA 2GDUA 4PUEA 4FBUA 4X61A 2C7FA 1BQCA 1N82A 5D2XA 1IGWA 4FNTA 1JUBA 1R0MA 2OMAA 4L9YA 3KOZA 1V77A 5DY2A 3T08A 5I2UA 1YDVA 2NV2A 5EMKA 5I24A 2CEQA 4F0MA 4CD6A 2W5FA 2AMXA 4FBTA 4YVVA 3BC9A 4DJEC 3II1A 3EEGA 3AHXA 3OQEA 4W87A 1RJQA 1AL7A 4BQ2A 3W88A 3DG6A 4GABA 2XIJA 1XLFA 3W71A 4GD0A 1DHKA 3ELFA 4TVDA 1MI3A 3MKVA 3M0VA 2QMJA 1HJWA 3K4DA 3FYYA 4JYDA 4AMAA 3HMJG 1Z9AA 2C1IA 1FKXA 1H7OA 1XICA 1FWCC 3CAWA 3B9EA 3DN5A 2YOCA 2J74A 3EWYA 3E74A 1QUMA 1ISVA 4CVWA 1P7TB 1XPYA 5BXRA 1GOOA 3AMLA 1FDYA 5A6JA 2GJNA 2V68A 3WZ0E 4Q4KA 2FZ8A 1ME9A 2XH4A 3N11A 2DUXA 1EUNA 1EDGA 1DWGM 2JGQA 3MMTA 2OX1A 4GXPA 3W7IA 1IIGA 3VA8A 1FOBA 4FLSA 4ZB2A 4C60A 3S5OA 3IV8A 1PZ0A 3IGSA 3H7RA 1ZP4A 1OWQA 4PR4A 1I6NA 4WK9A 3E96A 3WDRA 5BXPA 3RN6A 4XD5A 5CG7A 4J40A 1XX1A 1R6WA 3VMNA 2CLKA 4Q8NA 3FJNA 4RDWA 2FDMA 5DBUA 3VDHA 2ADAA 1IWBA 5AHLA 5DG7A 3GR8A 3OVRA 4HT3A 4FX6M 2W91A 4ZA0A 1B57A 4Y2WA 3GD6A 1J6OA 2VEPA 4IP5A 3VKJA 1M1BA 2ISFA 3AIBA 5BRQA 4ZVJA 4NQ1A 1H7PA 2X2YA 5HXMA 4PRWA 2VC9A 5ABFA 2J7DA 3VCRA 5EB8A 1YPXA 3AHZA 1HFBA 2YL9A 1JYVA 1ICSA 1RUSA 1E6NA 2J79A 2WMIB 2EPMX 3H53A 4WGHA 2BBFA 1XBXA 1B3WA 1GPFA 3IJDA 4LRSA 1UWUA 4IMAA 2RDXA 4UFIA 4MYXA 4AUBA 1BFNA 2YA2A 5L1KA 1HJXA 1RLDA 1CDGA 3PW5A 1KFJA 4PC8A 3FXGA 2JFEX 4M6PA 3W37A 2J13A 1FWAC 5EA9A 5FESA 3CL7A 2PA6A 3W22A 2QJIA 1JCLA 4GQGA 5D09A 1SR9A 3MQTA 5K9DA 4D6HA 2E6AA 3ZR5A 1HTIA 3WQ5A 3CK5A 1V6YA 3M7WA 3MUAA 3UXKA 3T5HA 1SJCA 2YL8A 3GHRA 3VOJA 4J3SA 3OODA 2Q3RA 3M5VA 1KM3A 4BZYA 3B05A 1EO7A 1JFXA 1SSGA 4BR1A 1B30A 1FP9A 2Y70A 4S3KA 5CXPA 5KG6A 4EAYA 4NNCA 4LUIA 3W1LA 3GIYA 2DPJA 4U2YA 1OC5A 3RMEA 4IICA 5FACA 3BCDA 1TPC1 4HNTA 5TQLA 4JY8A 3AS2A 1QT1A 1L6GA 1A5MC 1LUCA 1FWFC 2KAUC 4F4XA 2WBGA 3DKLA 3SCUA 1M41A 3GHSA 2VD9A 4QHRA 3GXIA 2CZDA 4U3AA 3S2MA 1DIOA 1PSCA 2W9AA 2EO7A 3MBDA 1B9BA 2IKJA 3ARYA 5AHEA 1AH3A 3KL5A 3S8HA 4IR1A 2ZRUA 4HMDA 1JI2A 1BWKA 3K30A 3KWSA 4IL2A 4F4YA 1C91A 1M03A 1R3QA 1GVFA 1XKJA 3P61A 4K39A 3U4FA 4XAGA 3UWYA 4Q4SA 1PJ9A 4XBJA 1QVBA 1E55A 2C8NA 3A4AA 1JPMA 1GYLA 4JFUA 5D33A 5JBFA 3K13A 4DI9A 1VEOA 3AXMA 3VD5A 2NW0A 1W3TA 1UUMA 2XVKA 4ECTA 3S2CA 4GXMA 4ICMA 4W8LA 1MDRA 4UMBA 3WJZA 3M0IA 3UZYA 3UXDA 3PVFA 3VIHA 3SI9A 5KINA 2VQUA 1SUXA 5I6SA 1WYIA 4QE1A 5KFAA 3I65A 2QCDA 4E2DA 4M8UA 1V0NA 4F2BA 2VFIA 4ORIA 2VX7A 2Z29A 1K70A 4LUSB 4EBDA 3RX2A 1JCJA 2J8TA 3MW7A 1E9YB 4UFJA 1EPXA 1IM4A 4DBWA 1ZAHA 1KBLA 4EBCA 4S3EA 1XBZA 2R1LA 1ADDA 1KTNA 2E28A 2GOKA 3ARRA 2GGIA 4QE4A 3WD3A 3FN9A 4CD8A 1KGWA 2WJEA 5FEWA 2MUCA 2YX0A 3O9NA 1H7WA 3PTMA 3BH4A 4EK7A 2NUXA 2FKPA 2CLMA 5TNVA 4KRZA 5KFBA 3TA6A 4MWAA 1NELA 2XIOA 2WZHA 3O07A 5LHEA 1UR8A 2V63A 1J0IA 5A94A 3D5HA 2NWSA 1X1NA 4Z2GA 1VBJA 4PB3A 1EZ2A 4IXXA 4RKAA 3F1QA 4Q4PA 2MANA 1EF3A 3BCFA 2DEPA 4HYWA 4O4WA 5CC5A 2RDIA 1TJ0A 3RX3A 3DHFA 3ARWA 2Y7GA 3N4EA 5KFHA 2WZMA 2Q01A 1EBGA 4JIHA 2PZ0A 1WBHA 2XUCA 5DFAA 1VC4A 2PU0A 2YXXA 5TAOA 2Z24A 1F3EA 1V0LA 5C54A 3DERA 1G9HA 1XYMA 5HNNA 2EJ1A 2VWSA 4GO9A 4M3PA 3CMJA 1MYRA 4FLRA 3PF3A 3SCNA 4GY1A 4UFHA 4WXYA 1XIIA 3TJLA 3L65A 4PMOA 2E9BA 2ZZ1A 3KLLA 5I06A 2V0TA 3LPOA 4AW7A 1YPIA 3KHDA 4C7GA 2O7SA 4ZO6A 1ZETA 1C92A 1LROA 5E70A 5CPOA 2HQAA 3B0YA 2ZICA 3BXWA 4LAUA 2ICSA 1GW1A 1WO2A 3NNTA 1EP1A 4C65A 3W1MA 3B8UA 1BVZA 4LV9A 1F6PA 4MY1A 4CQCA 3UEQA 3M47A 4JDBA 4QITA 3H2NA 4L7ZA 1S2UA 1BVNP 4QR6A 4O0ZA 2OH2A 3W53A 2VOTA 4PUJA 4DM1A 3GR7A 2IKIA 3PW7A 3TNOA 3FGCB 3NDYA 3GFXA 3OO2A 2C91A 5I0DA 4J9MA 3SUUA 2XWDA 5KFUA 2B7NA 1IZKA 3BQ6A 1XGDA 4PUUA 4GIAA 1QPOA 3RPMA 5C5YA 3H2FA 2E40A 2EPOA 4S3FA 1K9TA 3RAOA 2RHGA 2ZE0A 2AKZA 3WSUA 4D1JA 3EA3A 2DORA 1H63A 2X0SA 1SYTA 1V6TA 2Y2WA 2NXIA 3DI0A 3M07A 3M5XA 1CXKA 4Q45A 3TQKA 3QTPA 2BOGX 2FZBA 3V0UA 1UA7A 3PJUA 5J04A 2GSEA 4C6NA 4PCSA 1ME8A 2BHYA 4JYFA 4P8VA 1CNVA 1QNQA 3V1HA 4AVFA 1I75A 3DFHA 2QDGA 1ZFJA 4K7YA 4Q8QA 1TCDA 1OM0A 4DF2A 3H7UA 3TAOA 2F2HA 4C6FA 4NP7A 1LL6A 3SSJA 3O0KA 1YX1A 1UW9A 2VRJA 3RR4A 2Y5SA 3ZVHA 1GPWA 2XFYA 2BZNA 4GYFA 4O57A 2GJXB 4W7VA 1S2AA 5F4WA 2FPVA 1C29A 1W5MA 5DBTA 3LPPA 1OGGA 4O4VA 3E0IA 1QO2A 1DJNA 4EIVA 3WQGA 1C7TA 4R34A 4ACYA 4B5UA 4ECVA 1WKEA 5GPRA 1QK0A 3GIJA 3JU2A 1EGVA 4CCEA 2NLIA 4XD3A 4FIRA 4RV8A 3DEQA 3PPHA 1KM0A 3RLUA 4PBGA 4AEEA 6XIMA 4X3ZA 4ZSTA 5BU9A 2AGTA 4GI6A 2XVLA 1ZLPA 3W01A 2X7WA 2ZZ2A 3KX6A 4QWBA 4GKTA 4DWSC 3ANVA 2OLHA 3LCWA 1JJKA 1UD8A 3VPLA 1AW1A 1S0OA 2I17A 4WOQA 1NVMA 2WM1A 3MPGA 1J4EA 3PZPA 1R3RA 1JYXA 4NYYA 4JKMA 1DBTA 2FB3A 3VI2A 3OYXA 3U8GA 3BV7A 1K9EA 5JBEA 1W31A 5ABEA 3Q58A 3JS3A 2ISVA 1Z89A 2Z1WA 4UNIA 5FEZA 2PDGA 4GE8A 4UTTA 4MDOA 3GUWA 5CAHA 5T9BG 2NXGA 3LCXA 4LANA 4M29A 1NAL1 2E68A 2ZBTA 2ESCA 3BZJA 1LWHA 4P7LA 2HE8A 1IT8A 1P6CA 4BQ5A 1OCQA 4WIWA 4NL1A 3RAQA 1EP2A 4ES4A 4W7UA 3W25A 1BTCA 2PGFA 1ISZA 2CZFA 2HCVA 1MWOA 1RYSA 1TUXA 2I56A 3DBPA 2I5GA 4RE0A 4H7CA 3LB0A 3WJYA 3ZT5A 2VX4A 3GM8A 3PB2A 3MCOA 1YW1A 1G5AA 1J5TA 1ZJAA 3QMSA 4E3TA 2FGZA 4PCNA 5D8WA 1S5NA 5KFVA 3VMOA 4RJEA 2GGJA 2W0UA 5I7GA 1MW2A 4JIQA 1JFHA 4ZODA 3VMPA 1PWMA 2ZZ7A 4W7WA 4C5YA 3GU9A 1EB3A 2QJJA 4Q3MA 4TTUA 3LZ5A 4QDWA 1LRTA 3LPFA 5DF0A 4F48A 1TPUA 3FJ6A 3WF1A 3LV6A 2GFTA 4DF0A 4FLQA 4DO6A 1EWEA 4YWSA 1TQXA 1KC7A 4Z2JA 1J0YA 2FPYA 4XWUA 1KBIA 3W72A 4K3ZA 3PUOA 3I6TA 1GQNA 3NQ6A 3W7LA 4AZCB 1ZENA 5DT7A 2HZGA 5IBXA 1Z48A 3EOLA 1O66A 2ZTJA 3PNUA 1S2CA 2OTDA 3AIRA 1IR1A 4WLCA 1PEZA 3CH0A 3QEZA 1QNSA 4OOUA 4C6CA 2P0OA 3F4DA 4RPPA 1LORA 2WANA 3E2QA 4NHVA 3IWPA 1A50A 3OVPA 4TX9A 2F6XA 2VUYA 3QH2A 2CNCA 1KM1A 5FIPA 3N04A 3LERA 4GXWA 5T8GA 3QXBA 1T99A 1NWRA 3KRSA 4URIA 4BF9A 3TYZA 2GOUA 1AQHA 1QPNA 1JUKA 2IQDA 1TTPA 4LC6A 1O12A 4HA1A 5DRIA 3N6JA 2GDVA 5JU6A 1PIGA 1YKWA 4IHCA 3AROA 3Q67A 4KIEA 4HYRA 1ZSXA 2WSYA 1ZS2A 4ZGYA 1GGOA 5LA2A 3PZOA 2W9CB 4TTGA 2WNWA 1I9CB 4FI4A 1JDEA 4PTDA 1QJWA 1A5LC 3UPMA 1ZJHA 3UQNA 3G1VA 1TTIA 1JPHA 2X7VA 1NFPA 1KW1A 3KDOA 5HQMA 3KEHA 1U1HA 3CQHA 4IJRA 1WDSA 5DLCA 2CLHA 3SW6A 3LCFA 5JBDA 3GTXA 2PEVA 1JZ6A 1CLKA 2AGPA 4HKPA 1DWHM 1FCQA 4GVIA 1YADA 3GK0A 4IG2A 2Y6ZA 2QAPA 3W23A 1HP4A 1T41A 5IRPA 4D6JA 3RCNA 1HN1A 3MCNA 2F2KA 2VMFA 1JF6A 2FVMA 1A5BA 4R8UB 2I9EA 3L66A 2D2OA 4TR9A 2KX9A 3G5EA 2X09A 1FWEC 3C8FA 3UNDA 3AWNA 5HJLA 1FWGC 4FNQA 3GILA 2FLIA 4LNYA 2EPNA 1LBFA 2HNEA 1WOBA 3V0TA 1E71M 4I8YA 8TIMA 3HQNA 2C3ZA 2ZUVA 2BG5A 1OADA 3E38A 3WD0A 5BCAA 3VIJA 4HNNA 2QYGA 5FJRA 2C22A 3HBLA 2UVRA 3L9CA 5LNVA 3S5NA 1W9BM 4Z0JA 3W84A 5CZSA 4K38A 4MNKA 4Q8EA 4N9EA 4U10A 2PDXA 3F03K 1XLGA 3WEOA 2D73A 3IIXA 2J6TA 3CPUA 2P88A 2DH2A 2JBMA 2WKJA 5FEPA 3U48A 1EGZA 3L4TA 3ITCA 3QOMA 2O7QA 4XBKA 3IJ6A 2NQLA 3W27A 3W2NA 1JRCA 3TTOA 7CGTA 2GGGA 3ZSSA 4GUJA 4UFLA 4L56A 1Q3NA 3C5QA 5REQA 4NAEB 4XIMA 2V2DA 3R25A 3VDAA 1NJJA 2OB3A 3I3DA 4QCFA 5CGTA 4LX4A 1E6XM 4ZR8A 4IM4A 3L12A 3T5JA 1Z8AA 2BP1A 3C86A 1IYXA 1WUFA 4DJFC 2FHFA 1A5OC 3GUGA 4REQB 2JEQA 5LHFA 3NQBA 1NFBA 1Z44A 2NT0A 2R1PA 3WH6A 2RDWA 4C7DA 2ATMA 1H0GA 2VC6A 2EQDA 5FJUA 4IIEA 1JPDX 5F4XA 1GK8A 2ZOXA 2FJUB 3FHAA 8A3HA 4JBRA 4GCXA 5FAGA 3OGRA 4GACA 1EHNA 4ED0A 5KZEA 2XFWA 5T26A 3SM0A 5F2LA 2HRWA 2FHCA 1XRSA 2ALZA 3KCLA 1GVSA 3GXFA 3CQIA 1QR7A 4R7OA 1OYBA 4OT7A 5AYZA 5KZ6A 2FH8A 3SDOA 4AEFA 1UQYA 3QC0A 3BAWA 4KFOA 2O0TA 3SGGA 2OR2A 3WF3A 4S38A 3NEHA 3ARQA 4LQ1A 3W7JA 2PDQA 3PR4A 1CGTA 2PCQA 4XAPA 4O1EA 2A85A 3G1XA 3PUGA 2P53A 4KT2A 1UUOA 4MAZA 2DVTA 4N9BA 1WUEA 4MB1A 1ECQA 3GKFA 4EVZA 2AQ4A 4CNUA 3BLIA 2ZTKA 4RXGA 1J0HA 4GCAA 3F4NA 3GVGA 2PFHA 5EMLA 4IJBA 1R9XA 1IT7A 4HYVA 4DWSB 3GHTA 1R3VA 4CLMA 3NQFA 3HF3A 4BWLA 3G18A 4AB4A 4TXEA 3U3HA 3VIGA 3MJMA 1WOAA 1LL4A 3G1FA 1I2RA 3QHNA 4NY2A 4MF4A 1GEQA 4BK9A 4F0HA 3GQYA 5SWUA 4AXNA 4I9AA 1LLOA 3WMCA 1DHPA 3G6LA 1VD6A 1PIIA 3VAVA 2W61A 5HQLA 3G22A 5ECUA 5D9PA 2R94A 4TV5A 3MV01 4R3UA 3QJAA 1S5MA 2GYIA 3I68A 1QXLA 1GVOA 3SEPA 3C8NA 2PLJA 3T6CA 3ZJ8A 4RZ6A 4AX6A 4XZMX 3NO1A 3WH5A 5TIMA 1CEOA 1FY6A 1YRRA 3MCMA 2ASDA 2CIPA 4ZQOA 1GVRA 2H9AA 4H19A 3TZFA 4PTMA 3A3HA 3D46A 3CYVA 2X1IA 4JTFA 2QHAA 3WH8A 1RPKA 1TWIA 4PTXA 3MO7A 1GG1A 1M01A 1EUAA 2ACQA 5A2CA 1SJBA 3OBKA 3PVXA 2DT1A 2CXGA 2GVEA 3CIVA 1HL2A 3NAVA 5F9LA 1O6IA 3G6VA 1W5OA 4LVDA 1OC6A 3OLDA 3KUMA 5D04C 3LQGA 1OCNA 5KG3A 3DG3A 3SAZA 3GXMA 4E5TA 2PTZA 4MZYA 3L0KA 1L6FA 3AOFA 2XTKA 4Q33A 3OZPA 3R10A 3L2MA 2OX4A 4QS6A 4HPGA 3REQB 1EXBA 1ZRQA 1SW0A 1QU4A 3TXVA 3W73A 8RUCA 2EG6A 3VDBA 1W3KA 3ABSA 1JZ5A 3M0JA 3M0LA 1WB0A 3NVTA 4CNNA 7REQB 2D2JA 3OLEA 4WJXA 1HKMA 1WDRA 3F4WA 3NL3A 1JD9A 3B3DA 1XRVA 5BNKA 4JS3A 3OHMB 3A5FA 4G56A 1ITUA 3R79A 2CHNA 1VIWA 2OWXA 2JEPA 1PTGA 4GVHA 1IGSA 1Y7VA 1JDFA 5C8BB 3WH9A 2BGSA 1G6CA 1KM2A 3INPA 3MHFA 4GJIA 3D6NA 1RP9A 3MYPA 5D38A 4CGTA 4PH6A 3QGVA 4XZIA 5AKQA 4NZ3A 5KEZA 4HNUA 2OEKA 1EL3A 1JCYA 3HV8A 1XLKA 1H09A 4S1FA 4ED2A 4IIHA 1E0XA 1KQZA 4CD4A 2D2HA 4J9OA 3FDGA 4HVXA 4JQ4A 2BASA 1KFBA 1EZWA 1EEPA 2A7RA 3VILA 1CWYA 2JEJA 4MLRA 4GBDA 3VGGA 4Q8MA 1Y0EA 3MSDA 5AC6A 1FWNA 4FHAA 3AIUA 1NOUA 3PW2A 4ZE5A 1ELSA 3W6MA 4Z42C 2HMCA 2EF9A 2XCPA 2WKLA 2VT0A 3NZ1A 3O2LA 4AD2A 3MDUA 3ITGA 3PWAA 2QJGA 3A64A 4CN1A 4IPPA 2FZMA 4DQWA 1IZCA 1VQTA 4L6DA 1MW1A 3SURA 4DAIA 2JEGA 5DY3A 4Q43A 3DI1A 3KRUA 1U5JA 1XDLA 2MNRA 1BG4A 4RW3A 3S2JA 4CQ9A 3P82A 5FEXA 4IP4A 3QYSA 3EKLA 5A8NA 4YWIA 1UH2A 1T96A 5DN1A 2BVYA 1FCVA 2YYUA 3GDLA 3VKAA 5XINA 3I3BA 3HPSA 2PDMA 2VNCA 4IF2A 3ID7A 2IS7A 2DT3A 5GJNA 3V18A 4XIAA 9RUBA 1DJHA 1V3MA 4B16A 4DZ5A 2OG9A 3HG4A 1BRLB 5AYIA 2WQDA 1U30A 3UXIA 1W5NA 3VIFA 3TQVA 5BWFA 3BTNA 4HK6A 5DMLA 1K4GA 2J8GA 1JDCA 2Y62A 1P0KA 1VBGA 3UG3A 3PZIA 1KM4A 2Y4SA 4MKVA 1W1A1 4JFWA 1RYRA 1LG1A 4KESA 1XLIA 3S9YA 4Q8PA 1HKVA 3CPRA 1A5SA 3SFWA 4O3PA 1DQUA 4LF2A 1ZBKA 2FZNA 2P3ZA 1Q13A 2DZXA 4ICNA 2F8QA 2QF8A 3PZTA 2BX7A 4DB7A 3LA4A 2AL2B 4NZFA 5CPMA 3LM3A 1BF6A 2WVUA 4PULA 1WKFA 4ERIA 5C7HA 2BODX 3DU0A 1UBSA 3R7MA 3QPEA 1B3YA 3ZT6A 4J9SA 4YIWA 1Z7AA 3O3RA 4JV0A 3T0DA 5C5JA 4GI9A 2IUZA 4GH3A 2DZPA 3LGDA 4H8HA 3VD4A 1HXJA 4LAKA 1BXNA 5BRPA 1UWRA 1KBJA 1LOLA 3ALFA 4R7WA 2TMDA 4GQ0A 2Z1BA 2V4QA 3QZAA 3ARSA 3GE7A 3FK4A 4FMVA 1MRQA 2C1GA 1QAPA 2QJHA 3G2GA 1V08A 5KT4A 4W8AA 5FSEC 2AU0A 2QPUA 4AC1X 1FCUA 4XVDA 5BYWA 1XYZA 3PP7A 2ZRZA 4PA8A 4Z17A 1H4PA 4J5NA 4QWAA 4S3DA 4ILSA 3FOKA 3MFIA 2QUUA 2DZAA 1UH3A 1E51A 4GNVA 4MB3A 2XGBA 2Z2UA 3VIMA 3BQ0A 2REQA 3UG8A 2SFPA 4GISA 3FXYA 3PHAA 1G0CA 4ACZA 1UP2A 4ECLA 1UB3A 2O9OA 5LIUX 2NQ5A 2DZVA 4NRRA 5LNWA 5KFDA 2IMRA 4IQJA 2E0PA 3W1UA 5CH9A 4ZB0A 3WD1A 1K9FA 2J24A 2QUVA 3IRSA 2FMOA 4ECZA 2Y63A 1XBYA 2ZUUA 4HNLA 4E6MA 3W7CA 3N6QA 2HV5A 4GX8A 5AC5A 4RLIA 3UFYA 4LS0A 3PUDA 3URBA 3G3MA 4Q32A 4KFNA 1HT6A 2XIIA 1K6WA 1TX2A 4GQRA 4XISA 3GU2A 1JVNA 4FF7A 3U6WA 1F07A 4LAMA 1W37A 3ZOAA 5CPNA 5EU9A 1UCWA 4ATDA 4J9JA 1VF8A 2WNNA 2VKZG 2BTMA 1JNDA 3UVAA 3LLFA 3WUEA 1FWIC 4ECQA 3MUY1 4Y9MA 1DJZA 3A22A 1GEHA 4WY0A 4I7VA 1UQZA 4M19A 1F3TA 1IXPA 1MSSA 3SQSA 4HIBA 2IQ0A 2ONEA 4WF7A 2ZXAA 5BROA 2F6UA 3CJPA 4FS1A 4L1GA 3Q65A 1V6XA 1GOMA 2TODA 5HNRA 3AJXA 4N2YA 3MHUA 1ZL1A 2B31A 3VX1A 4OIFA 4TQRA 4E8CA 4QJ4B 5JUMA 1QI2A 3MYOA 2V5KA 4RUCA 3GNPA 4WY0F 1M68A 3EB3A 4FA3A 3V4BA 4JV1A 2JKAA 3FSTA 2VA3A 3NXLA 1ZBWA 2WC3A 4CD5A 3G1HA 1KWGA 3XIMA 3TYEA 3GDTA 1JRBA 2I9UA 3TX9A 1ZGDA 1US2A 2OVLA 4HTYA 2C16A 4KCUA 3UWZA 1P1MA 3C0LA 4JN8A 2Z6JA 3UGVA 4RK8A 5DELA 4JQAA 3S83A 4GQBA 3CHDA 1DV7A 4NG3A 3OOQA 3F5JA 3NZGA 4Z0SA 3GV7B 2YR1A 3VYLA 6CGTA 2YBUA 4DL7A 1QI0A 1L2UA 3ITLA 2WVVA 1O5QA 4WZHA 1HG3A 4RX0A 4DL3A 3M5ZA 3RCMA 5F2IA 1UD6A 4AD0A 1D8WA 1S3TC 2QVNA 3EPOA 1XYLA 2ZA2A 3PZ9A 4HYKA 1KTBA 4JX6A 1EF2A 3I7RA 4H8VA 1EXPA 2D22A 2V5CA 3PFMA 4A35A 4BF7A 1MXDA 2VO5A 4DBUA 2BY0A 3ZFHA 3L23A 2AL1A 3UPWA 3LGGA 3QHMA 3RPDA 3CO4A 1FDZA 4D6CA 1JPIA 4G7EA 5E5CA 4YPJA 4B2DD 1F6KA 5AHNA 2CERA 2PD5A 1A5UA 4DL2A 4CU6A 4DUVA 2I7GA 3G1AA 1W3HA 2QMKA 1XPGA 5J8LA 4ZOCA 3KHRA 2CKSA 2OZTA 3R1ZA 2INFA 1NWSA 4X60A 4RZ5A 3BLDA 2DSZA 5MHBA 2DV0A 1R9YA 1FWDC 1E72M 1E0WA 2PWVA 2QR6A 4NSBA 2TRSA 2HPMA 5F7UA 1VHCA 4U2ZA 4DZHA 1QOQA 5IM51 3UYIA 4Z1YA 1MW0A 5KT3A 2A7NA 2J77A 1WZLA 4HNVA 4W85A 1R87A 4HOZA 2OSYA 4UQEA 4IFKB 1RALA 3N2TA 3C3UA 5DQIA 1TV7A 2YCLB 5I3GA 4CQ8A 2J62A 2BGQA 1W6TA 3TK7A 3AAMA 1ZCOA 3DOPA 5AFDA 3SN0A 4WEVX 1AW2A 1E70M 3OB8A 1KR0A 1YE4A 5DGAA 4HNCA 3H24A 2UY3A 2CXEA 1NU5A 4RV3A 1E6RA 3QFWA 1YBQB 1WP6A 5DT5A 3QKEA 1SPQA 3B40A 4MOZA 4A3HA 3NPVA 4MHBA 4F40A 2OWCA 1PUDA 1LDCA 3PBMA 3TN4A 2YCJA 2D3LA 4DLFA 1O5RA 4XZ9A 3SB0A 4MG4A 1SGJA 2OQLA 1SJDA 1D8CA 1BKHA 4D9PA 4AY7A 5AC4A 1XIHA 1H5VA 2KZHA 1N8FA 3BGJA 2D1ZA 3BW4A 1F4AA 1RBLA 4UQAA 1B54A 1LWIA 4IX0A 2A3EA 3M9OB 5C70A 3S6TA 1P0NA 2J8FA 4FX7A 1QW7A 4OVXA 4NXKA 3VTRA 4M24A 1XIEA 1PZ3A 1S0MA 4HZ6A 4J9RA 3BWWA 3AHVA 1VFMA 3S1VA 3T55A 2VEGA 3RB0A 3VNKA 2VFDA 3NQGA 2GZXA 5A8GA 4KGLA 1F05A 3R0KA 4EAMA 4GNKB 2A1YA 4LBRA 2BY3A 3NL6A 1DOSA 4A22A 3ZR4A 1PHQA 1OK4A 3FA5A 4Q22A 3VUSA 3QSTA 1S46A 4LTSA 3HFTA 3GAKA 1IWAA 2QT3A 5KFWA 2CLIA 1F61A 1T6MA 4IMEA 1Q6OA 2VZOA 1QNPA 4LRTA 4HPJA 2QS8A 3GB6A 2QLYA 5FF7A 3UJRA 4LY8A 3CWNA 3C3NA 3DX5A 1A49A 3ITXA 3BG5A 1TIMA 3UR5A 1M6JA 4J9NA 3ME3A 1GOKA 1V3KA 3BK0A 5J5DA 3FS2A 2EPKX 1EEXA 2FYMA 4O8AA 2ASLA 1ZHAA 3ZMRA 1B0IA 3V3WA 4PB4A 3NO3A 4P7QA 3UG5A 3LTYA 1TPEA 3BAIA 1F76A 3NCOA 5DMMA 3CWHA 4RDVA 3PS7A 1OG0A 3KOXA 5BXSA 2NQZA 1JL8A 1CZ1A 2EXOA 4ZSUA 1XIGA 1VFOA 3UT0A 2I16A 1QHZA 4JTSA 1LG2A 3RBEA 4YTTA 4FXSA 3Q37A 1YEYA 1CXLA 1UR1A 4Z1BA 1JUEA 3TH6A 1F4HA 1UP3A 1LRNA 1TA3B 1VBUA 3EXTA 4WQ6A 4F4RA 5HR6A 2E6DA 3LMZA 7TAAA 2ZUSA 3EWZA 4EKJA 4ZFCA 4ENLA 1IXOA 3OHAA 4UTWC 3VFCA 2PURA 4I7WA 1PYMA 3RLHA 4HZ7A 4LY4A 2WVTA 3XISA 1ZQ5A 3T4WA 4DXVA 4F8XA 4XKMA 2VA2A 2WJFA 3C2EA 1THFD 3VGHA 5EGRA 3M5YA 5D8ZA 2DIJA 1CCWB 1EC8A 1TX0A 1U22A 3KVMA 4K36A 3ZLHA 5CAKA 2OKOA 2QNEA 4Q8WA 4B5VA 3UZWA 4OV9A 3KP0A 3UVIA 4JCLA 4G9PA 4B2DA 4PMVA 2C2RA 3STCA 4QJ3B 3EA2A 1BD0A 1RD5A 5F1VA 5CJMA 3ABOA 1OIMA 3OZMA 4PTVA 5G2WA 2F38A 2X41A 4GC7A 1M04A 3H55A 3L4XA 3LX9A 3MZ2A 1I1XA 1SZEA 4RZ4A 4O3RA 4MUZA 3CZKA 4AFYA 5KZMA 1KRCC 1PE1A 4NF7A 5KFZA 2PS2A 3K1DA 1XSKA 4DL4A 4C1KA 1Q6EA 2Y7FA 1HIZA 3ES7A 1FRBA 3VGEA 1DTUA 1J10A 3DENA 4C6IA 3LRMA 3ZJKA 2QUMA 4IWWA 4ML4A 2ZRYA 4FALA 3GHUA 4HN4A 1I2QA 2NUWA 3WDPP 3HPFA 2WM0A 3EPMA 5CC7A 5A8OA 1TPH1 3JRKA 4D6FA 3KTCA 3K46A 2PTXA 4B5SA 3CZ8A 2VJXA 1DWAM 4DJDD 2IQTA 2V9DA 1AL8A 3HB9A 3TU9A 4MMWA 2XN1A 1XLMA 3K8KA 2D2GA 2PDKA 2YIHA 3GNDA 1TRDA 2X0YA 4O16A 3I6EA 1UZ4A 2V67A 3M0XA 3U5UA 1NFGA 4PN2A 3GW3A 1L9WA 1PXGA 4DBDA 2D0GA 5AVNA 2PBGA 2HBXA 2G4JA 1W3JA 2W8LA 1PX3A 4C6MA 2R82A 3OZYA 4UQDA 4UQCA 5HDRA 1AD1A 1UPPA 1E9ZB 3HN3A 2OO0A 5A1AA 4OU1A 3S6OA 4KRTA 3ABRA 5FJJA 2J25A 1E15A 1B90A 4QWEA 4ED3A 2ZRWA 2C15A 3I3EA 2WHMA 1R3YA 3AI0A 3V75A 3IPWA 2J6XA 3E6EA 1KO0A 3ORWA 3ZO9A 5U4NA 4MSSA 3HOJA 4GOAA 5A69A 1TCMA 3W29A 2OZ3A 5I02A 2DSWA 4AWEA 5FD0A 3M46A 1WDQA 1S3HA 3D0CA 3RM8A 3HM7A 1R85A 3M6YA 3U2ZA 4PMRA 1ONWA 3TCSA 4TV6A 2J88A 2CESA 5K9XA 1BAGA 3WDHA 4AISA 3VNLA 1TWWA 4RE3A 4J2PA 3NQ7A 3W2JA 3O6CA 1BTMA 4KWUA 4ATWA 4MLJA 4LCSA 2RKXA 3B0XA 2NT1A 4PGLA 4GUHA 2DT0A 2RAGA 1E6SM 3M0KA 3CV7A 2WHKA 3TW9A 4GVFA 2ODOA 2VI0A 4Y9PA 2BQ3A 2OODA 2VZTA 3AO0A 2WWDA 1UWTA 1RQHA 1OGBA 3RR1A 1DJIA 3TYCA 3GNRA 4UQBA 1X7FA 1XH0A 1TPDA 4HZ8A 5AY7A 3H4DA 3C2FA 4P61A 1VGAA 3TTYA 2E5DA 2POTA 4U33A 3UESA 2IA6A 3B8TA 4QAWA 1GWJA 5IOBA 2E1DA 1H7NA 3RFAA 1DIKA 3GG7A 1K9DA 2HK1A 2VRKA 1UYQA 4PE8A 1FFRA 3WEMA 5BW6A 2IKGA 4W86A 3O7UA 1X6NA 2OQYA 2WKGA 5DGBA 3ARZA 4NUWA 4H9MA 4G5DA 3RAXA 2DQWA 3AUOA 1QI3A 5H91A 3GGMA 3CLMA 3VU2A 5MKGA 2OJPA 3A5VA 3STEA 2Y5JA 4A8LA 3OJGA 4QJ5B 3UWEA 1ZUAX 1GQIA 5KZDA 3EX1A 1UG6A 1VYRA 3CMGA 2ZX6A 1XYFA 2WLZA 3KHJA 4WHBA 4ZEPA 2FTWA 3PWIA 2BY2A 3G0UA 1S97A 4KW2A 2YYTA 3EX6A 3CUJA 4PODA 3MWCA 3HV9A 4EWND 3AHYA 3DFQA 3UBPC 3LV5A 4JQ2A 5HMDA 2PB1A 1JPKA 3T0TA 4KWOA 4LOCA 4C1NA 3KXQA 4BCEA 3GG0A 4JX5A 3VOHA 3LSCA 2PDUA 2JGYA 1JAEA 3XINA 4Z2IA 4MUPA 1MVYA 3UZ5A 4IRCA 1TE1A 2UV8G 3WLPA 5I09A 3N73A 1L0PA 4MWAC 4DM2A 1GG0A 4J3VA 5HMEA 1E4NA 3LBOA 1FXQA 1VJIA 1W9PA 4MZ1A 4AIOA 4NNAA 3KBSA 3LEPA 4IGHA 4R9OA 2UVUA 2QJNA 4XZWA 5DX7A 1H2JA 2PDWA 3BZGA 3N13A 3GDKA 5KFJA 4B3KA 2WBKA 5CPQA 3URAA 2UVVA 1M7OA 3UJSA 2PPGA 3QQ0A 3LXCA 3RHGA 4QWDA 2E67A 4IP7A 4QEEA 1CB7B 3E2SA 5A6TC 4DXXA 3WQ6A 3BOXA 2HXTA 5CBJA 4OFCA 1KCZA 4DJDA 2ZC8A 4JNYA 3CL6A 4CCDA 1PKNA 3VDGA 4OBTA 5CJ5A 1KGXA 4M80A 5KFLA 1KBKA 1G4TA 3QF0A 5GJMA 4IPIA 3WNLA 4MB4A 3A9BA 1QRQA 4QW9A 3LHZA 4YTSA 1HJUA 4KQNA 4Y8EA 4NU7A 5F4SA 4QRNA 1MMFA 5E9XA 3AS0A 1XIJA 1SJAA 5EWEA 2OO6A 1K8CA 3ZT7A 5DMYA 5KFPA 2VX5A 2XM2A 1BGGA 2JIEA 1J6PA 3RB4A 3PC0A 2XFFA 1MQRA 3DGRA 4E3VA 3SUVA 5D02A 1OCBA 1J18A 3WQ4A 3BG3A 1MFVA 1ONRA 1RSCA 3C4UA 1E6PA 1UA3A 5H2ZA 4YLWA 1DQWA 1RVKA 4O14A 3O6DA 5G4EA 1KV5A 1VFFA 1I2NA 6ENLA 3WNOA 2C0AA 1E73M 1AD4A 1FH9A 1XYAA 2J7CA 1DJXA 1GONA 1S2TA 2P1FA 4KCVA 3ES8A 1QASA 4FNSA 3UZJA 1QATA 3LXAA 4EX4A 3WUFA 4B92A 5C55A 1XLCA 2PSNA 2W9MA 2V6AA 4QM1A 3PZMA 1MEIA 1JCNA 2BHZA 5HPCA 3LHVA 4YU1A 1UUQA 4A6GA 1DXIA 5FF4A 2HE5A 3LD5A 3E9AA 4P8UA 5D9MA 2E25A 2QKFA 4GO8A 1X8CA 4LCQA 3GV8B 3TWAA 1T40A 4ED6A 2CBJA 3WK1A 2EKCA 3QLLA 3G1SA 4A29A 5G2HA 1BWVA 2CWNA 2JKEA 1RZMA 3N1AA 5HWMA 2ZADA 4M1BA 1PB0A 5E9AA 3M0MA 4Q8TA 3W2KA 4HU3A 2JF6A 2P9BA 3GC5A 2XPKA 4IUOA 3MVTA 3TTSA 1LT8A 3PY2A 3MWAA 2BLEA 5I3DA 1RVGA 4AD4A 1SO3A 3H40A 3I7QA 1W91A 3BCJA 4ORMA 1OIFA 3VOCA 1K3UA 1P0EA 4AZ6A 1KBBA 4XX6A 3ANYA 3R89A 1W3NA 2FDSA 4K37A 3AIWA 2H3DA 2NV9A 4WKFA 1KFEA 2H8XA 1KQYA 2VENA 2WVSA 2G5WA 3UXAA 2DPIA 1RY0A 1SZGA 4JEQA 1R7OA 2JQXA 3CTLA 1JCXA 3FW6A 4LVFA 3UY7A 2HBVA 3ARXA 3M4HA 3ZXWA 4G2DA 1ZU8A 3DGBA 2OGJA 2OT1A 1JXKA 3VXGA 5ABFB 4J9KA 3EKZA 4L9ZA 2NV1A 4X0VA 4UTLA 4O3QA 1HQTA 1AJZA 2NWRA 2GUYA 5FSDC 1Q85A 3WLNA 1S5TA 4CUCA 4L1XA 1QK2A 4UTKA 3P81A 4UTTC 2HROA 4ADSA 1K8XA 1IXQA 3THAA 4P8XA 2YXGA 2VHLA 4GY0A 2PDHA 1U5VA 1UROA 1YDYA 2RJHA 4GC3A 1KM5A 1M5WA 5BMWA 2BR0A 2Y5EA 3VE9A 3IUIA 5F9NA 5LSMA 3SCQA 3MI2A 1AK5A 4XUGA 3UP8A 3HIJA 1H7XA 3MI6A 3NEVA 4IMGA 1TZZA 3T05A 1HX0A 1KFKA 5KFMA 2CC0A 4R7JA 3UJEA 4AZ7A 4EACA 3GDRA 5A8PA 3U2CA 1RD6A 4JIPA 1R47A 1MEHA 2VURA 2BS9A 1XC6A 2OGYA 2AKMA 5JXQA 2ZRXA 1D9EA 1RH9A 1LUCB 4MNMA 2HEJA 2HS8A 4UCGA 1V6WA 4D6DA 1SW7A 3IGUA 3NPWA 3C6CA 3LCHA 3G1YA 3HPXA 1FCBA 2WMHA 4WJEA 1V51A 5I5RA 1UJQA 4WSHA 1H11A 4H7ZA 4ECUA 2FLNA 3L2IA 2W8KA 2INZA 1TVLA 3RJXA 3N2MA 4CNSA 1W9UA 3QOKA 1JCTA 5IBXC 2Q8LA 3C0JA 3APYA 4DRSA 2P8BA 3JR2A 1JULA 3ARVA 1EPVA 4Y90A 3EDDA 5DANA 4AF0A 2VGFA 4O53A 2G3NA 1SO6A 1A53A 4JNMA 1JGIA 2O56A 3C52A 4JV2A 1SFLA 2DZWA 4CQBA 2D24A 3GX9A 3WLSA 3ZWSA 2HJPA 7XIMA 2F6KA 3E0FA 4IFRA 2YFOA 3R43A 3L4UA 4GFIA 3WY1A 3Q8PB 2PDPA 3UCCA 2QCDB 3EMCA 5FAJA 4DEZA 5I3KA 4RNMA 3PAOA 1YYAA 1XH2A 1TFVA 1VZWA 3U7BA 2WSPA 4JXCA 1MW3A 4JQ3A 3R13A 1ESWA 3CXOA 4PMXA 4TUFA 3PK7A 2P5NA 3GZ3A 2XSXA 4O0QA 2G97A 1TE6A 1QFEA 3T2PA 2QV5A 4C6DA 1CXHA 3ABQA 3WKZA 4ONVA 3A6OA 2WNQA 3W1QA 2VUNA 3NFUA 4MB5A 4AQLA 4O11A 1XHGA 1FA2A 2WWCA 1RV8A 3NQMA 4ZOEA 4PBFA 4I3GA 4W5ZA 3T5LA 4C90A 3CUFA 1FKWA 1S1RA 1O68A 1D3GA 1EJXC 1BEUA 4PUDA 5D03A 4MWAB 2W3ZA 4PMQA 4QSHA 4XD6A 1ONXA 1DXFA 4L6HA 1GTHA 1BVWA 1H60A 2E6YA 1XRFA 1E43A 3RXZA 1WKYA 4TX8A 3B9NA 2BOFX 4NT0A 4FB7A 5LNRA 1IHIA 1V7YA 2CZ5A 5KT2A 1S5VA 3GU1A 3QZ6A 5HWJA 3H54A 1WX0A 2XGZA 4ZXOA 1S9FA 4XTDA 5A8MA 4NJHA 4QIUA 1PO9A 2G50A 2DZSA 2F7FA 5GNYA 2X05A 3TYUA 2R1NA 1H61A 3H4BA 3SCTA 2EEXA 5G1MA 3W2UA 3WJWA 4OE7A 2Y24A 4QNWA 5L1IA 4JGDA 4G6CA 2X1TA 3H26A 1UR2A 1S2WA 1R5YA 5CJNA 3SECA 4UTFA 3S1WA 2PWDA 3M0ZA 4FAMA 4B4FA 1TV8A 4ERAA 1GT8A 1ME7A 3WLJA 1FVPA 3DHDA 1B1YA 4IRKA 4H8UA 4QX4A 2E6FA 3GTIA 3EEZA 4E4PA 3QPZA 4NNBA 2PWEA 1YMYA 1ZJIA 2WYSA 1EGMA 2OZ8A 4G7FA 3BPWA 3T8LA 5AYXA 4JTRA 4FXFA 3W7OA 4LC8A 3TONA 3C61A 4Y96A 3U7VA 2XGIA 2YBTA 3L21A 3PJWA 1OC7A 4H9UA 1UD4A 3MDWA 4DY1A 4LGXA 3TN3A 1T8QA 4PMJA 1Y5VA 3HA1A 4V28A 3GDBA 2X16A 2VGIA 1NQ6A 2CZVA 4EF9A 3CQKA 3S5YA 1VJZA 3S3GA 3THCA 3E0VA 1OEPA 4XB3A 3CB3A 4L65A 3OG3A 1VRDA 1KB3A 1LQAA 1YTEA 3EDJA 4NYUA 4EEYA 1EC9A 4A3YA 2QEZA 3AS1A 1M7JA 3W1AA 3W7MA 3GR4A 3DFSA 1C8QA 3VKKA 2GK1A 5AYYA 3M0HA 1UZ1A 2V5BA 1CW2A 2HDJA 5CC6A 2FJKA 3W74A 1DE5A 2E77A 1T7LA 4UQ9A 2EBNA 1V02A 4ZQMA 3R0UA 1JZ4A 2PGEA 3MVIA 3ONCA 4G8TA 1XIBA 2L5HA 1KA9F 4ED7A 2CETA 3ZVHB 5FCZA 1W1ZA 2HPIA 3P7YA 4CQAA 4QTGA 4IFOA 4JTEA 3T0BA 4HU0A 5C9UA 4LVGA 1XQKA 3TQ1A 1UKTA 4JIEA 3EBVA 4YYFA 1BF2A 3NSNA 2VXNA 3E2VA 1Q8AA 4MNLA 4DHGA 1SR0A 4XO6A 2OLAA 1VIZA 4BY3A 3QV8A 1BYDA 4FZIA 2UWFA 4M6QA 1QBAA 1OY0A 1G4EA 2J7FA 2I5QA 4H9VA 3VZXA 1M9HA 3TKFA 4GZ7A 5CGQA 4GI8A 3G77A 1AH0A 3Q8QB 1XFCA 2XGQA 3HQOA 5E0CA 1ZNNA 4NZCA 4B5XA 4GG9A 2QUTA 5F2GA 3LHYA 1VCFA 3VOIA 4F79A 1ZPTA 2Z25A 4HSHA 2O4QA 3SN4A 4M1RA 4OTKA 3NQEA 2HISA 3QZ7A 3GYCA 4ZB5A 2VL4A 5CSSA 4BWLC 4GX9A 4D6GA 3OSPA 1JZ7A 4HTBA 4GYKA 2EGZA 2V3FA 1BGAA 1EP3A 1FWRA 1YXYA 4W93A 1XDMA 3TCEA 4BFAA 3WQ8A 3GW0A 1EQPA 2WCAA 5M3WA 2ALDA 2DSVA 1Q6RA 4NI8A 3UWVA 3SUSA 3LUTA 4QG8A 3A23A 1EOKA 1UR3M 3CL8A 2CITA 1OX6A 2C2EA 2Z26A 2W6RA 4AHOA 2VCCA 2FQIA 4DO5A 4LNCA 3ITVA 4OJYA 3EDEA 1OFRA 4MM1A 2C6QA 1JCMP 1C7SA 2W92A 3KBJA 1KLYA 3N14A 1F8MA 1A3XA 1UD2A 4ROPA 4I9TA 3A24A 1GQLA 3EX2A 3BURA 1W1TA 3GXPA 1LM1A 1OQFA 4HOXA 4PB5A 2A6LA 4OBRA 2NSXA 1GQJA 4J9LA 1Y65A 1RA5A 4DUOA 2CLOA 4L4MA 4HCLA 1P5BA 4BQ4A 4PSRA 2X40A 3TW7A 1R8LA 4HU4A 4ATLA 2ZZ6A 1DJGA 3BARA 3UGRA 4UWMA 3N25A 5C2GA 1MO0A 3OVGA 4LYQA 2R1KA 1CLVA 3UZXA 1OZQA 4PBEA 4Z1AA 4B9YA 4B5TA 5KG5A 3MR5A 3H2MA 2OEJA 3QLDA 4MADA 3WLQA 3N9SA 2V2HA 2NX3A 3W6LA 3WF2A 3NZRA 1GKRA 5EYWA 4C6QA 3WK2A 4K7VA 1XDJA 3WIJA 1PZ2A 3KL3A 2BNJA 3WH7A 1H3GA 4ED8A 1S39A 4FOUA 3GYEA 2BVWA 3DBNA 3PW4A 1R38A 2WQPA 3W83A 2HXUA 5C71A 3N9KA 3WFZA 1P4CA 3SY5A 2CPUA 1QI4A 4PMDA 3AMDA 1TPWA 4NZ4A 3NDOA 2NVCA 4HCHA 3TFXA 4QE5A 3K4AA 3ENLA 4GK8A 3GLCA 4L9XA 4M6VA 3H4XA 1N55A 3TOPA 1H1ZA 3B9DA 1ICPA 5HA7A 3NQ2A 1D7KA 1RCXB 4JHZA 5DCDA 1B4EA 3G8EA 3P3BA 1XYCA 1S2VA 5KFOA 4X0NA 2GQ9A 4GKLA 4XQ6A 3TSBA 3AJ7A 3E12A 4WD0A 4IIGA 2V9WA 4V1YA 5K4XA 2PI6A 3BLLA 4EXAA 4ECYA 3TN6A 2W7PA 1J01A 5EPDA 2YW4A 1V0MA 2PMQA 3USBA 3NQDA 2VDHA 3K4WA 2XIMA 3MA8A 2W7OA 1WDPA 2YFNA 1PPIA 2XVGA 1VENA 2PWGA 1DYSA 5FJOA 4CVUA 4PFMA 2FH6A 4YNGA 4BS0A 1KXVA 3W7RA 1X7IA 2F9RA 3IIPA 2WXDM 4EF8A 1GOIA 1HJVA 1MUMA 2TPSA 3M41A 3MT1A 1J9YA 4PMNA 3WLTA 1YXCA 4HHPA 2E9LA 5A5WA 1RP8A 1PCWA 4IG2B 3QTGA 1XG4A 4FLOA 1GVEA 5EBAA 4O15A 1CIUA 2A0NA 3W1TA 4AMCA 4GIEA 1X98A 3NL5A 3GNNA 2UY5A 2R8GA 4YXGA 1OFEA 3M16A 4LS2A 4JY9A 2B0MA 4AY1A 4PUKA 2BMBA 2BXVA 3DFYA 5I77A 3NZQA 1D3CA 4XKYA 3EX4A 5AHFA 5B7ZA 4M82A 3GTHA 3S1XA 3AALA 1O4UA 1TV5A 4FXJA 2QDEA 2PC4A 1YLVA 1A0DA 4AWSA 5DXXA 3KAOA 2A79A 2DUZA 4NJIA 2J47A 2JK2A 2B7OA 1CGXA 1K03A 3QSRA 1UD3A 4UC5A 1LBMA 3WQOA 2OEMA 2GSHA 1H49A 1QW8A 3EMZA 4GVGA 2ABAA 3STGA 2YSWA 3G6XA 4TOQA 3RF9A 3QMRA 2W62A 3KOYA 2V5DA 4JX4A 4CQDA 3BJTA 3OBEA 1EJUC 1GNXA 3VVGA 4DNMA 4NLGA 4AYGA 2PC8A 1LYXA 4EPKA 3KTXA 2PGWA 3TW6A 4S3AA 4XZHA 2VP8A 1NOFA 3MMUA 4ZTYA 1TJPA 2QZRA 1ZAIA 4MJZA 1PKMA 3EWBX 2OQHA 1V02E 1V6VA 1A47A 4GJ1A 3NDZA 2DP3A 2PLMA 4PRTA 1XLDA 4JHOA 5FF0A 3OBAA 3PBVA 5G1YA 2E5CA 2X0HA 3BDKA 5REQB 4UTIA 5KETA 1OX4A 5EFDA 4LUTA 4DYEA 4XSLA 2ASHA 3EA1A 2WHLA 1CGVA 4CCCA 4DO7A 4QROA 3UA4A 5HMSA 3S9ZA 2QIIA 4BA0A 4F50A 3FEMA 1Q8JA 2PRHA 1G01A 1IEQA 3WD4A 4M6UA 1XCFA 4XUYA 4C5ZA 2BGNE 3WJXA 3CV1A 4AHQA 4HA3A 4K1WA 3HGRA 3UCDA 3GQCA 1H0IA 1GOWA 3PBUA 4IQLA 1AJ0A 4QNEA 2X1RA 3P14A 3VGBA 5FOOA 3RRXA 4UOZA 2GDQA 3ERPA 3WNKA 1DL3A 4QP0A 1XIDA 2Z28A 3GG1A 2PDNA 3SY8A 5LA0A 2VWTA 1AQMA 5C2XA 1QPQA 1GKQA 5AZ0A 5DQGA 3SSZA 4YR3A 3W6YA 5BWAA 1Q66A 3ARUA 4QG9A 4E2VA 4KRUA 2PDBA 4G1KA 4PTNA 5T9CE 4IUGA 4H2HA 1E0VA 4RZRA 5FL0A 3IJ8A 3VNDA 5LNUA 1VPXA 4XTIA 1J96A 3NPXA 1NQKA 2QW5A 1FWHC 3CS2A 3G8RA 1I8JA 2W9BA 3ALGA 3UERA 3U5YA 3O8AA 2X1UA 3NYZA 1BYBA 1C8YA 1J12A 3U0HA 1LOSA 3B06A 4RDZA 1E1FA 3STPA 3G3DA 3ITOA 4HHHA 4MGGA 2O4MA 4K8HA 2QULA 3GRIA 2BB0A 4Q8VA 2BVDA 3TQPA 3UU0A 3VGFA 1D7FA 2FTPA 4HB7A 4PCFA 1DJQA 2W63A 2G4FA 4TMBA 5HAOA 3CGTA 1GJWA 2DH3A 3K2GA 4U3CA 4YCPA 1VJSA 1BHGA 4JIIX 3TJIA 1XFBA 1UMLA 1UKQA 1YDOA 2H9AB 3WDQA 8XIMA 2QAFA 1A80A 2HVOA 3DC8A 3GH5A 3MP4A 4V2XA 1Z42A 2PRMA 4ZBCA 1Z32X 4MWAE 4WXZA 3OYZA 4R33A 3MU7A 3QGAC 2DT2A 3QBUA 3W24A 4HA4A 2J7HA 3WNMA 1TKKA 1BSIA 4X63A 5CSYA 1XLEA 4IX2A 3F5LA 2IPGA 2QIWA 1BKSA 1QI5A 1ZCCA 1IF2A 3BAYA 1XCWA 1W0MA 3SIMA 3H2OA 3TZNA 3O6AA 1VPYA 3ARTA 1TJ2A 3MUCA 2UY2A 4Z2HA 4JTDA 1R2TA 1OF6A 4IIFA 4WDUA 3WUGA 4ERGA 3O1NA 4AG0A 3EMQA 3E0WA 2I57A 1N8WA 3Q94A 3N18A 3GXTA 2PRLA 4BF5A 3SUTA 3QC3A 2V30A 2PF0A 4KCWA 4B90A 4Z1CA 2TSYA 3N2XA 3NA8A 3TOYA 4H83A 2QPXA 4PMZA 1ALDA 4Y8FA 1G1YA 5I23A 2WMJA 4JKLA 1HP5A 3GAYA 4C6BA 4MJMA 1P6BA 1BWLA 1MXGA 2E7FA 3CUGA 2QCNA 2DUAA 5I03A 1SU5A 4O50A 3UNTA 4XZLX 3TTEA 1KXHA 5LYRA 1R7AA 3M7SA 1CYGA 4O3SA 5AC8A 1VYSX 2WAGA 3PBWA 4NI3A 3PBGA 1Q4WA 1OYCA 3BOFA 1UHVA 4WSKA 3F2DA 5KG0A 3NYDA 4GC4A 3MZNA 3H22A 4O12A 5CZ0A 4D1IA 1PDYA 2W79A 3PZQA 1V6UA 3TSMA 4EANA 3POHA 3HZ3A 3NO5A 4Z2LA 3P67A 3CH9A 3OIHA 3VIOA 5HK4A 1JI1A 3S0CA 5K2ZA 1VLIA 2NX1A 1PZ1A 3RUBL 3W7NA 4H6KA 4LUJA 4XAYA 3TSDA 3W1RA 3THUA 1HVXA 2XH2A 3R11A 4J28A 1KLZA 1F74A 1O5KA 4GYPA 4WKHA 3PW0A 4C6PA 1DE6A 2XH7A 1TR1A 4OHQA 4JAWA 2G3FA 2WMFA 5G4HC 2BHUA 1MRAA 1NDVA 3H2EA 3RJYA 1FWJC 1WZMA 3W7KA 1B9ZA 4H6QA 1IE7C 4JHMA 3FEQA 2C18A 3WCZA 4YTUA 2XVPA 5I78A 1E1EA 3C0QA 2E1WA 3UWUA 3ITYA 3OZOA 1QCWA 3N4AA 3H23A 3HG3A 1J0JA 3S1UA 3EPIA 3I10A 2VFHA 5HMFA 2CLLA 3GKAA 1MUCA 4H9XA 3C0SA 5DG9A 5H6HA 3SRHA 4GHRA 3FJ4A 4IPNB 4NZ5A 3RM4A 1PCKA 4YR0A 5K7JA 4R88A 4BI7A 2J4GA 1TIWA 1WNOA 2P3EA 5CC3A 1L6WA 3CNYA 3KBWA 3W38A 1FH8A 4GI4A 3CUIA 2TYSA 2GGEA 3NVDA 3FCPA 1EC7A 5C9RA 1N2VA 3UYCA 3W00A 4E4FA 3GWQA 2P0IA 4LT9A 4OZOA 3DZ1A 4IH3A 1AJ2A 1W9VA 5E93A 3V5FA 4DUXA 4L80A 3KZPA 1NEYA 5ABTA 3B9AA 3T8QA 1EJTC 4HMNA 1TRIA 4ECXA 1JXJA 1XR2A 3IRDA 4R27A 3VCCA 4PEEA 2ZXBA 4FR1A 4EPEC 3QW3A 2IKHA 3TDFA 4AIUA 3H21A 3PSVA 5M03A 4EWJA 3SRFA 3CHFA 3DFNA 2RGMA 2VYOA 3HURA 4FSAA 2CLPA 4DNHA 6TIMA 2A3AA 1B3OA 3BVJA 3UD6A 1KFLA 1O5XA 3UA3A 3LBMA 4H4IA 4Q6JA 3J7HA 3R5EA 4F0KA 1K7XA 3CZLA 2UBPC 3WBWA 1JEZA 2REQB 2E5BA 2FVLA 4LVAA 1MEWA 5DRCA 2OYKA 4ZQNA 3WMBA 3AYTA 2HNHA 2PDLA 4ACZB 2VM8A 5LA1A 3Q4DA 3IJ7A 2YB1A 3DAQA 4U31A 4A8NA 4O3OA 1TREA 4O18A 3W28A 3HGSA 2Z7GA 1E1CA 3L67A 1UD5A 3R58A 4C6EA 5CZKA 3F2CA 1G69A 3GNOA 4CEUC 2VC5A 1YPFA 1NH6A 4WDXA 1KRMA 4E8DA 2VZUA 6REQA 5IFPA 3SGUA 3VK5A 4G3IA 1AVAA 4F2UA 4MWAD 4NVTA 1HKKA 2E9MA 3WLHA 3WK0A 5LIWX 2PF8A 1OVDA 2XN0A 4W4QA 4NX0A 2V4RA 4FF5A 4LJ3A 1VKFA 3BL3A 3P6LA 1PX8A 1E9LA 1TPB1 1M53A 3QFEA 4L1WA 4L4LA 2A3HA 4DWDA 3APGA 3AYVA 2PDJA 5L1LA 1PL9A 1DJYA 1ZJBA 1Z69A 1VEMA 3Q2DA 4YJ5A 1BPLB 3NGDA 3TROA 4MPQA 1NDZA 5IHSA 4C6OA 3TN5A 3GG8A 1E6QM 3GDMA 5DQHA 5KFNA 3DCPA 4Z2KA 2FVKA 2XN2A 3TC3A 4WY0B 4CKQA 1EHAA 3RYSA 3QHOA 3CZEA 1H50A 2Z6IA 3NSXA 5FF3A 1SQ7A 3HG2A 4LWWA 3USZA 2XG9A 4LBSA 5D37A 4V1XA 2J7BA 4W9TA 4ICCX 4I6VA 3A4WA 2VEIA 3ABXA 1CGUA 2NVDA 4J9PA 4IISA 1J5SA 3M9NB 3QY6A 5HWNA 3CQJA 1FTXA 1OB0A 4OKDA 2ZQ0A 3FVDA 2QCFA 3MJYA 3OLIA 4KKXA 4W89A 3AZRA 4LPCA 3KZSA 2AQVA 1EDTA 5HJYA 3DH7A 1MQQA 2NVAA 3AFBA 4EYIB 1CB2A 1UPMB 5I3HA 2DJLA 3G24A 6PTDA 1WV2A 3BMVA 1WDDA 2ZZ3A 3SCOA 4LEQA 1AQ0A 2BV9A 3PULA 4QDPA 2IBKA 4JN7A 1UZHA 2Z1XA 3H4WA 3LTSA 1SO4A 2IMWP 2GJPA 3JZUA 2RH9A 4FXRA 1EX1A 2AGOA 2CBIA 1UKOA 5M5DA 4RNHA 4KEMA 1W17A 1EA9C 3WNPA 2WVVB 3WLOA 2ISDA 3P8JA 5A3HA 2A3BA 4JL1A 3B8IA 1K7FA 2A21A 1VBRA 4CEXC 2C19A 1E0UA 2Q71A 4IOTA 3TNBA 2ZDRA 2VFEA 1G7UA 4TIMA 3C2OA 2A5HA 4EPBC 2YKKA 3NQCA 3PZVA 5KG1A 1QNRA 4WCJA 5LIXX 4JPGA 4IMFA 1HNYA 1IQ8A 3IVSA 1K1QA 4G7EB 1DJWA 5EWFA 2Q6ZA 2DVXA 2QJMA 4ZO7A 1KCXA 2DZBA 5DEZA 3B0UX 1W32A 3QMTA 2W4XA 4N7QA 1Q4NX 1EJRC 3RLGA 1V79A 3CV6A 3NPUA 4GIRA 4LUYA 1MDLA 2C2DA 1A0EA 3UPBA 3W1NA 1OK6A 2PP1A 5D2YA 3B0VC 4M81A 3M1ZA 4O3NA 1GKPA 4FS2A 1Z3NA 2H90A 2E8YA 3IV3A 2ZUMA 3DHPA 2WNZA 3AISA 5KFFA 3QR1A 3R4IA 4O1AA 3HGJA 3H7VA 1U1JA 1K4HA 4PL2A 4PYSA 4YTRA 1N7KA 2DU2A 2QCEA 1XIMA 4LSBA 1S5WA 2GQAA 3LSBA 3ZLGA 2PDFA 3EPNA 4XZNX 3R8HA 1OYAA 1W3LA 1RJPA 4NAFA 4ZL1A 4BJHA 1YNQA 3DYOA 1U1UA 1X6UA 4EYHB 4HJFA 1VAHA 2DDXA 3COTA 1QPRA 4A4AA 3IJ9A 4JIRA 1P48A 1LQ0A 1LLWA 1PBGA 1UOKA 5DCBA 1MNZA 1K77A 4U6PA 3MKCA 1U5HA 3OQ8A 2D69A 3SADA 1M3UA 2WOQA 4FO4A 4U4MA 3AQUA 3HPAA 2Q8XA 2O55A 2PTWA 1RBAA 1KR1A 3UF9A 1V3LA 1GYNA 1E5JA 2ZXQA 2GUUA 4QSFA 1F3WA 1RQEA 3LI1A 4PCPA 1FXPA 1KKRA 1TMQA 4IR9A 3T0AA 3O05A 3CASA 2PTYA 3T0CA 5EMYA